2AZSA

Nmr structure of the n-terminal sh3 domain of drk (calculated without noe restraints)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2-SH3 adapter protein drk
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azsA00
5I22A 2ESWA 1G83A 1CSKA 1T0HA 2GQIA 2VVKA 4Z88A 4HXJA 4RTTA 1X2KA 2KXCA 1QLYA 3M0TA 2EYWA 2L3SA 3O5ZA 1V1CA 1WYXA 1OPKA 2HSPA 2AZVA 2KRNA 2M51A 2AZSA 4JJCA 1M8MA 1UGVA 1UHFA 2LQWA 1ABOA 2BZXA 1NLOC 1QWEA 1ZX6A 5FWBA 1B3QA 3UATA 1YCSB 1JXOA 1Z9ZA 1U3OA 3RNJA 2FPFA 2CH4A 1UJ0A 2D8HA 2EYYA 2M0YA 1J3TA 1SRLA 2EGCA 1OPLA 4AG1C 2FPEA 1CKAA 2JS2A 2DJQA 1VYTA 1JEGA 2L0AA 4K11A 2JS0A 1AWOA 4DEYA 1UG1A 1BK2A 3I9QA 1GFCA 5EC7A 1VA7A 2O9SA 2ECZA 5L23A 1E7OA 2RF0A 2LP5A 2V1RA 2J7IA 2SEMA 4RTYA 2DM1A 3M0RA 1JXMA 4F14A 2IIMA 1K0XA 4J9FA 3VS6A 1K76A 3REAB 1RLQC 2VWFA 2GTOA 3I5RA 1Y0MA 2YUQA 2LNHB 4GBQA 2FG0A 1ARKA 1AVZC 2FRYA 2A36A 1KIKA 2JM8A 2L2PA 3NHNA 4CC7A 4WCIA 1K9AA 1NYGA 1VYUA 2YDLA 4LNPA 2F2XA 2LMJA 2JM9A 5FWCA 2RMOA 2AKLA 1UHCA 1A0NB 1WXBA 1SHFA 2X3WD 2I0NA 2JW4A 2J6OA 2DL8A 2RQUA 1M27C 1X6BA 4CC2A 3H41A 2LJ0A 4AFUC 3EG0A 3ULRB 1UJYA 2DL3A 1H3HA 4R0KA 2JMCA 1MUZA 1AWWA 1SRMA 4HVVA 5GJWB 2FPDA 4Y92A 1MV0B 1T3SA 1WLPB 1BU1A 3VS1A 2LJ1A 2O9VA 4J9GA 3REBB 3LH5A 4JJBA 3VS3A 2KT8A 2D8JA 2K7AA 1Y57A 2ED1A 3TSZA 1S1NA 2EW3A 4D8KA 1PHTA 2FO0A 1ZUYA 1K4US 1UTIA 1QKXA 3UA6A 2CREA 5IXFA 2SRCA 3EG3A 1GBQA 4RUGA 1H92A 2GBQA 4GLMA 2K3BA 1SSHA 2DMOA 2EVRA 4F16A 2C0OA 4Z89A 2J6KA 3VS4A 1NEGA 3NGPA 1X27A 1SPKA 4AFSC 4RTUA 1AZGB 2GTJA 2RQWA 2F2VA 2CSIA 2NWMA 3KFVA 2YSQA 4AG2C 1UFFA 1KJWA 2DL5A 1AZEA 2BZ8A 2L3PA 1M30A 2ROTA 1ZLMA 2J06A 2RQRA 4ORZA 1BBZA 2XMFA 2JTEA 3ZL7C 1G2BA 2EQIA 3VS0A 4Z8AA 2DNUA 3SHWA 1HD3A 4F17A 2O2OA 1X6GA 1WDXA 2ENMA 1PRMC 3EGUA 1I07A 4RTVA 1TUCA 2DLPA 2EKHA 4ESRA 3C0CA 4OMMA 1WX6A 1E6GA 2KYBA 2PTKA 1B07A 2K2MA 4LN2A 2DF6A 3VRYA 1FMKA 2DYBA 2V1QA 2O31A 4X1VA 2JMAA 2DRMA 2HDAA 2RPNA 2FRWA 1NEBA 2OI3A 1X69A 4JZ3A 3TSWA 1HSQA 1RI9A 1YWOA 4RTWA 1SEMA 1ZUUA 2CT3A 3H0HA 1JO8A 3THKA 1PKTA 2BZYA 3VS5A 2KT1A 2ROLA 3RBBB 3IQLA 1UECA 2MIOA 2KE9A 1WXUA 2GNCA 2KXDA 4J9EA 2EPDA 2K79A 2A37A 1GCQA 1KFZA 1UE9A 2PNIA 4JPBW 3M0SA 2O88A 2KRSA 2D1XA 1I0CA 1X2QA 1QWFA 1YWPA 3VS2A 2YUOA 2KR3A 1JQQA 3VS7A 3UF4A 4A63B 2EGEA 1NYFA 2YT6A 2VKNA 2OJ2A 2CH4W 2FEIA 1AWJA 1I1JA 4HVUA 4D8DA 2RNAA 1FYNA 1X43A 1OEBA 3QWXX 2LZ6B 4J9CA 2EBPA 5IHKA 3NMZC 4J9BA 1OV3A 3H0FA 1LCKA 2W0ZA 2CUDA 2RN8A 2YUNA 2C0IA 1M3CA 3UA7A 2RQVA 2KBTA 1ZSGA 1K0SA 2X3XD 5HCKA 2KYMA 5IHIA 5IH2A 1T3LA 2A08A 2MOXA 3EHRA 3TVTA 4OMNA 2K9GA 4QT7A 1PRLC 1GBRA 1GFDA 2DBKA 2L3QA 2DILA 2HCKA 1UDLA 1YP5A 4OMPA 3PVQA 2DVJA 2E5KA 2LJ3A 1AWXA 1WI7A 1M3BA 4J9HA 4OMOA 4RTZA 3SEMA 2DRKA 1U06A 4J9DA 1Z9QA 4LUDA 3M0QA 1EFNA 2CUBA 2JXBA 1W70A 3FJ5A 2DL7A 2LX7A 3CQTA 4IIMA 2DA9A 5I11A 1AOJA 1XOVA 2B86A 2P4RA 2KROA 2CT4A 3A98A 4CC3A 1MV3A 1K1ZA 4AFZC 3EG1A 2DBMA 2J05A 2D0NA 3EG2A 1SHGA 4M4ZA 2LCSA 1JU5C 1NG2A 4HCKA 2OAWA 1E6HA 1RUWA 1W1FA 3H0IA 2GGRA 2DX1A 4JJDA 4J9IA 1YNZA 2AKKA 1TUDA 1ABQA 2QDLA 1GCPA 2ABLA 2EYZA 1UUEA 3M0UA 2YUPA 5GJVB 2F2WA 3GBQA 3R6NA 2KGTA 5ECAA 1GCQC 3PE0A 1NM7A 1RLPC 3I35A 2PZ1A 3VRZA 2C0TA 3U23A 1IO6A 2DE0X 2ED0A 2HBWA 4LUEA 2NUZA 1U5SA 4FSSA 4ZNXA 4KRTA 3EHQA 1PWTA 1GRIA 4LE9A 2KEAA 4RTXA 1ZUKA 3PVLA 1T0JA 4JZ4A 2JT4A 1H8KA 1PKSA 2HEQA 1M3AA 2EGAA 2J6FA 1YN8A 1OOTA 1TG0A 2EYXA 4HVWA 4AFQC 1CKBA 4DEXA 3NPFA 3JV3A 1BB9A 5FW9A 1PNJA 5IXBA 1QCFA 5IHNA 2LQNA 3QWYA 1W6XA 2AK5A 2BTTA 2DL4A 1QKWA 1GL5A 1NLPC 3I5SA 2CDTA 1N5ZA 1WA7A 2W10A 1AEYA 4IIOA 2K6DA 1AD5A 2CSQA 1HJDA 2G6FX 2KNBB 2MCNA 1WXTA 3M0PA 4OMQA 4E6RA 1VYVA 2A28A 2RQTA 1WIEA 1ZBJA 1KSWA 2KRMA 4CC4B 2H8HA 4EIKA 4OMLA 1WFWA
chains in the Genus database with same CATH superfamily
1JJ2P 1ZSZB 3EGXA 1FX7A 2GQIA 4HXJA 2KXCA 1K73C 1OPKA 1EIFA 2AZVA 2EFIA 1UGVA 4NL2A 4KULA 2ZPBB 3FEOA 2YXYA 2NLUA 5GANj 3DKMA 3OYCA 2X51A 1WHLA 1ZX6A 3BDUA 1OQKA 4Y91A 1B3QA 1Z9ZA 2D8HA 1YFNA 4ZTFA 1J3TA 5D6YA 3PFSA 3TCJA 4FIBA 5IN1A 2ZPIB 3DLLA 3JCMX 1LNXA 2RJCA 1KHCA 1VYTA 4M7AE 2CZ0B 4EMKB 3JCMg 2P4TA 2L0AA 2JS0A 3M58A 3I9QA 1GFCA 2VYTA 1VA7A 2BKDN 1E7OA 2RF0A 3GIBA 2RB6A 2J7IA 3M0RA 1KD1U 5IT9E 1IXDA 3CCQQ 3GPLA 2IIMA 4E7JA 4C92E 1VQ9T 4J9FA 3VS6A 3REAB 1KC8C 2VWFA 5GAOn 2LNHB 5EG2A 4PJNA 3ASKA 1ARKA 1AVZC 1B7TA 4QVCA 5LJ5f 3H9NA 3NHNA 4PJOA 4WCIA 1VYUA 4PJMA 4LNPA 2DFUA 1D1BA 2RI2A 2RMOA 3CCQA 5HK3A 3BFMA 1UHCA 1WXBA 4KUIA 8AT1B 1VQ6Q 2I0NA 2J6OA 3VUZA 4M7DG 3OYAA 4M77G 3VYHB 4RMOA 3HPWA 3MEAA 1AWWA 2YRDA 2M02A 4LDUA 4Y28E 3RKWA 5GMKl 2RHIA 5GJWB 4M7DD 4Y92A 4KUDK 4M77D 2DZCA 4KGZB 1VQ6A 4MZPA 2JTFA 3OSVA 2P0QA 2XHCA 2YRVA 2O9VA 3OQ5A 1U1TA 4IUVA 1VQNQ 1YITQ 3REBB 2QG9B 3VS3A 3H6ZA 2K7AA 2QGGA 1S1NA 1VIFA 1QMCA 1ZUYA 2ZPEB 3M54A 1V29B 3OY9A 1UTIA 5FROA 1LOJA 4OGCA 1M2VB 5AT1B 3EG3A 1YITA 1PG5B 1H92A 5GAN7 1IGUA 4F04B 4JRQA 2LVMA 4GLMA 3CXCA 2C0OA 2J6KA 2E5QA 2NUPA 4EDUA 4M7AF 4AFSC 1PSEA 2M1HA 3M56A 2GTJA 5GAN4 2CSIA 2NWMA 1VQOQ 4AT1B 4AG2C 3BY7A 2DEUA 2ROTA 2EKOA 2CKKA 3LWHA 1BBZA 2DTOA 3ZL7C 1WGSA 1G2BA 1Q7YU 2QQRA 4Z8AA 1Q81U 4C92F 1VQ5Q 3CC2A 4ZN3A 2DTIA 3CCQT 2ENMA 4X9CA 3TQ7P 3AT1B 5KYWB 4M78E 3UWNA 3RUXA 1WX6A 2RO0A 1E6GA 4C8QC 4LN2A 4F7UA 3EGDA 5FU7C 1Q82C 1VQ5A 1WHGA 1R8OB 1RABB 2DRMA 2RPNA 5LJ5e 2FRWA 1NEBA 5DY9A 4PFZA 1TOVA 3TSWA 2DXTA 1VQ6T 2DK3A 3CBPA 1ZUUA 3H0HA 1JO8A 3DB4A 3THKA 2EJ9A 2E1HA 5A2QE 2KT1A 1OYXA 2RH2A 1Y7XA 3RBBB 1VIEA 4OMFB 2OAUA 2MIOA 2XIDA 2QGFB 4OB0B 4A4HA 3CCJQ 2A37A 5DLQE 1QVPA 3OYDA 1MMNA 4HT8A 2CP2A 1YITT 4M7AB 1QWFA 3V7RA 4XQ3A 1VOMA 3VS2A 3TU4K 4LDXA 1JQQA 2JUFA 5CK9A 2EAYA 3CCJA 3META 4DQ2A 2CYZB 2CZ7B 2OJ2A 2O01E 2E65A 3MP8A 2RNAA 3MEWA 2LQKA 4ANJA 5KYUA 1OEBA 4LDYA 4C92B 1X75C 1BCOA 2EBPA 4XTWA 5IHKA 3NMZC 4XU3A 2E3IA 3OYBA 2W0ZA 2ZPGB 4OP0A 3MPUB 1FXXA 2RJEA 1ZSGA 3CC2T 2X3XD 5IHIA 2KYMA 3LW5E 4IUUA 3EHRA 2F69A 4OMNA 2K9GA 2YRCA 1GFDA 1WZOA 2DPPB 5HY6A 5LJ5g 1UDLA 1YP5A 2EQMA 2JZ2A 2VXFA 5J3BA 2LC4A 3PVQA 4FW2A 1VQ5T 2C06A 4TVRA 3M4GA 1M3BA 4M78F 3ZFJA 2E12A 4OMOA 3SEMA 1TSFA 4LUDA 3BDLA 4J9DA 1EFNA 1VQKA 1W70A 1U1SA 5GAN3 