2AZSA

Nmr structure of the n-terminal sh3 domain of drk (calculated without noe restraints)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
b'MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2-SH3 adapter protein drk
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azsA00
1GL5A 1GCQA 1YCSB 2H8HA 2FRYA 1QKWA 4F16A 2AKKA 1NYFA 1G2BA 2NWMA 3I5RA 3U23A 1I0CA 4AFSC 1OV3A 1NLPC 1Y0MA 4D8DA 1WDXA 2JXBA 5IXFA 3M0RA 2K2MA 4HVVA 1X6GA 3TVTA 4Z88A 2L0AA 4RTXA 2L3PA 3EG2A 2IIMA 1AEYA 2EW3A 2MCNA 1AWXA 2O31A 3M0PA 3VRYA 1E6GA 1FYNA 4RUGA 2RMOA 1WA7A 1PKTA 2KE9A 2QDLA 2KROA 2EBPA 1V1CA 1UG1A 2SEMA 3UA6A 2DYBA 4JPBW 3EG0A 2DM1A 2KBTA 3C0CA 1TUCA 1VA7A 4GLMA 2P4RA 4RTYA 4J9EA 3ULRB 5ECAA 1M8MA 2LJ1A 3H0HA 4ESRA 3KFVA 3CQTA 3VS3A 2C0OA 4OMOA 1WXBA 2KXDA 2KRMA 2DL4A 2EYWA 2G6FX 2KRSA 2F2XA 2ECZA 4LE9A 4HVWA 1UJ0A 2DVJA 2RQUA 2RQTA 1NEBA 2C0IA 2ROTA 2K79A 2FPFA 2J6OA 4F17A 5GJWB 3VS5A 3VS6A 1ZUYA 1MV0B 1WXTA 1T0JA 1T3LA 3NGPA 4JJBA 1JU5C 2BZXA 1N5ZA 1BBZA 2KYMA 4DEYA 1AWWA 1ZUKA 1X69A 2JM8A 1ABOA 4JJCA 3VS4A 1Z9ZA 3TSZA 4AFUC 1K0XA 1JXOA 2J6FA 4OMLA 1PWTA 1SRLA 1OEBA 4RTZA 2FO0A 2CSQA 2EYYA 1RLPC 1GCPA 1AD5A 4AFQC 3NHNA 1X2KA 3M0SA 2D1XA 1NYGA 2LJ0A 3I9QA 1ZLMA 1K0SA 1QKXA 4HXJA 2VWFA 1H3HA 4D8KA 1M27C 4IIMA 1W70A 2DRKA 1B07A 1H92A 3UA7A 2F2WA 1A0NB 1VYUA 2HEQA 4OMNA 5L23A 1GFDA 2EYZA 2YSQA 1OPKA 2V1QA 1EFNA 1Z9QA 2VKNA 1HD3A 1PNJA 2CT4A 2DX1A 2X3XD 3EG1A 1UDLA 5IXBA 2JS2A 2W10A 2LNHB 1UHCA 2KYBA 3SEMA 2AZVA 2CUDA 2DILA 1AWOA 1I07A 2OAWA 2RNAA 1KIKA 3VRZA 2CDTA 4DEXA 2BTTA 3VS7A 2M51A 1YN8A 2DNUA 2M0YA 1M30A 1U06A 1GBQA 4HVUA 2FRWA 4ORZA 2K6DA 2JT4A 2HCKA 4KRTA 5HCKA 2J6KA 2CREA 1M3AA 2DLPA 2L3SA 4LUDA 4OMPA 1AZEA 3M0UA 2X3WD 2SRCA 1UTIA 1CKBA 1AVZC 1PRLC 4RTUA 2LX7A 2O9SA 4WCIA 5IHKA 1QLYA 2DE0X 4Z8AA 2PNIA 1ARKA 2J05A 2KXCA 1MV3A 2O2OA 4Y92A 3PVLA 2RQRA 2ABLA 2EVRA 1E7OA 4JZ3A 1T0HA 1H8KA 2YUQA 1SSHA 1GRIA 4J9FA 2JM9A 1JO8A 2JS0A 2JMCA 4R0KA 1JQQA 1X6BA 2B86A 1W6XA 4LN2A 1OPLA 2YDLA 1KFZA 2RQVA 2D8JA 3O5ZA 3TSWA 1GFCA 2AKLA 1K1ZA 4E6RA 3EGUA 1WXUA 5I22A 1WYXA 2W0ZA 2GTJA 1SPKA 2LZ6B 2DF6A 2O9VA 3SHWA 2JW4A 2EGCA 1UHFA 1J3TA 1YWPA 1BK2A 2L3QA 4AFZC 2RPNA 2FG0A 2YUOA 2AK5A 2DL3A 1ABQA 2K9GA 3I5SA 3RBBB 3QWYA 1M3CA 2FEIA 2HDAA 4AG1C 1QCFA 1K4US 2DBKA 4CC4B 1QWEA 2K3BA 2O88A 1VYTA 3UF4A 1JEGA 4LNPA 5FWBA 1X43A 1G83A 2C0TA 1RLQC 4CC3A 3ZL7C 2J06A 2JMAA 1E6HA 5FW9A 4AG2C 1K9AA 4J9IA 2EYXA 2CH4W 2DJQA 4EIKA 1SHFA 3R6NA 1M3BA 2E5KA 2K7AA 3VS0A 2A08A 2KT8A 3RNJA 4RTVA 1TUDA 4M4ZA 2GNCA 2YUNA 4CC7A 2MIOA 4OMMA 1ZX6A 2KEAA 2FPDA 1HSQA 2EPDA 4Z89A 1AWJA 1WI7A 1T3SA 1NM7A 2D0NA 2EQIA 1GCQC 1SEMA 3H0FA 1UGVA 3NPFA 2OI3A 2LP5A 1KSWA 1WLPB 4RTTA 4J9BA 4JJDA 2CSIA 3H0IA 4HCKA 1ZUUA 2LQWA 3QWXX 1WIEA 2EGAA 2BZYA 2PZ1A 3VS2A 2GBQA 3PVQA 2KNBB 1MUZA 2DRMA 1NG2A 2ED1A 1TG0A 3GBQA 1I1JA 4ZNXA 1YWOA 2DL8A 2ROLA 5IHNA 2LMJA 1YNZA 2J7IA 1PKSA 1SRMA 1Y57A 2ENMA 1UECA 1PRMC 2A28A 3PE0A 2A37A 1UUEA 5IHIA 2L2PA 4RTWA 4GBQA 1K76A 1ZSGA 1BU1A 1UFFA 4X1VA 4JZ4A 1B3QA 5IH2A 1UE9A 4J9CA 2LJ3A 2PTKA 2XMFA 2EGEA 3NMZC 2YUPA 1OOTA 4QT7A 2CUBA 1AZGB 1FMKA 1CSKA 2HSPA 1JXMA 2KGTA 3THKA 1SHGA 1WX6A 2GTOA 4FSSA 3M0QA 2DBMA 2D8HA 3UATA 2ESWA 4J9GA 2ED0A 4J9HA 3REAB 1X27A 2RQWA 2CT3A 3EHRA 2LQNA 1RUWA 2KR3A 3A98A 3EHQA 2RN8A 2YT6A 2AZSA 2BZ8A 2RF0A 3FJ5A 1XOVA 1IO6A 1NLOC 4LUEA 1UJYA 1AOJA 2HBWA 1W1FA 2GGRA 4K11A 5EC7A 2DL7A 1VYVA 3EG3A 1BB9A 1GBRA 5I11A 5GJVB 2OJ2A 3M0TA 2DMOA 1U3OA 2KRNA 5FWCA 4CC2A 3H41A 2NUZA 1PHTA 2JTEA 2DL5A 2GQIA 4A63B 1S1NA 2FPEA 1KJWA 1RI9A 1LCKA 3VS1A 1QWFA 1U5SA 1ZBJA 3IQLA 4OMQA 1HJDA 1CKAA 1YP5A 2DA9A 3JV3A 4IIOA 2F2VA 2MOXA 2EKHA 3I35A 2KT1A 4J9DA 1NEGA 2V1RA 2VVKA 1WFWA 3LH5A 4F14A 2A36A 2LCSA 1X2QA 3REBB 2CH4A 2I0NA
chains in the Genus database with same CATH superfamily
4BUGA 1KK7A 1WQWA 1K8AR 5FLXE 4QQGA 4R56A 2FRYA 1QKWA 3BDUA 2RHYA 5GAN5 1M8VA 1NLPC 1Y0MA 1D3BA 1PD1A 2KDSA 1X6GA 4Z88A 3VUBA 1PD0A 2H3JA 3JB9G 2XG8D 5KYWA 5DY9A 3PMTA 5LJ5e 4HA8A 1K9MR 2RM4A 1AWXA 2O31A 1KC8U 1ZSZC 1FMVA 2EAYA 3OS5A 3P8DA 2KE9A 3DKMA 1MGQA 5LJ3e 1UG1A 3H8ZA 2DERA 2DYBA 4JPBW 5GAN7 3OQ5A 4M7AC 2Y90A 1YHQT 4M75D 1IB8A 1M8MA 4F7UE 3CPFA 5DLQE 3VS3A 4C5HA 3CCEQ 3JCMh 5GAOm 1JJ2S 2PUKB 2MYSA 4IKFA 2HL5C 3JCMW 2DVJA 1K9MC 1NEBA 2DO3A 2HNIA 2ROTA 3EH1A 2K79A 4OGEA 2EYQA 2K5IA 3L1AA 3VS6A 4M77B 1T0JA 4MMLA 1JU5C 1IZ6A 2HZYA 1N5ZA 2KYMA 2R5AA 2ZPBB 1X69A 1ABOA 1M5Q1 4JJCA 1NJIC 2L3RA 3TSZA 3PIPA 4JRQA 5AT1B 1M90R 1SRLA 2FO0A 1YJWA 4C8QC 4Z02A 3M58A 3CCUT 1NYGA 1ZHIA 4HXJA 1VQ5A 4MZPA 4OMFB 2CP7A 1B07A 5CO7A 3UA7A 4IUQA 1RAFB 2CP0A 1YIJA 4M78A 3MJXA 3CC4Q 2EYZA 4M7DD 2V1QA 1EFNA 5GAMf 4JUVA 1HD3A 2L8DA 5FU7B 2QQ9A 4PKCC 5DM7R 3CCQA 3GNGA 5D7UA 5IXBA 4QW2A 2XDPA 1M90C 1RAEB 2X4XA 4MZTA 2V8IA 1UHCA 3MEAA 2E4HA 2KYBA 2FZKB 3SEMA 4BE0A 1K8AU 4LDWA 1QVFS 2MPXC 2DZCA 4E7IA 2M0YA 3S3MA 1KD1U 5C0MA 3CC2A 3JB9F 4OVAA 3M54A 2QQAA 3CC7Q 1TXQA 4KRTA 4XU0A 4MDXA 2RJFA 2L3SA 3CCRQ 3QZ9B 3LW5E 3GLXA 3TEEA 4OGCA 2X3WD 3VYHB 1UTIA 3I55A 4WCIA 2DIGA 3OW2S 3CMEQ 4PFZA 4FCYA 5J39A 1E7OA 3CC4T 4D6WA 2KSSA 1VQ4Q 1QP3A 2OTJT 2JS0A 3QBYA 2MF2A 1I4K1 2JMCA 4R0KA 2QASA 3BE3A 1VQ6Q 1W6XA 4OP0A 8AT1B 4PLLA 2RQVA 1UGSB 1I5OB 2DD5A 4UC4A 3RUXA 3TSWA 3RERA 1GFCA 3CCJQ 4JRKA 3GNFB 3EGUA 1VOMA 1WYXA 1SG5A 2W0ZA 1VQKA 2LZ6B 3OYJA 2O9VA 1BI1A 3CCSA 1EX4A 5CQYA 2LT4A 4PLIA 1WPYA 2RPNA 4PJNA 4M75E 4BD3A 2NUPB 3I5SA 1ACMB 2X4YA 2ZCFB 3SDZA 4A4FA 4AG1C 4XU2A 3CCRT 2LDMA 2K3BA 3JCMg 2QTVA 3INZA 3L42A 4LNPA 2XDDA 5FWBA 2DFUA 