2AZSA

Nmr structure of the n-terminal sh3 domain of drk (calculated without noe restraints)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords SH2-SH3 adapter protein drk
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azsA00
3TVTA 4A63B 2RQTA 2DRKA 3SEMA 1X2QA 1UJ0A 3CQTA 2DX1A 1UHCA 3M0QA 2E5KA 2D8HA 2SRCA 2YSQA 3VS1A 4LE9A 2SEMA 3I35A 4Z88A 2O9VA 4RTVA 4OMOA 3RNJA 1JQQA 5L23A 1MV3A 2JW4A 2EW3A 1QCFA 1UG1A 2O88A 2MCNA 1RLPC 1KIKA 3EHRA 2DNUA 2W0ZA 1GCQC 1OPLA 1AOJA 2LCSA 1VA7A 1RI9A 5IHNA 1VYUA 1K9AA 2RQWA 3FJ5A 4JJDA 2K6DA 3JV3A 1YN8A 2CSIA 3A98A 3I5SA 3VS0A 2MIOA 3UATA 4K11A 1I07A 2D1XA 3KFVA 3RBBB 2J05A 3UF4A 1X43A 2ROLA 1FYNA 2VVKA 1AWWA 3M0SA 4JJCA 1ZLMA 2CSQA 4IIMA 1M8MA 2RQVA 3EG3A 2GGRA 2FRYA 1FMKA 3C0CA 1T3SA 2DBMA 4RTYA 1UUEA 2BZ8A 2AK5A 4J9EA 1X6BA 3REAB 1UDLA 2YUNA 1HSQA 4X1VA 5GJWB 2B86A 5I22A 1SSHA 1PNJA 2J06A 2YDLA 2EQIA 3PVLA 2I0NA 1GFDA 2A36A 2OI3A 1NM7A 2KRNA 1JO8A 4OMPA 2P4RA 1U3OA 4DEYA 1CKAA 1GBRA 1NEBA 2J7IA 1PKTA 4F16A 1IO6A 4FSSA 4GLMA 2EPDA 2JS2A 1AVZC 2C0IA 2FG0A 5I11A 3EG2A 3R6NA 1MV0B 1RUWA 3H0HA 1ZUUA 1M27C 1G2BA 1NYGA 2JM9A 1YCSB 2DL5A 4CC2A 2DL4A 2YUPA 4J9IA 3I9QA 1AZGB 2C0OA 1BB9A 2CH4A 4Z8AA 2RNAA 4HCKA 2DBKA 5IHKA 1NG2A 1WYXA 2RQUA 1LCKA 2EGCA 2V1QA 5FWBA 1EFNA 2DYBA 1QKXA 2GTJA 1KFZA 2EBPA 1CKBA 5IXFA 4J9HA 4D8DA 1E6HA 2KNBB 1X6GA 2KYMA 2ED1A 3REBB 1SPKA 3NGPA 4ORZA 1I1JA 1QWFA 2A37A 1WLPB 4JPBW 3NMZC 3ZL7C 1W6XA 2K3BA 1S1NA 2A08A 4J9CA 1GFCA 1PKSA 2YT6A 2JMAA 3H41A 3M0PA 3VS7A 2KRMA 2BZXA 1Y0MA 2ROTA 4LUEA 2JTEA 2KR3A 2RF0A 1Z9QA 4ESRA 2CUDA 1W70A 1X69A 2LJ1A 4CC7A 2GNCA 3SHWA 2L3SA 4AFQC 2OJ2A 2LQNA 2OAWA 2DM1A 1ZX6A 1E6GA 5FWCA 2XMFA 4J9GA 2EGAA 1HD3A 2K7AA 2FPDA 2DL8A 3NHNA 1AZEA 4HVUA 2LZ6B 4AG2C 2DILA 2BTTA 4LNPA 4AG1C 2GTOA 2K9GA 2X3XD 2VWFA 4Z89A 3UA7A 3U23A 2KXDA 2LQWA 2DF6A 1I0CA 1WXBA 1H92A 4OMMA 2DJQA 3EHQA 3TSWA 1AEYA 1ZSGA 1K0SA 1N5ZA 1VYTA 3H0IA 4OMQA 2F2WA 1U5SA 2J6KA 2IIMA 4HVWA 1GCPA 1PHTA 2CH4W 2EVRA 1H8KA 2DL7A 2O9SA 5HCKA 1A0NB 4ZNXA 2H8HA 1WXUA 2EGEA 2L3PA 2YUQA 3VS2A 3NPFA 4WCIA 1MUZA 4OMNA 1M30A 2KYBA 1WIEA 1BK2A 1X27A 1TG0A 2C0TA 2K79A 1M3BA 4J9BA 1G83A 2EYWA 2D0NA 1WDXA 3VS4A 3ULRB 2DE0X 1ZUYA 1YNZA 2F2XA 2G6FX 2KXCA 4F17A 1J3TA 4D8KA 1ABOA 1UE9A 1OV3A 1HJDA 2PZ1A 1PRMC 1QKWA 4J9FA 3THKA 2VKNA 1UJYA 2X3WD 5IH2A 2ENMA 4F14A 1OEBA 2KE9A 4M4ZA 4R0KA 4RTZA 1WA7A 1JEGA 4E6RA 3IQLA 2KROA 2W10A 2ED0A 4OMLA 1K0XA 1BU1A 2RPNA 1Z9ZA 2DLPA 1WFWA 1NLOC 1E7OA 3EG1A 1K1ZA 1UECA 4CC4B 3TSZA 1NLPC 1SRLA 1OPKA 2KT8A 1GCQA 2EYYA 4AFSC 3QWYA 1SRMA 2LNHB 3QWXX 2KGTA 2K2MA 4LUDA 3EG0A 3I5RA 1UGVA 1T0HA 3PE0A 2HDAA 1ZBJA 1XOVA 2JMCA 2KBTA 1KSWA 3PVQA 2JS0A 1K76A 2FRWA 1AWXA 2DMOA 2GQIA 2V1RA 1W1FA 2EYXA 1KJWA 1T3LA 2O31A 1CSKA 1UHFA 2LJ3A 2NWMA 1H3HA 1SHFA 4EIKA 2QDLA 2FO0A 1X2KA 1NEGA 1QWEA 1AD5A 3VRYA 2EKHA 1V1CA 2CDTA 3VS3A 3VS6A 1GBQA 1B3QA 2ECZA 2PNIA 2DL3A 2HSPA 4J9DA 2CREA 2FPEA 2BZYA 2ESWA 4CC3A 2A28A 2EYZA 2JT4A 2LX7A 5FW9A 1OOTA 2RMOA 2DRMA 2MOXA 1GRIA 1T0JA 4IIOA 2JM8A 2ABLA 2L0AA 1ZUKA 2FPFA 2LP5A 2D8JA 1AWOA 2KT1A 4JZ4A 1VYVA 2RQRA 2KRSA 2CT3A 3O5ZA 3M0TA 2LJ0A 1YP5A 1YWPA 5EC7A 1M3AA 4RTTA 2HCKA 2AZVA 2RN8A 2HEQA 1JXOA 3GBQA 4LN2A 1U06A 2J6OA 2FEIA 2DA9A 4DEXA 2HBWA 3VS5A 1Y57A 1WX6A 3M0UA 2NUZA 1PRLC 1GL5A 3M0RA 1AWJA 4KRTA 2M51A 5ECAA 4RTUA 2LMJA 1UFFA 1WXTA 1NYFA 2J6FA 1TUCA 5GJVB 1PWTA 2AKKA 4Y92A 3H0FA 4GBQA 1B07A 2AZSA 5IXBA 1YWOA 3LH5A 1SHGA 4AFZC 3UA6A 4AFUC 1WI7A 1M3CA 2F2VA 1BBZA 1RLQC 5IHIA 4RUGA 3VRZA 4JJBA 2DVJA 2CT4A 1UTIA 2GBQA 1TUDA 4RTWA 1JXMA 4QT7A 2L3QA 2JXBA 2O2OA 2M0YA 3EGUA 1ABQA 4JZ3A 2PTKA 2CUBA 1ARKA 2YUOA 1SEMA 4HVVA 4RTXA 1QLYA 2KEAA 1JU5C 2L2PA 1K4US 2AKLA 4HXJA
chains in the Genus database with same CATH superfamily
3CC2T 2A0FB 3SD4A 4A63B 2KDSA 1UJ0A 5GAOp 3M59A 3C4SA 2YSQA 4ME7A 3VS1A 3CMAT 2P84A 4Z88A 2EQJA 1VQKA 5GAOm 1RI0A 3GPLA 5L23A 4C92A 2ZZDA 2O88A 1Q7YC 2VXEA 1YITQ 2MCNA 2RHYA 1S72T 1G3TA 3CMET 1RI9A 2IG0A 5IHNA 4ZN3A 2RQWA 3FJ5A 4YTLA 3CCLQ 1Q81U 3ZEHA 2CZ6B 3HL8A 2CP0A 5LJ3d 2QXFA 4KH0B 1YJNQ 1PSEA 3H8ZA 4C92B 2ROLA 3OS0A 1K73C 4PJOE 3BFMA 1F1BB 1ZLMA 2CSQA 1M8MA 1C6VX 3PIOA 1Q7YR 2FRYA 1D0YA 1FMKA 2K4YA 1YJ9A 4OB1B 3CMAQ 3AT1B 1UB4A 3HRUA 4LDUA 4A4KA 2YUNA 1HSQA 3JSCA 3JCMh 5I22A 2X4XA 3JCMQ 1SSHA 2J06A 2YDLA 2EQIA 3CCVQ 1W4SA 2RD1A 3OYEA 1GFDA 2MK5A 3V7RA 1I4K1 1NM7A 1JO8A 4OMPA 3LYIA 2PUKB 1VQPQ 1U3OA 3CMEQ 2OTJT 2J7IA 3SDZA 5LJ5h 1PKTA 1U1TA 4N4IA 2CP6A 5DY9A 4F16A 1KD1C 4GLMA 4FSSA 2G3RA 2JS2A 1RABB 3EG2A 3R6NA 1MV0B 3H0HA 4HA8A 3GNGA 3JCMP 3EGXB 4JLIA 2EAYA 1YCSB 4E7LA 5KYUB 2DL4A 2YUPA 3JCMe 3OA6A 1FMWA 1VQ8Q 4HKEA 2C0OA 2CH4A 1H3ZA 2OTLA 2RNAA 5GAN2 2DBKA 3TQ7P 5FRNA 4J8OA 4PJJA 3RKYA 5FWBA 3QPHA 1NE8A 2NYSA 1QKXA 2E6ZA 2K5IA 3MEWA 2CZ0B 2KNBB 3RKWA 3REBB 1D3BB 1YITA 3NGPA 4A4FA 3G1JA 2A37A 3G6EQ 1FX7A 5KYWA 3ZL7C 1S1NA 1M1FA 5CQXA 3X25B 2YLCA 4F04B 3ZBDA 5HK0A 4B9XA 2QTVA 1Y0MA 2JNGA 2JJ9A 4JS5A 2JTMA 2H3EB 2LT4A 4ESRA 4XQ3A 4BB7A 3CCQA 5GANg 4E7KA 1X69A 4EDUA 3L2UA 2LJ1A 3M58A 4CC7A 2RK2A 4AFQC 2LQNA 2M1HA 4N4GA 5FWCA 1XTDA 2HQEA 4BE0A 3HRTA 4E7JA 2LZ6B 4KUDK 4WF2A 1Q82R 2F5TX 1VOMA 3M9QA 2GTOA 3CCQT 5FU6C 1VQ9A 1PM3A 2BKDN 4MMKA 4EMKB 1M1KC 2LQWA 2DF6A 1I0CA 1H92A 2KY9A 2DJQA 3E9FA 1K0SA 1N5ZA 3H0IA 1O9SA 5FRMA 1TS9A 4PKCC 1ZQ1A 3MEVA 1GCPA 2AHJB 2EVRA 2O9SA 3V8JA 4WTOB 2EGEA 2L3PA 2CGHA 1TU0B 3QYHB 1BI2A 5D7UA 4HT9A 4X9CA 1PD1A 2RJFA 2K79A 5GAMj 4M7DE 1G83A 1QVGA 2Y4YA 1YFNA 2D0NA 1G3SA 1WDXA 4ELYC 3ULRB 2DE0X 3FC3A 2LT1A 4BDZA 1YNZA 4QVCA 4M75E 1VQ6T 4BE2A 2QQRA 3QJYA 3ASKA 3LWIA 1J3TA 4N4HA 2E64A 4D8KA 3CC2A 4Z02A 2O4XB 1I8FA 3LGLA 2OTJA 3CCSA 2PZ1A 3QDFA 3P8DA 3THKA 2LRQA 1AHJB 3JCMc 4L5GA 1KHCA 1YJ9Q 2ENMA 2FZCB 3RDVA 1WHLA 3VYHB 3MEAA 5CIUA 1TXQA 3OMGA 4A4EA 1ZBXA 4E6RA 4JS4A 2MAMA 4LDYA 4ANJA 1AT1B 4JUVA 4OP0A 3CPWA 2RPNA 2DLPA 2RJDA 2H3JA 1UECA 4PFOA 5HK3A 3A8HB 3OYHA 2KT8A 4E7HA 2EYYA 1M2VA 1SRMA 2A7YA 3E9GA 3QWXX 3EG0A 1PSFA 3MHXA 1YJNT 2HDAA 3DB4A 2JMCA 1KSWA 3PVQA 1QVPA 1PG5B 4ZN1A 4QQDA 2XIDA 2EYXA 1T3LA 4XU0A 1IZ6A 2O31A 3H9NA 5GMKe 3VUBA 