1M90U 3FJ5A 4E7LA 2DL7A 4A53A 2KK4A 5CKBA 2DA9A 1XJWB 1KC8R 5I11A 1XOVA 3CMAQ 1KG1A 3SD4A 3RKXA 5GAOl 1KQSA 1MV3A 1X01A 2O4XA 3QYHB 4BDZA 3BE3A 3RMQA 1ZSZC 3QSUA 4E7SA 3CCMQ 2OAWA 1B34A 3CMAA 1RUWA 1Q86C 4PJOC 3C12A 3LGLA 3CCJT 2F5TX 1GCPA 3C95A 2ABLA 3LYIA 2EYZA 2CZ6B 3UDCA 3CC4A 4M7DE 1UUEA 1RL2A 4M77E 1OU9A 2F2WA 5ECAA 2D0QB 1M1KR 1SF9A 1GCQC 3MHXA 2QDYB 1NM7A 1D3BB 2R58A 4NOYA 2RJDA 4LUEA 1PSFA 4FSSA 4ZNXA 3QG1A 4LE9A 3M5AA 4RTXA 3CCVQ 1ZUKA 1T0JA 4JZ4A 3J80E 1H8KA 3GNGA 3D7SB 4LXCA 1Y96A 2J6FA 1YN8A 2X35A 3CBMA 5AYFA 1TG0A 2BE9B 4M78B 3WVEB 2DVEA 1BB9A 5FW9A 1PNJA 5IXBA 1QCFA 1KQ1A 3MCAB 3QWYA 1W6XA 1WHHA 2AK5A 3CCVA 2HZYA 4E2FB 1UGQB 3I5SA 1G3WA 1M5Q1 2CDTA 3CPFA 2WSFE 2QA4Q 1HJDA 2G6FX 2IPOB 2MCNA 4OMQA 1FWZA 3M0PA 4RG2A 2HMAA 4E6RA 1WIEA 1EX4A 1ZBJA 4CC4B 1KQSP 2V8JA 2ESWA 3NTKA 5FU6C 1CSKA 2VVKA 4D6WA 3OW2S 1RAIB 2QA4A 3M55A 3O5ZA 3QUIA 2HSPA 2KRNA 4MDXA 1M2OA 2M51A 3HRSA 2AZSA 4N0AC 2LTOA 1M8MA 3CMAT 2Z0WA 1UHFA 2MAMA 2LQWA 4B9WA 5DM7R 1ABOA 2CP7A 4CRIA 1Q82R 2K57A 3CC4T 5CQXA 1K8AC 5LJ5j 2YHTA 2FPFA 2RD1A 2CH4A 1OX8A 1UJ0A 3ZBDA 1ZBXA 2EYYA 1DJ7B 3JCMQ 1VQ7Q 2EGCA 4AG1C 2A3LA 2DAQA 2JS2A 4M7DF 3J81E 4M77F 2CGHA 1JEGA 1N6AA 1VQPQ 5A0GA 1W4SA 1YHQQ 2JVVA 2FZCB 5GAMd 4BE1A 1N9RA 2DYIA 1BK2A 1VQ7A 4QQ6A 2RHXA 3OS2A 2LP5A 2V1RA 2PUKB 1YJ9Q 1VQPA 1BI0A 3CCVT 1YHQA 2HL5C 5KYXB 1K76A 2LT4A 2FG0A 1ZQ1A 1D1CA 3OBYA 1KIKA 5GAN5 3CCUA 2EQUA 1NYGA 3CCSQ 1YI2Q 2YDLA 2F2XA 2LMJA 4F7UE 5DLOA 1A0NB 3S3NA 5KCHA 3L2WA 4BI8B 4JJNK 1WNLA 2CP6A 4P5NA 2DL8A 1M27C 2KQWA 4CC2A 3H41A 2QQ9A 4FM4B 3BW1A 3ULRB 1UJYA 2QA4T 3A8MB 2DL3A 1WJSA 4X34A 2GFUA 2JMCA 4R0KA 3CCSA 1YI2A 4HVVA 2YLCA 3M9QA 1TS9A 5KH6A 2XG8D 1MV0B 4II1A 4JUVA 5FRNA 2OX7A 5A0DA 4FW1A 4C8QG 2XICA 3QO3A 4M75A 5CKHA 3VUBA 1Q7YC 5GAOq 4M7DB 5GMKh 2KT8A 4M77B 2ED1A 4MMLA 1N8RR 1PHTA 2FO0A 2LT1A 3SWNB 3NTIA 3L2UA 4C8QD 3UA6A 2SRCA 1GBQA 2NYSA 4BD3A 3JCMP 1SSHA 4M7AC 4V2SA 3CMEQ 1NEGA 1VQ7T 1VUBA 1VQMQ 4QVDA 2Y4YA 3E19A 4XTZA 4KBMB 2E64A 2RQWA 2F2VA 3VJPA 1VQPT 1RAAB 4BY6B 1YHQT 1KJWA 1AZEA 1EZZB 5J39A 2V26A 1SKUB 1NJIR 5IAYA 5GAMh 2EWNA 3CMEA 3C4SA 4ORZA 1VQMA 1G3SA 3CCLQ 1G8XA 2EQIA 3CCUT 3SHWA 1HD3A 4F17A 2JOYA 1YJ9T 3PIPA 2PUOB 1MMGA 1YJNQ 3EGUA 5CVIA 2EKHA 2FZGB 1I5OB 2H3EB 2VGNA 3AHUA 2NUTA 2K2MA 3CCLA 2KSSA 2DF6A 3CCST 1YI2T 2X4XA 2O31A 3OYKA 4X1VA 2JMAA 2CP5A 6AT1B 1OX9A 3QKJA 3EFRA 1ZSZA 1YJNA 4J6WA 1HSQA 4RTWA 3FIFA 1SEMA 2QEXQ 1X6OA 1PKTA 2E6NA 4LD6A 1UECA 2KXDA 2COYA 2B8AA 2HSEB 7AT1B 1GCQA 4HT9A 4Q5WA 2QEXA 1KFZA 2PNIA 4IUQA 2L5QA 2O88A 2KRSA 2D1XA 4JLIA 4C0DC 4AMCA 2EJFA 2WSCE 4A63B 5GMKi 4NL3A 1IHVA 2KI7A 2EGEA 1NYFA 3JAME 2VKNA 4EMKA 4XTYA 2D9TA 2QQAA 1BKBA 2CH4W 2FEIA 1AWJA 3MP6A 4LD9K 1FYNA 2QQSA 2K2VA 2LZ6B 4J9BA 3CMET 1OV3A 2XD0A 1VQMT 4PJOG 5LJ3d 2YUNA 2C0IA 1K8AR 4PNOA 2YLBA 1JJ2S 5HCKA 1T3LA 3JCMW 2M0OA 3TVTA 4QT7A 1PRLC 4XTUA 2FYKA 4PJOD 2DBKA 1W2BS 4OB1B 2HCKA 3CCLT 3CD6A 4GY5A 4OMPA 4HCBA 3Q1JA 3CC2Q 1YJNT 4WTOB 2V8IA 4J9HA 4MMKA 4N0AA 3OBWA 3GLXA 3M59A 2HNIA 1ACMB 3CBOA 1OZ3A 4PL6A 3G4SQ 1TU0B 2HBPA 4DBHA 2LX7A 1UGRB 5KE3A 2HKQB 3OS5A 2KAFA 2P4RA 5LJ5d 2AT1B 1MMDA 2CT4A 3A98A 2QEXT 1FMVA 2RM4A 1K1ZA 4AFZC 3G4SA 2MMPA 1SHGA 1I5LA 1BI2A 1JU5C 3OYJA 1E6HA 4FYXB 5KYYB 2GGRA 3CCRQ 4OVAA 2DX1A 4ZGJB 4N4HA 2AKKA 3OW2A 1RACB 1QVFS 3GNFB 4HA8A 1PC0A 4ZGEB 3GBQA 2KGTA 2CP0A 1QQJA 3PE0A 2QTXA 4HKEA 3S3MA 3T9NA 2A7YA 3VRZA 3VKIA 3CCRA 4PFOA 1RADB 2DE0X 2HBWA 4KGVB 4C0FA 3CXCP 2NUZA 1OZ2A 2K5LA 4ZN1A 4KRTA 3EHQA 2CS7A 1H641 2X4WA 1TWBA 3PVLA 2R5MA 3HP9A 4BUGA 4C8QE 4N4GA 3SB2A 2EGAA 1OOTA 4F7UG 3RMSA 4M75C 5LJ3h 4HVWA 1K73R 3FB9A 3CD6T 5C6SA 2L89A 2LQNA 2PQWA 1K9MC 5KYWA 3HFOA 1VQ8A 5I2MA 4FYVB 1WA7A 4R55A 4IIOA 2K6DA 1OULA 1WXTA 5GMKm 2MWOA 1KC8U 3M4YA 3EG9A 2XDDA 2JTMA 1FMWA 1G83A 2P0PA 1HK9A 1VQKQ 4B9XA 1WHMA 3G4ST 1X2KA 1QLYA 3GOXA 3HFNA 4ELZC 1QCOA 2DIGA 1WYXA 3G6EQ 3A1PA 3MP1A 2RHUA 2VXEA 2E6ZA 2X4YA 2EIFA 2BZXA 3WVDB 4M7AA 2PVOB 1NLOC 3PMIA 3KUFA 4C5HA 5GANd 3G6EA 1IB8A 4ME7A 1YCSB 1M1KU 3RNJA 1O75A 5HKCA 2M0YA 2EQKA 1NZ9A 3CCRT 1YBYA 1SRLA 1OPLA 2FPEA 1N9SA 1WJRA 5A0LA 3CC4Q 5I21A 4C92A 1S72A 4OF1A 2KDSA 4K11A 3OYHA 4J8OA 4DEYA 4IUPA 5EC7A 1MMAA 3OYIA 2ECZA 5L23A 3URGA 1IHWA 1WQ7A 2DM1A 4C8QF 1JXMA 4F14A 1VQ8T 1M1FA 1RAHB 1IREB 2I2LA 2GTOA 4GBQA 2CP3A 4WF2A 1Q95G 2FRYA 1XNIA 3QHSA 4KGXB 1YIJA 4PJLA 4CC7A 4XU1A 1BIBA 1M4ZA 2K3XA 3A8HB 2V8KA 4MDWA 4JRIA 2HQXA 3G7ZA 3LGFA 4EMKC 3HHTB 1SHFA 2JW4A 4R56A 2RQUA 1X6BA 2LJ0A 4FU6A 3EG0A 5GAMf 2HQEA 1MUZA 1I4K1 4PJOE 1SRMA 2E4HA 1GXIE 2YWWA 2DXBA 4QQDA 2FPDA 2BIVA 3I56Q 1VQKT 3EFOB 2QYZA 3VS1A 2LJ1A 1Q82U 3PNWC 1MGQA 1KQ2A 4MZMA 3G6ET 2QXFA 2D8JA 3TSZA 1Y57A 2EW3A 3H8ZA 3NFCA 3I55Q 3I56A 2ZGWA 2GF7A 1S72T 4IKFA 3M57A 1D0ZA 1AHJB 4DOVA 5GANh 3OYLA 3RDVA 1D3BA 2GBQA 3P8BB 2K3BA 1KD1C 3OA6A 4C8QB 4Z89A 3VS4A 3NGPA 4C5IA 3I55A 5FU7B 1X27A 3QPHA 2MYSA 1M1GA 1SPKA 4RTUA 4PLIA 1AZGB 2ZZDA 2M16A 2F5KA 3L42A 4YTLA 4B6MA 3S3OA 2E41A 2YSQA 3OB9A 1VQLQ 2DL5A 4M78A 2BZ8A 1M30A 2COZA 2QK0A 2XMFA 4DBFA 2JTEA 3E9GA 2LX9A 5GMKe 1R0BG 2DNUA 3X20B 1QP3A 2DERA 2RK2A 2JN0A 1WDXA 1VQLA 2WACA 3LWIA 1JB0E 2FB7A 4RTVA 1TUCA 3WXMB 4OMMA 3CCUQ 1B07A 4O6JA 1FMKA 3P8HA 2DYBA 1JJ2A 3FDRA 5D6XA 2OI3A 2D6FA 3QDRB 2GFAA 1RI9A 3PGGA 1YWOA 1W2BA 4Z02A 5GAOm 2E70A 3JCMd 2OTJQ 1XQHA 3VS5A 4PJOF 3EGXB 3INZA 2ZAEA 1K9MR 2DJZA 1BYMA 3GF5A 3IQLA 1D09B 3E9FA 2KE9A 2GNCA 5GAMe 1N8RU 3X24B 1UGPB 1N27A 3O8VA 3I56T 3CC7Q 1VQ4Q 2OTJA 1UGSB 4KH1B 3QDFA 2KMTA 3M0SA 4JPBW 3OYEA 1YWPA 2YUOA 3QJ6A 3CPWS 1R0CB 2HL3A 2KR3A 4L5GA 4OGEA 3VS7A 3I55T 2DZ9A 3C94A 3CC7A 1QVGS 2YT6A 1M8VA 1VQ4A 3QIIA 1I1JA 2K5IA 1X43A 2MK5A 9ATCB 1Q81C 1BCMA 3F70A 1HYOA 3M53A 1NJIU 3PT9A 1JRIA 3R6OA 4OB3B 2RN8A 1M3CA 2M9UA 1QVFA 3ER0A 1VQLT 2A08A 2MOXA 3PIOA 1C1AA 1GBRA 2E10A 5CCAA 2DETA 3DLMA 1ZHIA 3X25B 2XK0A 1HXDA 3JSCA 5HK0A 4ZGDB 3L2RA 4GLKA 5M9OA 1W2BP 1Q86R 2K3YA 4PJOB 1AWXA 1WI7A 1TUGB 3JB9H 3OMGA 5FRMA 4RTZA 4EMHA 1U06A 4VUBA 4RG8A 4C92C 4M75G 3M0QA 5CAIA 2CUBA 2DD4A 2JXBA 1BIAA 3A8OB 5GAMg 4QKUA 2LRQA 5LJ3f 2MI6A 4PJJA 2VB6A 2B86A 5CIUA 