2CP2A 1N8RR 2JUFA 2LCLA 2J06A 1YI2Q 2K57A 2JMAA 3M53A 4KBMB 2RA2A 4M7AG 1QCNA 1D1BA 3M57A 3MO8A 2QYZA 4C8QB 2RJDA 1VQ4T 1BKBA 4CI0C 2A08A 3OYHA 1KQ2A 2K4YA 1YJNQ 5GMKe 2QXFA 1VQ6T 2BE7D 3JCMf 3BDLA 1M1KU 2LX9A 3RMQA 5KYUB 4M77D 4M4ZA 1Q81R 4ZN1A 2GNCA 2XDBA 1OX8A 2FZCB 1HSQA 4QVCA 5D6XA 1AWJA 1IRXA 1WI7A 2X4JA 4X9DA 1T3SA 1NM7A 4B9XA 1N8RC 1GCQC 3NPFA 2OI3A 3NTKA 1KSWA 2E1HA 4RCCA 4V2SA 3CEYA 5CIUA 1VQPT 4XQ3A 3OYKA 4M7DE 1OYXA 1O9SA 3M56A 2JTMA 4F7UG 4FYWB 1WIEA 1Q95G 2DVEA 2BZYA 2D6FA 3OYMA 4EMHA 4E7SA 3GBQA 1I1JA 1YWOA 2M9UA 3OYGA 5IHNA 2LMJA 2J7IA 1C6VX 1PKSA 4FYXB 3EFOB 4EMGA 3QO3A 3VV0A 1PSFA 2XI9A 4LDYA 4FL6A 1K73R 1IGUA 1UUEA 4AMCA 4J6XA 3JCMP 2L2PA 4RTWA 3E9FA 3QZ5B 3FLGA 1BU1A 2QQSA 3PIOA 4X1VA 1YJWQ 2V26A 4BDZA 3X20B 1UE9A 4J9CA 4L6V5 2XMFA 1JJ2A 3QKJA 1KQ1A 3OYDA 2H3EB 1VQ5Q 3MCAB 3BW1A 2VXEA 2CUBA 1AZGB 2YRVA 5IAYA 1CSKA 2DKGA 6AT1B 1YIJQ 1SHGA 2DETA 1WX6A 4E7KA 1PCXA 1ZA1B 1VQ7Q 3GOXA 2LT1A 1G3WA 2BKDN 3GPLA 3CCQQ 2CT3A 3EHRA 1RUWA 3A98A 4NL2A 3J7AF 4KGZB 3JCMe 4C0GA 3MP1A 2BZ8A 3FJ5A 3EFRA 1B7TA 2P0KA 1W1FA 1OZ3A 3H6ZA 4XTXA 1VYVA 1UGQB 4Q5WA 4JLIA 2KY9A 1TH7A 5FWCA 4CC2A 1BIBA 4A4HA 4PJOA 2DL5A 2LTOA 1WZOA 3CD6A 3PFSA 4OMQA 1ZBJA 1HJDA 1W2BS 1CKAA 3JV3A 5GMKm 4R55A 3I55Q 1Q81U 3JB9J 2HL3A 2HQEA 3I35A 4XTUA 5DLOA 2F5KA 2ATCB 1D1AA 4LDVA 3REBB 1YIJT 4LDUA 1QVFA 1GL5A 1RACB 5GAOp 1IXDA 2FYKA 2ZAEA 3I5RA 5GMKl 1YITA 4F7UF 3HRSA 3LH0A 2WACA 1OV3A 4AFSC 2E3HA 2MWOA 4ELZC 1WDXA 2JXBA 2LC4A 3SD4A 1JJ2P 5IXFA 2EFIA 1GXIE 2AHJB 1B34B 2NLUA 3G1JA 4NL3A 1VQKQ 4C8QD 2EJ9A 1AEYA 5KYYB 1UB4A 3CCSQ 1OX9A 2RJCA 4IUUA 3QUIA 1I81A 3UT1A 2XHCA 3G6EA 1E6GA 3CC2T 4RUGA 2JN0A 4PK4A 3OW2A 1PKTA 1K73U 2PVDB 1ZSZA 3RR6A 3JCMQ 2SEMA 4ZGEB 3EG0A 4M75G 1X01A 2F69A 4GLMA 2DTHA 5GAMh 2PUOB 1Q7YR 4C5GA 3KFVA 3CQTA 4BACA 4M77C 3QJYA 2C0OA 4OMOA 4PJOE 1LJOA 4M7AA 1WXBA 2NUTA 4LD6A 2DL4A 2DPPB 4MZMA 2EQUA 4C0DB 2F2XA 1MMAA 5KCHA 1UJ0A 2RI3A 5KCOA 2E41A 3VUZA 3JB9H 4F17A 3QXEB 1XNIA 3L2WA 3SWNA 1ZUYA 1QVGS 4E7JA 3CMEA 2WSFE 1WNLA 1YJ9A 3NGPA 2GFUA 4JJBA 2LCCA 2JM8A 4BI3A 1Q7YC 3VS4A 2JNGA 3CCMA 2IPOB 5M9OA 3CCST 1OEBA 1SKUB 4IUTA 4FW1A 1QVFP 1O75A 1GCPA 2RK2A 4AFQC 2EIFA 3NHNA 4EDUA 3P8HA 2HMAA 5FU7C 1M9SA 4F7UA 2D1XA 1K0SA 1QKXA 3GIBA 1H3HA 4IIMA 5GAOq 2PU9B 2HD0A 4JS5A 4M7DG 3CCVA 2F2WA 3NFCA 1VYUA 2HEQA 1Y07A 1Z9QA 2P0QA 4QVZA 4C92D 2VGNA 2X35A 3HFNA 2DX1A 1UDLA 1VQ8A 3FEOA 1VUBA 1Y96A 2W10A 3OW2P 1EZZB 2AZVA 2KAFA 1M2VA 1LVKA 1DJ7B 5IT9E 2OAWA 2RNAA 1YI2A 4M7AE 2L5QA 1KIKA 2CDTA 4DEXA 2BTTA 2M51A 4BE1A 2K5FA 1YN8A 2VV5A 2ZPEB 3M59A 4M78F 4C5EA 2FRWA 4E7HA 1YJNA 1KHCA 2PVOB 5GAMj 1RAGB 2CREA 3PNWC 2DLPA 4OF1A 3FIFA 1EIFA 5EG2A 2O4XB 2Y4YA 3M0UA 4QVDA 2FL7A 1TUGB 4RTUA 2E65A 4KGVB 5IHKA 2DE0X 2PNIA 3KBGA 4FM4B 1ARKA 2J05A 2KXCA 1MV3A 1V76A 1XJWB 3JCMX 2DEQA 1G8XA 4N4IA 1NJIR 4J9FA 1GRIA 2FZGB 1JO8A 2GCXA 3QDFA 2RO0A 2YXYA 2B86A 4C8QE 1OPLA 2HKQB 1OU9A 4EMKC 3O5ZA 1WXUA 5I22A 1N9SA 1I5LA 3CD6Q 2DF6A 2VB6A 5GAN4 2EGCA 2DTOA 1BK2A 2JVVA 3MHXA 5GAOl 5GAOr 2L3QA 2VUBA 5KYXB 5HY6A 1WJSA 1WHHA 4IUVA 3J80E 1VQMQ 2YUOA 2AK5A 2LQ8A 5GANd 5GAMg 1YCYA 1VQ9A 1QW1A 3RBBB 4CC4B 3JCMb 2DYIA 1X43A 4CC3A 1YITQ 1M1GA 3X28B 4M7DF 2V8KA 1K9AA 4A53A 4J9IA 2EYXA 3MEVA 2CH4W 1SHFA 3NTIA 1VQ7A 1QQJA 3ZFJA 2HQXA 3S6WA 3CCET 2QI2A 4WTOB 2KT8A 1W2BA 1S72A 4KUIA 3G6EQ 4RG2A 2JZ2A 1TUDA 3GP8A 2YUNA 4CC7A 4OMMA 4M75A 1ZX6A 3ASKA 3VU3C 1ZA2B 3CD6T 1TTHB 1SEMA 1UGVA 2QK0A 2QEXA 4IUPA 2P4TA 3MKDA 3EGXB 4ELYC 5HK3A 3G7ZA 5CKHA 2CP6A 3HFOA 1BCMA 3QWXX 2HQHA 1RL2A 2K5LA 1K9MU 3OYAA 1G3YA 4PJOG 4J83A 2A7YA 4FW2A 3VS2A 5J3BA 1MUZA 2KNBB 3R6OA 1NG2A 2E64A 1TG0A 1UGPB 2LVMA 3LLRA 2GF7A 1C1AA 4A4KA 1YJ9Q 1SRMA 3JB9D 1Q82R 4BE2A 5CCAA 3M55A 5CVIA 2A28A 1NJIU 3OSSC 2RI2A 3CCMQ 2CZ1B 5IHIA 2E5QA 1VQLA 4A4GA 4ZN3A 3FB9A 4MDWA 1M2OA 1K76A 1ZSGA 3G6ET 4C92C 1B3QA 5GAN2 4PJLA 2PTKA 3NMZC 1PSEA 1WJQA 1LOJA 4M7DA 1RADB 1FMKA 1HYOA 3CCVQ 3JB9I 1JXMA 3THKA 3DLMA 3L2RA 2XD0A 2XU8A 4B6MA 4FSSA 3M0QA 2D8HA 3HPWA 4EMKB 3BY7A 3WVDB 1Q82C 1QVGA 1W2BP 3CC7T 3EH2A 4J9GA 5GANf 5GAMe 1VQ8Q 2KMTA 2RQWA 4RCBA 4O6JA 1M90U 3EHQA 2RN8A 3MEUA 3G4SQ 2XIDA 1XOVA 3A8GB 2A3LA 4RKUE 2GGRA 5EC7A 3EG3A 3J81E 3CMET 1MMDA 5I11A 1YJ9T 4HCCA 3HRTA 3M4YA 2I2LA 4RMOA 2DD4A 2NUZA 3CCMT 2CZ7B 2JTEA 4M78C 2B8AA 4HT9A 2ZPHB 1LCKA 3VS1A 1U5SA 3IQLA 3CCJT 4IIOA 2R57A 3FC3A 2EKHA 5HK0A 2KT1A 1D09B 1G5VA 1NEGA 2RB6A 1TOVA 2V1RA 3CCVT 3O8VA 1SF9A 3EGDB 2CH4A 3FRNA 4JRIA 2G3RA 1YCSB 1R0BG 1VQ8T 1G2BA 3ZEHA 2VASA 4PJOF 3UPUA 4NS5A 4NOYA 2HSEB 4C8QG 3PT9A 4DBQA 3EFSA 4RTXA 1YI2T 2O4XA 2VXFA 3OA6A 1D3BB 4C0ZA 2CYZB 3RMSA 3VRYA 3X24B 1QVGP 1FYNA 3PMIA 2RMOA 4BB7A 4IURA 1WA7A 1ZQ1A 2QDLA 2JJ9A 4C0DC 1YJNT 2EBPA 2QG9B 4O5VA 1VQ9Q 3UA6A 2DM1A 3C0CA 3ER0A 3MEWA 1OZ2A 3L2UA 1M4ZA 4QKUA 2P4RA 4RTYA 4J9EA 3ULRB 5ECAA 4JLGA 4JRPA 2LJ1A 4ESRA 3MP8A 4FYVB 3G71Q 5HKCA 2KRMA 2RHUA 2KRSA 5D6WA 2ECZA 4J6WA 4HVWA 4F04B 4M77A 5AYFA 2RQTA 4C92B 4CRIA 2C0IA 4N4GA 3OYCA 1S72Q 3A5ZB 1X75C 2J6OA 5KYXA 2NYSA 4KULA 5LL6S 5GJWB 3ME9A 5LJ5d 1MV0B 2QDYB 2BZXA 1N9RA 1AWWA 1ZUKA 1Q86R 5FRMA 4DQ2A 1PM3A 4AFUC 1N8RU 5FU6C 3CCUA 1PWTA 1IHVA 2QEXQ 4RTZA 4M7AF 4KGXB 2E6NA 1AD5A 3JCMJ 4ZTFA 1D0ZA 3M0SA 3KUFA 3RDVA 2LJ0A 3I9QA 2DIQA 1ZLMA 2VWFA 2AIRB 1VQ9T 2ZGWA 1YJWT 2CZ0B 2DRKA 2M02A 1H92A 2YLBA 2FB7A 2RH2A 5GAN6 3QJ6A 1FMWA 3OYEA 1VQ5T 2VKNA 5D6YA 1PNJA 1VQMA 1Q86C 2CT4A 2A0FB 3UDCA 1LPLA 2VYTA 9ATCB 1U1TA 4M78B 4L5GA 1VQ7T 2LNHB 4J6YA 4FYYB 5CKEA 3WXMB 1VQLQ 1S72T 2CGHA 1NBEB 3CCQT 1AWOA 