1H3HA 2Z0WA 2CP2A 4EIKA 3OW2P 2ZGWA 2QDLA 1U1SA 4OVAA 3V7SA 3HHTB 3OYAA 1D09B 1VQOQ 2GF7A 3VS6A 2BE9B 4PJOG 2CREA 2ESWA 4CC3A 3ER0A 2LX7A 1OOTA 5LL6S 3QZ9B 3S3MA 1IGQA 1ZSZC 4J7FA 1VQ7Q 1LJOA 1T0JA 3ME9A 2JM8A 1VQOT 2PVDB 4PJOB 2YWWA 1HXDA 1ZUKA 2FPFA 3CC2Q 4EMKA 2A3LA 3JCMg 2RQRA 4M7AD 3M0TA 4M77D 2LJ0A 4EPCA 1YP5A 4M7DF 3P8HA 1OU8A 2RJCA 4M75G 2J6OA 3S3NA 2GQVA 5GAOl 4DQ2A 4DEXA 5LJ5g 1WX6A 3A8OB 4KGVB 2M51A 2ZPFB 1BCOA 1BIBA 2DPPB 1RAIB 4F7UG 5LJ3h 3QKJA 4C5GA 4TVRA 3MP8A 3E2UA 1TUCA 5GJVB 5DM7R 1PWTA 5FU7C 4Y92A 3CMEA 3H0FA 4F7UB 2EJGA 1B07A 5CKBA 3OS5A 2V8IA 4AFZC 1Q82U 4AFUC 4C5EA 1WHHA 1M2OA 1RLQC 4C92D 2X4YA 4XTXA 4QKUA 3ZFJA 3OYBA 2CT4A 2DIQA 3KUFA 1UTIA 1EZZB 4PJLA 1G3WA 2F1LA 4J6WA 2O2OA 3X26B 1LOJA 1YBYA 3LLRA 5CAIA 2PTKA 1OI1A 1BI0A 2CUBA 4M78F 4DOVA 2YUOA 3N5BB 4LXCA 4C0GA 4RTXA 2P0PA 3R6OA 2F5KA 2L2PA 1N8RC 1O75A 4N0AC 3SEMA 3CQTA 2DYIA 3M0QA 4M77F 4M75A 1KHIA 3WVEB 2R57A 2SEMA 3I35A 1KQSP 2O9VA 3M56A 4OMOA 2R5AA 3GIBA 4C92F 1JQQA 3MO8A 2RI5A 1X75C 1QCFA 2RHIA 4B9WA 2QQBA 1UG1A 1WNLA 4XU2A 4E7SA 1RLPC 1ZA2B 2KK4A 1MNDA 4M75F 1AOJA 4LD9K 3TEEA 3GLXA 4KBMB 3PNWC 3QXEB 1K9AA 2KMTA 2K6DA 5CKDA 3JV3A 1IHVA 2CYZB 3A98A 3I5SA 4PJNA 4XTZA 3VS0A 1UGQB 4K11A 1I07A 4F7UF 2DJZA 2D1XA 3KFVA 3M4GA 2LX9A 2J05A 2RK1A 1X43A 1N8RU 1FYNA 2RHZA 2QEXA 1M90R 4JJCA 2NLUA 4KULA 2RQVA 2F69A 2YLBA 1KQSA 2GGRA 4UC4A 2XKOC 3PFSA 3C95A 2DBMA 4BUGA 4RTYA 2ZAEA 2AK5A 1X6BA 3REAB 4MZPA 3J7AF 5C6SA 3OSSC 1OZ3A 3I55T 2I0NA 4C5IA 2IVWA 3CCET 2P4RA 4ZTFA 1MMAA 2XK0A 2WACA 3FRNA 4DEYA 3OW2S 2VASA 1NEBA 1R0BG 4IUTA 1OZ2A 1VQPA 2VB6A 2EQMA 1AVZC 2C0IA 3A8GB 1BCMA 5GAMg 2FG0A 1RUWA 1M27C 3EG9A 2HL5C 3SWNC 4RG2A 1JRIA 2EIFA 3CXCA 2IPOB 4J83A 2PUOB 3L42A 1AZGB 1BB9A 3MP6A 1Y71A 4FIBA 3MEUA 1NG2A 1WYXA 2RQUA 4VUBA 3NTIA 3SWNB 2OTLQ 2D9TA 1KFZA 4D8DA 3CCST 2DXUA 2ED1A 5GANd 3CCLT 1I1JA 1QWFA 4V2SA 3RUXA 1WLPB 4JPBW 3PGGA 2K3BA 4J9CA 1PKSA 2YT6A 2JMAA 2D6FA 1RAHB 3H41A 5GANe 3M0PA 2QG9B 3VS7A 3JCMV 2BE7D 2K3YA 1BI3A 5CQYA 4FT4A 1WQWA 4LUEA 4FYXB 1Z9QA 2CUDA 1ACMB 2EJFA 2QEXQ 1VQ9Q 3INZA 2GNCA 3LX7A 3X24B 2DM1A 3L1AA 4J9GA 3BDUA 3L2VA 2K7AA 2FPDA 5GAMf 2DL8A 3NHNA 3JCMW 1WJSA 2CP3A 2BTTA 1KQ1A 1WHJA 5FLXE 2E5QA 2X3XD 1Q86R 4KT0E 3U23A 4CRIA 6AT1B 3SFMA 3CCMQ 1M4ZA 3HP9A 2DTIA 1AEYA 4OMFB 4Y28E 3S6WA 4OMQA 4EMKC 1U5SA 1VIFA 3LGFA 2DAQA 5HCKA 2GFUA 3G71T 4ZNXA 4WCIA 1RACB 4OMNA 4ZGDB 5A0LA 1Y7XA 1KQ2A 2JVVA 4XTUA 3CCMT 4IUUA 1IREB 2E10A 1M30A 3KXTA 1TG0A 2JUFA 2HQHA 3Q1JA 2EYWA 3CCJA 5A0GA 1ZUYA 2VXFA 4IURA 2L89A 1NBEB 4A53A 4J6YA 3VJPA 4JRPA 1G5VA 1W2BS 2YHTA 4LDXA 2BUDA 1OV3A 1HJDA 2PVGB 2YRCA 3URGA 2YRVA 1B34B 1UGSB 2DTOA 3CCEQ 3JCMb 2VGMA 4J9FA 4PJMA 2VKNA 2FL7A 1UJYA 3NTKA 3OSVA 4M4ZA 2JOYA 4RTZA 1Q86U 1IXDA 1M8VA 1WA7A 2OAUA 3IQLA 4QQ6A 2KROA 2W10A 5LJ5f 2RH2A 4OMLA 2XDBA 2DETA 1WFWA 4M78E 1E7OA 4EMHA 1KC8U 5EG2A 3CEYA 5D6XA 3TU4K 4XAXB 4C8QF 4CC4B 3OYIA 3TSZA 2K5FA 1SRLA 4M7AF 4M75C 2ZPBB 3E1SA 4M7DD 1QVFA 1GCQA 1UGRB 4LUDA 2HNIA 2LNHB 2FYKA 2KGTA 3QWYA 3OYCA 3I5RA 2GCXA 3PE0A 3OYDA 1SG5A 4C92C 2FRWA 3UWNA 4BY6C 2QTXA 1KJWA 3QHSA 3EGDB 3I56Q 3UPUA 5GMKm 1N27A 1EIFA 1CSKA 3L2QA 2M02A 2NWMA 4BI3A 3CC7Q 1SHFA 1Q86C 4F7UE 5L8RE 1X2KA 1NEGA 1YI2A 1ZHIA 3FEOA 1AD5A 3VRYA 3OYYA 1V1CA 1WHKA 2CZ7B 3WVDB 1GBQA 3QYGB 2ECZA 2PNIA 5GAOn 4XU3A 3CCJQ 4J9DA 1BI1A 2BZYA 2JT4A 5FW9A 2EQKA 1K73R 3NFCA 1LNXA 1IRXA 2L0AA 3CCRQ 1GXIE 2NUPB 1RADB 5GAN8 4DOWA 2LP5A 2KT1A 4JZ4A 1VYVA 2L3RA 2KRSA 1FXXA 3MP1A 4A4HA 1YWPA 4RKUE 1N9RA 1M3AA 1MNEA 2LDMA 3SWNA 2HEQA 1TH7A 3FIFA 4IKFA 3GBQA 1M90U 1NJIC 3OYFA 2FEIA 3A5ZB 3HTRA 3VS5A 4B6MA 5CVIA 3JB9J 4FYWB 1GL5A 1AWJA 1D3BA 4KRTA 3PIPA 5ECAA 4MMLA 5HY6A 1UFFA 1YI2T 5C0MA 4JRQA 1VQMT 1JB0E 3CCQQ 4MZTA 2JTFA 2ZPHB 2LCLA 4GBQA 3LW5E 4NOYA 1YWOA 3LH5A 4J6XA 3OYGA 1FMVA 1WI7A 1I5LA 1M3CA 3BW1A 2XDPA 4X9DA 2F2VA 1BBZA 1RL2A 4J5YA 4M77B 4JJBA 2MMPA 5M9OA 2QK0A 3NTHA 2ATCB 5D6WA 4II1A 4M7AE 2HL3A 1VQ4Q 4QT7A 2JXBA 2MF2A 2M0YA 3EGUA 1VQNA 1VQLQ 2D0QB 1ABQA 1K9MC 3EFRA 3CCSQ 1ARKA 1OX8A 1JBMA 1QVGP 1SEMA 4XU1A 1V76A 1VQ4T 2KEAA 1K4US 3QZ5B 1H641 3JB9I 3TVTA 1YHQA 1R0CB 1KG1A 2DX1A 1UHCA 2VUBA 2DERA 2E5KA 2D8HA 1WZOA 3UDCA 4LE9A 3CCJT 3RNJA 1IGUA 2JW4A 4LDVA 2KSSA 2E4HA 1MHNA 1VQMQ 1KIKA 3EHRA 2W0ZA 3M54A 3CCVA 4GLKA 4IUQA 3EH1A 3LH0A 1VYUA 1QW1A 2HQXA 3A1PA 5KYXB 4JJDA 2FZKB 1YN8A 2CSIA 4FL6A 2MIOA 1XQHA 3UATA 1SF9A 4ATOA 5LJ3f 2XHCA 3UF4A 3M5AA 3HFOA 1NPRA 2VVKA 1OULA 3M0SA 1AWWA 2HKNA 3G6ET 4JLGA 3C0CA 3EGXA 2BZ8A 3OYKA 3BDLA 2NUPA 4PLLA 1M90C 2B86A 3FLGA 4A4GA 2CKKA 1PNJA 2JN0A 2MYSA 3PVLA 1QCNA 2K3XA 2DEUA 1NJIU 1YJNA 2A36A 2KRNA 1VQ8T 4R56A 3DKMA 2RJEA 1PC0A 1G3YA 1CKAA 1N9SA 5I21A 2RHXA 4E47A 1GBRA 4PJOC 4PJOF 9ATCB 4E7IA 3CC7T 5CKEA 2EPDA 4P5NA 2HKQB 1W2BP 5GMKj 1ZUUA 2BIVA 3OB9A 3EG9B 2DXBA 3MJXA 1VQPT 1B7TA 1VQ7T 2EKOA 5IHKA 4XTVA 1LCKA 5D6YA 2QGFB 2V1QA 2MI6A 3CCEA 1C0MA 1OU9A 2QDYB 3EAEA 1N6AA 2EBPA 4PJOA 1CKBA 2QQSA 4J9HA 1K8AU 1E6HA 1SPKA 3VYGA 3HKSA 1VQ7A 3UT1A 3OQ5A 1W6XA 1M5Q1 3CCLA 2A08A 1GFCA 4M77E 4C92G 5CR2A 5KCOA 2BZXA 1TTHB 2RHUA 1K73U 1SKUB 2E65A 2KVQG 1ZSZB 1M1KR 4ELZC 1RAGB 4C8QA 2L3SA 5CO7A 2RA2A 2DO3A 2OAWA 3F70A 1E6GA 4E2FB 2EGAA 4BACA 1Y96B 2QYZA 3GP8A 1FWZA 3MCAB 4HVUA 4FCYA 3P8BB 3QJ6A 2LVMA 2DILA 1Q82C 2K5LA 3C12A 1KQSS 2MWOA 2K9GA 2C06A 5LJ3j 2V26A 2VYTA 2VWFA 3UA7A 4FU6A 5CCAA 3VKIA 3JRZA 3RIRA 3S3OA 4J7IA 2FHDA 3CPWP 2KI7A 1WXBA 3QSUA 1N8RR 2VV5A 2ZPGB 3TSWA 5GAMd 1ZSGA 5FU6B 2KAFA 4HCCA 4M7DG 3CCMA 3WXMB 3G71Q 2F2WA 1P92A 5GMKl 3A8MB 3CBPA 2OTJQ 2IIMA 3DLLA 2HSEB 2CH4W 1PHTA 1A0NB 1H8KA 2DL7A 3G6EA 4FT2A 1Q7YU 2YUQA 3VS2A 3NPFA 4M78D 5CKFA 2E12A 8ATCB 1NPPA 1D0ZA 2KYBA 1X27A 4JRIA 1YITT 2E70A 2C0TA 3GF5A 4J9BA 4M78B 2PU9B 3J80E 1KC8C 1B34A 4JDSA 2NUTA 1EX4A 1HK9A 3OS2A 2KXCA 4C8QG 4F17A 1U8RA 3QIIA 1ABOA 2Y4XA 1UE9A 4C0DC 1D1CA 1K8AC 2EYQA 2QGGA 2E3IA 5LJ5d 1YJWT 2LNVA 4FM4B 3OYMA 1QCOA 2RB6A 4L6V5 2OTLT 3JB9F 4JJNK 1JEGA 3KBGA 4NL3A 2E3HA 3FDRA 2FZGB 4C5HA 2M9UA 1BU1A 3PMIA 1NLOC 4BI4A 1OQKA 3EG1A 1K1ZA 1KD1U 2E1HA 1NLPC 3HRSA 2X9HA 3DB3A 2QI2A 1YI2Q 4MZMA 