2X9HA 2KROA 3QZ9B 4M75D 2E3HA 4CC3A 4RCBA 1PM3A 2LDMA 2OTJT 3JCMh 3EG1A 2AIRB 4F7UF 4M7DA 4M77A 2D0NA 4QW2A 2LCSA 4HCKA 1OI1A 3SWNA 4DOWA 4E7KA 4KH0B 1QCNA 4J9IA 3CC7T 5KE2A 1VQ4T 3ZEHA 2QDLA 4C5GA 4L6V5 2XKOC 3M0UA 3X26B 5GJVB 1G3TA 1NBEB 2XI9A 1MHNA 4XTXA 1RLPC 3VU3C 2PZ1A 1QVFP 5I2SA 4XK8E 3TREA 1IO6A 4ZTJA 2ED0A 1K8AU 4J6YA 4PFPA 2NUPB 4UC4A 3HRUA 4X9DA 1PWTA 1GRIA 5GAN8 4FT2A 2R57A 3L2VA 2JNGA 4IURA 5FU6B 2ZPHB 3G1JA 2HEQA 2OTLQ 2P0KA 3FRNA 1M3AA 2R5AA 3SFMA 4HCZA 3V7CA 3OS1A 4FYYB 2DD5A 3VV0A 4DEXA 4XU0A 3JV3A 2RK1A 1D1AA 3OYYA 1M90C 3CCEQ 1I81A 1KD1R 1QKWA 1I8FA 1GL5A 2RHZA 4DBRA 2P84A 2OTLA 2VASA 1M1KC 1N5ZA 2MF2A 2VV5A 3LX7A 3RESA 3CD6Q 1PCXA 3HTRA 3RKYA 3CCEA 5CQYA 2LCLA 4F7UB 2RQTA 3EGDB 1KSWA 2KRMA 2H8HA 4EIKA 4OMLA 1WFWA 5I22A 4JS4A 1T0HA 1RAEB 4Z88A 4RTTA 3M0TA 5GMKj 2EYWA 2L3SA 3KBGA 4M78C 1V1CA 1VQNA 1QW1A 3LH0A 1OU8A 5GAOp 4JJCA 3A5ZB 5LJ3e 3FLGA 2VUBA 3P8DA 1TH7A 1RAFB 3JCMJ 3MJXA 4EPCA 5GAOr 2VC8A 1QWEA 2JJ9A 5FWBA 2RA2A 4E7HA 3JB9G 3V8LA 2CZ1B 1WJQA 3UATA 1JXOA 5CKFA 3MO8A 1U3OA 2PVDB 3JCMc 2BE7D 5L8RE 3S6WA 3N5BB 1CKAA 5D6WA 2DJQA 3JB9D 1IRXA 1D0YA 1VQOA 5GAMj 3OYFA 5GAN6 3QXEB 5KYUB 1AWOA 1UG1A 1M2VA 1K73U 2O9SA 4FCYA 2F1LA 5CKDA 1PD0A 2SEMA 4RTYA 5C0MA 2IG0A 1K0XA 3KXTA 4DBQA 1F1BB 2OTLT 1RLQC 3I5RA 5GANf 1Y0MA 2EQJA 2YUQA 3RIRA 3FJPA 3EG9B 2GCXA 3HL8A 2A36A 4J5YA 1Q7YR 2VGMA 2JM8A 2L2PA 2IVWA 1R77A 1K9AA 2XU8A 1Q81R 3CCET 2JM9A 5FWCA 1VQ8Q 2AKLA 2MPXC 4A4FA 4C5EA 1G3YA 2X3WD 3HSBA 3OYNA 4AFUC 4FL6A 1MNDA 1MNEA 2FL7A 1H3HA 5LJ3g 1VQNT 3RERA 5FLXE 3E1SA 8ATCB 4PK4A 4ATOA 3J7AF 4A54A 2COWA 3MEUA 1T3SA 1WLPB 5CR2A 4E47A 4QVZA 4C0ZA 1BU1A 1SG5A 1WPYA 4J9GA 1P92A 1RI0A 3OYMA 4KT0E 2O4XB 3LH5A 4JJBA 5KYYA 3X28B 4D8KA 4JRKA 1K4US 3QZ5B 1B34B 1ZA2B 1QKXA 5D7UA 2CREA 5IXFA 4O5VA 4RUGA 2HKNA 1VQOT 4M75E 3OW2P 1UEBA 2A0FB 2DMOA 2EVRA 4F16A 5LJ5h 1KK7A 2DXCA 2AHJB 2DXUA 2PVGB 3NTHA 1C6VX 2QI2A 4J6XA 1S72Q 4IUTA 3JCMV 5CO7A 3KFVA 1UFFA 3QYGB 3LLRA 2QTVA 3CPWA 3VYGA 2QASA 4J83A 2L3PA 4M7DC 1ZLMA 1N8RC 2J06A 4M77C 2RQRA 1QVGA 4A4EA 4BDYA 1TXQA 1Y96B 3VS0A 3SWNC 1WQWA 4BE2A 2H3JA 2O2OA 1X6GA 3G71Q 3SDZA 2PU9B 1PRMC 1TTHB 1I07A 2DLPA 4ESRA 3C0CA 4NS5A 4L59A 3OMCA 3UPUA 2KYBA 2PTKA 1YIJQ 5GANe 2QQBA 3VRYA 4C0DB 2V1QA 4BE0A 3G71A 2HDAA 2ZPFB 3QJYA 4PKCC 2DEQA 1X69A 4JZ3A 2DIQA 4BY6C 4M7AG 1M9SA 2CT3A 3JCMb 1NJIC 1D0XA 4BI3A 2BUDA 2RJFA 2BZYA 2Y4XA 4JS5A 4RKUE 1M90R 2DO3A 4JLGA 2ROLA 2EYQA 2FVUA 2G3RA 1WXUA 3CEYA 3EH1A 4J9EA 3CCMA 4M7AD 4BACA 2EJGA 3JB9J 4A4KA 3CXCS 4E7IA 3PTAA 1LVKA 2EPDA 2K79A 4BB7A 3V7SA 3A8GB 2ATCB 4C92G 5CKEA 1UE9A 2K4YA 1IGQA 4XTVA 1I0CA 4EMGA 1X2QA 3OSSC 4PLLA 4JDSA 3UF4A 4C92D 4FYWB 3V8KA 3CPWP 3JRZA 4M75F 4HVUA 1NPRA 3HKSA 3TEEA 1YCYA 4D8DA 3JCMf 1QVGP 1H3ZA 3QWXX 2XDPA 4J9CA 5LJ3j 2HD0A 1XTDA 2RHYA 3EH2A 3H0FA 1LCKA 1NE8A 2RI3A 2CUDA 3DB3A 4XAXB 4LDWA 3UA7A 2RQVA 3EFSA 2KBTA 2KY9A 4DA4A 1RAGB 3JB9I 1K0SA 5IH2A 3E2UA 1KHIA 2FHDA 5GANg 4QQGA 1V76A 2L3QA 2DILA 5J26A 4LDVA 2DVJA 3G71T 2LNVA 3HRTA 1U8RA 3RR6A 2HAXA 2E5KA 3PMTA 2LJ3A 2GQVA 4C0GA 1YJWQ 4A4GA 2DRKA 1SSFA 1Z9QA 2K5FA 1YIJT 1G5VA 3EAEA 1PD1A 1K9MU 4ELYC 5KCOA 1BI1A 2LQ8A 1O9SA 3CQTA 1BI3A 4IIMA 1IZ6A 3GP8A 1AOJA 3CCMT 4JRPA 3ME9A 5GAN2 1YJWA 3A8LB 3EFOA 2X4JA 1C0MA 3QBYA 1Y07A 2DBMA 2J05A 2LCCA 3EG2A 1WHJA 2KVQG 4M4ZA 4CI0C 3UT1A 1NG2A 4N4IA 4M75B 1W1FA 3H0IA 3OYGA 2RI5A 1LPLA 4JJDA 1YNZA 2WSEE 2QAZA 1TUDA 4FSXA 1ABQA 1AT1B 2XDBA 3L1AA 1NPPA 4M78G 2YUPA 3R6NA 4C8QA 2Y90A 2DTHA 1UB4A 1ZA1B 3I35A 2C0TA 3MEVA 1JBMA 4HCCA 4XU2A 3U23A 4E7ZA 4M78D 1QP2A 1LJOA 1U5SA 4J7FA 5KYNA 2KEAA 1YJ9A 2JT4A 1VQ9Q 1PKSA 3L2QA 3JCMe 2FZKB 2EYXA 4J7IA 4RCCA 3MKDA 4AFQC 1CKBA 2L8DA 3NPFA 2DKGA 2HQHA 3L2ZA 5IHNA 2DL4A 2BTTA 5LL6S 1Q86U 3JB9F 1NLPC 1VQ9A 4FT4A 1Y71A 2L3RA 2W10A 4BI4A 3OS0A 1KQSS 1AEYA 2ZCFB 1AD5A 2CSQA 4OB2B 3FC3A 2KNBB 4MZTA 3V8JA 2NUTB 5KYXA 2MWPA 1WHKA 1VYVA 2A28A 1YJWT
chains in the Genus database with same CATH topology
5I22A 2ESWA 1G83A 1CSKA 1T0HA 2GQIA 2VVKA 4Z88A 4HXJA 4RTTA 1X2KA 2KXCA 1QLYA 3M0TA 2EYWA 2L3SA 3O5ZA 1V1CA 1WYXA 1OPKA 2HSPA 2AZVA 2KRNA 2M51A 2AZSA 4JJCA 1M8MA 1UGVA 1UHFA 2LQWA 1ABOA 2BZXA 1NLOC 1QWEA 1ZX6A 5FWBA 1B3QA 3UATA 1YCSB 1JXOA 1Z9ZA 1U3OA 3RNJA 2FPFA 2CH4A 1UJ0A 2D8HA 2EYYA 2M0YA 1J3TA 1SRLA 2EGCA 1OPLA 4AG1C 2FPEA 1CKAA 2JS2A 2DJQA 1VYTA 1JEGA 2L0AA 4K11A 2JS0A 1AWOA 4DEYA 1UG1A 1BK2A 3I9QA 1GFCA 5EC7A 1VA7A 2O9SA 2ECZA 5L23A 1E7OA 2RF0A 2LP5A 2V1RA 2J7IA 2SEMA 4RTYA 2DM1A 3M0RA 1JXMA 4F14A 2IIMA 1K0XA 4J9FA 3VS6A 1K76A 3REAB 1RLQC 2VWFA 2GTOA 3I5RA 1Y0MA 2YUQA 2LNHB 4GBQA 2FG0A 1ARKA 1AVZC 2FRYA 2A36A 1KIKA 2JM8A 2L2PA 3NHNA 4CC7A 4WCIA 1K9AA 1NYGA 1VYUA 2YDLA 4LNPA 2F2XA 2LMJA 2JM9A 5FWCA 2RMOA 2AKLA 1UHCA 1A0NB 1WXBA 1SHFA 2X3WD 2I0NA 2JW4A 2J6OA 2DL8A 2RQUA 1M27C 1X6BA 4CC2A 3H41A 2LJ0A 4AFUC 3EG0A 3ULRB 1UJYA 2DL3A 1H3HA 4R0KA 2JMCA 1MUZA 1AWWA 1SRMA 4HVVA 5GJWB 2FPDA 4Y92A 1MV0B 1T3SA 1WLPB 1BU1A 3VS1A 2LJ1A 2O9VA 4J9GA 3REBB 3LH5A 4JJBA 3VS3A 2KT8A 2D8JA 2K7AA 1Y57A 2ED1A 3TSZA 1S1NA 2EW3A 4D8KA 1PHTA 2FO0A 1ZUYA 1K4US 1UTIA 1QKXA 3UA6A 2CREA 5IXFA 2SRCA 3EG3A 1GBQA 4RUGA 1H92A 2GBQA 4GLMA 2K3BA 1SSHA 2DMOA 2EVRA 4F16A 2C0OA 4Z89A 2J6KA 3VS4A 1NEGA 3NGPA 1X27A 1SPKA 4AFSC 4RTUA 1AZGB 2GTJA 2RQWA 2F2VA 2CSIA 2NWMA 3KFVA 2YSQA 4AG2C 1UFFA 1KJWA 2DL5A 1AZEA 2BZ8A 2L3PA 1M30A 2ROTA 1ZLMA 2J06A 2RQRA 4ORZA 1BBZA 2XMFA 2JTEA 3ZL7C 1G2BA 2EQIA 3VS0A 4Z8AA 2DNUA 3SHWA 1HD3A 4F17A 2O2OA 1X6GA 1WDXA 2ENMA 1PRMC 3EGUA 1I07A 4RTVA 1TUCA 2DLPA 2EKHA 4ESRA 3C0CA 4OMMA 1WX6A 1E6GA 2KYBA 2PTKA 1B07A 2K2MA 4LN2A 2DF6A 3VRYA 1FMKA 2DYBA 2V1QA 2O31A 4X1VA 2JMAA 2DRMA 2HDAA 2RPNA 2FRWA 1NEBA 2OI3A 1X69A 4JZ3A 3TSWA 1HSQA 1RI9A 1YWOA 4RTWA 1SEMA 1ZUUA 2CT3A 3H0HA 1JO8A 3THKA 1PKTA 2BZYA 3VS5A 2KT1A 2ROLA 3RBBB 3IQLA 1UECA 2MIOA 2KE9A 1WXUA 2GNCA 2KXDA 4J9EA 2EPDA 2K79A 2A37A 1GCQA 1KFZA 1UE9A 2PNIA 4JPBW 3M0SA 2O88A 2KRSA 2D1XA 1I0CA 1X2QA 1QWFA 1YWPA 3VS2A 2YUOA 2KR3A 1JQQA 3VS7A 3UF4A 4A63B 2EGEA 1NYFA 2YT6A 2VKNA 2OJ2A 2CH4W 2FEIA 1AWJA 1I1JA 4HVUA 4D8DA 2RNAA 1FYNA 