1IGQA 3VJPA 4TVRA 3VRZA 3JCMV 4XTWA 4B9WA 1PG5B 3L2ZA 4C8QF 5FRNA 4M77E 2DNUA 1W4SA 3AHUA 1M30A 1KG1A 5KH6A 3EG9B 3HHTB 3N5BB 1GBQA 4XTYA 2CP5A 2JT4A 2HCKA 4FT2A 5HCKA 2RI5A 5CKFA 4LUDA 1AZEA 3M4GA 2SRCA 4C0FA 1AVZC 3OYLA 1PRLC 4BY6B 3OBWA 3S3NA 2DXUA 3V8LA 2DXTA 2OTJA 4Y92A 1KC8R 2RQRA 2QTXA 2ABLA 3OYBA 4A4EA 4JZ3A 3I55T 1C0MA 2YUQA 1SSHA 3JRZA 3META 2P84A 3C95A 4DA4A 1X6BA 4LN2A 4N0AC 2YDLA 3KXTA 2IG0A 2D8JA 2WSCE 4L59A 1VQLT 4EMKA 2D9TA 2YRDA 3SHWA 2JW4A 2NUPA 3I56A 1J3TA 1YWPA 1NZ9A 4DOWA 1M1FA 1AHJB 2QGGA 3HKSA 1KC8C 1VQKT 2JOYA 3URGA 2BE9B 2K9GA 3P8BB 1M3CA 2FEIA 3LGLA 1QWEA 3OSVA 2O88A 3HTRA 1JEGA 3CMAA 2FVUA 2C0TA 3A8LB 3PGGA 4C8QA 4C5IA 4HCZA 3CCLA 2COWA 4AT1B 5FU6B 1IHWA 2QAZA 4AG2C 2EKOA 5KYUA 2DJQA 8ATCB 4EIKA 1M3BA 3DB3A 4HCBA 1HK9A 4J8OA 4JS4A 3G4SA 3TQ7P 1YHQQ 1U8RA 2FPDA 3JSCA 2EPDA 3A8MB 4Z89A 3QG1A 4XTVA 4VUBA 4XU1A 2EQIA 3H0FA 4HKEA 2LP5A 1WLPB 1UEBA 3OBYA 4RTTA 4JJDA 3C94A 4FSXA 5GANh 2QQBA 2CSIA 1VQOA 1ZUUA 2M1HA 3A8HB 2MMPA 4PJJA 1QP2A 1KD1R 2F1LA 3EFOA 3WVEB 1VIFA 4II1A 2DRMA 2JTFA 4M75F 4DBHA 1G3SA 1BI0A 1TU0B 2XK0A 4A54A 2ZPIB 2ENMA 4M78D 1MMNA 1UECA 4OB0B 3E19A 1Q7YU 2A37A 3CCUQ 4HT8A 1K8AC 1KQSS 1UFFA 4JZ4A 4PFOA 5CKDA 2LJ3A 2EGEA 1WHMA 1OOTA 4RG8A 1P92A 4QT7A 1KD1C 4C92A 5A0DA 2P0PA 1D0XA 2HSPA 2K3XA 5GMKj 3M9QA 3C12A 1G3TA 2HAXA 2DBMA 4GLKA 3SWNC 2OTLA 2ESWA 4FT4A 3A1PA 3T9NA 2ED0A 4FIBA 4J9HA 3REAB 2F5TX 1F1BB 3TCJA 2LQNA 3E9GA 2YT6A 4OB3B 7AT1B 2AZSA 2E12A 2DEUA 1V29B 1IO6A 1NLOC 4LUEA 1AOJA 1TSFA 2HBWA 1R0CB 2MAMA 2DL7A 1YBYA 1BB9A 3G71A 1GBRA 2BIVA 5GJVB 5L8RE 2OJ2A 3M0TA 3UWNA 2DTIA 2DMOA 1U3OA 4XTZA 2ZPGB 3TU4K 3H41A 1PHTA 3CBMA 2RHXA 4M77G 1RAAB 3CBOA 1S1NA 5GANj 1MNDA 1QWFA 3V7CA 1YP5A 2DA9A 4PJOB 2MOXA 5KE2A 5GAOn 2OTJQ 3OYFA 1M1KR 3LH5A 2DJZA 4F14A 2LQKA 2I0NA 3JCMd 4KH0B 3CPWS 2FHDA 1D0YA 1GCQA 2H8HA 2YRCA 4E7ZA 2V8JA 1VQMT 1MHNA 1H641 1B34A 2AKKA 4F16A 1NYFA 4C92E 2NWMA 4OB1B 3OS0A 3U23A 2GQVA 4EPCA 1I0CA 3DLLA 2RJEA 3EG9A 5KYYA 4XU3A 5CAIA 4D8DA 2R5MA 1QVPA 2MWPA 2Z0WA 2K2MA 3M0RA 4HVVA 4OB2B 4QQ6A 2MI6A 1H3ZA 3TVTA 2L0AA 2RD1A 1UGRB 1YITT 2L3PA 3EG2A 1MMGA 2IIMA 4X9CA 2EQKA 2EW3A 2MCNA 3FDRA 3I56Q 3H9NA 1NPRA 3S3OA 3M0PA 2E3IA 1M1KC 2KI7A 3V8KA 2EQJA 4J5YA 3V8JA 3CBPA 2KROA 3GF5A 1V1CA 1OU8A 5GANg 2KBTA 5A0GA 2COZA 1VQNA 1TUCA 1VA7A 2EWNA 3D7SB 3CMAQ 2BUDA 4PL6A 2KQWA 2VGMA 2X9HA 3H0HA 5CR2A 1ZSZB 3CCLQ 3QDRB 2QA4A 2KXDA 2EYWA 2G6FX 4LE9A 2RQUA 1N27A 3TREA 5GAN8 4M78E 1D1CA 3QHSA 4M7AB 2IVWA 2FPFA 2NUTB 5J26A 3VS5A 2D0QB 4N4HA 1WXTA 2OX7A 4GY5A 1T3LA 4P5NA 4KT0E 1N6AA 4DEYA 1BBZA 3LYIA 2X51A 4X34A 1VQPQ 4DOVA 1Z9ZA 3SWNB 5IN1A 1K0XA 1JXOA 2J6FA 1WHJA 4OMLA 3I56T 1WHGA 2CSQA 3DB4A 2EYYA 4JJNK 1RLPC 1X2KA 3LWIA 4M77F 5FROA 2MK5A 1VQOQ 4D8KA 1M27C 2YHTA 1W70A 2WSEE 1OQKA 3LWHA 4Y91A 1WJRA 4F7UB 1A0NB 3CMAT 1R8OB 2E10A 4E2FB 4OMNA 1FWZA 5L23A 1GFDA 2YSQA 1OPKA 3CCLT 2DAQA 3X26B 4ZTJA 1OI1A 2X3XD 3OMCA 3EG1A 3CXCA 4M75C 2JS2A 3L2VA 5I2MA 2PVGB 3VKIA 2HKNA 5LJ5h 1Y71A 2CUDA 2DILA 1I07A 3OMGA 1Y96B 3OB9A 3G4ST 3VS7A 5KYNA 3SFMA 3MP6A 3SB2A 4BY6C 5LJ3h 1M2VB 2CKKA 1FX7A 5A2QE 3QPHA 1U06A 4HVUA 5KE3A 4ORZA 2CS7A 2K6DA 2O01E 1YFNA 2CZ6B 2J6KA 2C06A 1M3AA 2OTLQ 1Q82U 4DBRA 4OMPA 2YWWA 5GAN3 5KYWB 1CKBA 1VQOT 3E2UA 1YHQA 4PJOD 1LNXA 2LX7A 2O9SA 1Q81C 1RAIB 1QLYA 1HXDA 4Z8AA 5GANe 2XICA 2LNVA 2O2OA 1BI3A 3MPUB 3PVLA 2DXBA 1ZBXA 3Q1JA 5CQXA 1OULA 2EVRA 3C4SA 1JBMA 1T0HA 1H8KA 1FXXA 2K2VA 2JM9A 4WF2A 1KQSA 1JQQA 2R58A 4PFPA 4M7DC 1KFZA 3V7SA 4J7IA 2E70A 4E6RA 2AKLA 1K1ZA 5GMKi 3BFMA 4N0AA 3HSBA 3LX7A 2E6ZA 2EJGA 2GTJA 1SPKA 2KK4A 3HP9A 4FU6A 4KUDK 1UHFA 2ZZDA 3RIRA 2YLCA 3LGFA 3RKWA 4AFZC 2FG0A 1WQ7A 2COYA 3QYHB 5LJ3d 2DL3A 1QCOA 3CXCP 1ABQA 3OYYA 1K73C 4E7LA 3QWYA 2HDAA 1K4US 1QCFA 2DBKA 2OTLT 1VYTA 3UF4A 2EQMA 3F70A 2PQWA 3A8OB 1G83A 1Y7XA 1PC0A 1RLQC 3ZL7C 2KVQG 3QYGB 3CCEA 2AT1B 1TWBA 3JAME 1E6HA 5FW9A 4C92G 3HRUA 5LJ5j 2CP3A 1BYMA 1IREB 4QQDA 1RI0A 3CC2Q 3R6NA 3FJPA 4ANJA 1RAHB 3ZBDA 3M5AA 2E5KA 2K7AA 3VS0A 3G71T 4M7AD 3RNJA 3NTHA 4BI4A 1SSFA 5LJ3j 4RTVA 4BDYA 3OYIA 4XK8E 2MIOA 2KEAA 3PTAA 1NPPA 3EGXA 3CPWA 1VQNQ 2D0NA 1JRIA 3OYNA 1BIAA 4LD9K 5I21A 4M75B 4J9BA 4ME7A 1KQSP 2DXCA 3H0IA 4HCKA 2QA4Q 2QEXT 4PNOA 1XQHA 2HBPA 1BI2A 4XAXB 2LQWA 3HL8A 2EGAA 3AT1B 3OS2A 2PZ1A 4ATOA 3RESA 2GBQA 3CC4A 3PVQA 2ED1A 4ZNXA 2DL8A 1U1SA 4LXCA 1WHLA 4M78G 2ROLA 2QGFB 1KHIA 5LJ5g 3L2QA 1YNZA 1Y57A 5C6SA 4LDXA 4BI8B 1PRMC 4E47A 3PE0A 2X4WA 1MNEA 4DBFA 1VIEA 5I2SA 2RHIA 5LJ3g 4GBQA 2LRQA 4Y28E 5IH2A 3V7RA 2YUPA 4J7FA 3RKYA 5LJ5f 3CC7A 1I8FA 1VQNT 2RHZA 2KGTA 3OS1A 2DK3A 1QMCA 2L89A 2GTOA 4M7DB 3CCRA 3UATA 5LJ3f 2QQRA 4MMKA 1Q86U 2QA4T 1X27A 1XTDA 1X6OA 2KR3A 3JCMc 1BCOA 2Y4XA 2RK1A 1WHKA 1NE8A 3QSUA 2RF0A 5GMKh 3QIIA 2K3YA 1UJYA 5CKBA 2ZPFB 4ZGJB 3CPWP 1AT1B 4K11A 1WGSA 3X25B 1VQ4A 2DZ9A 2GFAA 3VYGA 4C92F 1VQ6A 4PJOC 1R77A 1JB0E 4JDSA 2KRNA 2M16A 4PJMA 3CCJA 4KH1B 2GQIA 4A63B 2FPEA 2M0OA 1KJWA 2XKOC 1RI9A 2VC8A 3EGDA 2OAUA 3RKXA 3CXCS 1RABB 2EJFA 2F2VA 4YTLA 4J9DA 1VQPA 5GAMd 3E1SA 2VVKA 4ZGDB 1WFWA 1TS9A 2A36A 3EAEA 1X2QA 2LCSA 5CK9A 3OY9A 5A0LA
chains in the Genus database with same CATH topology