2DEQA 4ZGJB 3JCMf 1MMDA 1YIJA 1VQOA 1VQMA 1T0HA 4M7DA 1XOVA 3BE3A 2LCCA 2M16A 4IUPA 2JS0A 1NJIR 1K76A 2DXCA 2XDDA 1WHGA 1R77A 3H6ZA 3RESA 2DMOA 1WJRA 2GQIA 2V1RA 1W1FA 4ZTJA 5J3BA 1QVFP 2DKGA 1UHFA 2LJ3A 3G4ST 1DJ7B 4X34A 4DBHA 2FO0A 1QWEA 3BY7A 1TUGB 5GAN4 2EKHA 2DK3A 3CC7A 2K57A 2CDTA 3VS3A 3OBWA 1M9SA 4QVDA 2V8KA 2HSPA 3L2RA 4C8QC 2E41A 2X4WA 2A28A 2EYZA 2RMOA 5GAOq 2MOXA 2X4JA 1GRIA 4IIOA 1VQ9T 2D8JA 2P0KA 2LC4A 2CT3A 3O5ZA 3HFNA 2CP7A 5GMKh 3CPWS 5EC7A 1YCYA 2O4XA 5CK9A 4L59A 2MPXC 2HCKA 2AZVA 4KGXB 2RN8A 1JXOA 4LN2A 4M7AB 4HCZA 3RERA 3JCMJ 3X20B 1BYMA 2DFUA 2HBWA 3JAME 1Y57A 2QA4Q 2RO0A 1R8OB 4M78A 3M0RA 4C0ZA 1JJ2P 4RTUA 1WXTA 4NL2A 2J6FA 3FB9A 4MDXA 3M53A 3QDRB 1XJWB 2AKKA 1K9MU 5IXBA 3EH2A 3UA6A 4XTYA 2QA4T 3JCMX 4O6JA 2CP5A 1KC8R 1YIJQ 2EQUA 1WHMA 5A0DA 3GNFB 2M0OA 2V8JA 5IHIA 3VRZA 4BI8B 4HCBA 4FSXA 2DVJA 4QQGA 2GBQA 4RCBA 1TUDA 4RTWA 3CC4A 1JXMA 2ZCFB 4RCCA 2L3QA 1X6OA 4M75D 4C92E 5IN1A 1S72Q 4FW1A 4OB0B 1VQ4A 4C8QD 7AT1B 4BDYA 1VQKT 3G4SA 1JU5C 3EHQA 1W2BA 1G8XA 4R55A 2MWPA 2RQTA 2DD4A 2DRKA 1X2QA 4PFZA 4CI0C 2SRCA 1VQ5T 2VC8A 1VQ6Q 2LTOA 4RTVA 3I56A 4OF1A 3G7ZA 1MV3A 1JJ2A 2EW3A 2P4TA 8AT1B 2VGNA 5GAMe 4BE1A 2HMAA 2DNUA 4PJOD 1GCQC 2E6NA 1OPLA 2LCSA 1VA7A 2RI2A 1MMNA 1Q81C 3G71A 5KYUA 2YRDA 5LJ5j 3I56T 4M78G 2WSCE 3CC4Q 3HSBA 2PQWA 3I55Q 2XI9A 1MMGA 2DIGA 2P0QA 4XK8E 3RBBB 2AT1B 1TWBA 3LWHA 2X35A 3C94A 3E19A 2B8AA 4IIMA 3QO3A 3OBYA 2QQAA 2PVOB 3EFOB 3EG3A 2HD0A 3L2WA 1D1BA 1T3SA 3MPUB 5GAMh 2XU8A 1UUEA 3D7SB 4J9EA 1UDLA 2COYA 4X1VA 5GJWB 2OX7A 5A2QE 4Y91A 1YJWQ 4M7AA 1ZSZA 1VQ8A 2OI3A 3OYNA 2DVEA 4QVZA 5KE2A 5GAOr 3QUIA 3AHUA 2DXTA 1PD0A 2EFIA 3JB9D 4A54A 1IO6A 1C1AA 5GMKi 5I11A 5DLQE 4DBFA 3CD6A 5IAYA 1G2BA 1NYGA 5KYYA 2RI3A 2JM9A 4M75B 2DL5A 4CC2A 5GANh 1TOVA 2XG8D 4J9IA 3I9QA 1M1KU 4M7AC 3PMTA 2R58A 4Z8AA 2EWNA 2L8DA 4PLIA 4HCKA 4JRKA 1VQ6A 1IHWA 2LQ8A 2COWA 1X01A 2EGCA 4DBQA 1LPLA 3EFSA 1EFNA 2DYBA 3OYJA 3OW2A 2GTJA 5IXFA 3CPFA 3META 5LJ5e 1X6GA 2KYMA 4AT1B 4ORZA 3V8LA 2ZPEB 2AIRB 1WPYA 3CD6Q 3VUZA 3NMZC 3OS1A 1BIAA 1VQLA 3QBYA 3SB2A 1K8AR 5I2MA 5LJ3g 3TREA 3CXCS 1BKBA 2QQ9A 4Q5WA 2KRMA 3RR6A 3VU3C 2ROTA 1QVGS 2JTEA 5KYNA 2KR3A 2RF0A 2I2LA 3CC4T 2HZYA 3FJPA 1W70A 1WQ7A 3RMQA 3SHWA 1HYOA 2OJ2A 1ZX6A 2XMFA 3MKDA 1HD3A 3I55A 4D6WA 1AZEA 1TSFA 4AG2C 4M7AG 1SSFA 1VQNT 4LNPA 2QAZA 4AG1C 5HKCA 3CCUT 3M55A 1Y96A 1PCXA 1I5OB 5GAN6 3V7CA 4Z89A 3M4YA 4MDWA 1UGPB 1RAEB 2KXDA 4KUIA 4GY5A 1QMCA 3CBMA 1ZA1B 2QEXT 4KH1B 4OMMA 3GOXA 2ZPIB 1VYTA 2DZ9A 3VV0A 4PNOA 1I81A 4C8QE 4OGCA 2CZ1B 2GFAA 3CCUA 2J6KA 1UEBA 4EMGA 1K9MR 2COZA 5FU7B 4HVWA 1WGSA 2XICA 3X28B 4DA4A 2H8HA 1WXUA 2HBPA 1QVFS 1MUZA 3OYLA 1LVKA 3L2ZA 4O5VA 1VQ5A 3O8VA 3CBOA 3DLMA 1WIEA 1BK2A 2JZ2A 2L5QA 3QG1A 1M3BA 4C0DB 4FW2A 4ZGEB 3VS4A 4OGEA 1KK7A 2F2XA 2RM4A 3RKXA 2G6FX 4M77A 3TCJA 2QA4A 5KYXA 2QASA 2XD0A 4LDWA 1PRMC 4IUVA 1RAFB 1JJ2S 3CD6T 2DZCA 1QQJA 1QKWA 4OB3B 1OYXA 2X3WD 5IH2A 4F14A 1OEBA 2KE9A 4PL6A 4R0KA 4M7DC 1QP2A 4E7ZA 4OB2B 2ED0A 3CCUQ 1K0XA 3JCMd 5J39A 1Z9ZA 1OX9A 1NZ9A 4M7DB 3PTAA 3J81E 1M2VB 1OPKA 4FYYB 1YJ9T 4BY6B 2DTHA 4AFSC 2K2MA 5FROA 3M57A 2X51A 1UGVA 4XTWA 3CCRA 1ZBJA 2KBTA 1XNIA 5AYFA 2NUTB 1VQLT 1AWXA 2R5MA 2WSFE 2FVUA 4PK4A 1MGQA 1Q81R 4M77G 1QP3A 5GAN5 5GAN7 1Y07A 4AMCA 1VQ5Q 1V29B 1D0XA 1IB8A 4NS5A 1B3QA 4RMOA 2DL3A 5KYWB 2CS7A 2FPEA 4DBRA 5KH6A 2K2VA 5LJ3e 2DRMA 4PFPA 2ABLA 4C0FA 4RG8A 3T9NA 3CXCP 4C8QB 1AWOA 5I2SA 1VIEA 1WJQA 5KCHA 1VUBA 3JB9G 4RTTA 5GANj 3EGDA 4N0AA 5GAN3 1U06A 2YXYA 3OY9A 2DA9A 1YIJT 1D1AA 3M0UA 3OMCA 2NUZA 2HAXA 1PRLC 1YHQT 2O01E 1YJWA 5DLOA 2LMJA 3V8KA 4FYVB 3CCRT 5IT9E 2DD5A 1NYFA 1M1GA 2FB7A 1VQNQ 3RMSA 4HT8A 4F7UA 1VQKQ 4M77C 2AZSA 2EJ9A 3JB9H 1SHGA 3A8LB 5GANf 2LQKA 1RAAB 2WSEE 5KYYB 4KGZB 1YHQQ 4RUGA 3PT9A 3HPWA 4QW2A 3G4SQ 3CMAA 4M78C 4LD6A 3EFOA 2Y90A 1Q95G 4BD3A 5KE3A 1S72A 2KQWA 4JZ3A 5J26A 5AT1B 1KD1R 4HVVA 1QLYA 3CCVT 5CKHA 2AKLA 4HXJA
chains in the Genus database with same CATH topology
3TVTA 4A63B 2RQTA 2DRKA 3SEMA 1X2QA 1UJ0A 3CQTA 2DX1A 1UHCA 3M0QA 2E5KA 2D8HA 2SRCA 2YSQA 3VS1A 4LE9A 2SEMA 3I35A 4Z88A 2O9VA 4RTVA 4OMOA 3RNJA 1JQQA 5L23A 1MV3A 2JW4A 2EW3A 1QCFA 1UG1A 2O88A 2MCNA 1RLPC 1KIKA 3EHRA 2DNUA 2W0ZA 1GCQC 1OPLA 1AOJA 2LCSA 1VA7A 1RI9A 5IHNA 1VYUA 1K9AA 2RQWA 3FJ5A 4JJDA 2K6DA 3JV3A 1YN8A 2CSIA 3A98A 3I5SA 3VS0A 2MIOA 3UATA 4K11A 1I07A 2D1XA 3KFVA 3RBBB 2J05A 3UF4A 1X43A 2ROLA 1FYNA 2VVKA 1AWWA 3M0SA 4JJCA 1ZLMA 2CSQA 4IIMA 1M8MA 2RQVA 3EG3A 2GGRA 2FRYA 1FMKA 3C0CA 1T3SA 2DBMA 4RTYA 1UUEA 2BZ8A 2AK5A 4J9EA 1X6BA 3REAB 1UDLA 2YUNA 1HSQA 4X1VA 5GJWB 2B86A 5I22A 1SSHA 1PNJA 2J06A 2YDLA 2EQIA 3PVLA 2I0NA 1GFDA 2A36A 2OI3A 1NM7A 2KRNA 1JO8A 4OMPA 2P4RA 1U3OA 4DEYA 1CKAA 1GBRA 1NEBA 2J7IA 1PKTA 4F16A 1IO6A 4FSSA 4GLMA 2EPDA 2JS2A 1AVZC 2C0IA 2FG0A 5I11A 3EG2A 3R6NA 1MV0B 1RUWA 3H0HA 1ZUUA 1M27C 1G2BA 1NYGA 2JM9A 1YCSB 2DL5A 4CC2A 2DL4A 2YUPA 4J9IA 3I9QA 1AZGB 2C0OA 1BB9A 2CH4A 4Z8AA 2RNAA 4HCKA 2DBKA 5IHKA 1NG2A 1WYXA 2RQUA 1LCKA 2EGCA 2V1QA 5FWBA 1EFNA 2DYBA 1QKXA 2GTJA 1KFZA 2EBPA 1CKBA 5IXFA 4J9HA 4D8DA 1E6HA 2KNBB 1X6GA 2KYMA 2ED1A 3REBB 1SPKA 3NGPA 4ORZA 1I1JA 1QWFA 2A37A 1WLPB 4JPBW 3NMZC 3ZL7C 1W6XA 2K3BA 1S1NA 2A08A 4J9CA 1GFCA 1PKSA 2YT6A 2JMAA 3H41A 3M0PA 3VS7A 2KRMA 2BZXA 1Y0MA 2ROTA 4LUEA 2JTEA 2KR3A 2RF0A 1Z9QA 4ESRA 2CUDA 1W70A 1X69A 2LJ1A 4CC7A 2GNCA 3SHWA 2L3SA 4AFQC 2OJ2A 2LQNA 2OAWA 2DM1A 1ZX6A 1E6GA 5FWCA 2XMFA 4J9GA 2EGAA 1HD3A 2K7AA 2FPDA 2DL8A 3NHNA 1AZEA 4HVUA 2LZ6B 4AG2C 2DILA 2BTTA 4LNPA 4AG1C 2GTOA 2K9GA 2X3XD 2VWFA 4Z89A 3UA7A 3U23A 2KXDA 2LQWA 2DF6A 1I0CA 1WXBA 1H92A 4OMMA 2DJQA 3EHQA 3TSWA 1AEYA 1ZSGA 1K0SA 1N5ZA 1VYTA 3H0IA 4OMQA 2F2WA 1U5SA 2J6KA 2IIMA 4HVWA 1GCPA 1PHTA 2CH4W 2EVRA 1H8KA 2DL7A 2O9SA 5HCKA 1A0NB 4ZNXA 2H8HA 1WXUA 2EGEA 2L3PA 2YUQA 3VS2A 3NPFA 4WCIA 1MUZA 4OMNA 1M30A 2KYBA 1WIEA 1BK2A 1X27A 1TG0A 2C0TA 2K79A 1M3BA 4J9BA 1G83A 2EYWA 2D0NA 1WDXA 3VS4A 3ULRB 2DE0X 1ZUYA 1YNZA 2F2XA 2G6FX 2KXCA 4F17A 1J3TA 4D8KA 1ABOA 1UE9A 1OV3A 1HJDA 2PZ1A 1PRMC 1QKWA 4J9FA 3THKA 2VKNA 1UJYA 2X3WD 5IH2A 2ENMA 4F14A 