1X43A 1OEBA 3QWXX 2LZ6B 4J9CA 2EBPA 5IHKA 3NMZC 4J9BA 1OV3A 3H0FA 1LCKA 2W0ZA 2CUDA 2RN8A 2YUNA 2C0IA 1M3CA 3UA7A 2RQVA 2KBTA 1ZSGA 1K0SA 2X3XD 5HCKA 2KYMA 5IHIA 5IH2A 1T3LA 2A08A 2MOXA 3EHRA 3TVTA 4OMNA 2K9GA 4QT7A 1PRLC 1GBRA 1GFDA 2DBKA 2L3QA 2DILA 2HCKA 1UDLA 1YP5A 4OMPA 3PVQA 2DVJA 2E5KA 2LJ3A 1AWXA 1WI7A 1M3BA 4J9HA 4OMOA 4RTZA 3SEMA 2DRKA 1U06A 4J9DA 1Z9QA 4LUDA 3M0QA 1EFNA 2CUBA 2JXBA 1W70A 3FJ5A 2DL7A 2LX7A 3CQTA 4IIMA 2DA9A 5I11A 1AOJA 1XOVA 2B86A 2P4RA 2KROA 2CT4A 3A98A 4CC3A 1MV3A 1K1ZA 4AFZC 3EG1A 2DBMA 2J05A 2D0NA 3EG2A 1SHGA 4M4ZA 2LCSA 1JU5C 1NG2A 4HCKA 2OAWA 1E6HA 1RUWA 1W1FA 3H0IA 2GGRA 2DX1A 4JJDA 4J9IA 1YNZA 2AKKA 1TUDA 1ABQA 2QDLA 1GCPA 2ABLA 2EYZA 1UUEA 3M0UA 2YUPA 5GJVB 2F2WA 3GBQA 3R6NA 2KGTA 5ECAA 1GCQC 3PE0A 1NM7A 1RLPC 3I35A 2PZ1A 3VRZA 2C0TA 3U23A 1IO6A 2DE0X 2ED0A 2HBWA 4LUEA 2NUZA 1U5SA 4FSSA 4ZNXA 4KRTA 3EHQA 1PWTA 1GRIA 4LE9A 2KEAA 4RTXA 1ZUKA 3PVLA 1T0JA 4JZ4A 2JT4A 1H8KA 1PKSA 2HEQA 1M3AA 2EGAA 2J6FA 1YN8A 1OOTA 1TG0A 2EYXA 4HVWA 4AFQC 1CKBA 4DEXA 3NPFA 3JV3A 1BB9A 5FW9A 1PNJA 5IXBA 1QCFA 5IHNA 2LQNA 3QWYA 1W6XA 2AK5A 2BTTA 2DL4A 1QKWA 1GL5A 1NLPC 3I5SA 2CDTA 1N5ZA 1WA7A 2W10A 1AEYA 4IIOA 2K6DA 1AD5A 2CSQA 1HJDA 2G6FX 2KNBB 2MCNA 1WXTA 3M0PA 4OMQA 4E6RA 1VYVA 2A28A 2RQTA 1WIEA 1ZBJA 1KSWA 2KRMA 4CC4B 2H8HA 4EIKA 4OMLA 1WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I22 A;  2ESW A;  1G83 A;  1CSK A;  1T0H A;  2GQI A;  2VVK A;  4Z88 A;  4HXJ A;  4RTT A;  1X2K A;  2KXC A;  1QLY A;  3M0T A;  2EYW A;  2L3S A;  3O5Z A;  1V1C A;  1WYX A;  1OPK A;  2HSP A;  2AZV A;  2KRN A;  2M51 A;  2AZS A;  4JJC A;  1M8M A;  1UGV A;  1UHF A;  2LQW A;  1ABO A;  2BZX A;  1NLO C;  1QWE A;  1ZX6 A;  5FWB A;  1B3Q A;  3UAT A;  1YCS B;  1JXO A;  1Z9Z A;  1U3O A;  3RNJ A;  2FPF A;  2CH4 A;  1UJ0 A;  2D8H A;  2EYY A;  2M0Y A;  1J3T A;  1SRL A;  2EGC A;  1OPL A;  4AG1 C;  2FPE A;  1CKA A;  2JS2 A;  2DJQ A;  1VYT A;  1JEG A;  2L0A A;  4K11 A;  2JS0 A;  1AWO A;  4DEY A;  1UG1 A;  1BK2 A;  3I9Q A;  1GFC A;  5EC7 A;  1VA7 A;  2O9S A;  2ECZ A;  5L23 A;  1E7O A;  2RF0 A;  2LP5 A;  2V1R A;  2J7I A;  2SEM A;  4RTY A;  2DM1 A;  3M0R A;  1JXM A;  4F14 A;  2IIM A;  1K0X A;  4J9F A;  3VS6 A;  1K76 A;  3REA B;  1RLQ C;  2VWF A;  2GTO A;  3I5R A;  1Y0M A;  2YUQ A;  2LNH B;  4GBQ A;  2FG0 A;  1ARK A;  1AVZ C;  2FRY A;  2A36 A;  1KIK A;  2JM8 A;  2L2P A;  3NHN A;  4CC7 A;  4WCI A;  1K9A A;  1NYG A;  1VYU A;  2YDL A;  4LNP A;  2F2X A;  2LMJ A;  2JM9 A;  5FWC A;  2RMO A;  2AKL A;  1UHC A;  1A0N B;  1WXB A;  1SHF A;  2X3W D;  2I0N A;  2JW4 A;  2J6O A;  2DL8 A;  2RQU A;  1M27 C;  1X6B A;  4CC2 A;  3H41 A;  2LJ0 A;  4AFU C;  3EG0 A;  3ULR B;  1UJY A;  2DL3 A;  1H3H A;  4R0K A;  2JMC A;  1MUZ A;  1AWW A;  1SRM A;  4HVV A;  5GJW B;  2FPD A;  4Y92 A;  1MV0 B;  1T3S A;  1WLP B;  1BU1 A;  3VS1 A;  2LJ1 A;  2O9V A;  4J9G A;  3REB B;  3LH5 A;  4JJB A;  3VS3 A;  2KT8 A;  2D8J A;  2K7A A;  1Y57 A;  2ED1 A;  3TSZ A;  1S1N A;  2EW3 A;  4D8K A;  1PHT A;  2FO0 A;  1ZUY A;  1K4U S;  1UTI A;  1QKX A;  3UA6 A;  2CRE A;  5IXF A;  2SRC A;  3EG3 A;  1GBQ A;  4RUG A;  1H92 A;  2GBQ A;  4GLM A;  2K3B A;  1SSH A;  2DMO A;  2EVR A;  4F16 A;  2C0O A;  4Z89 A;  2J6K A;  3VS4 A;  1NEG A;  3NGP A;  1X27 A;  1SPK A;  4AFS C;  4RTU A;  1AZG B;  2GTJ A;  2RQW A;  2F2V A;  2CSI A;  2NWM A;  3KFV A;  2YSQ A;  4AG2 C;  1UFF A;  1KJW A;  2DL5 A;  1AZE A;  2BZ8 A;  2L3P A;  1M30 A;  2ROT A;  1ZLM A;  2J06 A;  2RQR A;  4ORZ A;  1BBZ A;  2XMF A;  2JTE A;  3ZL7 C;  1G2B A;  2EQI A;  3VS0 A;  4Z8A A;  2DNU A;  3SHW A;  1HD3 A;  4F17 A;  2O2O A;  1X6G A;  1WDX A;  2ENM A;  1PRM C;  3EGU A;  1I07 A;  4RTV A;  1TUC A;  2DLP A;  2EKH A;  4ESR A;  3C0C A;  4OMM A;  1WX6 A;  1E6G A;  2KYB A;  2PTK A;  1B07 A;  2K2M A;  4LN2 A;  2DF6 A;  3VRY A;  1FMK A;  2DYB A;  2V1Q A;  2O31 A;  4X1V A;  2JMA A;  2DRM A;  2HDA A;  2RPN A;  2FRW A;  1NEB A;  2OI3 A;  1X69 A;  4JZ3 A;  3TSW A;  1HSQ A;  1RI9 A;  1YWO A;  4RTW A;  1SEM A;  1ZUU A;  2CT3 A;  3H0H A;  1JO8 A;  3THK A;  1PKT A;  2BZY A;  3VS5 A;  2KT1 A;  2ROL A;  3RBB B;  3IQL A;  1UEC A;  2MIO A;  2KE9 A;  1WXU A;  2GNC A;  2KXD A;  4J9E A;  2EPD A;  2K79 A;  2A37 A;  1GCQ A;  1KFZ A;  1UE9 A;  2PNI A;  4JPB W;  3M0S A;  2O88 A;  2KRS A;  2D1X A;  1I0C A;  1X2Q A;  1QWF A;  1YWP A;  3VS2 A;  2YUO A;  2KR3 A;  1JQQ A;  3VS7 A;  3UF4 A;  4A63 B;  2EGE A;  1NYF A;  2YT6 A;  2VKN A;  2OJ2 A;  2CH4 W;  2FEI A;  1AWJ A;  1I1J A;  4HVU A;  4D8D A;  2RNA A;  1FYN A;  1X43 A;  1OEB A;  3QWX X;  2LZ6 B;  4J9C A;  2EBP A;  5IHK A;  3NMZ C;  4J9B A;  1OV3 A;  3H0F A;  1LCK A;  2W0Z A;  2CUD A;  2RN8 A;  2YUN A;  2C0I A;  1M3C A;  3UA7 A;  2RQV A;  2KBT A;  1ZSG A;  1K0S A;  2X3X D;  5HCK A;  2KYM A;  5IHI A;  5IH2 A;  1T3L A;  2A08 A;  2MOX A;  3EHR A;  3TVT A;  4OMN A;  2K9G A;  4QT7 A;  1PRL C;  1GBR A;  1GFD A;  2DBK A;  2L3Q A;  2DIL A;  2HCK A;  1UDL A;  1YP5 A;  4OMP A;  3PVQ A;  2DVJ A;  2E5K A;  2LJ3 A;  1AWX A;  1WI7 A;  1M3B A;  4J9H A;  4OMO A;  4RTZ A;  3SEM A;  2DRK A;  1U06 A;  4J9D A;  1Z9Q A;  4LUD A;  3M0Q A;  1EFN A;  2CUB A;  2JXB A;  1W70 A;  3FJ5 A;  2DL7 A;  2LX7 A;  3CQT A;  4IIM A;  2DA9 A;  5I11 A;  1AOJ A;  1XOV A;  2B86 A;  2P4R A;  2KRO A;  2CT4 A;  3A98 A;  4CC3 A;  1MV3 A;  1K1Z A;  4AFZ C;  3EG1 A;  2DBM A;  2J05 A;  2D0N A;  3EG2 A;  1SHG A;  4M4Z A;  2LCS A;  1JU5 C;  1NG2 A;  4HCK A;  2OAW A;  1E6H A;  1RUW A;  1W1F A;  3H0I A;  2GGR A;  2DX1 A;  4JJD A;  4J9I A;  1YNZ A;  2AKK A;  1TUD A;  1ABQ A;  2QDL A;  1GCP A;  2ABL A;  2EYZ A;  1UUE A;  3M0U A;  2YUP A;  5GJV B;  2F2W A;  3GBQ A;  3R6N A;  2KGT A;  5ECA A;  1GCQ C;  3PE0 A;  1NM7 A;  1RLP C;  3I35 A;  2PZ1 A;  3VRZ A;  2C0T A;  3U23 A;  1IO6 A;  2DE0 X;  2ED0 A;  2HBW A;  4LUE A;  2NUZ A;  1U5S A;  4FSS A;  4ZNX A;  4KRT A;  3EHQ A;  1PWT A;  1GRI A;  4LE9 A;  2KEA A;  4RTX A;  1ZUK A;  3PVL A;  1T0J A;  4JZ4 A;  2JT4 A;  1H8K A;  1PKS A;  2HEQ A;  1M3A A;  2EGA A;  2J6F A;  1YN8 A;  1OOT A;  1TG0 A;  2EYX A;  4HVW A;  4AFQ C;  1CKB A;  4DEX A;  3NPF A;  3JV3 A;  1BB9 A;  5FW9 A;  1PNJ A;  5IXB A;  1QCF A;  5IHN A;  2LQN A;  3QWY A;  1W6X A;  2AK5 A;  2BTT A;  2DL4 A;  1QKW A;  1GL5 A;  1NLP C;  3I5S A;  2CDT A;  1N5Z A;  1WA7 A;  2W10 A;  1AEY A;  4IIO A;  2K6D A;  1AD5 A;  2CSQ A;  1HJD A;  2G6F X;  2KNB B;  2MCN A;  1WXT A;  3M0P A;  4OMQ A;  4E6R A;  1VYV A;  2A28 A;  2RQT A;  1WIE A;  1ZBJ A;  1KSW A;  2KRM A;  4CC4 B;  2H8H A;  4EIK A;  4OML A;  1WFW A; 