1GL5A 1GCQA 1YCSB 2H8HA 2FRYA 1QKWA 4F16A 2AKKA 1NYFA 1G2BA 2NWMA 3I5RA 3U23A 1I0CA 4AFSC 1OV3A 1NLPC 1Y0MA 4D8DA 1WDXA 2JXBA 5IXFA 3M0RA 2K2MA 4HVVA 1X6GA 3TVTA 4Z88A 2L0AA 4RTXA 2L3PA 3EG2A 2IIMA 1AEYA 2EW3A 2MCNA 1AWXA 2O31A 3M0PA 3VRYA 1E6GA 1FYNA 4RUGA 2RMOA 1WA7A 1PKTA 2KE9A 2QDLA 2KROA 2EBPA 1V1CA 1UG1A 2SEMA 3UA6A 2DYBA 4JPBW 3EG0A 2DM1A 2KBTA 3C0CA 1TUCA 1VA7A 4GLMA 2P4RA 4RTYA 4J9EA 3ULRB 5ECAA 1M8MA 2LJ1A 3H0HA 4ESRA 3KFVA 3CQTA 3VS3A 2C0OA 4OMOA 1WXBA 2KXDA 2KRMA 2DL4A 2EYWA 2G6FX 2KRSA 2F2XA 2ECZA 4LE9A 4HVWA 1UJ0A 2DVJA 2RQUA 2RQTA 1NEBA 2C0IA 2ROTA 2K79A 2FPFA 2J6OA 4F17A 5GJWB 3VS5A 3VS6A 1ZUYA 1MV0B 1WXTA 1T0JA 1T3LA 3NGPA 4JJBA 1JU5C 2BZXA 1N5ZA 1BBZA 2KYMA 4DEYA 1AWWA 1ZUKA 1X69A 2JM8A 1ABOA 4JJCA 3VS4A 1Z9ZA 3TSZA 4AFUC 1K0XA 1JXOA 2J6FA 4OMLA 1PWTA 1SRLA 1OEBA 4RTZA 2FO0A 2CSQA 2EYYA 1RLPC 1GCPA 1AD5A 4AFQC 3NHNA 1X2KA 3M0SA 2D1XA 1NYGA 2LJ0A 3I9QA 1ZLMA 1K0SA 1QKXA 4HXJA 2VWFA 1H3HA 4D8KA 1M27C 4IIMA 1W70A 2DRKA 1B07A 1H92A 3UA7A 2F2WA 1A0NB 1VYUA 2HEQA 4OMNA 5L23A 1GFDA 2EYZA 2YSQA 1OPKA 2V1QA 1EFNA 1Z9QA 2VKNA 1HD3A 1PNJA 2CT4A 2DX1A 2X3XD 3EG1A 1UDLA 5IXBA 2JS2A 2W10A 2LNHB 1UHCA 2KYBA 3SEMA 2AZVA 2CUDA 2DILA 1AWOA 1I07A 2OAWA 2RNAA 1KIKA 3VRZA 2CDTA 4DEXA 2BTTA 3VS7A 2M51A 1YN8A 2DNUA 2M0YA 1M30A 1U06A 1GBQA 4HVUA 2FRWA 4ORZA 2K6DA 2JT4A 2HCKA 4KRTA 5HCKA 2J6KA 2CREA 1M3AA 2DLPA 2L3SA 4LUDA 4OMPA 1AZEA 3M0UA 2X3WD 2SRCA 1UTIA 1CKBA 1AVZC 1PRLC 4RTUA 2LX7A 2O9SA 4WCIA 5IHKA 1QLYA 2DE0X 4Z8AA 2PNIA 1ARKA 2J05A 2KXCA 1MV3A 2O2OA 4Y92A 3PVLA 2RQRA 2ABLA 2EVRA 1E7OA 4JZ3A 1T0HA 1H8KA 2YUQA 1SSHA 1GRIA 4J9FA 2JM9A 1JO8A 2JS0A 2JMCA 4R0KA 1JQQA 1X6BA 2B86A 1W6XA 4LN2A 1OPLA 2YDLA 1KFZA 2RQVA 2D8JA 3O5ZA 3TSWA 1GFCA 2AKLA 1K1ZA 4E6RA 3EGUA 1WXUA 5I22A 1WYXA 2W0ZA 2GTJA 1SPKA 2LZ6B 2DF6A 2O9VA 3SHWA 2JW4A 2EGCA 1UHFA 1J3TA 1YWPA 1BK2A 2L3QA 4AFZC 2RPNA 2FG0A 2YUOA 2AK5A 2DL3A 1ABQA 2K9GA 3I5SA 3RBBB 3QWYA 1M3CA 2FEIA 2HDAA 4AG1C 1QCFA 1K4US 2DBKA 4CC4B 1QWEA 2K3BA 2O88A 1VYTA 3UF4A 1JEGA 4LNPA 5FWBA 1X43A 1G83A 2C0TA 1RLQC 4CC3A 3ZL7C 2J06A 2JMAA 1E6HA 5FW9A 4AG2C 1K9AA 4J9IA 2EYXA 2CH4W 2DJQA 4EIKA 1SHFA 3R6NA 1M3BA 2E5KA 2K7AA 3VS0A 2A08A 2KT8A 3RNJA 4RTVA 1TUDA 4M4ZA 2GNCA 2YUNA 4CC7A 2MIOA 4OMMA 1ZX6A 2KEAA 2FPDA 1HSQA 2EPDA 4Z89A 1AWJA 1WI7A 1T3SA 1NM7A 2D0NA 2EQIA 1GCQC 1SEMA 3H0FA 1UGVA 3NPFA 2OI3A 2LP5A 1KSWA 1WLPB 4RTTA 4J9BA 4JJDA 2CSIA 3H0IA 4HCKA 1ZUUA 2LQWA 3QWXX 1WIEA 2EGAA 2BZYA 2PZ1A 3VS2A 2GBQA 3PVQA 2KNBB 1MUZA 2DRMA 1NG2A 2ED1A 1TG0A 3GBQA 1I1JA 4ZNXA 1YWOA 2DL8A 2ROLA 5IHNA 2LMJA 1YNZA 2J7IA 1PKSA 1SRMA 1Y57A 2ENMA 1UECA 1PRMC 2A28A 3PE0A 2A37A 1UUEA 5IHIA 2L2PA 4RTWA 4GBQA 1K76A 1ZSGA 1BU1A 1UFFA 4X1VA 4JZ4A 1B3QA 5IH2A 1UE9A 4J9CA 2LJ3A 2PTKA 2XMFA 2EGEA 3NMZC 2YUPA 1OOTA 4QT7A 2CUBA 1AZGB 1FMKA 1CSKA 2HSPA 1JXMA 2KGTA 3THKA 1SHGA 1WX6A 2GTOA 4FSSA 3M0QA 2DBMA 2D8HA 3UATA 2ESWA 4J9GA 2ED0A 4J9HA 3REAB 1X27A 2RQWA 2CT3A 3EHRA 2LQNA 1RUWA 2KR3A 3A98A 3EHQA 2RN8A 2YT6A 2AZSA 2BZ8A 2RF0A 3FJ5A 1XOVA 1IO6A 1NLOC 4LUEA 1UJYA 1AOJA 2HBWA 1W1FA 2GGRA 4K11A 5EC7A 2DL7A 1VYVA 3EG3A 1BB9A 1GBRA 5I11A 5GJVB 2OJ2A 3M0TA 2DMOA 1U3OA 2KRNA 5FWCA 4CC2A 3H41A 2NUZA 1PHTA 2JTEA 2DL5A 2GQIA 4A63B 1S1NA 2FPEA 1KJWA 1RI9A 1LCKA 3VS1A 1QWFA 1U5SA 1ZBJA 3IQLA 4OMQA 1HJDA 1CKAA 1YP5A 2DA9A 3JV3A 4IIOA 2F2VA 2MOXA 2EKHA 3I35A 2KT1A 4J9DA 1NEGA 2V1RA 2VVKA 1WFWA 3LH5A 4F14A 2A36A 2LCSA 1X2QA 3REBB 2CH4A 2I0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL5 A;  1GCQ A;  1YCS B;  2H8H A;  2FRY A;  1QKW A;  4F16 A;  2AKK A;  1NYF A;  1G2B A;  2NWM A;  3I5R A;  3U23 A;  1I0C A;  4AFS C;  1OV3 A;  1NLP C;  1Y0M A;  4D8D A;  1WDX A;  2JXB A;  5IXF A;  3M0R A;  2K2M A;  4HVV A;  1X6G A;  3TVT A;  4Z88 A;  2L0A A;  4RTX A;  2L3P A;  3EG2 A;  2IIM A;  1AEY A;  2EW3 A;  2MCN A;  1AWX A;  2O31 A;  3M0P A;  3VRY A;  1E6G A;  1FYN A;  4RUG A;  2RMO A;  1WA7 A;  1PKT A;  2KE9 A;  2QDL A;  2KRO A;  2EBP A;  1V1C A;  1UG1 A;  2SEM A;  3UA6 A;  2DYB A;  4JPB W;  3EG0 A;  2DM1 A;  2KBT A;  3C0C A;  1TUC A;  1VA7 A;  4GLM A;  2P4R A;  4RTY A;  4J9E A;  3ULR B;  5ECA A;  1M8M A;  2LJ1 A;  3H0H A;  4ESR A;  3KFV A;  3CQT A;  3VS3 A;  2C0O A;  4OMO A;  1WXB A;  2KXD A;  2KRM A;  2DL4 A;  2EYW A;  2G6F X;  2KRS A;  2F2X A;  2ECZ A;  4LE9 A;  4HVW A;  1UJ0 A;  2DVJ A;  2RQU A;  2RQT A;  1NEB A;  2C0I A;  2ROT A;  2K79 A;  2FPF A;  2J6O A;  4F17 A;  5GJW B;  3VS5 A;  3VS6 A;  1ZUY A;  1MV0 B;  1WXT A;  1T0J A;  1T3L A;  3NGP A;  4JJB A;  1JU5 C;  2BZX A;  1N5Z A;  1BBZ A;  2KYM A;  4DEY A;  1AWW A;  1ZUK A;  1X69 A;  2JM8 A;  1ABO A;  4JJC A;  3VS4 A;  1Z9Z A;  3TSZ A;  4AFU C;  1K0X A;  1JXO A;  2J6F A;  4OML A;  1PWT A;  1SRL A;  1OEB A;  4RTZ A;  2FO0 A;  2CSQ A;  2EYY A;  1RLP C;  1GCP A;  1AD5 A;  4AFQ C;  3NHN A;  1X2K A;  3M0S A;  2D1X A;  1NYG A;  2LJ0 A;  3I9Q A;  1ZLM A;  1K0S A;  1QKX A;  4HXJ A;  2VWF A;  1H3H A;  4D8K A;  1M27 C;  4IIM A;  1W70 A;  2DRK A;  1B07 A;  1H92 A;  3UA7 A;  2F2W A;  1A0N B;  1VYU A;  2HEQ A;  4OMN A;  5L23 A;  1GFD A;  2EYZ A;  2YSQ A;  1OPK A;  2V1Q A;  1EFN A;  1Z9Q A;  2VKN A;  1HD3 A;  1PNJ A;  2CT4 A;  2DX1 A;  2X3X D;  3EG1 A;  1UDL A;  5IXB A;  2JS2 A;  2W10 A;  2LNH B;  1UHC A;  2KYB A;  3SEM A;  2AZV A;  2CUD A;  2DIL A;  1AWO A;  1I07 A;  2OAW A;  2RNA A;  1KIK A;  3VRZ A;  2CDT A;  4DEX A;  2BTT A;  3VS7 A;  2M51 A;  1YN8 A;  2DNU A;  2M0Y A;  1M30 A;  1U06 A;  1GBQ A;  4HVU A;  2FRW A;  4ORZ A;  2K6D A;  2JT4 A;  2HCK A;  4KRT A;  5HCK A;  2J6K A;  2CRE A;  1M3A A;  2DLP A;  2L3S A;  4LUD A;  4OMP A;  1AZE A;  3M0U A;  2X3W D;  2SRC A;  1UTI A;  1CKB A;  1AVZ C;  1PRL C;  4RTU A;  2LX7 A;  2O9S A;  4WCI A;  5IHK A;  1QLY A;  2DE0 X;  4Z8A A;  2PNI A;  1ARK A;  2J05 A;  2KXC A;  1MV3 A;  2O2O A;  4Y92 A;  3PVL A;  2RQR A;  2ABL A;  2EVR