1OEBA 2KE9A 4M4ZA 4R0KA 4RTZA 1WA7A 1JEGA 4E6RA 3IQLA 2KROA 2W10A 2ED0A 4OMLA 1K0XA 1BU1A 2RPNA 1Z9ZA 2DLPA 1WFWA 1NLOC 1E7OA 3EG1A 1K1ZA 1UECA 4CC4B 3TSZA 1NLPC 1SRLA 1OPKA 2KT8A 1GCQA 2EYYA 4AFSC 3QWYA 1SRMA 2LNHB 3QWXX 2KGTA 2K2MA 4LUDA 3EG0A 3I5RA 1UGVA 1T0HA 3PE0A 2HDAA 1ZBJA 1XOVA 2JMCA 2KBTA 1KSWA 3PVQA 2JS0A 1K76A 2FRWA 1AWXA 2DMOA 2GQIA 2V1RA 1W1FA 2EYXA 1KJWA 1T3LA 2O31A 1CSKA 1UHFA 2LJ3A 2NWMA 1H3HA 1SHFA 4EIKA 2QDLA 2FO0A 1X2KA 1NEGA 1QWEA 1AD5A 3VRYA 2EKHA 1V1CA 2CDTA 3VS3A 3VS6A 1GBQA 1B3QA 2ECZA 2PNIA 2DL3A 2HSPA 4J9DA 2CREA 2FPEA 2BZYA 2ESWA 4CC3A 2A28A 2EYZA 2JT4A 2LX7A 5FW9A 1OOTA 2RMOA 2DRMA 2MOXA 1GRIA 1T0JA 4IIOA 2JM8A 2ABLA 2L0AA 1ZUKA 2FPFA 2LP5A 2D8JA 1AWOA 2KT1A 4JZ4A 1VYVA 2RQRA 2KRSA 2CT3A 3O5ZA 3M0TA 2LJ0A 1YP5A 1YWPA 5EC7A 1M3AA 4RTTA 2HCKA 2AZVA 2RN8A 2HEQA 1JXOA 3GBQA 4LN2A 1U06A 2J6OA 2FEIA 2DA9A 4DEXA 2HBWA 3VS5A 1Y57A 1WX6A 3M0UA 2NUZA 1PRLC 1GL5A 3M0RA 1AWJA 4KRTA 2M51A 5ECAA 4RTUA 2LMJA 1UFFA 1WXTA 1NYFA 2J6FA 1TUCA 5GJVB 1PWTA 2AKKA 4Y92A 3H0FA 4GBQA 1B07A 2AZSA 5IXBA 1YWOA 3LH5A 1SHGA 4AFZC 3UA6A 4AFUC 1WI7A 1M3CA 2F2VA 1BBZA 1RLQC 5IHIA 4RUGA 3VRZA 4JJBA 2DVJA 2CT4A 1UTIA 2GBQA 1TUDA 4RTWA 1JXMA 4QT7A 2L3QA 2JXBA 2O2OA 2M0YA 3EGUA 1ABQA 4JZ3A 2PTKA 2CUBA 1ARKA 2YUOA 1SEMA 4HVVA 4RTXA 1QLYA 2KEAA 1JU5C 2L2PA 1K4US 2AKLA 4HXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVT A;  4A63 B;  2RQT A;  2DRK A;  3SEM A;  1X2Q A;  1UJ0 A;  3CQT A;  2DX1 A;  1UHC A;  3M0Q A;  2E5K A;  2D8H A;  2SRC A;  2YSQ A;  3VS1 A;  4LE9 A;  2SEM A;  3I35 A;  4Z88 A;  2O9V A;  4RTV A;  4OMO A;  3RNJ A;  1JQQ A;  5L23 A;  1MV3 A;  2JW4 A;  2EW3 A;  1QCF A;  1UG1 A;  2O88 A;  2MCN A;  1RLP C;  1KIK A;  3EHR A;  2DNU A;  2W0Z A;  1GCQ C;  1OPL A;  1AOJ A;  2LCS A;  1VA7 A;  1RI9 A;  5IHN A;  1VYU A;  1K9A A;  2RQW A;  3FJ5 A;  4JJD A;  2K6D A;  3JV3 A;  1YN8 A;  2CSI A;  3A98 A;  3I5S A;  3VS0 A;  2MIO A;  3UAT A;  4K11 A;  1I07 A;  2D1X A;  3KFV A;  3RBB B;  2J05 A;  3UF4 A;  1X43 A;  2ROL A;  1FYN A;  2VVK A;  1AWW A;  3M0S A;  4JJC A;  1ZLM A;  2CSQ A;  4IIM A;  1M8M A;  2RQV A;  3EG3 A;  2GGR A;  2FRY A;  1FMK A;  3C0C A;  1T3S A;  2DBM A;  4RTY A;  1UUE A;  2BZ8 A;  2AK5 A;  4J9E A;  1X6B A;  3REA B;  1UDL A;  2YUN A;  1HSQ A;  4X1V A;  5GJW B;  2B86 A;  5I22 A;  1SSH A;  1PNJ A;  2J06 A;  2YDL A;  2EQI A;  3PVL A;  2I0N A;  1GFD A;  2A36 A;  2OI3 A;  1NM7 A;  2KRN A;  1JO8 A;  4OMP A;  2P4R A;  1U3O A;  4DEY A;  1CKA A;  1GBR A;  1NEB A;  2J7I A;  1PKT A;  4F16 A;  1IO6 A;  4FSS A;  4GLM A;  2EPD A;  2JS2 A;  1AVZ C;  2C0I A;  2FG0 A;  5I11 A;  3EG2 A;  3R6N A;  1MV0 B;  1RUW A;  3H0H A;  1ZUU A;  1M27 C;  1G2B A;  1NYG A;  2JM9 A;  1YCS B;  2DL5 A;  4CC2 A;  2DL4 A;  2YUP A;  4J9I A;  3I9Q A;  1AZG B;  2C0O A;  1BB9 A;  2CH4 A;  4Z8A A;  2RNA A;  4HCK A;  2DBK A;  5IHK A;  1NG2 A;  1WYX A;  2RQU A;  1LCK A;  2EGC A;  2V1Q A;  5FWB A;  1EFN A;  2DYB A;  1QKX A;  2GTJ A;  1KFZ A;  2EBP A;  1CKB A;  5IXF A;  4J9H A;  4D8D A;  1E6H A;  2KNB B;  1X6G A;  2KYM A;  2ED1 A;  3REB B;  1SPK A;  3NGP A;  4ORZ A;  1I1J A;  1QWF A;  2A37 A;  1WLP B;  4JPB W;  3NMZ C;  3ZL7 C;  1W6X A;  2K3B A;  1S1N A;  2A08 A;  4J9C A;  1GFC A;  1PKS A;  2YT6 A;  2JMA A;  3H41 A;  3M0P A;  3VS7 A;  2KRM A;  2BZX A;  1Y0M A;  2ROT A;  4LUE A;  2JTE A;  2KR3 A;  2RF0 A;  1Z9Q A;  4ESR A;  2CUD A;  1W70 A;  1X69 A;  2LJ1 A;  4CC7 A;  2GNC A;  3SHW A;  2L3S A;  4AFQ C;  2OJ2 A;  2LQN A;  2OAW A;  2DM1 A;  1ZX6 A;  1E6G A;  5FWC A;  2XMF A;  4J9G A;  2EGA A;  1HD3 A;  2K7A A;  2FPD A;  2DL8 A;  3NHN A;  1AZE A;  4HVU A;  2LZ6 B;  4AG2 C;  2DIL A;  2BTT A;  4LNP A;  4AG1 C;  2GTO A;  2K9G A;  2X3X D;  2VWF A;  4Z89 A;  3UA7 A;  3U23 A;  2KXD A;  2LQW A;  2DF6 A;  1I0C A;  1WXB A;  1H92 A;  4OMM A;  2DJQ A;  3EHQ A;  3TSW A;  1AEY A;  1ZSG A;  1K0S A;  1N5Z A;  1VYT A;  3H0I A;  4OMQ A;  2F2W A;  1U5S A;  2J6K A;  2IIM A;  4HVW A;  1GCP A;  1PHT A;  2CH4 W;  2EVR A;  1H8K A;  2DL7 A;  2O9S A;  5HCK A;  1A0N B;  4ZNX A;  2H8H A;  1WXU A;  2EGE A;  2L3P A;  2YUQ A;  3VS2 A;  3NPF A;  4WCI A;  1MUZ A;  4OMN A;  1M30 A;  2KYB A;  1WIE A;  1BK2 A;  1X27 A;  1TG0 A;  2C0T A;  2K79 A;  1M3B A;  4J9B A;  1G83 A;  2EYW A;  2D0N A;  1WDX A;  3VS4 A;  3ULR B;  2DE0 X;  1ZUY A;  1YNZ A;  2F2X A;  2G6F X;  2KXC A;  4F17 A;  1J3T A;  4D8K A;  1ABO A;  1UE9 A;  1OV3 A;  1HJD A;  2PZ1 A;  1PRM C;  1QKW A;  4J9F A;  3THK A;  2VKN A;  1UJY A;  2X3W D;  5IH2 A;  2ENM A;  4F14 A;  1OEB A;  2KE9 A;  4M4Z A;  4R0K A;  4RTZ A;  1WA7 A;  1JEG A;  4E6R A;  3IQL A;  2KRO A;  2W10 A;  2ED0 A;  4OML A;  1K0X A;  1BU1 A;  2RPN A;  1Z9Z A;  2DLP A;  1WFW A;  1NLO C;  1E7O A;  3EG1 A;  1K1Z A;  1UEC A;  4CC4 B;  3TSZ A;  1NLP C;  1SRL A;  1OPK A;  2KT8 A;  1GCQ A;  2EYY A;  4AFS C;  3QWY A;  1SRM A;  2LNH B;  3QWX X;  2KGT A;  2K2M A;  4LUD A;  3EG0 A;  3I5R A;  1UGV A;  1T0H A;  3PE0 A;  2HDA A;  1ZBJ A;  1XOV A;  2JMC A;  2KBT A;  1KSW A;  3PVQ A;  2JS0 A;  1K76 A;  2FRW A;  1AWX A;  2DMO A;  2GQI A;  2V1R A;  1W1F A;  2EYX A;  1KJW A;  1T3L A;  2O31 A;  1CSK A;  1UHF A;  2LJ3 A;  2NWM A;  1H3H A;  1SHF A;  4EIK A;  2QDL A;  2FO0 A;  1X2K A;  1NEG A;  1QWE A;  1AD5 A;  3VRY A;  2EKH A;  1V1C A;  2CDT A;  3VS3 A;  3VS6 A;  1GBQ A;  1B3Q A;  2ECZ A;  2PNI A;  2DL3 A;  2HSP A;  4J9D A;  2CRE A;  2FPE A;  2BZY A;  2ESW A;  4CC3 A;  2A28 A;  2EYZ A;  2JT4 A;  2LX7 A;  5FW9 A;  1OOT A;  2RMO A;  2DRM A;  2MOX A;  1GRI A;  1T0J A;  4IIO A;  2JM8 A;  2ABL A;  2L0A A;  1ZUK A;  2FPF A;  2LP5 A;  2D8J A;  1AWO A;  2KT1 A;  4JZ4 A;  1VYV A;  2RQR A;  2KRS A;  2CT3 A;  3O5Z A;  3M0T A;  2LJ0 A;  1YP5 A;  1YWP A;  5EC7 A;  1M3A A;  4RTT A;  2HCK A;  2AZV A;  2RN8 A;  2HEQ A;  1JXO A;  3GBQ A;  4LN2 A;  1U06 A;  2J6O A;  2FEI A;  2DA9 A;  4DEX A;  2HBW A;  3VS5 A;  1Y57 A;  1WX6 A;  3M0U A;  2NUZ A;  1PRL C;  1GL5 A;  3M0R A;  1AWJ A;  4KRT A;  2M51 A;  5ECA A;  4RTU A;  2LMJ A;  1UFF A;  1WXT A;  1NYF A;  2J6F A;  1TUC A;  5GJV B;  1PWT A;  2AKK A;  4Y92 A;  3H0F A;  4GBQ A;  1B07 A;  2AZS A;  5IXB A;  1YWO A;  3LH5 A;  1SHG A;  4AFZ C;  3UA6 A;  4AFU C;  1WI7 A;  1M3C A;  2F2V A;  1BBZ A;  1RLQ C;  5IHI A;  4RUG A;  3VRZ A;  4JJB A;  2DVJ A;  2CT4 A;  1UTI A;  2GBQ A;  1TUD A;  4RTW A;  1JXM A;  4QT7 A;  2L3Q A;  2JXB A;  2O2O A;  2M0Y A;  3EGU A;  1ABQ A;  4JZ3 A;  2PTK A;  2CUB A;  1ARK A;  2YUO A;  1SEM A;  4HVV A;  4RTX A;  1QLY A;  2KEA A;  1JU5 C;  2L2P A;  1K4U S;  2AKL A;  4HXJ A; 