#chains in the Genus database with same CATH topology
 1JJ2 P;  1ZSZ B;  3EGX A;  1FX7 A;  2GQI A;  4HXJ A;  2KXC A;  1K73 C;  1OPK A;  1EIF A;  2AZV A;  2EFI A;  1UGV A;  4NL2 A;  4KUL A;  2ZPB B;  3FEO A;  2YXY A;  2NLU A;  5GAN j;  3DKM A;  3OYC A;  2X51 A;  1WHL A;  1ZX6 A;  3BDU A;  1OQK A;  4Y91 A;  1B3Q A;  1Z9Z A;  2D8H A;  1YFN A;  4ZTF A;  1J3T A;  5D6Y A;  3PFS A;  3TCJ A;  4FIB A;  5IN1 A;  2ZPI B;  3DLL A;  3JCM X;  1LNX A;  2RJC A;  1KHC A;  1VYT A;  4M7A E;  2CZ0 B;  4EMK B;  3JCM g;  2P4T A;  2L0A A;  2JS0 A;  3M58 A;  3I9Q A;  1GFC A;  2VYT A;  1VA7 A;  2BKD N;  1E7O A;  2RF0 A;  3GIB A;  2RB6 A;  2J7I A;  3M0R A;  1KD1 U;  5IT9 E;  1IXD A;  3CCQ Q;  3GPL A;  2IIM A;  4E7J A;  4C92 E;  1VQ9 T;  4J9F A;  3VS6 A;  3REA B;  1KC8 C;  2VWF A;  5GAO n;  2LNH B;  5EG2 A;  4PJN A;  3ASK A;  1ARK A;  1AVZ C;  1B7T A;  4QVC A;  5LJ5 f;  3H9N A;  3NHN A;  4PJO A;  4WCI A;  1VYU A;  4PJM A;  4LNP A;  2DFU A;  1D1B A;  2RI2 A;  2RMO A;  3CCQ A;  5HK3 A;  3BFM A;  1UHC A;  1WXB A;  4KUI A;  8AT1 B;  1VQ6 Q;  2I0N A;  2J6O A;  3VUZ A;  4M7D G;  3OYA A;  4M77 G;  3VYH B;  4RMO A;  3HPW A;  3MEA A;  1AWW A;  2YRD A;  2M02 A;  4LDU A;  4Y28 E;  3RKW A;  5GMK l;  2RHI A;  5GJW B;  4M7D D;  4Y92 A;  4KUD K;  4M77 D;  2DZC A;  4KGZ B;  1VQ6 A;  4MZP A;  2JTF A;  3OSV A;  2P0Q A;  2XHC A;  2YRV A;  2O9V A;  3OQ5 A;  1U1T A;  4IUV A;  1VQN Q;  1YIT Q;  3REB B;  2QG9 B;  3VS3 A;  3H6Z A;  2K7A A;  2QGG A;  1S1N A;  1VIF A;  1QMC A;  1ZUY A;  2ZPE B;  3M54 A;  1V29 B;  3OY9 A;  1UTI A;  5FRO A;  1LOJ A;  4OGC A;  1M2V B;  5AT1 B;  3EG3 A;  1YIT A;  1PG5 B;  1H92 A;  5GAN 7;  1IGU A;  4F04 B;  4JRQ A;  2LVM A;  4GLM A;  3CXC A;  2C0O A;  2J6K A;  2E5Q A;  2NUP A;  4EDU A;  4M7A F;  4AFS C;  1PSE A;  2M1H A;  3M56 A;  2GTJ A;  5GAN 4;  2CSI A;  2NWM A;  1VQO Q;  4AT1 B;  4AG2 C;  3BY7 A;  2DEU A;  2ROT A;  2EKO A;  2CKK A;  3LWH A;  1BBZ A;  2DTO A;  3ZL7 C;  1WGS A;  1G2B A;  1Q7Y U;  2QQR A;  4Z8A A;  1Q81 U;  4C92 F;  1VQ5 Q;  3CC2 A;  4ZN3 A;  2DTI A;  3CCQ T;  2ENM A;  4X9C A;  3TQ7 P;  3AT1 B;  5KYW B;  4M78 E;  3UWN A;  3RUX A;  1WX6 A;  2RO0 A;  1E6G A;  4C8Q C;  4LN2 A;  4F7U A;  3EGD A;  5FU7 C;  1Q82 C;  1VQ5 A;  1WHG A;  1R8O B;  1RAB B;  2DRM A;  2RPN A;  5LJ5 e;  2FRW A;  1NEB A;  5DY9 A;  4PFZ A;  1TOV A;  3TSW A;  2DXT A;  1VQ6 T;  2DK3 A;  3CBP A;  1ZUU A;  3H0H A;  1JO8 A;  3DB4 A;  3THK A;  2EJ9 A;  2E1H A;  5A2Q E;  2KT1 A;  1OYX A;  2RH2 A;  1Y7X A;  3RBB B;  1VIE A;  4OMF B;  2OAU A;  2MIO A;  2XID A;  2QGF B;  4OB0 B;  4A4H A;  3CCJ Q;  2A37 A;  5DLQ E;  1QVP A;  3OYD A;  1MMN A;  4HT8 A;  2CP2 A;  1YIT T;  4M7A B;  1QWF A;  3V7R A;  4XQ3 A;  1VOM A;  3VS2 A;  3TU4 K;  4LDX A;  1JQQ A;  2JUF A;  5CK9 A;  2EAY A;  3CCJ A;  3MET A;  4DQ2 A;  2CYZ B;  2CZ7 B;  2OJ2 A;  2O01 E;  2E65 A;  3MP8 A;  2RNA A;  3MEW A;  2LQK A;  4ANJ A;  5KYU A;  1OEB A;  4LDY A;  4C92 B;  1X75 C;  1BCO A;  2EBP A;  4XTW A;  5IHK A;  3NMZ C;  4XU3 A;  2E3I A;  3OYB A;  2W0Z A;  2ZPG B;  4OP0 A;  3MPU B;  1FXX A;  2RJE A;  1ZSG A;  3CC2 T;  2X3X D;  5IHI A;  2KYM A;  3LW5 E;  4IUU A;  3EHR A;  2F69 A;  4OMN A;  2K9G A;  2YRC A;  1GFD A;  1WZO A;  2DPP B;  5HY6 A;  5LJ5 g;  1UDL A;  1YP5 A;  2EQM A;  2JZ2 A;  2VXF A;  5J3B A;  2LC4 A;  3PVQ A;  4FW2 A;  1VQ5 T;  2C06 A;  4TVR A;  3M4G A;  1M3B A;  4M78 F;  3ZFJ A;  2E12 A;  4OMO A;  3SEM A;  1TSF A;  4LUD A;  3BDL A;  4J9D A;  1EFN A;  1VQK A;  1W70 A;  1U1S A;  5GAN 3;  1M90 U;  3FJ5 A;  4E7L A;  2DL7 A;  4A53 A;  2KK4 A;  5CKB A;  2DA9 A;  1XJW B;  1KC8 R;  5I11 A;  1XOV A;  3CMA Q;  1KG1 A;  3SD4 A;  3RKX A;  5GAO l;  1KQS A;  1MV3 A;  1X01 A;  2O4X A;  3QYH B;  4BDZ A;  3BE3 A;  3RMQ A;  1ZSZ C;  3QSU A;  4E7S A;  3CCM Q;  2OAW A;  1B34 A;  3CMA A;  1RUW A;  1Q86 C;  4PJO C;  3C12 A;  3LGL A;  3CCJ T;  2F5T X;  1GCP A;  3C95 A;  2ABL A;  3LYI A;  2EYZ A;  2CZ6 B;  3UDC A;  3CC4 A;  4M7D E;  1UUE A;  1RL2 A;  4M77 E;  1OU9 A;  2F2W A;  5ECA A;  2D0Q B;  1M1K R;  1SF9 A;  1GCQ C;  3MHX A;  2QDY B;  1NM7 A;  1D3B B;  2R58 A;  4NOY A;  2RJD A;  4LUE A;  1PSF A;  4FSS A;  4ZNX A;  3QG1 A;  4LE9 A;  3M5A A;  4RTX A;  3CCV Q;  1ZUK A;  1T0J A;  4JZ4 A;  3J80 E;  1H8K A;  3GNG A;  3D7S B;  4LXC A;  1Y96 A;  2J6F A;  1YN8 A;  2X35 A;  3CBM A;  5AYF A;  1TG0 A;  2BE9 B;  4M78 B;  3WVE B;  2DVE A;  1BB9 A;  5FW9 A;  1PNJ A;  5IXB A;  1QCF A;  1KQ1 A;  3MCA B;  3QWY A;  1W6X A;  1WHH A;  2AK5 A;  3CCV A;  2HZY A;  4E2F B;  1UGQ B;  3I5S A;  1G3W A;  1M5Q 1;  2CDT A;  3CPF A;  2WSF E;  2QA4 Q;  1HJD A;  2G6F X;  2IPO B;  2MCN A;  4OMQ A;  1FWZ A;  3M0P A;  4RG2 A;  2HMA A;  4E6R A;  1WIE A;  1EX4 A;  1ZBJ A;  4CC4 B;  1KQS P;  2V8J A;  2ESW A;  3NTK A;  5FU6 C;  1CSK A;  2VVK A;  4D6W A;  3OW2 S;  1RAI B;  2QA4 A;  3M55 A;  3O5Z A;  3QUI A;  2HSP A;  2KRN A;  4MDX A;  1M2O A;  2M51 A;  3HRS A;  2AZS A;  4N0A C;  2LTO A;  1M8M A;  3CMA T;  2Z0W A;  1UHF A;  2MAM A;  2LQW A;  4B9W A;  5DM7 R;  1ABO A;  2CP7 A;  4CRI A;  1Q82 R;  2K57 A;  3CC4 T;  5CQX A;  1K8A C;  5LJ5 j;  2YHT A;  2FPF A;  2RD1 A;  2CH4 A;  1OX8 A;  1UJ0 A;  3ZBD A;  1ZBX A;  2EYY A;  1DJ7 B;  3JCM Q;  1VQ7 Q;  2EGC A;  4AG1 C;  2A3L A;  2DAQ A;  2JS2 A;  4M7D F;  3J81 E;  4M77 F;  2CGH A;  1JEG A;  1N6A A;  1VQP Q;  5A0G A;  1W4S A;  1YHQ Q;  2JVV A;  2FZC B;  5GAM d;  4BE1 A;  1N9R A;  2DYI A;  1BK2 A;  1VQ7 A;  4QQ6 A;  2RHX A;  3OS2 A;  2LP5 A;  2V1R A;  2PUK B;  1YJ9 Q;  1VQP A;  1BI0 A;  3CCV T;  1YHQ A;  2HL5 C;  