A;  1E7O A;  4JZ3 A;  1T0H A;  1H8K A;  2YUQ A;  1SSH A;  1GRI A;  4J9F A;  2JM9 A;  1JO8 A;  2JS0 A;  2JMC A;  4R0K A;  1JQQ A;  1X6B A;  2B86 A;  1W6X A;  4LN2 A;  1OPL A;  2YDL A;  1KFZ A;  2RQV A;  2D8J A;  3O5Z A;  3TSW A;  1GFC A;  2AKL A;  1K1Z A;  4E6R A;  3EGU A;  1WXU A;  5I22 A;  1WYX A;  2W0Z A;  2GTJ A;  1SPK A;  2LZ6 B;  2DF6 A;  2O9V A;  3SHW A;  2JW4 A;  2EGC A;  1UHF A;  1J3T A;  1YWP A;  1BK2 A;  2L3Q A;  4AFZ C;  2RPN A;  2FG0 A;  2YUO A;  2AK5 A;  2DL3 A;  1ABQ A;  2K9G A;  3I5S A;  3RBB B;  3QWY A;  1M3C A;  2FEI A;  2HDA A;  4AG1 C;  1QCF A;  1K4U S;  2DBK A;  4CC4 B;  1QWE A;  2K3B A;  2O88 A;  1VYT A;  3UF4 A;  1JEG A;  4LNP A;  5FWB A;  1X43 A;  1G83 A;  2C0T A;  1RLQ C;  4CC3 A;  3ZL7 C;  2J06 A;  2JMA A;  1E6H A;  5FW9 A;  4AG2 C;  1K9A A;  4J9I A;  2EYX A;  2CH4 W;  2DJQ A;  4EIK A;  1SHF A;  3R6N A;  1M3B A;  2E5K A;  2K7A A;  3VS0 A;  2A08 A;  2KT8 A;  3RNJ A;  4RTV A;  1TUD A;  4M4Z A;  2GNC A;  2YUN A;  4CC7 A;  2MIO A;  4OMM A;  1ZX6 A;  2KEA A;  2FPD A;  1HSQ A;  2EPD A;  4Z89 A;  1AWJ A;  1WI7 A;  1T3S A;  1NM7 A;  2D0N A;  2EQI A;  1GCQ C;  1SEM A;  3H0F A;  1UGV A;  3NPF A;  2OI3 A;  2LP5 A;  1KSW A;  1WLP B;  4RTT A;  4J9B A;  4JJD A;  2CSI A;  3H0I A;  4HCK A;  1ZUU A;  2LQW A;  3QWX X;  1WIE A;  2EGA A;  2BZY A;  2PZ1 A;  3VS2 A;  2GBQ A;  3PVQ A;  2KNB B;  1MUZ A;  2DRM A;  1NG2 A;  2ED1 A;  1TG0 A;  3GBQ A;  1I1J A;  4ZNX A;  1YWO A;  2DL8 A;  2ROL A;  5IHN A;  2LMJ A;  1YNZ A;  2J7I A;  1PKS A;  1SRM A;  1Y57 A;  2ENM A;  1UEC A;  1PRM C;  2A28 A;  3PE0 A;  2A37 A;  1UUE A;  5IHI A;  2L2P A;  4RTW A;  4GBQ A;  1K76 A;  1ZSG A;  1BU1 A;  1UFF A;  4X1V A;  4JZ4 A;  1B3Q A;  5IH2 A;  1UE9 A;  4J9C A;  2LJ3 A;  2PTK A;  2XMF A;  2EGE A;  3NMZ C;  2YUP A;  1OOT A;  4QT7 A;  2CUB A;  1AZG B;  1FMK A;  1CSK A;  2HSP A;  1JXM A;  2KGT A;  3THK A;  1SHG A;  1WX6 A;  2GTO A;  4FSS A;  3M0Q A;  2DBM A;  2D8H A;  3UAT A;  2ESW A;  4J9G A;  2ED0 A;  4J9H A;  3REA B;  1X27 A;  2RQW A;  2CT3 A;  3EHR A;  2LQN A;  1RUW A;  2KR3 A;  3A98 A;  3EHQ A;  2RN8 A;  2YT6 A;  2AZS A;  2BZ8 A;  2RF0 A;  3FJ5 A;  1XOV A;  1IO6 A;  1NLO C;  4LUE A;  1UJY A;  1AOJ A;  2HBW A;  1W1F A;  2GGR A;  4K11 A;  5EC7 A;  2DL7 A;  1VYV A;  3EG3 A;  1BB9 A;  1GBR A;  5I11 A;  5GJV B;  2OJ2 A;  3M0T A;  2DMO A;  1U3O A;  2KRN A;  5FWC A;  4CC2 A;  3H41 A;  2NUZ A;  1PHT A;  2JTE A;  2DL5 A;  2GQI A;  4A63 B;  1S1N A;  2FPE A;  1KJW A;  1RI9 A;  1LCK A;  3VS1 A;  1QWF A;  1U5S A;  1ZBJ A;  3IQL A;  4OMQ A;  1HJD A;  1CKA A;  1YP5 A;  2DA9 A;  3JV3 A;  4IIO A;  2F2V A;  2MOX A;  2EKH A;  3I35 A;  2KT1 A;  4J9D A;  1NEG A;  2V1R A;  2VVK A;  1WFW A;  3LH5 A;  4F14 A;  2A36 A;  2LCS A;  1X2Q A;  3REB B;  2CH4 A;  2I0N A; 
#chains in the Genus database with same CATH topology
 4BUG A;  1KK7 A;  1WQW A;  1K8A R;  5FLX E;  4QQG A;  4R56 A;  2FRY A;  1QKW A;  3BDU A;  2RHY A;  5GAN 5;  1M8V A;  1NLP C;  1Y0M A;  1D3B A;  1PD1 A;  2KDS A;  1X6G A;  4Z88 A;  3VUB A;  1PD0 A;  2H3J A;  3JB9 G;  2XG8 D;  5KYW A;  5DY9 A;  3PMT A;  5LJ5 e;  4HA8 A;  1K9M R;  2RM4 A;  1AWX A;  2O31 A;  1KC8 U;  1ZSZ C;  1FMV A;  2EAY A;  3OS5 A;  3P8D A;  2KE9 A;  3DKM A;  1MGQ A;  5LJ3 e;  1UG1 A;  3H8Z A;  2DER A;  2DYB A;  4JPB W;  5GAN 7;  3OQ5 A;  4M7A C;  2Y90 A;  1YHQ T;  4M75 D;  1IB8 A;  1M8M A;  4F7U E;  3CPF A;  5DLQ E;  3VS3 A;  4C5H A;  3CCE Q;  3JCM h;  5GAO m;  1JJ2 S;  2PUK B;  2MYS A;  4IKF A;  2HL5 C;  3JCM W;  2DVJ A;  1K9M C;  1NEB A;  2DO3 A;  2HNI A;  2ROT A;  3EH1 A;  2K79 A;  4OGE A;  2EYQ A;  2K5I A;  3L1A A;  3VS6 A;  4M77 B;  1T0J A;  4MML A;  1JU5 C;  1IZ6 A;  2HZY A;  1N5Z A;  2KYM A;  2R5A A;  2ZPB B;  1X69 A;  1ABO A;  1M5Q 1;  4JJC A;  1NJI C;  2L3R A;  3TSZ A;  3PIP A;  4JRQ A;  5AT1 B;  1M90 R;  1SRL A;  2FO0 A;  1YJW A;  4C8Q C;  4Z02 A;  3M58 A;  3CCU T;  1NYG A;  1ZHI A;  4HXJ A;  1VQ5 A;  4MZP A;  4OMF B;  2CP7 A;  1B07 A;  5CO7 A;  3UA7 A;  4IUQ A;  1RAF B;  2CP0 A;  1YIJ A;  4M78 A;  3MJX A;  3CC4 Q;  2EYZ A;  4M7D D;  2V1Q A;  1EFN A;  5GAM f;  4JUV A;  1HD3 A;  2L8D A;  5FU7 B;  2QQ9 A;  4PKC C;  5DM7 R;  3CCQ A;  3GNG A;  5D7U A;  5IXB A;  4QW2 A;  2XDP A;  1M90 C;  1RAE B;  2X4X A;  4MZT A;  2V8I A;  1UHC A;  3MEA A;  2E4H A;  2KYB A;  2FZK B;  3SEM A;  4BE0 A;  1K8A U;  4LDW A;  1QVF S;  2MPX C;  2DZC A;  4E7I A;  2M0Y A;  3S3M A;  1KD1 U;  5C0M A;  3CC2 A;  3JB9 F;  4OVA A;  3M54 A;  2QQA A;  3CC7 Q;  1TXQ A;  4KRT A;  4XU0 A;  4MDX A;  2RJF A;  2L3S A;  3CCR Q;  3QZ9 B;  3LW5 E;  3GLX A;  3TEE A;  4OGC A;  2X3W D;  3VYH B;  1UTI A;  3I55 A;  4WCI A;  2DIG A;  3OW2 S;  3CME Q;  4PFZ A;  4FCY A;  5J39 A;  1E7O A;  3CC4 T;  4D6W A;  2KSS A;  1VQ4 Q;  1QP3 A;  2OTJ T;  2JS0 A;  3QBY A;  2MF2 A;  1I4K 1;  2JMC A;  4R0K A;  2QAS A;  3BE3 A;  1VQ6 Q;  1W6X A;  4OP0 A;  8AT1 B;  4PLL A;  2RQV A;  1UGS B;  1I5O B;  2DD5 A;  4UC4 A;  3RUX A;  3TSW A;  3RER A;  1GFC A;  3CCJ Q;  4JRK A;  3GNF B;  3EGU A;  1VOM A;  1WYX A;  1SG5 A;  2W0Z A;  1VQK A;  2LZ6 B;  3OYJ A;  2O9V A;  1BI1 A;  3CCS A;  1EX4 A;  5CQY A;  2LT4 A;  4PLI A;  1WPY A;  2RPN A;  4PJN A;  4M75 E;  4BD3 A;  2NUP B;  3I5S A;  1ACM B;  2X4Y A;  2ZCF B;  3SDZ A;  4A4F A;  4AG1 C;  4XU2 A;  3CCR T;  2LDM A;  2K3B A;  3JCM g;  2QTV A;  3INZ A;  3L42 A;  4LNP A;  2XDD A;  5FWB A;  2DFU A;  2CP2 A;  1N8R R;  2JUF A;  2LCL A;  2J06 A;  1YI2 Q;  2K57 A;  2JMA A;  3M53 A;  4KBM B;  