#chains in the Genus database with same CATH topology
 3CC2 T;  2A0F B;  3SD4 A;  4A63 B;  2KDS A;  1UJ0 A;  5GAO p;  3M59 A;  3C4S A;  2YSQ A;  4ME7 A;  3VS1 A;  3CMA T;  2P84 A;  4Z88 A;  2EQJ A;  1VQK A;  5GAO m;  1RI0 A;  3GPL A;  5L23 A;  4C92 A;  2ZZD A;  2O88 A;  1Q7Y C;  2VXE A;  1YIT Q;  2MCN A;  2RHY A;  1S72 T;  1G3T A;  3CME T;  1RI9 A;  2IG0 A;  5IHN A;  4ZN3 A;  2RQW A;  3FJ5 A;  4YTL A;  3CCL Q;  1Q81 U;  3ZEH A;  2CZ6 B;  3HL8 A;  2CP0 A;  5LJ3 d;  2QXF A;  4KH0 B;  1YJN Q;  1PSE A;  3H8Z A;  4C92 B;  2ROL A;  3OS0 A;  1K73 C;  4PJO E;  3BFM A;  1F1B B;  1ZLM A;  2CSQ A;  1M8M A;  1C6V X;  3PIO A;  1Q7Y R;  2FRY A;  1D0Y A;  1FMK A;  2K4Y A;  1YJ9 A;  4OB1 B;  3CMA Q;  3AT1 B;  1UB4 A;  3HRU A;  4LDU A;  4A4K A;  2YUN A;  1HSQ A;  3JSC A;  3JCM h;  5I22 A;  2X4X A;  3JCM Q;  1SSH A;  2J06 A;  2YDL A;  2EQI A;  3CCV Q;  1W4S A;  2RD1 A;  3OYE A;  1GFD A;  2MK5 A;  3V7R A;  1I4K 1;  1NM7 A;  1JO8 A;  4OMP A;  3LYI A;  2PUK B;  1VQP Q;  1U3O A;  3CME Q;  2OTJ T;  2J7I A;  3SDZ A;  5LJ5 h;  1PKT A;  1U1T A;  4N4I A;  2CP6 A;  5DY9 A;  4F16 A;  1KD1 C;  4GLM A;  4FSS A;  2G3R A;  2JS2 A;  1RAB B;  3EG2 A;  3R6N A;  1MV0 B;  3H0H A;  4HA8 A;  3GNG A;  3JCM P;  3EGX B;  4JLI A;  2EAY A;  1YCS B;  4E7L A;  5KYU B;  2DL4 A;  2YUP A;  3JCM e;  3OA6 A;  1FMW A;  1VQ8 Q;  4HKE A;  2C0O A;  2CH4 A;  1H3Z A;  2OTL A;  2RNA A;  5GAN 2;  2DBK A;  3TQ7 P;  5FRN A;  4J8O A;  4PJJ A;  3RKY A;  5FWB A;  3QPH A;  1NE8 A;  2NYS A;  1QKX A;  2E6Z A;  2K5I A;  3MEW A;  2CZ0 B;  2KNB B;  3RKW A;  3REB B;  1D3B B;  1YIT A;  3NGP A;  4A4F A;  3G1J A;  2A37 A;  3G6E Q;  1FX7 A;  5KYW A;  3ZL7 C;  1S1N A;  1M1F A;  5CQX A;  3X25 B;  2YLC A;  4F04 B;  3ZBD A;  5HK0 A;  4B9X A;  2QTV A;  1Y0M A;  2JNG A;  2JJ9 A;  4JS5 A;  2JTM A;  2H3E B;  2LT4 A;  4ESR A;  4XQ3 A;  4BB7 A;  3CCQ A;  5GAN g;  4E7K A;  1X69 A;  4EDU A;  3L2U A;  2LJ1 A;  3M58 A;  4CC7 A;  2RK2 A;  4AFQ C;  2LQN A;  2M1H A;  4N4G A;  5FWC A;  1XTD A;  2HQE A;  4BE0 A;  3HRT A;  4E7J A;  2LZ6 B;  4KUD K;  4WF2 A;  1Q82 R;  2F5T X;  1VOM A;  3M9Q A;  2GTO A;  3CCQ T;  5FU6 C;  1VQ9 A;  1PM3 A;  2BKD N;  4MMK A;  4EMK B;  1M1K C;  2LQW A;  2DF6 A;  1I0C A;  1H92 A;  2KY9 A;  2DJQ A;  3E9F A;  1K0S A;  1N5Z A;  3H0I A;  1O9S A;  5FRM A;  1TS9 A;  4PKC C;  1ZQ1 A;  3MEV A;  1GCP A;  2AHJ B;  2EVR A;  2O9S A;  3V8J A;  4WTO B;  2EGE A;  2L3P A;  2CGH A;  1TU0 B;  3QYH B;  1BI2 A;  5D7U A;  4HT9 A;  4X9C A;  1PD1 A;  2RJF A;  2K79 A;  5GAM j;  4M7D E;  1G83 A;  1QVG A;  2Y4Y A;  1YFN A;  2D0N A;  1G3S A;  1WDX A;  4ELY C;  3ULR B;  2DE0 X;  3FC3 A;  2LT1 A;  4BDZ A;  1YNZ A;  4QVC A;  4M75 E;  1VQ6 T;  4BE2 A;  2QQR A;  3QJY A;  3ASK A;  3LWI A;  1J3T A;  4N4H A;  2E64 A;  4D8K A;  3CC2 A;  4Z02 A;  2O4X B;  1I8F A;  3LGL A;  2OTJ A;  3CCS A;  2PZ1 A;  3QDF A;  3P8D A;  3THK A;  2LRQ A;  1AHJ B;  3JCM c;  4L5G A;  1KHC A;  1YJ9 Q;  2ENM A;  2FZC B;  3RDV A;  1WHL A;  3VYH B;  3MEA A;  5CIU A;  1TXQ A;  3OMG A;  4A4E A;  1ZBX A;  4E6R A;  4JS4 A;  2MAM A;  4LDY A;  4ANJ A;  1AT1 B;  4JUV A;  4OP0 A;  3CPW A;  2RPN A;  2DLP A;  2RJD A;  2H3J A;  1UEC A;  4PFO A;  5HK3 A;  3A8H B;  3OYH A;  2KT8 A;  4E7H A;  2EYY A;  1M2V A;  1SRM A;  2A7Y A;  3E9G A;  3QWX X;  3EG0 A;  1PSF A;  3MHX A;  1YJN T;  2HDA A;  3DB4 A;  2JMC A;  1KSW A;  3PVQ A;  1QVP A;  1PG5 B;  4ZN1 A;  4QQD A;  2XID A;  2EYX A;  1T3L A;  4XU0 A;  1IZ6 A;  2O31 A;  3H9N A;  5GMK e;  3VUB A;  1H3H A;  2Z0W A;  2CP2 A;  4EIK A;  3OW2 P;  2ZGW A;  2QDL A;  1U1S A;  4OVA A;  3V7S A;  3HHT B;  3OYA A;  1D09 B;  1VQO Q;  2GF7 A;  3VS6 A;  2BE9 B;  4PJO G;  2CRE A;  2ESW A;  4CC3 A;  3ER0 A;  2LX7 A;  1OOT A;  5LL6 S;  3QZ9 B;  3S3M A;  1IGQ A;  1ZSZ C;  4J7F A;  1VQ7 Q;  1LJO A;  1T0J A;  3ME9 A;  2JM8 A;  1VQO T;  2PVD B;  4PJO B;  2YWW A;  1HXD A;  1ZUK A;  2FPF A;  3CC2 Q;  4EMK A;  2A3L A;  3JCM g;  2RQR A;  4M7A D;  3M0T A;  4M77 D;  2LJ0 A;  4EPC A;  1YP5 A;  4M7D F;  3P8H A;  1OU8 A;  2RJC A;  4M75 G;  2J6O A;  3S3N A;  2GQV A;  5GAO l;  4DQ2 A;  4DEX A;  5LJ5 g;  1WX6 A;  3A8O B;  4KGV B;  2M51 A;  2ZPF B;  1BCO A;  1BIB A;  2DPP B;  1RAI B;  4F7U G;  5LJ3 h;  3QKJ A;  4C5G A;  4TVR A;  3MP8 A;  3E2U A;  1TUC A;  5GJV B;  5DM7 R;  1PWT A;  5FU7 C;  4Y92 A;  3CME A;  3H0F A;  4F7U B;  2EJG A;  1B07 A;  5CKB A;  3OS5 A;  2V8I A;  4AFZ C;  1Q82 U;  4AFU C;  4C5E A;  1WHH A;  1M2O A;  1RLQ C;  4C92 D;  2X4Y A;  4XTX A;  4QKU A;  3ZFJ A;  3OYB A;  2CT4 A;  2DIQ A;  3KUF A;  1UTI A;  1EZZ B;  4PJL A;  1G3W A;  2F1L A;  4J6W A;  2O2O A;  3X26 B;  1LOJ A;  1YBY A;  3LLR A;  5CAI A;  2PTK A;  1OI1 A;  1BI0 A;  2CUB A;  4M78 F;  4DOV A;  2YUO A;  3N5B B;  4LXC A;  4C0G A;  4RTX A;  2P0P A;  3R6O A;  2F5K A;  2L2P A;  1N8R C;  1O75 A;  4N0A C;  3SEM A;  3CQT A;  2DYI A;  3M0Q A;  4M77 F;  4M75 A;  1KHI A;  3WVE B;  2R57 A;  2SEM A;  3I35 A;  1KQS P;  2O9V A;  3M56 A;  4OMO A;  2R5A A;  3GIB A;  4C92 F;  1JQQ A;  3MO8 A;  2RI5 A;  1X75 C;  1QCF A;  2RHI A;  4B9W A;  2QQB A;  1UG1 A;  1WNL A;  4XU2 A;  4E7S A;  1RLP C;  1ZA2 B;  2KK4 A;  1MND A;  4M75 F;  1AOJ A;  4LD9 K;  3TEE A;  3GLX A;  4KBM B;  3PNW C;  3QXE B;  1K9A A;  2KMT A;  2K6D A;  5CKD A;  3JV3 A;  1IHV A;  2CYZ B;  3A98 A;  3I5S A;  4PJN A;  4XTZ A;  3VS0 A;  1UGQ B;  4K11 A;  1I07 A;  4F7U F;  2DJZ A;  2D1X A;  3KFV A;  3M4G A;  2LX9 A;  2J05 A;  2RK1 A;  1X43 A;  1N8R U;  1FYN A;  2RHZ A;  2QEX A;  1M90 R;  4JJC A;  2NLU A;  4KUL A;  2RQV A;  2F69 A;  