5KYX B;  1K76 A;  2LT4 A;  2FG0 A;  1ZQ1 A;  1D1C A;  3OBY A;  1KIK A;  5GAN 5;  3CCU A;  2EQU A;  1NYG A;  3CCS Q;  1YI2 Q;  2YDL A;  2F2X A;  2LMJ A;  4F7U E;  5DLO A;  1A0N B;  3S3N A;  5KCH A;  3L2W A;  4BI8 B;  4JJN K;  1WNL A;  2CP6 A;  4P5N A;  2DL8 A;  1M27 C;  2KQW A;  4CC2 A;  3H41 A;  2QQ9 A;  4FM4 B;  3BW1 A;  3ULR B;  1UJY A;  2QA4 T;  3A8M B;  2DL3 A;  1WJS A;  4X34 A;  2GFU A;  2JMC A;  4R0K A;  3CCS A;  1YI2 A;  4HVV A;  2YLC A;  3M9Q A;  1TS9 A;  5KH6 A;  2XG8 D;  1MV0 B;  4II1 A;  4JUV A;  5FRN A;  2OX7 A;  5A0D A;  4FW1 A;  4C8Q G;  2XIC A;  3QO3 A;  4M75 A;  5CKH A;  3VUB A;  1Q7Y C;  5GAO q;  4M7D B;  5GMK h;  2KT8 A;  4M77 B;  2ED1 A;  4MML A;  1N8R R;  1PHT A;  2FO0 A;  2LT1 A;  3SWN B;  3NTI A;  3L2U A;  4C8Q D;  3UA6 A;  2SRC A;  1GBQ A;  2NYS A;  4BD3 A;  3JCM P;  1SSH A;  4M7A C;  4V2S A;  3CME Q;  1NEG A;  1VQ7 T;  1VUB A;  1VQM Q;  4QVD A;  2Y4Y A;  3E19 A;  4XTZ A;  4KBM B;  2E64 A;  2RQW A;  2F2V A;  3VJP A;  1VQP T;  1RAA B;  4BY6 B;  1YHQ T;  1KJW A;  1AZE A;  1EZZ B;  5J39 A;  2V26 A;  1SKU B;  1NJI R;  5IAY A;  5GAM h;  2EWN A;  3CME A;  3C4S A;  4ORZ A;  1VQM A;  1G3S A;  3CCL Q;  1G8X A;  2EQI A;  3CCU T;  3SHW A;  1HD3 A;  4F17 A;  2JOY A;  1YJ9 T;  3PIP A;  2PUO B;  1MMG A;  1YJN Q;  3EGU A;  5CVI A;  2EKH A;  2FZG B;  1I5O B;  2H3E B;  2VGN A;  3AHU A;  2NUT A;  2K2M A;  3CCL A;  2KSS A;  2DF6 A;  3CCS T;  1YI2 T;  2X4X A;  2O31 A;  3OYK A;  4X1V A;  2JMA A;  2CP5 A;  6AT1 B;  1OX9 A;  3QKJ A;  3EFR A;  1ZSZ A;  1YJN A;  4J6W A;  1HSQ A;  4RTW A;  3FIF A;  1SEM A;  2QEX Q;  1X6O A;  1PKT A;  2E6N A;  4LD6 A;  1UEC A;  2KXD A;  2COY A;  2B8A A;  2HSE B;  7AT1 B;  1GCQ A;  4HT9 A;  4Q5W A;  2QEX A;  1KFZ A;  2PNI A;  4IUQ A;  2L5Q A;  2O88 A;  2KRS A;  2D1X A;  4JLI A;  4C0D C;  4AMC A;  2EJF A;  2WSC E;  4A63 B;  5GMK i;  4NL3 A;  1IHV A;  2KI7 A;  2EGE A;  1NYF A;  3JAM E;  2VKN A;  4EMK A;  4XTY A;  2D9T A;  2QQA A;  1BKB A;  2CH4 W;  2FEI A;  1AWJ A;  3MP6 A;  4LD9 K;  1FYN A;  2QQS A;  2K2V A;  2LZ6 B;  4J9B A;  3CME T;  1OV3 A;  2XD0 A;  1VQM T;  4PJO G;  5LJ3 d;  2YUN A;  2C0I A;  1K8A R;  4PNO A;  2YLB A;  1JJ2 S;  5HCK A;  1T3L A;  3JCM W;  2M0O A;  3TVT A;  4QT7 A;  1PRL C;  4XTU A;  2FYK A;  4PJO D;  2DBK A;  1W2B S;  4OB1 B;  2HCK A;  3CCL T;  3CD6 A;  4GY5 A;  4OMP A;  4HCB A;  3Q1J A;  3CC2 Q;  1YJN T;  4WTO B;  2V8I A;  4J9H A;  4MMK A;  4N0A A;  3OBW A;  3GLX A;  3M59 A;  2HNI A;  1ACM B;  3CBO A;  1OZ3 A;  4PL6 A;  3G4S Q;  1TU0 B;  2HBP A;  4DBH A;  2LX7 A;  1UGR B;  5KE3 A;  2HKQ B;  3OS5 A;  2KAF A;  2P4R A;  5LJ5 d;  2AT1 B;  1MMD A;  2CT4 A;  3A98 A;  2QEX T;  1FMV A;  2RM4 A;  1K1Z A;  4AFZ C;  3G4S A;  2MMP A;  1SHG A;  1I5L A;  1BI2 A;  1JU5 C;  3OYJ A;  1E6H A;  4FYX B;  5KYY B;  2GGR A;  3CCR Q;  4OVA A;  2DX1 A;  4ZGJ B;  4N4H A;  2AKK A;  3OW2 A;  1RAC B;  1QVF S;  3GNF B;  4HA8 A;  1PC0 A;  4ZGE B;  3GBQ A;  2KGT A;  2CP0 A;  1QQJ A;  3PE0 A;  2QTX A;  4HKE A;  3S3M A;  3T9N A;  2A7Y A;  3VRZ A;  3VKI A;  3CCR A;  4PFO A;  1RAD B;  2DE0 X;  2HBW A;  4KGV B;  4C0F A;  3CXC P;  2NUZ A;  1OZ2 A;  2K5L A;  4ZN1 A;  4KRT A;  3EHQ A;  2CS7 A;  1H64 1;  2X4W A;  1TWB A;  3PVL A;  2R5M A;  3HP9 A;  4BUG A;  4C8Q E;  4N4G A;  3SB2 A;  2EGA A;  1OOT A;  4F7U G;  3RMS A;  4M75 C;  5LJ3 h;  4HVW A;  1K73 R;  3FB9 A;  3CD6 T;  5C6S A;  2L89 A;  2LQN A;  2PQW A;  1K9M C;  5KYW A;  3HFO A;  1VQ8 A;  5I2M A;  4FYV B;  1WA7 A;  4R55 A;  4IIO A;  2K6D A;  1OUL A;  1WXT A;  5GMK m;  2MWO A;  1KC8 U;  3M4Y A;  3EG9 A;  2XDD A;  2JTM A;  1FMW A;  1G83 A;  2P0P A;  1HK9 A;  1VQK Q;  4B9X A;  1WHM A;  3G4S T;  1X2K A;  1QLY A;  3GOX A;  3HFN A;  4ELZ C;  1QCO A;  2DIG A;  1WYX A;  3G6E Q;  3A1P A;  3MP1 A;  2RHU A;  2VXE A;  2E6Z A;  2X4Y A;  2EIF A;  2BZX A;  3WVD B;  4M7A A;  2PVO B;  1NLO C;  3PMI A;  3KUF A;  4C5H A;  5GAN d;  3G6E A;  1IB8 A;  4ME7 A;  1YCS B;  1M1K U;  3RNJ A;  1O75 A;  5HKC A;  2M0Y A;  2EQK A;  1NZ9 A;  3CCR T;  1YBY A;  1SRL A;  1OPL A;  2FPE A;  1N9S A;  1WJR A;  5A0L A;  3CC4 Q;  5I21 A;  4C92 A;  1S72 A;  4OF1 A;  2KDS A;  4K11 A;  3OYH A;  4J8O A;  4DEY A;  4IUP A;  5EC7 A;  1MMA A;  3OYI A;  2ECZ A;  5L23 A;  3URG A;  1IHW A;  1WQ7 A;  2DM1 A;  4C8Q F;  1JXM A;  4F14 A;  1VQ8 T;  1M1F A;  1RAH B;  1IRE B;  2I2L A;  2GTO A;  4GBQ A;  2CP3 A;  4WF2 A;  1Q95 G;  2FRY A;  1XNI A;  3QHS A;  4KGX B;  1YIJ A;  4PJL A;  4CC7 A;  4XU1 A;  1BIB A;  1M4Z A;  2K3X A;  3A8H B;  2V8K A;  4MDW A;  4JRI A;  2HQX A;  3G7Z A;  3LGF A;  4EMK C;  3HHT B;  1SHF A;  2JW4 A;  4R56 A;  2RQU A;  1X6B A;  2LJ0 A;  4FU6 A;  3EG0 A;  5GAM f;  2HQE A;  1MUZ A;  1I4K 1;  4PJO E;  1SRM A;  2E4H A;  1GXI E;  2YWW A;  2DXB A;  4QQD A;  2FPD A;  2BIV A;  3I56 Q;  1VQK T;  3EFO B;  2QYZ A;  3VS1 A;  2LJ1 A;  1Q82 U;  3PNW C;  1MGQ A;  1KQ2 A;  4MZM A;  3G6E T;  2QXF A;  2D8J A;  3TSZ A;  1Y57 A;  2EW3 A;  3H8Z A;  3NFC A;  3I55 Q;  3I56 A;  2ZGW A;  2GF7 A;  1S72 T;  4IKF A;  3M57 A;  1D0Z A;  1AHJ B;  4DOV A;  5GAN h;  3OYL A;  3RDV A;  1D3B A;  2GBQ A;  3P8B B;  2K3B A;  1KD1 C;  3OA6 A;  4C8Q B;  4Z89 A;  3VS4 A;  3NGP A;  4C5I A;  3I55 A;  5FU7 B;  1X27 A;  3QPH A;  2MYS A;  1M1G A;  1SPK A;  4RTU A;  4PLI A;  1AZG B;  2ZZD A;  2M16 A;  2F5K A;  3L42 A;  4YTL A;  4B6M A;  3S3O A;  2E41 A;  2YSQ A;  3OB9 A;  1VQL Q;  2DL5 A;  4M78 A;  2BZ8 A;  1M30 A;  2COZ A;  2QK0 A;  2XMF A;  4DBF A;  2JTE A;  3E9G A;  2LX9 A;  5GMK e;  1R0B G;  2DNU A;  3X20 B;  1QP3 A;  2DER A;  2RK2 A;  2JN0 A;  1WDX A;  1VQL A;  2WAC A;  3LWI A;  1JB0 E;  2FB7 A;  4RTV A;  1TUC A;  3WXM B;  4OMM A;  3CCU Q;  1B07 A;  4O6J A;  1FMK A;  3P8H A;  2DYB A;  1JJ2 A;  3FDR A;  5D6X A;  2OI3 A;  2D6F A;  3QDR B;  2GFA A;  1RI9 A;  3PGG A;  1YWO A;  1W2B A;  4Z02 A;  5GAO m;  2E70 A;  3JCM d;  2OTJ Q;  1XQH A;  3VS5 A;  4PJO F;  3EGX B;  3INZ A;  2ZAE A;  1K9M R;  2DJZ A;  1BYM A;  3GF5 A;  3IQL A;  1D09 B;  3E9F A;  2KE9 A;  2GNC A;  5GAM e;  1N8R U;  3X24 B;  