2RA2 A;  4M7A G;  1QCN A;  1D1B A;  3M57 A;  3MO8 A;  2QYZ A;  4C8Q B;  2RJD A;  1VQ4 T;  1BKB A;  4CI0 C;  2A08 A;  3OYH A;  1KQ2 A;  2K4Y A;  1YJN Q;  5GMK e;  2QXF A;  1VQ6 T;  2BE7 D;  3JCM f;  3BDL A;  1M1K U;  2LX9 A;  3RMQ A;  5KYU B;  4M77 D;  4M4Z A;  1Q81 R;  4ZN1 A;  2GNC A;  2XDB A;  1OX8 A;  2FZC B;  1HSQ A;  4QVC A;  5D6X A;  1AWJ A;  1IRX A;  1WI7 A;  2X4J A;  4X9D A;  1T3S A;  1NM7 A;  4B9X A;  1N8R C;  1GCQ C;  3NPF A;  2OI3 A;  3NTK A;  1KSW A;  2E1H A;  4RCC A;  4V2S A;  3CEY A;  5CIU A;  1VQP T;  4XQ3 A;  3OYK A;  4M7D E;  1OYX A;  1O9S A;  3M56 A;  2JTM A;  4F7U G;  4FYW B;  1WIE A;  1Q95 G;  2DVE A;  2BZY A;  2D6F A;  3OYM A;  4EMH A;  4E7S A;  3GBQ A;  1I1J A;  1YWO A;  2M9U A;  3OYG A;  5IHN A;  2LMJ A;  2J7I A;  1C6V X;  1PKS A;  4FYX B;  3EFO B;  4EMG A;  3QO3 A;  3VV0 A;  1PSF A;  2XI9 A;  4LDY A;  4FL6 A;  1K73 R;  1IGU A;  1UUE A;  4AMC A;  4J6X A;  3JCM P;  2L2P A;  4RTW A;  3E9F A;  3QZ5 B;  3FLG A;  1BU1 A;  2QQS A;  3PIO A;  4X1V A;  1YJW Q;  2V26 A;  4BDZ A;  3X20 B;  1UE9 A;  4J9C A;  4L6V 5;  2XMF A;  1JJ2 A;  3QKJ A;  1KQ1 A;  3OYD A;  2H3E B;  1VQ5 Q;  3MCA B;  3BW1 A;  2VXE A;  2CUB A;  1AZG B;  2YRV A;  5IAY A;  1CSK A;  2DKG A;  6AT1 B;  1YIJ Q;  1SHG A;  2DET A;  1WX6 A;  4E7K A;  1PCX A;  1ZA1 B;  1VQ7 Q;  3GOX A;  2LT1 A;  1G3W A;  2BKD N;  3GPL A;  3CCQ Q;  2CT3 A;  3EHR A;  1RUW A;  3A98 A;  4NL2 A;  3J7A F;  4KGZ B;  3JCM e;  4C0G A;  3MP1 A;  2BZ8 A;  3FJ5 A;  3EFR A;  1B7T A;  2P0K A;  1W1F A;  1OZ3 A;  3H6Z A;  4XTX A;  1VYV A;  1UGQ B;  4Q5W A;  4JLI A;  2KY9 A;  1TH7 A;  5FWC A;  4CC2 A;  1BIB A;  4A4H A;  4PJO A;  2DL5 A;  2LTO A;  1WZO A;  3CD6 A;  3PFS A;  4OMQ A;  1ZBJ A;  1HJD A;  1W2B S;  1CKA A;  3JV3 A;  5GMK m;  4R55 A;  3I55 Q;  1Q81 U;  3JB9 J;  2HL3 A;  2HQE A;  3I35 A;  4XTU A;  5DLO A;  2F5K A;  2ATC B;  1D1A A;  4LDV A;  3REB B;  1YIJ T;  4LDU A;  1QVF A;  1GL5 A;  1RAC B;  5GAO p;  1IXD A;  2FYK A;  2ZAE A;  3I5R A;  5GMK l;  1YIT A;  4F7U F;  3HRS A;  3LH0 A;  2WAC A;  1OV3 A;  4AFS C;  2E3H A;  2MWO A;  4ELZ C;  1WDX A;  2JXB A;  2LC4 A;  3SD4 A;  1JJ2 P;  5IXF A;  2EFI A;  1GXI E;  2AHJ B;  1B34 B;  2NLU A;  3G1J A;  4NL3 A;  1VQK Q;  4C8Q D;  2EJ9 A;  1AEY A;  5KYY B;  1UB4 A;  3CCS Q;  1OX9 A;  2RJC A;  4IUU A;  3QUI A;  1I81 A;  3UT1 A;  2XHC A;  3G6E A;  1E6G A;  3CC2 T;  4RUG A;  2JN0 A;  4PK4 A;  3OW2 A;  1PKT A;  1K73 U;  2PVD B;  1ZSZ A;  3RR6 A;  3JCM Q;  2SEM A;  4ZGE B;  3EG0 A;  4M75 G;  1X01 A;  2F69 A;  4GLM A;  2DTH A;  5GAM h;  2PUO B;  1Q7Y R;  4C5G A;  3KFV A;  3CQT A;  4BAC A;  4M77 C;  3QJY A;  2C0O A;  4OMO A;  4PJO E;  1LJO A;  4M7A A;  1WXB A;  2NUT A;  4LD6 A;  2DL4 A;  2DPP B;  4MZM A;  2EQU A;  4C0D B;  2F2X A;  1MMA A;  5KCH A;  1UJ0 A;  2RI3 A;  5KCO A;  2E41 A;  3VUZ A;  3JB9 H;  4F17 A;  3QXE B;  1XNI A;  3L2W A;  3SWN A;  1ZUY A;  1QVG S;  4E7J A;  3CME A;  2WSF E;  1WNL A;  1YJ9 A;  3NGP A;  2GFU A;  4JJB A;  2LCC A;  2JM8 A;  4BI3 A;  1Q7Y C;  3VS4 A;  2JNG A;  3CCM A;  2IPO B;  5M9O A;  3CCS T;  1OEB A;  1SKU B;  4IUT A;  4FW1 A;  1QVF P;  1O75 A;  1GCP A;  2RK2 A;  4AFQ C;  2EIF A;  3NHN A;  4EDU A;  3P8H A;  2HMA A;  5FU7 C;  1M9S A;  4F7U A;  2D1X A;  1K0S A;  1QKX A;  3GIB A;  1H3H A;  4IIM A;  5GAO q;  2PU9 B;  2HD0 A;  4JS5 A;  4M7D G;  3CCV A;  2F2W A;  3NFC A;  1VYU A;  2HEQ A;  1Y07 A;  1Z9Q A;  2P0Q A;  4QVZ A;  4C92 D;  2VGN A;  2X35 A;  3HFN A;  2DX1 A;  1UDL A;  1VQ8 A;  3FEO A;  1VUB A;  1Y96 A;  2W10 A;  3OW2 P;  1EZZ B;  2AZV A;  2KAF A;  1M2V A;  1LVK A;  1DJ7 B;  5IT9 E;  2OAW A;  2RNA A;  1YI2 A;  4M7A E;  2L5Q A;  1KIK A;  2CDT A;  4DEX A;  2BTT A;  2M51 A;  4BE1 A;  2K5F A;  1YN8 A;  2VV5 A;  2ZPE B;  3M59 A;  4M78 F;  4C5E A;  2FRW A;  4E7H A;  1YJN A;  1KHC A;  2PVO B;  5GAM j;  1RAG B;  2CRE A;  3PNW C;  2DLP A;  4OF1 A;  3FIF A;  1EIF A;  5EG2 A;  2O4X B;  2Y4Y A;  3M0U A;  4QVD A;  2FL7 A;  1TUG B;  4RTU A;  2E65 A;  4KGV B;  5IHK A;  2DE0 X;  2PNI A;  3KBG A;  4FM4 B;  1ARK A;  2J05 A;  2KXC A;  1MV3 A;  1V76 A;  1XJW B;  3JCM X;  2DEQ A;  1G8X A;  4N4I A;  1NJI R;  4J9F A;  1GRI A;  2FZG B;  1JO8 A;  2GCX A;  3QDF A;  2RO0 A;  2YXY A;  2B86 A;  4C8Q E;  1OPL A;  2HKQ B;  1OU9 A;  4EMK C;  3O5Z A;  1WXU A;  5I22 A;  1N9S A;  1I5L A;  3CD6 Q;  2DF6 A;  2VB6 A;  5GAN 4;  2EGC A;  2DTO A;  1BK2 A;  2JVV A;  3MHX A;  5GAO l;  5GAO r;  2L3Q A;  2VUB A;  5KYX B;  5HY6 A;  1WJS A;  1WHH A;  4IUV A;  3J80 E;  1VQM Q;  2YUO A;  2AK5 A;  2LQ8 A;  5GAN d;  5GAM g;  1YCY A;  1VQ9 A;  1QW1 A;  3RBB B;  4CC4 B;  3JCM b;  2DYI A;  1X43 A;  4CC3 A;  1YIT Q;  1M1G A;  3X28 B;  4M7D F;  2V8K A;  1K9A A;  4A53 A;  4J9I A;  2EYX A;  3MEV A;  2CH4 W;  1SHF A;  3NTI A;  1VQ7 A;  1QQJ A;  3ZFJ A;  2HQX A;  3S6W A;  3CCE T;  2QI2 A;  4WTO B;  2KT8 A;  1W2B A;  1S72 A;  4KUI A;  3G6E Q;  4RG2 A;  2JZ2 A;  1TUD A;  3GP8 A;  2YUN A;  4CC7 A;  4OMM A;  4M75 A;  1ZX6 A;  3ASK A;  3VU3 C;  1ZA2 B;  3CD6 T;  1TTH B;  1SEM A;  1UGV A;  2QK0 A;  2QEX A;  4IUP A;  2P4T A;  3MKD A;  3EGX B;  4ELY C;  5HK3 A;  3G7Z A;  5CKH A;  2CP6 A;  3HFO A;  1BCM A;  3QWX X;  2HQH A;  1RL2 A;  2K5L A;  1K9M U;  3OYA A;  1G3Y A;  4PJO G;  4J83 A;  2A7Y A;  4FW2 A;  3VS2 A;  5J3B A;  1MUZ A;  2KNB B;  3R6O A;  1NG2 A;  2E64 A;  1TG0 A;  1UGP B;  2LVM A;  3LLR A;  2GF7 A;  1C1A A;  4A4K A;  1YJ9 Q;  1SRM A;  3JB9 D;  1Q82 R;  4BE2 A;  5CCA A;  3M55 A;  5CVI A;  2A28 