2YLB A;  1KQS A;  2GGR A;  4UC4 A;  2XKO C;  3PFS A;  3C95 A;  2DBM A;  4BUG A;  4RTY A;  2ZAE A;  2AK5 A;  1X6B A;  3REA B;  4MZP A;  3J7A F;  5C6S A;  3OSS C;  1OZ3 A;  3I55 T;  2I0N A;  4C5I A;  2IVW A;  3CCE T;  2P4R A;  4ZTF A;  1MMA A;  2XK0 A;  2WAC A;  3FRN A;  4DEY A;  3OW2 S;  2VAS A;  1NEB A;  1R0B G;  4IUT A;  1OZ2 A;  1VQP A;  2VB6 A;  2EQM A;  1AVZ C;  2C0I A;  3A8G B;  1BCM A;  5GAM g;  2FG0 A;  1RUW A;  1M27 C;  3EG9 A;  2HL5 C;  3SWN C;  4RG2 A;  1JRI A;  2EIF A;  3CXC A;  2IPO B;  4J83 A;  2PUO B;  3L42 A;  1AZG B;  1BB9 A;  3MP6 A;  1Y71 A;  4FIB A;  3MEU A;  1NG2 A;  1WYX A;  2RQU A;  4VUB A;  3NTI A;  3SWN B;  2OTL Q;  2D9T A;  1KFZ A;  4D8D A;  3CCS T;  2DXU A;  2ED1 A;  5GAN d;  3CCL T;  1I1J A;  1QWF A;  4V2S A;  3RUX A;  1WLP B;  4JPB W;  3PGG A;  2K3B A;  4J9C A;  1PKS A;  2YT6 A;  2JMA A;  2D6F A;  1RAH B;  3H41 A;  5GAN e;  3M0P A;  2QG9 B;  3VS7 A;  3JCM V;  2BE7 D;  2K3Y A;  1BI3 A;  5CQY A;  4FT4 A;  1WQW A;  4LUE A;  4FYX B;  1Z9Q A;  2CUD A;  1ACM B;  2EJF A;  2QEX Q;  1VQ9 Q;  3INZ A;  2GNC A;  3LX7 A;  3X24 B;  2DM1 A;  3L1A A;  4J9G A;  3BDU A;  3L2V A;  2K7A A;  2FPD A;  5GAM f;  2DL8 A;  3NHN A;  3JCM W;  1WJS A;  2CP3 A;  2BTT A;  1KQ1 A;  1WHJ A;  5FLX E;  2E5Q A;  2X3X D;  1Q86 R;  4KT0 E;  3U23 A;  4CRI A;  6AT1 B;  3SFM A;  3CCM Q;  1M4Z A;  3HP9 A;  2DTI A;  1AEY A;  4OMF B;  4Y28 E;  3S6W A;  4OMQ A;  4EMK C;  1U5S A;  1VIF A;  3LGF A;  2DAQ A;  5HCK A;  2GFU A;  3G71 T;  4ZNX A;  4WCI A;  1RAC B;  4OMN A;  4ZGD B;  5A0L A;  1Y7X A;  1KQ2 A;  2JVV A;  4XTU A;  3CCM T;  4IUU A;  1IRE B;  2E10 A;  1M30 A;  3KXT A;  1TG0 A;  2JUF A;  2HQH A;  3Q1J A;  2EYW A;  3CCJ A;  5A0G A;  1ZUY A;  2VXF A;  4IUR A;  2L89 A;  1NBE B;  4A53 A;  4J6Y A;  3VJP A;  4JRP A;  1G5V A;  1W2B S;  2YHT A;  4LDX A;  2BUD A;  1OV3 A;  1HJD A;  2PVG B;  2YRC A;  3URG A;  2YRV A;  1B34 B;  1UGS B;  2DTO A;  3CCE Q;  3JCM b;  2VGM A;  4J9F A;  4PJM A;  2VKN A;  2FL7 A;  1UJY A;  3NTK A;  3OSV A;  4M4Z A;  2JOY A;  4RTZ A;  1Q86 U;  1IXD A;  1M8V A;  1WA7 A;  2OAU A;  3IQL A;  4QQ6 A;  2KRO A;  2W10 A;  5LJ5 f;  2RH2 A;  4OML A;  2XDB A;  2DET A;  1WFW A;  4M78 E;  1E7O A;  4EMH A;  1KC8 U;  5EG2 A;  3CEY A;  5D6X A;  3TU4 K;  4XAX B;  4C8Q F;  4CC4 B;  3OYI A;  3TSZ A;  2K5F A;  1SRL A;  4M7A F;  4M75 C;  2ZPB B;  3E1S A;  4M7D D;  1QVF A;  1GCQ A;  1UGR B;  4LUD A;  2HNI A;  2LNH B;  2FYK A;  2KGT A;  3QWY A;  3OYC A;  3I5R A;  2GCX A;  3PE0 A;  3OYD A;  1SG5 A;  4C92 C;  2FRW A;  3UWN A;  4BY6 C;  2QTX A;  1KJW A;  3QHS A;  3EGD B;  3I56 Q;  3UPU A;  5GMK m;  1N27 A;  1EIF A;  1CSK A;  3L2Q A;  2M02 A;  2NWM A;  4BI3 A;  3CC7 Q;  1SHF A;  1Q86 C;  4F7U E;  5L8R E;  1X2K A;  1NEG A;  1YI2 A;  1ZHI A;  3FEO A;  1AD5 A;  3VRY A;  3OYY A;  1V1C A;  1WHK A;  2CZ7 B;  3WVD B;  1GBQ A;  3QYG B;  2ECZ A;  2PNI A;  5GAO n;  4XU3 A;  3CCJ Q;  4J9D A;  1BI1 A;  2BZY A;  2JT4 A;  5FW9 A;  2EQK A;  1K73 R;  3NFC A;  1LNX A;  1IRX A;  2L0A A;  3CCR Q;  1GXI E;  2NUP B;  1RAD B;  5GAN 8;  4DOW A;  2LP5 A;  2KT1 A;  4JZ4 A;  1VYV A;  2L3R A;  2KRS A;  1FXX A;  3MP1 A;  4A4H A;  1YWP A;  4RKU E;  1N9R A;  1M3A A;  1MNE A;  2LDM A;  3SWN A;  2HEQ A;  1TH7 A;  3FIF A;  4IKF A;  3GBQ A;  1M90 U;  1NJI C;  3OYF A;  2FEI A;  3A5Z B;  3HTR A;  3VS5 A;  4B6M A;  5CVI A;  3JB9 J;  4FYW B;  1GL5 A;  1AWJ A;  1D3B A;  4KRT A;  3PIP A;  5ECA A;  4MML A;  5HY6 A;  1UFF A;  1YI2 T;  5C0M A;  4JRQ A;  1VQM T;  1JB0 E;  3CCQ Q;  4MZT A;  2JTF A;  2ZPH B;  2LCL A;  4GBQ A;  3LW5 E;  4NOY A;  1YWO A;  3LH5 A;  4J6X A;  3OYG A;  1FMV A;  1WI7 A;  1I5L A;  1M3C A;  3BW1 A;  2XDP A;  4X9D A;  2F2V A;  1BBZ A;  1RL2 A;  4J5Y A;  4M77 B;  4JJB A;  2MMP A;  5M9O A;  2QK0 A;  3NTH A;  2ATC B;  5D6W A;  4II1 A;  4M7A E;  2HL3 A;  1VQ4 Q;  4QT7 A;  2JXB A;  2MF2 A;  2M0Y A;  3EGU A;  1VQN A;  1VQL Q;  2D0Q B;  1ABQ A;  1K9M C;  3EFR A;  3CCS Q;  1ARK A;  1OX8 A;  1JBM A;  1QVG P;  1SEM A;  4XU1 A;  1V76 A;  1VQ4 T;  2KEA A;  1K4U S;  3QZ5 B;  1H64 1;  3JB9 I;  3TVT A;  1YHQ A;  1R0C B;  1KG1 A;  2DX1 A;  1UHC A;  2VUB A;  2DER A;  2E5K A;  2D8H A;  1WZO A;  3UDC A;  4LE9 A;  3CCJ T;  3RNJ A;  1IGU A;  2JW4 A;  4LDV A;  2KSS A;  2E4H A;  1MHN A;  1VQM Q;  1KIK A;  3EHR A;  2W0Z A;  3M54 A;  3CCV A;  4GLK A;  4IUQ A;  3EH1 A;  3LH0 A;  1VYU A;  1QW1 A;  2HQX A;  3A1P A;  5KYX B;  4JJD A;  2FZK B;  1YN8 A;  2CSI A;  4FL6 A;  2MIO A;  1XQH A;  3UAT A;  1SF9 A;  4ATO A;  5LJ3 f;  2XHC A;  3UF4 A;  3M5A A;  3HFO A;  1NPR A;  2VVK A;  1OUL A;  3M0S A;  1AWW A;  2HKN A;  3G6E T;  4JLG A;  3C0C A;  3EGX A;  2BZ8 A;  3OYK A;  3BDL A;  2NUP A;  4PLL A;  1M90 C;  2B86 A;  3FLG A;  4A4G A;  2CKK A;  1PNJ A;  2JN0 A;  2MYS A;  3PVL A;  1QCN A;  2K3X A;  2DEU A;  1NJI U;  1YJN A;  2A36 A;  2KRN A;  1VQ8 T;  4R56 A;  3DKM A;  2RJE A;  1PC0 A;  1G3Y A;  1CKA A;  1N9S A;  5I21 A;  2RHX A;  4E47 A;  1GBR A;  4PJO C;  4PJO F;  9ATC B;  4E7I A;  3CC7 T;  5CKE A;  2EPD A;  4P5N A;  2HKQ B;  1W2B P;  5GMK j;  1ZUU A;  2BIV A;  3OB9 A;  3EG9 B;  2DXB A;  3MJX A;  1VQP T;  1B7T A;  1VQ7 T;  2EKO A;  5IHK A;  4XTV A;  1LCK A;  5D6Y A;  2QGF B;  2V1Q A;  2MI6 A;  3CCE A;  1C0M A;  1OU9 A;  2QDY B;  3EAE A;  1N6A A;  2EBP A;  4PJO A;  1CKB A;  2QQS A;  4J9H A;  1K8A U;  1E6H A;  1SPK A;  3VYG A;  3HKS A;  1VQ7 A;  3UT1 A;  3OQ5 A;  1W6X A;  1M5Q 1;  3CCL A;  2A08 A;  1GFC A;  4M77 E;  4C92 G;  5CR2 A;  5KCO A;  2BZX A;  1TTH B;  2RHU A;  1K73 U;  1SKU B;  2E65 A;  2KVQ G;  1ZSZ B;  1M1K R;  4ELZ C;  1RAG B;  4C8Q A;  2L3S A;  5CO7 A;  2RA2 A;  2DO3 A;  2OAW A;  3F70 A;  1E6G A;  4E2F B;  2EGA A;  4BAC A;  1Y96 B;  2QYZ A;  3GP8 A;  1FWZ A;  3MCA B;  4HVU A;  4FCY A;  3P8B B;  3QJ6 A;  2LVM A;  2DIL A;  1Q82 C;  2K5L A;  3C12 A;  1KQS S;  2MWO A;  2K9G A;  2C06 A;  5LJ3 j;  2V26 A;  2VYT A;  2VWF A;  3UA7 A;  4FU6 A;  5CCA A;  3VKI A;  3JRZ A;  3RIR A;  3S3O A;  4J7I A;  2FHD A;  3CPW P;  2KI7 A;  1WXB A;  3QSU A;  1N8R R;  