1UGP B;  1N27 A;  3O8V A;  3I56 T;  3CC7 Q;  1VQ4 Q;  2OTJ A;  1UGS B;  4KH1 B;  3QDF A;  2KMT A;  3M0S A;  4JPB W;  3OYE A;  1YWP A;  2YUO A;  3QJ6 A;  3CPW S;  1R0C B;  2HL3 A;  2KR3 A;  4L5G A;  4OGE A;  3VS7 A;  3I55 T;  2DZ9 A;  3C94 A;  3CC7 A;  1QVG S;  2YT6 A;  1M8V A;  1VQ4 A;  3QII A;  1I1J A;  2K5I A;  1X43 A;  2MK5 A;  9ATC B;  1Q81 C;  1BCM A;  3F70 A;  1HYO A;  3M53 A;  1NJI U;  3PT9 A;  1JRI A;  3R6O A;  4OB3 B;  2RN8 A;  1M3C A;  2M9U A;  1QVF A;  3ER0 A;  1VQL T;  2A08 A;  2MOX A;  3PIO A;  1C1A A;  1GBR A;  2E10 A;  5CCA A;  2DET A;  3DLM A;  1ZHI A;  3X25 B;  2XK0 A;  1HXD A;  3JSC A;  5HK0 A;  4ZGD B;  3L2R A;  4GLK A;  5M9O A;  1W2B P;  1Q86 R;  2K3Y A;  4PJO B;  1AWX A;  1WI7 A;  1TUG B;  3JB9 H;  3OMG A;  5FRM A;  4RTZ A;  4EMH A;  1U06 A;  4VUB A;  4RG8 A;  4C92 C;  4M75 G;  3M0Q A;  5CAI A;  2CUB A;  2DD4 A;  2JXB A;  1BIA A;  3A8O B;  5GAM g;  4QKU A;  2LRQ A;  5LJ3 f;  2MI6 A;  4PJJ A;  2VB6 A;  2B86 A;  5CIU A;  2X9H A;  2KRO A;  3QZ9 B;  4M75 D;  2E3H A;  4CC3 A;  4RCB A;  1PM3 A;  2LDM A;  2OTJ T;  3JCM h;  3EG1 A;  2AIR B;  4F7U F;  4M7D A;  4M77 A;  2D0N A;  4QW2 A;  2LCS A;  4HCK A;  1OI1 A;  3SWN A;  4DOW A;  4E7K A;  4KH0 B;  1QCN A;  4J9I A;  3CC7 T;  5KE2 A;  1VQ4 T;  3ZEH A;  2QDL A;  4C5G A;  4L6V 5;  2XKO C;  3M0U A;  3X26 B;  5GJV B;  1G3T A;  1NBE B;  2XI9 A;  1MHN A;  4XTX A;  1RLP C;  3VU3 C;  2PZ1 A;  1QVF P;  5I2S A;  4XK8 E;  3TRE A;  1IO6 A;  4ZTJ A;  2ED0 A;  1K8A U;  4J6Y A;  4PFP A;  2NUP B;  4UC4 A;  3HRU A;  4X9D A;  1PWT A;  1GRI A;  5GAN 8;  4FT2 A;  2R57 A;  3L2V A;  2JNG A;  4IUR A;  5FU6 B;  2ZPH B;  3G1J A;  2HEQ A;  2OTL Q;  2P0K A;  3FRN A;  1M3A A;  2R5A A;  3SFM A;  4HCZ A;  3V7C A;  3OS1 A;  4FYY B;  2DD5 A;  3VV0 A;  4DEX A;  4XU0 A;  3JV3 A;  2RK1 A;  1D1A A;  3OYY A;  1M90 C;  3CCE Q;  1I81 A;  1KD1 R;  1QKW A;  1I8F A;  1GL5 A;  2RHZ A;  4DBR A;  2P84 A;  2OTL A;  2VAS A;  1M1K C;  1N5Z A;  2MF2 A;  2VV5 A;  3LX7 A;  3RES A;  3CD6 Q;  1PCX A;  3HTR A;  3RKY A;  3CCE A;  5CQY A;  2LCL A;  4F7U B;  2RQT A;  3EGD B;  1KSW A;  2KRM A;  2H8H A;  4EIK A;  4OML A;  1WFW A;  5I22 A;  4JS4 A;  1T0H A;  1RAE B;  4Z88 A;  4RTT A;  3M0T A;  5GMK j;  2EYW A;  2L3S A;  3KBG A;  4M78 C;  1V1C A;  1VQN A;  1QW1 A;  3LH0 A;  1OU8 A;  5GAO p;  4JJC A;  3A5Z B;  5LJ3 e;  3FLG A;  2VUB A;  3P8D A;  1TH7 A;  1RAF B;  3JCM J;  3MJX A;  4EPC A;  5GAO r;  2VC8 A;  1QWE A;  2JJ9 A;  5FWB A;  2RA2 A;  4E7H A;  3JB9 G;  3V8L A;  2CZ1 B;  1WJQ A;  3UAT A;  1JXO A;  5CKF A;  3MO8 A;  1U3O A;  2PVD B;  3JCM c;  2BE7 D;  5L8R E;  3S6W A;  3N5B B;  1CKA A;  5D6W A;  2DJQ A;  3JB9 D;  1IRX A;  1D0Y A;  1VQO A;  5GAM j;  3OYF A;  5GAN 6;  3QXE B;  5KYU B;  1AWO A;  1UG1 A;  1M2V A;  1K73 U;  2O9S A;  4FCY A;  2F1L A;  5CKD A;  1PD0 A;  2SEM A;  4RTY A;  5C0M A;  2IG0 A;  1K0X A;  3KXT A;  4DBQ A;  1F1B B;  2OTL T;  1RLQ C;  3I5R A;  5GAN f;  1Y0M A;  2EQJ A;  2YUQ A;  3RIR A;  3FJP A;  3EG9 B;  2GCX A;  3HL8 A;  2A36 A;  4J5Y A;  1Q7Y R;  2VGM A;  2JM8 A;  2L2P A;  2IVW A;  1R77 A;  1K9A A;  2XU8 A;  1Q81 R;  3CCE T;  2JM9 A;  5FWC A;  1VQ8 Q;  2AKL A;  2MPX C;  4A4F A;  4C5E A;  1G3Y A;  2X3W D;  3HSB A;  3OYN A;  4AFU C;  4FL6 A;  1MND A;  1MNE A;  2FL7 A;  1H3H A;  5LJ3 g;  1VQN T;  3RER A;  5FLX E;  3E1S A;  8ATC B;  4PK4 A;  4ATO A;  3J7A F;  4A54 A;  2COW A;  3MEU A;  1T3S A;  1WLP B;  5CR2 A;  4E47 A;  4QVZ A;  4C0Z A;  1BU1 A;  1SG5 A;  1WPY A;  4J9G A;  1P92 A;  1RI0 A;  3OYM A;  4KT0 E;  2O4X B;  3LH5 A;  4JJB A;  5KYY A;  3X28 B;  4D8K A;  4JRK A;  1K4U S;  3QZ5 B;  1B34 B;  1ZA2 B;  1QKX A;  5D7U A;  2CRE A;  5IXF A;  4O5V A;  4RUG A;  2HKN A;  1VQO T;  4M75 E;  3OW2 P;  1UEB A;  2A0F B;  2DMO A;  2EVR A;  4F16 A;  5LJ5 h;  1KK7 A;  2DXC A;  2AHJ B;  2DXU A;  2PVG B;  3NTH A;  1C6V X;  2QI2 A;  4J6X A;  1S72 Q;  4IUT A;  3JCM V;  5CO7 A;  3KFV A;  1UFF A;  3QYG B;  3LLR A;  2QTV A;  3CPW A;  3VYG A;  2QAS A;  4J83 A;  2L3P A;  4M7D C;  1ZLM A;  1N8R C;  2J06 A;  4M77 C;  2RQR A;  1QVG A;  4A4E A;  4BDY A;  1TXQ A;  1Y96 B;  3VS0 A;  3SWN C;  1WQW A;  4BE2 A;  2H3J A;  2O2O A;  1X6G A;  3G71 Q;  3SDZ A;  2PU9 B;  1PRM C;  1TTH B;  1I07 A;  2DLP A;  4ESR A;  3C0C A;  4NS5 A;  4L59 A;  3OMC A;  3UPU A;  2KYB A;  2PTK A;  1YIJ Q;  5GAN e;  2QQB A;  3VRY A;  4C0D B;  2V1Q A;  4BE0 A;  3G71 A;  2HDA A;  2ZPF B;  3QJY A;  4PKC C;  2DEQ A;  1X69 A;  4JZ3 A;  2DIQ A;  4BY6 C;  4M7A G;  1M9S A;  2CT3 A;  3JCM b;  1NJI C;  1D0X A;  4BI3 A;  2BUD A;  2RJF A;  2BZY A;  2Y4X A;  4JS5 A;  4RKU E;  1M90 R;  2DO3 A;  4JLG A;  2ROL A;  2EYQ A;  2FVU A;  2G3R A;  1WXU A;  3CEY A;  3EH1 A;  4J9E A;  3CCM A;  4M7A D;  4BAC A;  2EJG A;  3JB9 J;  4A4K A;  3CXC S;  4E7I A;  3PTA A;  1LVK A;  2EPD A;  2K79 A;  4BB7 A;  3V7S A;  3A8G B;  2ATC B;  4C92 G;  5CKE A;  1UE9 A;  2K4Y A;  1IGQ A;  4XTV A;  1I0C A;  4EMG A;  1X2Q A;  3OSS C;  4PLL A;  4JDS A;  3UF4 A;  4C92 D;  4FYW B;  3V8K A;  3CPW P;  3JRZ A;  4M75 F;  4HVU A;  1NPR A;  3HKS A;  3TEE A;  1YCY A;  4D8D A;  3JCM f;  1QVG P;  1H3Z A;  3QWX X;  2XDP A;  4J9C A;  5LJ3 j;  2HD0 A;  1XTD A;  2RHY A;  3EH2 A;  3H0F A;  1LCK A;  1NE8 A;  2RI3 A;  2CUD A;  3DB3 A;  4XAX B;  4LDW A;  3UA7 A;  2RQV A;  3EFS A;  2KBT A;  2KY9 A;  4DA4 A;  1RAG B;  3JB9 I;  1K0S A;  5IH2 A;  3E2U A;  1KHI A;  2FHD A;  5GAN g;  4QQG A;  1V76 A;  2L3Q A;  2DIL A;  5J26 A;  4LDV A;  2DVJ A;  3G71 T;  2LNV A;  3HRT A;  1U8R A;  3RR6 A;  2HAX A;  2E5K A;  3PMT A;  2LJ3 A;  2GQV A;  4C0G A;  1YJW Q;  4A4G A;  2DRK A;  1SSF A;  1Z9Q A;  2K5F A;  1YIJ T;  1G5V A;  3EAE A;  1PD1 A;  1K9M U;  4ELY C;  5KCO A;  1BI1 A;  2LQ8 A;  1O9S A;  3CQT A;  1BI3 A;  4IIM A;  1IZ6 A;  3GP8 A;  1AOJ A;  3CCM T;  4JRP A;  3ME9 A;  5GAN 2;  1YJW A;  3A8L B;  3EFO A;  2X4J A;  1C0M A;  3QBY A;  1Y07 A;  2DBM A;  2J05 A;  2LCC A;  3EG2 A;  1WHJ A;  2KVQ G;  4M4Z A;  4CI0 C;  3UT1 A;  1NG2 A;  4N4I A;  4M75 B;  1W1F A;  3H0I A;  3OYG A;  2RI5 A;  1LPL A;  4JJD A;  1YNZ A;  2WSE E;  2QAZ A;  1TUD A;  4FSX A;  1ABQ A;  1AT1 B;  2XDB A;  3L1A A;  1NPP A;  4M78 G;  2YUP A;  3R6N A;  4C8Q A;  2Y90 A;  2DTH A;  1UB4 A;  1ZA1 B;  3I35 A;  2C0T A;  3MEV A;  1JBM A;  4HCC A;  4XU2 A;  3U23 A;  4E7Z A;  4M78 D;  1QP2 A;  1LJO A;  1U5S A;  4J7F A;  5KYN A;  2KEA A;  1YJ9 A;  2JT4 A;  1VQ9 Q;  1PKS A;  3L2Q A;  3JCM e;  2FZK B;  2EYX A;  4J7I A;  4RCC A;  3MKD A;  4AFQ C;  1CKB A;  2L8D A;  3NPF A;  2DKG A;  2HQH A;  3L2Z A;  5IHN A;  2DL4 A;  2BTT A;  5LL6 S;  1Q86 U;  3JB9 F;  1NLP C;  1VQ9 A;  4FT4 A;  1Y71 A;  2L3R A;  2W10 A;  4BI4 A;  3OS0 A;  1KQS S;  1AEY A;  2ZCF B;  1AD5 A;  2CSQ A;  4OB2 B;  3FC3 A;  2KNB B;  4MZT A;  3V8J A;  2NUT B;  5KYX A;  2MWP A;  1WHK A;  1VYV A;  2A28 A;  1YJW T; 