A;  1NJI U;  3OSS C;  2RI2 A;  3CCM Q;  2CZ1 B;  5IHI A;  2E5Q A;  1VQL A;  4A4G A;  4ZN3 A;  3FB9 A;  4MDW A;  1M2O A;  1K76 A;  1ZSG A;  3G6E T;  4C92 C;  1B3Q A;  5GAN 2;  4PJL A;  2PTK A;  3NMZ C;  1PSE A;  1WJQ A;  1LOJ A;  4M7D A;  1RAD B;  1FMK A;  1HYO A;  3CCV Q;  3JB9 I;  1JXM A;  3THK A;  3DLM A;  3L2R A;  2XD0 A;  2XU8 A;  4B6M A;  4FSS A;  3M0Q A;  2D8H A;  3HPW A;  4EMK B;  3BY7 A;  3WVD B;  1Q82 C;  1QVG A;  1W2B P;  3CC7 T;  3EH2 A;  4J9G A;  5GAN f;  5GAM e;  1VQ8 Q;  2KMT A;  2RQW A;  4RCB A;  4O6J A;  1M90 U;  3EHQ A;  2RN8 A;  3MEU A;  3G4S Q;  2XID A;  1XOV A;  3A8G B;  2A3L A;  4RKU E;  2GGR A;  5EC7 A;  3EG3 A;  3J81 E;  3CME T;  1MMD A;  5I11 A;  1YJ9 T;  4HCC A;  3HRT A;  3M4Y A;  2I2L A;  4RMO A;  2DD4 A;  2NUZ A;  3CCM T;  2CZ7 B;  2JTE A;  4M78 C;  2B8A A;  4HT9 A;  2ZPH B;  1LCK A;  3VS1 A;  1U5S A;  3IQL A;  3CCJ T;  4IIO A;  2R57 A;  3FC3 A;  2EKH A;  5HK0 A;  2KT1 A;  1D09 B;  1G5V A;  1NEG A;  2RB6 A;  1TOV A;  2V1R A;  3CCV T;  3O8V A;  1SF9 A;  3EGD B;  2CH4 A;  3FRN A;  4JRI A;  2G3R A;  1YCS B;  1R0B G;  1VQ8 T;  1G2B A;  3ZEH A;  2VAS A;  4PJO F;  3UPU A;  4NS5 A;  4NOY A;  2HSE B;  4C8Q G;  3PT9 A;  4DBQ A;  3EFS A;  4RTX A;  1YI2 T;  2O4X A;  2VXF A;  3OA6 A;  1D3B B;  4C0Z A;  2CYZ B;  3RMS A;  3VRY A;  3X24 B;  1QVG P;  1FYN A;  3PMI A;  2RMO A;  4BB7 A;  4IUR A;  1WA7 A;  1ZQ1 A;  2QDL A;  2JJ9 A;  4C0D C;  1YJN T;  2EBP A;  2QG9 B;  4O5V A;  1VQ9 Q;  3UA6 A;  2DM1 A;  3C0C A;  3ER0 A;  3MEW A;  1OZ2 A;  3L2U A;  1M4Z A;  4QKU A;  2P4R A;  4RTY A;  4J9E A;  3ULR B;  5ECA A;  4JLG A;  4JRP A;  2LJ1 A;  4ESR A;  3MP8 A;  4FYV B;  3G71 Q;  5HKC A;  2KRM A;  2RHU A;  2KRS A;  5D6W A;  2ECZ A;  4J6W A;  4HVW A;  4F04 B;  4M77 A;  5AYF A;  2RQT A;  4C92 B;  4CRI A;  2C0I A;  4N4G A;  3OYC A;  1S72 Q;  3A5Z B;  1X75 C;  2J6O A;  5KYX A;  2NYS A;  4KUL A;  5LL6 S;  5GJW B;  3ME9 A;  5LJ5 d;  1MV0 B;  2QDY B;  2BZX A;  1N9R A;  1AWW A;  1ZUK A;  1Q86 R;  5FRM A;  4DQ2 A;  1PM3 A;  4AFU C;  1N8R U;  5FU6 C;  3CCU A;  1PWT A;  1IHV A;  2QEX Q;  4RTZ A;  4M7A F;  4KGX B;  2E6N A;  1AD5 A;  3JCM J;  4ZTF A;  1D0Z A;  3M0S A;  3KUF A;  3RDV A;  2LJ0 A;  3I9Q A;  2DIQ A;  1ZLM A;  2VWF A;  2AIR B;  1VQ9 T;  2ZGW A;  1YJW T;  2CZ0 B;  2DRK A;  2M02 A;  1H92 A;  2YLB A;  2FB7 A;  2RH2 A;  5GAN 6;  3QJ6 A;  1FMW A;  3OYE A;  1VQ5 T;  2VKN A;  5D6Y A;  1PNJ A;  1VQM A;  1Q86 C;  2CT4 A;  2A0F B;  3UDC A;  1LPL A;  2VYT A;  9ATC B;  1U1T A;  4M78 B;  4L5G A;  1VQ7 T;  2LNH B;  4J6Y A;  4FYY B;  5CKE A;  3WXM B;  1VQL Q;  1S72 T;  2CGH A;  1NBE B;  3CCQ T;  1AWO A;  1IGQ A;  3VJP A;  4TVR A;  3VRZ A;  3JCM V;  4XTW A;  4B9W A;  1PG5 B;  3L2Z A;  4C8Q F;  5FRN A;  4M77 E;  2DNU A;  1W4S A;  3AHU A;  1M30 A;  1KG1 A;  5KH6 A;  3EG9 B;  3HHT B;  3N5B B;  1GBQ A;  4XTY A;  2CP5 A;  2JT4 A;  2HCK A;  4FT2 A;  5HCK A;  2RI5 A;  5CKF A;  4LUD A;  1AZE A;  3M4G A;  2SRC A;  4C0F A;  1AVZ C;  3OYL A;  1PRL C;  4BY6 B;  3OBW A;  3S3N A;  2DXU A;  3V8L A;  2DXT A;  2OTJ A;  4Y92 A;  1KC8 R;  2RQR A;  2QTX A;  2ABL A;  3OYB A;  4A4E A;  4JZ3 A;  3I55 T;  1C0M A;  2YUQ A;  1SSH A;  3JRZ A;  3MET A;  2P84 A;  3C95 A;  4DA4 A;  1X6B A;  4LN2 A;  4N0A C;  2YDL A;  3KXT A;  2IG0 A;  2D8J A;  2WSC E;  4L59 A;  1VQL T;  4EMK A;  2D9T A;  2YRD A;  3SHW A;  2JW4 A;  2NUP A;  3I56 A;  1J3T A;  1YWP A;  1NZ9 A;  4DOW A;  1M1F A;  1AHJ B;  2QGG A;  3HKS A;  1KC8 C;  1VQK T;  2JOY A;  3URG A;  2BE9 B;  2K9G A;  3P8B B;  1M3C A;  2FEI A;  3LGL A;  1QWE A;  3OSV A;  2O88 A;  3HTR A;  1JEG A;  3CMA A;  2FVU A;  2C0T A;  3A8L B;  3PGG A;  4C8Q A;  4C5I A;  4HCZ A;  3CCL A;  2COW A;  4AT1 B;  5FU6 B;  1IHW A;  2QAZ A;  4AG2 C;  2EKO A;  5KYU A;  2DJQ A;  8ATC B;  4EIK A;  1M3B A;  3DB3 A;  4HCB A;  1HK9 A;  4J8O A;  4JS4 A;  3G4S A;  3TQ7 P;  1YHQ Q;  1U8R A;  2FPD A;  3JSC A;  2EPD A;  3A8M B;  4Z89 A;  3QG1 A;  4XTV A;  4VUB A;  4XU1 A;  2EQI A;  3H0F A;  4HKE A;  2LP5 A;  1WLP B;  1UEB A;  3OBY A;  4RTT A;  4JJD A;  3C94 A;  4FSX A;  5GAN h;  2QQB A;  2CSI A;  1VQO A;  1ZUU A;  2M1H A;  3A8H B;  2MMP A;  4PJJ A;  1QP2 A;  1KD1 R;  2F1L A;  3EFO A;  3WVE B;  1VIF A;  4II1 A;  2DRM A;  2JTF A;  4M75 F;  4DBH A;  1G3S A;  1BI0 A;  1TU0 B;  2XK0 A;  4A54 A;  2ZPI B;  2ENM A;  4M78 D;  1MMN A;  1UEC A;  4OB0 B;  3E19 A;  1Q7Y U;  2A37 A;  3CCU Q;  4HT8 A;  1K8A C;  1KQS S;  1UFF A;  4JZ4 A;  4PFO A;  5CKD A;  2LJ3 A;  2EGE A;  1WHM A;  1OOT A;  4RG8 A;  1P92 A;  4QT7 A;  1KD1 C;  4C92 A;  5A0D A;  2P0P A;  1D0X A;  2HSP A;  2K3X A;  5GMK j;  3M9Q A;  3C12 A;  1G3T A;  2HAX A;  2DBM A;  4GLK A;  3SWN C;  2OTL A;  2ESW A;  4FT4 A;  3A1P A;  3T9N A;  2ED0 A;  4FIB A;  4J9H A;  3REA B;  2F5T X;  1F1B B;  3TCJ A;  2LQN A;  3E9G A;  2YT6 A;  4OB3 B;  7AT1 B;  2AZS A;  2E12 A;  2DEU A;  1V29 B;  1IO6 A;  1NLO C;  4LUE A;  1AOJ A;  1TSF A;  2HBW A;  1R0C B;  2MAM A;  2DL7 A;  1YBY A;  1BB9 A;  3G71 A;  1GBR A;  2BIV A;  5GJV B;  5L8R E;  2OJ2 A;  3M0T A;  3UWN A;  2DTI A;  2DMO A;  1U3O A;  4XTZ A;  2ZPG B;  3TU4 K;  3H41 A;  1PHT A;  3CBM A;  2RHX A;  4M77 G;  1RAA B;  3CBO A;  1S1N A;  5GAN j;  1MND A;  1QWF A;  3V7C A;  1YP5 A;  2DA9 A;  4PJO B;  2MOX A;  5KE2 A;  5GAO n;  2OTJ Q;  3OYF A;  1M1K R;  3LH5 A;  2DJZ A;  4F14 A;  2LQK A;  2I0N A;  3JCM d;  4KH0 B;  3CPW S;  2FHD A;  1D0Y A;  1GCQ A;  2H8H A;  2YRC A;  4E7Z A;  2V8J A;  1VQM T;  1MHN A;  1H64 1;  