2VV5 A;  2ZPG B;  3TSW A;  5GAM d;  1ZSG A;  5FU6 B;  2KAF A;  4HCC A;  4M7D G;  3CCM A;  3WXM B;  3G71 Q;  2F2W A;  1P92 A;  5GMK l;  3A8M B;  3CBP A;  2OTJ Q;  2IIM A;  3DLL A;  2HSE B;  2CH4 W;  1PHT A;  1A0N B;  1H8K A;  2DL7 A;  3G6E A;  4FT2 A;  1Q7Y U;  2YUQ A;  3VS2 A;  3NPF A;  4M78 D;  5CKF A;  2E12 A;  8ATC B;  1NPP A;  1D0Z A;  2KYB A;  1X27 A;  4JRI A;  1YIT T;  2E70 A;  2C0T A;  3GF5 A;  4J9B A;  4M78 B;  2PU9 B;  3J80 E;  1KC8 C;  1B34 A;  4JDS A;  2NUT A;  1EX4 A;  1HK9 A;  3OS2 A;  2KXC A;  4C8Q G;  4F17 A;  1U8R A;  3QII A;  1ABO A;  2Y4X A;  1UE9 A;  4C0D C;  1D1C A;  1K8A C;  2EYQ A;  2QGG A;  2E3I A;  5LJ5 d;  1YJW T;  2LNV A;  4FM4 B;  3OYM A;  1QCO A;  2RB6 A;  4L6V 5;  2OTL T;  3JB9 F;  4JJN K;  1JEG A;  3KBG A;  4NL3 A;  2E3H A;  3FDR A;  2FZG B;  4C5H A;  2M9U A;  1BU1 A;  3PMI A;  1NLO C;  4BI4 A;  1OQK A;  3EG1 A;  1K1Z A;  1KD1 U;  2E1H A;  1NLP C;  3HRS A;  2X9H A;  3DB3 A;  2QI2 A;  1YI2 Q;  4MZM A;  2DEQ A;  4ZGJ B;  3JCM f;  1MMD A;  1YIJ A;  1VQO A;  1VQM A;  1T0H A;  4M7D A;  1XOV A;  3BE3 A;  2LCC A;  2M16 A;  4IUP A;  2JS0 A;  1NJI R;  1K76 A;  2DXC A;  2XDD A;  1WHG A;  1R77 A;  3H6Z A;  3RES A;  2DMO A;  1WJR A;  2GQI A;  2V1R A;  1W1F A;  4ZTJ A;  5J3B A;  1QVF P;  2DKG A;  1UHF A;  2LJ3 A;  3G4S T;  1DJ7 B;  4X34 A;  4DBH A;  2FO0 A;  1QWE A;  3BY7 A;  1TUG B;  5GAN 4;  2EKH A;  2DK3 A;  3CC7 A;  2K57 A;  2CDT A;  3VS3 A;  3OBW A;  1M9S A;  4QVD A;  2V8K A;  2HSP A;  3L2R A;  4C8Q C;  2E41 A;  2X4W A;  2A28 A;  2EYZ A;  2RMO A;  5GAO q;  2MOX A;  2X4J A;  1GRI A;  4IIO A;  1VQ9 T;  2D8J A;  2P0K A;  2LC4 A;  2CT3 A;  3O5Z A;  3HFN A;  2CP7 A;  5GMK h;  3CPW S;  5EC7 A;  1YCY A;  2O4X A;  5CK9 A;  4L59 A;  2MPX C;  2HCK A;  2AZV A;  4KGX B;  2RN8 A;  1JXO A;  4LN2 A;  4M7A B;  4HCZ A;  3RER A;  3JCM J;  3X20 B;  1BYM A;  2DFU A;  2HBW A;  3JAM E;  1Y57 A;  2QA4 Q;  2RO0 A;  1R8O B;  4M78 A;  3M0R A;  4C0Z A;  1JJ2 P;  4RTU A;  1WXT A;  4NL2 A;  2J6F A;  3FB9 A;  4MDX A;  3M53 A;  3QDR B;  1XJW B;  2AKK A;  1K9M U;  5IXB A;  3EH2 A;  3UA6 A;  4XTY A;  2QA4 T;  3JCM X;  4O6J A;  2CP5 A;  1KC8 R;  1YIJ Q;  2EQU A;  1WHM A;  5A0D A;  3GNF B;  2M0O A;  2V8J A;  5IHI A;  3VRZ A;  4BI8 B;  4HCB A;  4FSX A;  2DVJ A;  4QQG A;  2GBQ A;  4RCB A;  1TUD A;  4RTW A;  3CC4 A;  1JXM A;  2ZCF B;  4RCC A;  2L3Q A;  1X6O A;  4M75 D;  4C92 E;  5IN1 A;  1S72 Q;  4FW1 A;  4OB0 B;  1VQ4 A;  4C8Q D;  7AT1 B;  4BDY A;  1VQK T;  3G4S A;  1JU5 C;  3EHQ A;  1W2B A;  1G8X A;  4R55 A;  2MWP A;  2RQT A;  2DD4 A;  2DRK A;  1X2Q A;  4PFZ A;  4CI0 C;  2SRC A;  1VQ5 T;  2VC8 A;  1VQ6 Q;  2LTO A;  4RTV A;  3I56 A;  4OF1 A;  3G7Z A;  1MV3 A;  1JJ2 A;  2EW3 A;  2P4T A;  8AT1 B;  2VGN A;  5GAM e;  4BE1 A;  2HMA A;  2DNU A;  4PJO D;  1GCQ C;  2E6N A;  1OPL A;  2LCS A;  1VA7 A;  2RI2 A;  1MMN A;  1Q81 C;  3G71 A;  5KYU A;  2YRD A;  5LJ5 j;  3I56 T;  4M78 G;  2WSC E;  3CC4 Q;  3HSB A;  2PQW A;  3I55 Q;  2XI9 A;  1MMG A;  2DIG A;  2P0Q A;  4XK8 E;  3RBB B;  2AT1 B;  1TWB A;  3LWH A;  2X35 A;  3C94 A;  3E19 A;  2B8A A;  4IIM A;  3QO3 A;  3OBY A;  2QQA A;  2PVO B;  3EFO B;  3EG3 A;  2HD0 A;  3L2W A;  1D1B A;  1T3S A;  3MPU B;  5GAM h;  2XU8 A;  1UUE A;  3D7S B;  4J9E A;  1UDL A;  2COY A;  4X1V A;  5GJW B;  2OX7 A;  5A2Q E;  4Y91 A;  1YJW Q;  4M7A A;  1ZSZ A;  1VQ8 A;  2OI3 A;  3OYN A;  2DVE A;  4QVZ A;  5KE2 A;  5GAO r;  3QUI A;  3AHU A;  2DXT A;  1PD0 A;  2EFI A;  3JB9 D;  4A54 A;  1IO6 A;  1C1A A;  5GMK i;  5I11 A;  5DLQ E;  4DBF A;  3CD6 A;  5IAY A;  1G2B A;  1NYG A;  5KYY A;  2RI3 A;  2JM9 A;  4M75 B;  2DL5 A;  4CC2 A;  5GAN h;  1TOV A;  2XG8 D;  4J9I A;  3I9Q A;  1M1K U;  4M7A C;  3PMT A;  2R58 A;  4Z8A A;  2EWN A;  2L8D A;  4PLI A;  4HCK A;  4JRK A;  1VQ6 A;  1IHW A;  2LQ8 A;  2COW A;  1X01 A;  2EGC A;  4DBQ A;  1LPL A;  3EFS A;  1EFN A;  2DYB A;  3OYJ A;  3OW2 A;  2GTJ A;  5IXF A;  3CPF A;  3MET A;  5LJ5 e;  1X6G A;  2KYM A;  4AT1 B;  4ORZ A;  3V8L A;  2ZPE B;  2AIR B;  1WPY A;  3CD6 Q;  3VUZ A;  3NMZ C;  3OS1 A;  1BIA A;  1VQL A;  3QBY A;  3SB2 A;  1K8A R;  5I2M A;  5LJ3 g;  3TRE A;  3CXC S;  1BKB A;  2QQ9 A;  4Q5W A;  2KRM A;  3RR6 A;  3VU3 C;  2ROT A;  1QVG S;  2JTE A;  5KYN A;  2KR3 A;  2RF0 A;  2I2L A;  3CC4 T;  2HZY A;  3FJP A;  1W70 A;  1WQ7 A;  3RMQ A;  3SHW A;  1HYO A;  2OJ2 A;  1ZX6 A;  2XMF A;  3MKD A;  1HD3 A;  3I55 A;  4D6W A;  1AZE A;  1TSF A;  4AG2 C;  4M7A G;  1SSF A;  1VQN T;  4LNP A;  2QAZ A;  4AG1 C;  5HKC A;  3CCU T;  3M55 A;  1Y96 A;  1PCX A;  1I5O B;  5GAN 6;  3V7C A;  4Z89 A;  3M4Y A;  4MDW A;  1UGP B;  1RAE B;  2KXD A;  4KUI A;  4GY5 A;  1QMC A;  3CBM A;  1ZA1 B;  2QEX T;  4KH1 B;  4OMM A;  3GOX A;  2ZPI B;  1VYT A;  2DZ9 A;  3VV0 A;  4PNO A;  1I81 A;  4C8Q E;  4OGC A;  2CZ1 B;  2GFA A;  3CCU A;  2J6K A;  1UEB A;  4EMG A;  1K9M R;  2COZ A;  5FU7 B;  4HVW A;  1WGS A;  2XIC A;  3X28 B;  4DA4 A;  2H8H A;  1WXU A;  2HBP A;  1QVF S;  1MUZ A;  3OYL A;  1LVK A;  3L2Z A;  4O5V A;  1VQ5 A;  3O8V A;  3CBO A;  3DLM A;  1WIE A;  1BK2 A;  2JZ2 A;  2L5Q A;  3QG1 A;  1M3B A;  4C0D B;  4FW2 A;  4ZGE B;  3VS4 A;  4OGE A;  1KK7 A;  2F2X A;  2RM4 A;  3RKX A;  2G6F X;  4M77 A;  3TCJ A;  2QA4 A;  5KYX A;  2QAS A;  2XD0 A;  4LDW A;  1PRM C;  4IUV A;  1RAF B;  1JJ2 S;  3CD6 T;  2DZC A;  1QQJ A;  1QKW A;  4OB3 B;  1OYX A;  2X3W D;  5IH2 A;  4F14 A;  1OEB A;  2KE9 A;  4PL6 A;  4R0K A;  4M7D C;  1QP2 A;  4E7Z A;  4OB2 B;  2ED0 A;  3CCU Q;  1K0X A;  3JCM d;  5J39 A;  1Z9Z A;  1OX9 A;  1NZ9 A;  4M7D B;  3PTA A;  3J81 E;  1M2V B;  1OPK A;  4FYY B;  1YJ9 T;  4BY6 B;  2DTH A;  4AFS C;  2K2M A;  5FRO A;  3M57 A;  2X51 A;  1UGV A;  4XTW A;  3CCR A;  1ZBJ A;  2KBT A;  1XNI A;  5AYF A;  2NUT B;  1VQL T;  1AWX A;  2R5M A;  2WSF E;  2FVU A;  4PK4 A;  1MGQ A;  1Q81 R;  4M77 G;  1QP3 A;  5GAN 5;  5GAN 7;  1Y07 A;  4AMC A;  1VQ5 Q;  1V29 B;  1D0X A;  1IB8 A;  4NS5 A;  1B3Q A;  4RMO A;  2DL3 A;  5KYW B;  2CS7 A;  2FPE A;  4DBR A;  5KH6 A;  2K2V A;  5LJ3 e;  2DRM A;  4PFP A;  2ABL A;  4C0F A;  4RG8 A;  3T9N A;  3CXC P;  4C8Q B;  1AWO A;  5I2S A;  1VIE A;  1WJQ A;  5KCH A;  1VUB A;  3JB9 G;  4RTT A;  5GAN j;  3EGD A;  4N0A A;  5GAN 3;  1U06 A;  2YXY A;  3OY9 A;  2DA9 A;  1YIJ T;  1D1A A;  3M0U A;  3OMC A;  2NUZ A;  2HAX A;  1PRL C;  1YHQ T;  2O01 E;  1YJW A;  5DLO A;  2LMJ A;  3V8K A;  4FYV B;  3CCR T;  5IT9 E;  2DD5 A;  1NYF A;  1M1G A;  2FB7 A;  1VQN Q;  3RMS A;  4HT8 A;  4F7U A;  1VQK Q;  4M77 C;  2AZS A;  2EJ9 A;  3JB9 H;  1SHG A;  3A8L B;  5GAN f;  2LQK A;  1RAA B;  2WSE E;  5KYY B;  4KGZ B;  1YHQ Q;  4RUG A;  3PT9 A;  3HPW A;  4QW2 A;  3G4S Q;  3CMA A;  4M78 C;  4LD6 A;  3EFO A;  2Y90 A;  1Q95 G;  4BD3 A;  5KE3 A;  1S72 A;  2KQW A;  4JZ3 A;  5J26 A;  5AT1 B;  1KD1 R;  4HVV A;  1QLY A;  3CCV T;  5CKH A;  2AKL A;  4HXJ A; 