#chains in the Genus database with same CATH homology
 5I22 A;  2ESW A;  1G83 A;  1CSK A;  1T0H A;  2GQI A;  2VVK A;  4Z88 A;  4HXJ A;  4RTT A;  1X2K A;  2KXC A;  1QLY A;  3M0T A;  2EYW A;  2L3S A;  3O5Z A;  1V1C A;  1WYX A;  1OPK A;  2HSP A;  2AZV A;  2KRN A;  2M51 A;  2AZS A;  4JJC A;  1M8M A;  1UGV A;  1UHF A;  2LQW A;  1ABO A;  2BZX A;  1NLO C;  1QWE A;  1ZX6 A;  5FWB A;  1B3Q A;  3UAT A;  1YCS B;  1JXO A;  1Z9Z A;  1U3O A;  3RNJ A;  2FPF A;  2CH4 A;  1UJ0 A;  2D8H A;  2EYY A;  2M0Y A;  1J3T A;  1SRL A;  2EGC A;  1OPL A;  4AG1 C;  2FPE A;  1CKA A;  2JS2 A;  2DJQ A;  1VYT A;  1JEG A;  2L0A A;  4K11 A;  2JS0 A;  1AWO A;  4DEY A;  1UG1 A;  1BK2 A;  3I9Q A;  1GFC A;  5EC7 A;  1VA7 A;  2O9S A;  2ECZ A;  5L23 A;  1E7O A;  2RF0 A;  2LP5 A;  2V1R A;  2J7I A;  2SEM A;  4RTY A;  2DM1 A;  3M0R A;  1JXM A;  4F14 A;  2IIM A;  1K0X A;  4J9F A;  3VS6 A;  1K76 A;  3REA B;  1RLQ C;  2VWF A;  2GTO A;  3I5R A;  1Y0M A;  2YUQ A;  2LNH B;  4GBQ A;  2FG0 A;  1ARK A;  1AVZ C;  2FRY A;  2A36 A;  1KIK A;  2JM8 A;  2L2P A;  3NHN A;  4CC7 A;  4WCI A;  1K9A A;  1NYG A;  1VYU A;  2YDL A;  4LNP A;  2F2X A;  2LMJ A;  2JM9 A;  5FWC A;  2RMO A;  2AKL A;  1UHC A;  1A0N B;  1WXB A;  1SHF A;  2X3W D;  2I0N A;  2JW4 A;  2J6O A;  2DL8 A;  2RQU A;  1M27 C;  1X6B A;  4CC2 A;  3H41 A;  2LJ0 A;  4AFU C;  3EG0 A;  3ULR B;  1UJY A;  2DL3 A;  1H3H A;  4R0K A;  2JMC A;  1MUZ A;  1AWW A;  1SRM A;  4HVV A;  5GJW B;  2FPD A;  4Y92 A;  1MV0 B;  1T3S A;  1WLP B;  1BU1 A;  3VS1 A;  2LJ1 A;  2O9V A;  4J9G A;  3REB B;  3LH5 A;  4JJB A;  3VS3 A;  2KT8 A;  2D8J A;  2K7A A;  1Y57 A;  2ED1 A;  3TSZ A;  1S1N A;  2EW3 A;  4D8K A;  1PHT A;  2FO0 A;  1ZUY A;  1K4U S;  1UTI A;  1QKX A;  3UA6 A;  2CRE A;  5IXF A;  2SRC A;  3EG3 A;  1GBQ A;  4RUG A;  1H92 A;  2GBQ A;  4GLM A;  2K3B A;  1SSH A;  2DMO A;  2EVR A;  4F16 A;  2C0O A;  4Z89 A;  2J6K A;  3VS4 A;  1NEG A;  3NGP A;  1X27 A;  1SPK A;  4AFS C;  4RTU A;  1AZG B;  2GTJ A;  2RQW A;  2F2V A;  2CSI A;  2NWM A;  3KFV A;  2YSQ A;  4AG2 C;  1UFF A;  1KJW A;  2DL5 A;  1AZE A;  2BZ8 A;  2L3P A;  1M30 A;  2ROT A;  1ZLM A;  2J06 A;  2RQR A;  4ORZ A;  1BBZ A;  2XMF A;  2JTE A;  3ZL7 C;  1G2B A;  2EQI A;  3VS0 A;  4Z8A A;  2DNU A;  3SHW A;  1HD3 A;  4F17 A;  2O2O A;  1X6G A;  1WDX A;  2ENM A;  1PRM C;  3EGU A;  1I07 A;  4RTV A;  1TUC A;  2DLP A;  2EKH A;  4ESR A;  3C0C A;  4OMM A;  1WX6 A;  1E6G A;  2KYB A;  2PTK A;  1B07 A;  2K2M A;  4LN2 A;  2DF6 A;  3VRY A;  1FMK A;  2DYB A;  2V1Q A;  2O31 A;  4X1V A;  2JMA A;  2DRM A;  2HDA A;  2RPN A;  2FRW A;  1NEB A;  2OI3 A;  1X69 A;  4JZ3 A;  3TSW A;  1HSQ A;  1RI9 A;  1YWO A;  4RTW A;  1SEM A;  1ZUU A;  2CT3 A;  3H0H A;  1JO8 A;  3THK A;  1PKT A;  2BZY A;  3VS5 A;  2KT1 A;  2ROL A;  3RBB B;  3IQL A;  1UEC A;  2MIO A;  2KE9 A;  1WXU A;  2GNC A;  2KXD A;  4J9E A;  2EPD A;  2K79 A;  2A37 A;  1GCQ A;  1KFZ A;  1UE9 A;  2PNI A;  4JPB W;  3M0S A;  2O88 A;  2KRS A;  2D1X A;  1I0C A;  1X2Q A;  1QWF A;  1YWP A;  3VS2 A;  2YUO A;  2KR3 A;  1JQQ A;  3VS7 A;  3UF4 A;  4A63 B;  2EGE A;  1NYF A;  2YT6 A;  2VKN A;  2OJ2 A;  2CH4 W;  2FEI A;  1AWJ A;  1I1J A;  4HVU A;  4D8D A;  2RNA A;  1FYN A;  1X43 A;  1OEB A;  3QWX X;  2LZ6 B;  4J9C A;  2EBP A;  5IHK A;  3NMZ C;  4J9B A;  1OV3 A;  3H0F A;  1LCK A;  2W0Z A;  2CUD A;  2RN8 A;  2YUN A;  2C0I A;  1M3C A;  3UA7 A;  2RQV A;  2KBT A;  1ZSG A;  1K0S A;  2X3X D;  5HCK A;  2KYM A;  5IHI A;  5IH2 A;  1T3L A;  2A08 A;  2MOX A;  3EHR A;  3TVT A;  4OMN A;  2K9G A;  4QT7 A;  1PRL C;  1GBR A;  1GFD A;  2DBK A;  2L3Q A;  2DIL A;  2HCK A;  1UDL A;  1YP5 A;  4OMP A;  3PVQ A;  2DVJ A;  2E5K A;  2LJ3 A;  1AWX A;  1WI7 A;  1M3B A;  4J9H A;  4OMO A;  4RTZ A;  3SEM A;  2DRK A;  1U06 A;  4J9D A;  1Z9Q A;  4LUD A;  3M0Q A;  1EFN A;  2CUB A;  2JXB A;  1W70 A;  3FJ5 A;  2DL7 A;  2LX7 A;  3CQT A;  4IIM A;  2DA9 A;  5I11 A;  1AOJ A;  1XOV A;  2B86 A;  2P4R A;  2KRO A;  2CT4 A;  3A98 A;  4CC3 A;  1MV3 A;  1K1Z A;  4AFZ C;  3EG1 A;  2DBM A;  2J05 A;  2D0N A;  3EG2 A;  1SHG A;  4M4Z A;  2LCS A;  1JU5 C;  1NG2 A;  4HCK A;  2OAW A;  1E6H A;  1RUW A;  1W1F A;  3H0I A;  2GGR A;  2DX1 A;  4JJD A;  4J9I A;  1YNZ A;  2AKK A;  1TUD A;  1ABQ A;  2QDL A;  1GCP A;  2ABL A;  2EYZ A;  1UUE A;  3M0U A;  2YUP A;  5GJV B;  2F2W A;  3GBQ A;  3R6N A;  2KGT A;  5ECA A;  1GCQ C;  3PE0 A;  1NM7 A;  1RLP C;  3I35 A;  2PZ1 A;  3VRZ A;  2C0T A;  3U23 A;  1IO6 A;  2DE0 X;  2ED0 A;  2HBW A;  4LUE A;  2NUZ A;  1U5S A;  4FSS A;  4ZNX A;  4KRT A;  3EHQ A;  1PWT A;  1GRI A;  4LE9 A;  2KEA A;  4RTX A;  1ZUK A;  3PVL A;  1T0J A;  4JZ4 A;  2JT4 A;  1H8K A;  1PKS A;  2HEQ A;  1M3A A;  2EGA A;  2J6F A;  1YN8 A;  1OOT A;  1TG0 A;  2EYX A;  4HVW A;  4AFQ C;  1CKB A;  4DEX A;  3NPF A;  3JV3 A;  1BB9 A;  5FW9 A;  1PNJ A;  5IXB A;  1QCF A;  5IHN A;  2LQN A;  3QWY A;  1W6X A;  2AK5 A;  2BTT A;  2DL4 A;  1QKW A;  1GL5 A;  1NLP C;  3I5S A;  2CDT A;  1N5Z A;  1WA7 A;  2W10 A;  1AEY A;  4IIO A;  2K6D A;  1AD5 A;  2CSQ A;  1HJD A;  2G6F X;  2KNB B;  2MCN A;  1WXT A;  3M0P A;  4OMQ A;  4E6R A;  1VYV A;  2A28 A;  2RQT A;  1WIE A;  1ZBJ A;  1KSW A;  2KRM A;  4CC4 B;  2H8H A;  4EIK A;  4OML A;  1WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...