#chains in the Genus database with same CATH homology
 3TVT A;  4A63 B;  2RQT A;  2DRK A;  3SEM A;  1X2Q A;  1UJ0 A;  3CQT A;  2DX1 A;  1UHC A;  3M0Q A;  2E5K A;  2D8H A;  2SRC A;  2YSQ A;  3VS1 A;  4LE9 A;  2SEM A;  3I35 A;  4Z88 A;  2O9V A;  4RTV A;  4OMO A;  3RNJ A;  1JQQ A;  5L23 A;  1MV3 A;  2JW4 A;  2EW3 A;  1QCF A;  1UG1 A;  2O88 A;  2MCN A;  1RLP C;  1KIK A;  3EHR A;  2DNU A;  2W0Z A;  1GCQ C;  1OPL A;  1AOJ A;  2LCS A;  1VA7 A;  1RI9 A;  5IHN A;  1VYU A;  1K9A A;  2RQW A;  3FJ5 A;  4JJD A;  2K6D A;  3JV3 A;  1YN8 A;  2CSI A;  3A98 A;  3I5S A;  3VS0 A;  2MIO A;  3UAT A;  4K11 A;  1I07 A;  2D1X A;  3KFV A;  3RBB B;  2J05 A;  3UF4 A;  1X43 A;  2ROL A;  1FYN A;  2VVK A;  1AWW A;  3M0S A;  4JJC A;  1ZLM A;  2CSQ A;  4IIM A;  1M8M A;  2RQV A;  3EG3 A;  2GGR A;  2FRY A;  1FMK A;  3C0C A;  1T3S A;  2DBM A;  4RTY A;  1UUE A;  2BZ8 A;  2AK5 A;  4J9E A;  1X6B A;  3REA B;  1UDL A;  2YUN A;  1HSQ A;  4X1V A;  5GJW B;  2B86 A;  5I22 A;  1SSH A;  1PNJ A;  2J06 A;  2YDL A;  2EQI A;  3PVL A;  2I0N A;  1GFD A;  2A36 A;  2OI3 A;  1NM7 A;  2KRN A;  1JO8 A;  4OMP A;  2P4R A;  1U3O A;  4DEY A;  1CKA A;  1GBR A;  1NEB A;  2J7I A;  1PKT A;  4F16 A;  1IO6 A;  4FSS A;  4GLM A;  2EPD A;  2JS2 A;  1AVZ C;  2C0I A;  2FG0 A;  5I11 A;  3EG2 A;  3R6N A;  1MV0 B;  1RUW A;  3H0H A;  1ZUU A;  1M27 C;  1G2B A;  1NYG A;  2JM9 A;  1YCS B;  2DL5 A;  4CC2 A;  2DL4 A;  2YUP A;  4J9I A;  3I9Q A;  1AZG B;  2C0O A;  1BB9 A;  2CH4 A;  4Z8A A;  2RNA A;  4HCK A;  2DBK A;  5IHK A;  1NG2 A;  1WYX A;  2RQU A;  1LCK A;  2EGC A;  2V1Q A;  5FWB A;  1EFN A;  2DYB A;  1QKX A;  2GTJ A;  1KFZ A;  2EBP A;  1CKB A;  5IXF A;  4J9H A;  4D8D A;  1E6H A;  2KNB B;  1X6G A;  2KYM A;  2ED1 A;  3REB B;  1SPK A;  3NGP A;  4ORZ A;  1I1J A;  1QWF A;  2A37 A;  1WLP B;  4JPB W;  3NMZ C;  3ZL7 C;  1W6X A;  2K3B A;  1S1N A;  2A08 A;  4J9C A;  1GFC A;  1PKS A;  2YT6 A;  2JMA A;  3H41 A;  3M0P A;  3VS7 A;  2KRM A;  2BZX A;  1Y0M A;  2ROT A;  4LUE A;  2JTE A;  2KR3 A;  2RF0 A;  1Z9Q A;  4ESR A;  2CUD A;  1W70 A;  1X69 A;  2LJ1 A;  4CC7 A;  2GNC A;  3SHW A;  2L3S A;  4AFQ C;  2OJ2 A;  2LQN A;  2OAW A;  2DM1 A;  1ZX6 A;  1E6G A;  5FWC A;  2XMF A;  4J9G A;  2EGA A;  1HD3 A;  2K7A A;  2FPD A;  2DL8 A;  3NHN A;  1AZE A;  4HVU A;  2LZ6 B;  4AG2 C;  2DIL A;  2BTT A;  4LNP A;  4AG1 C;  2GTO A;  2K9G A;  2X3X D;  2VWF A;  4Z89 A;  3UA7 A;  3U23 A;  2KXD A;  2LQW A;  2DF6 A;  1I0C A;  1WXB A;  1H92 A;  4OMM A;  2DJQ A;  3EHQ A;  3TSW A;  1AEY A;  1ZSG A;  1K0S A;  1N5Z A;  1VYT A;  3H0I A;  4OMQ A;  2F2W A;  1U5S A;  2J6K A;  2IIM A;  4HVW A;  1GCP A;  1PHT A;  2CH4 W;  2EVR A;  1H8K A;  2DL7 A;  2O9S A;  5HCK A;  1A0N B;  4ZNX A;  2H8H A;  1WXU A;  2EGE A;  2L3P A;  2YUQ A;  3VS2 A;  3NPF A;  4WCI A;  1MUZ A;  4OMN A;  1M30 A;  2KYB A;  1WIE A;  1BK2 A;  1X27 A;  1TG0 A;  2C0T A;  2K79 A;  1M3B A;  4J9B A;  1G83 A;  2EYW A;  2D0N A;  1WDX A;  3VS4 A;  3ULR B;  2DE0 X;  1ZUY A;  1YNZ A;  2F2X A;  2G6F X;  2KXC A;  4F17 A;  1J3T A;  4D8K A;  1ABO A;  1UE9 A;  1OV3 A;  1HJD A;  2PZ1 A;  1PRM C;  1QKW A;  4J9F A;  3THK A;  2VKN A;  1UJY A;  2X3W D;  5IH2 A;  2ENM A;  4F14 A;  1OEB A;  2KE9 A;  4M4Z A;  4R0K A;  4RTZ A;  1WA7 A;  1JEG A;  4E6R A;  3IQL A;  2KRO A;  2W10 A;  2ED0 A;  4OML A;  1K0X A;  1BU1 A;  2RPN A;  1Z9Z A;  2DLP A;  1WFW A;  1NLO C;  1E7O A;  3EG1 A;  1K1Z A;  1UEC A;  4CC4 B;  3TSZ A;  1NLP C;  1SRL A;  1OPK A;  2KT8 A;  1GCQ A;  2EYY A;  4AFS C;  3QWY A;  1SRM A;  2LNH B;  3QWX X;  2KGT A;  2K2M A;  4LUD A;  3EG0 A;  3I5R A;  1UGV A;  1T0H A;  3PE0 A;  2HDA A;  1ZBJ A;  1XOV A;  2JMC A;  2KBT A;  1KSW A;  3PVQ A;  2JS0 A;  1K76 A;  2FRW A;  1AWX A;  2DMO A;  2GQI A;  2V1R A;  1W1F A;  2EYX A;  1KJW A;  1T3L A;  2O31 A;  1CSK A;  1UHF A;  2LJ3 A;  2NWM A;  1H3H A;  1SHF A;  4EIK A;  2QDL A;  2FO0 A;  1X2K A;  1NEG A;  1QWE A;  1AD5 A;  3VRY A;  2EKH A;  1V1C A;  2CDT A;  3VS3 A;  3VS6 A;  1GBQ A;  1B3Q A;  2ECZ A;  2PNI A;  2DL3 A;  2HSP A;  4J9D A;  2CRE A;  2FPE A;  2BZY A;  2ESW A;  4CC3 A;  2A28 A;  2EYZ A;  2JT4 A;  2LX7 A;  5FW9 A;  1OOT A;  2RMO A;  2DRM A;  2MOX A;  1GRI A;  1T0J A;  4IIO A;  2JM8 A;  2ABL A;  2L0A A;  1ZUK A;  2FPF A;  2LP5 A;  2D8J A;  1AWO A;  2KT1 A;  4JZ4 A;  1VYV A;  2RQR A;  2KRS A;  2CT3 A;  3O5Z A;  3M0T A;  2LJ0 A;  1YP5 A;  1YWP A;  5EC7 A;  1M3A A;  4RTT A;  2HCK A;  2AZV A;  2RN8 A;  2HEQ A;  1JXO A;  3GBQ A;  4LN2 A;  1U06 A;  2J6O A;  2FEI A;  2DA9 A;  4DEX A;  2HBW A;  3VS5 A;  1Y57 A;  1WX6 A;  3M0U A;  2NUZ A;  1PRL C;  1GL5 A;  3M0R A;  1AWJ A;  4KRT A;  2M51 A;  5ECA A;  4RTU A;  2LMJ A;  1UFF A;  1WXT A;  1NYF A;  2J6F A;  1TUC A;  5GJV B;  1PWT A;  2AKK A;  4Y92 A;  3H0F A;  4GBQ A;  1B07 A;  2AZS A;  5IXB A;  1YWO A;  3LH5 A;  1SHG A;  4AFZ C;  3UA6 A;  4AFU C;  1WI7 A;  1M3C A;  2F2V A;  1BBZ A;  1RLQ C;  5IHI A;  4RUG A;  3VRZ A;  4JJB A;  2DVJ A;  2CT4 A;  1UTI A;  2GBQ A;  1TUD A;  4RTW A;  1JXM A;  4QT7 A;  2L3Q A;  2JXB A;  2O2O A;  2M0Y A;  3EGU A;  1ABQ A;  4JZ3 A;  2PTK A;  2CUB A;  1ARK A;  2YUO A;  1SEM A;  4HVV A;  4RTX A;  1QLY A;  2KEA A;  1JU5 C;  2L2P A;  1K4U S;  2AKL A;  4HXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...