1B34 A;  2AKK A;  4F16 A;  1NYF A;  4C92 E;  2NWM A;  4OB1 B;  3OS0 A;  3U23 A;  2GQV A;  4EPC A;  1I0C A;  3DLL A;  2RJE A;  3EG9 A;  5KYY A;  4XU3 A;  5CAI A;  4D8D A;  2R5M A;  1QVP A;  2MWP A;  2Z0W A;  2K2M A;  3M0R A;  4HVV A;  4OB2 B;  4QQ6 A;  2MI6 A;  1H3Z A;  3TVT A;  2L0A A;  2RD1 A;  1UGR B;  1YIT T;  2L3P A;  3EG2 A;  1MMG A;  2IIM A;  4X9C A;  2EQK A;  2EW3 A;  2MCN A;  3FDR A;  3I56 Q;  3H9N A;  1NPR A;  3S3O A;  3M0P A;  2E3I A;  1M1K C;  2KI7 A;  3V8K A;  2EQJ A;  4J5Y A;  3V8J A;  3CBP A;  2KRO A;  3GF5 A;  1V1C A;  1OU8 A;  5GAN g;  2KBT A;  5A0G A;  2COZ A;  1VQN A;  1TUC A;  1VA7 A;  2EWN A;  3D7S B;  3CMA Q;  2BUD A;  4PL6 A;  2KQW A;  2VGM A;  2X9H A;  3H0H A;  5CR2 A;  1ZSZ B;  3CCL Q;  3QDR B;  2QA4 A;  2KXD A;  2EYW A;  2G6F X;  4LE9 A;  2RQU A;  1N27 A;  3TRE A;  5GAN 8;  4M78 E;  1D1C A;  3QHS A;  4M7A B;  2IVW A;  2FPF A;  2NUT B;  5J26 A;  3VS5 A;  2D0Q B;  4N4H A;  1WXT A;  2OX7 A;  4GY5 A;  1T3L A;  4P5N A;  4KT0 E;  1N6A A;  4DEY A;  1BBZ A;  3LYI A;  2X51 A;  4X34 A;  1VQP Q;  4DOV A;  1Z9Z A;  3SWN B;  5IN1 A;  1K0X A;  1JXO A;  2J6F A;  1WHJ A;  4OML A;  3I56 T;  1WHG A;  2CSQ A;  3DB4 A;  2EYY A;  4JJN K;  1RLP C;  1X2K A;  3LWI A;  4M77 F;  5FRO A;  2MK5 A;  1VQO Q;  4D8K A;  1M27 C;  2YHT A;  1W70 A;  2WSE E;  1OQK A;  3LWH A;  4Y91 A;  1WJR A;  4F7U B;  1A0N B;  3CMA T;  1R8O B;  2E10 A;  4E2F B;  4OMN A;  1FWZ A;  5L23 A;  1GFD A;  2YSQ A;  1OPK A;  3CCL T;  2DAQ A;  3X26 B;  4ZTJ A;  1OI1 A;  2X3X D;  3OMC A;  3EG1 A;  3CXC A;  4M75 C;  2JS2 A;  3L2V A;  5I2M A;  2PVG B;  3VKI A;  2HKN A;  5LJ5 h;  1Y71 A;  2CUD A;  2DIL A;  1I07 A;  3OMG A;  1Y96 B;  3OB9 A;  3G4S T;  3VS7 A;  5KYN A;  3SFM A;  3MP6 A;  3SB2 A;  4BY6 C;  5LJ3 h;  1M2V B;  2CKK A;  1FX7 A;  5A2Q E;  3QPH A;  1U06 A;  4HVU A;  5KE3 A;  4ORZ A;  2CS7 A;  2K6D A;  2O01 E;  1YFN A;  2CZ6 B;  2J6K A;  2C06 A;  1M3A A;  2OTL Q;  1Q82 U;  4DBR A;  4OMP A;  2YWW A;  5GAN 3;  5KYW B;  1CKB A;  1VQO T;  3E2U A;  1YHQ A;  4PJO D;  1LNX A;  2LX7 A;  2O9S A;  1Q81 C;  1RAI B;  1QLY A;  1HXD A;  4Z8A A;  5GAN e;  2XIC A;  2LNV A;  2O2O A;  1BI3 A;  3MPU B;  3PVL A;  2DXB A;  1ZBX A;  3Q1J A;  5CQX A;  1OUL A;  2EVR A;  3C4S A;  1JBM A;  1T0H A;  1H8K A;  1FXX A;  2K2V A;  2JM9 A;  4WF2 A;  1KQS A;  1JQQ A;  2R58 A;  4PFP A;  4M7D C;  1KFZ A;  3V7S A;  4J7I A;  2E70 A;  4E6R A;  2AKL A;  1K1Z A;  5GMK i;  3BFM A;  4N0A A;  3HSB A;  3LX7 A;  2E6Z A;  2EJG A;  2GTJ A;  1SPK A;  2KK4 A;  3HP9 A;  4FU6 A;  4KUD K;  1UHF A;  2ZZD A;  3RIR A;  2YLC A;  3LGF A;  3RKW A;  4AFZ C;  2FG0 A;  1WQ7 A;  2COY A;  3QYH B;  5LJ3 d;  2DL3 A;  1QCO A;  3CXC P;  1ABQ A;  3OYY A;  1K73 C;  4E7L A;  3QWY A;  2HDA A;  1K4U S;  1QCF A;  2DBK A;  2OTL T;  1VYT A;  3UF4 A;  2EQM A;  3F70 A;  2PQW A;  3A8O B;  1G83 A;  1Y7X A;  1PC0 A;  1RLQ C;  3ZL7 C;  2KVQ G;  3QYG B;  3CCE A;  2AT1 B;  1TWB A;  3JAM E;  1E6H A;  5FW9 A;  4C92 G;  3HRU A;  5LJ5 j;  2CP3 A;  1BYM A;  1IRE B;  4QQD A;  1RI0 A;  3CC2 Q;  3R6N A;  3FJP A;  4ANJ A;  1RAH B;  3ZBD A;  3M5A A;  2E5K A;  2K7A A;  3VS0 A;  3G71 T;  4M7A D;  3RNJ A;  3NTH A;  4BI4 A;  1SSF A;  5LJ3 j;  4RTV A;  4BDY A;  3OYI A;  4XK8 E;  2MIO A;  2KEA A;  3PTA A;  1NPP A;  3EGX A;  3CPW A;  1VQN Q;  2D0N A;  1JRI A;  3OYN A;  1BIA A;  4LD9 K;  5I21 A;  4M75 B;  4J9B A;  4ME7 A;  1KQS P;  2DXC A;  3H0I A;  4HCK A;  2QA4 Q;  2QEX T;  4PNO A;  1XQH A;  2HBP A;  1BI2 A;  4XAX B;  2LQW A;  3HL8 A;  2EGA A;  3AT1 B;  3OS2 A;  2PZ1 A;  4ATO A;  3RES A;  2GBQ A;  3CC4 A;  3PVQ A;  2ED1 A;  4ZNX A;  2DL8 A;  1U1S A;  4LXC A;  1WHL A;  4M78 G;  2ROL A;  2QGF B;  1KHI A;  5LJ5 g;  3L2Q A;  1YNZ A;  1Y57 A;  5C6S A;  4LDX A;  4BI8 B;  1PRM C;  4E47 A;  3PE0 A;  2X4W A;  1MNE A;  4DBF A;  1VIE A;  5I2S A;  2RHI A;  5LJ3 g;  4GBQ A;  2LRQ A;  4Y28 E;  5IH2 A;  3V7R A;  2YUP A;  4J7F A;  3RKY A;  5LJ5 f;  3CC7 A;  1I8F A;  1VQN T;  2RHZ A;  2KGT A;  3OS1 A;  2DK3 A;  1QMC A;  2L89 A;  2GTO A;  4M7D B;  3CCR A;  3UAT A;  5LJ3 f;  2QQR A;  4MMK A;  1Q86 U;  2QA4 T;  1X27 A;  1XTD A;  1X6O A;  2KR3 A;  3JCM c;  1BCO A;  2Y4X A;  2RK1 A;  1WHK A;  1NE8 A;  3QSU A;  2RF0 A;  5GMK h;  3QII A;  2K3Y A;  1UJY A;  5CKB A;  2ZPF B;  4ZGJ B;  3CPW P;  1AT1 B;  4K11 A;  1WGS A;  3X25 B;  1VQ4 A;  2DZ9 A;  2GFA A;  3VYG A;  4C92 F;  1VQ6 A;  4PJO C;  1R77 A;  1JB0 E;  4JDS A;  2KRN A;  2M16 A;  4PJM A;  3CCJ A;  4KH1 B;  2GQI A;  4A63 B;  2FPE A;  2M0O A;  1KJW A;  2XKO C;  1RI9 A;  2VC8 A;  3EGD A;  2OAU A;  3RKX A;  3CXC S;  1RAB B;  2EJF A;  2F2V A;  4YTL A;  4J9D A;  1VQP A;  5GAM d;  3E1S A;  2VVK A;  4ZGD B;  1WFW A;  1TS9 A;  2A36 A;  3EAE A;  1X2Q A;  2LCS A;  5CK9 A;  3OY9 A;  5A0L A; 
#chains in the Genus database with same CATH homology
 1GL5 A;  1GCQ A;  1YCS B;  2H8H A;  2FRY A;  1QKW A;  4F16 A;  2AKK A;  1NYF A;  1G2B A;  2NWM A;  3I5R A;  3U23 A;  1I0C A;  4AFS C;  1OV3 A;  1NLP C;  1Y0M A;  4D8D A;  1WDX A;  2JXB A;  5IXF A;  3M0R A;  2K2M A;  4HVV A;  1X6G A;  3TVT A;  4Z88 A;  2L0A A;  4RTX A;  2L3P A;  3EG2 A;  2IIM A;  1AEY A;  2EW3 A;  2MCN A;  1AWX A;  2O31 A;  3M0P A;  3VRY A;  1E6G A;  1FYN A;  4RUG A;  2RMO A;  1WA7 A;  1PKT A;  2KE9 A;  2QDL A;  2KRO A;  2EBP A;  1V1C A;  1UG1 A;  2SEM A;  3UA6 A;  2DYB A;  4JPB W;  3EG0 A;  2DM1 A;  2KBT A;  3C0C A;  1TUC A;  1VA7 A;  4GLM A;  2P4R A;  4RTY A;  4J9E A;  3ULR B;  5ECA A;  1M8M A;  2LJ1 A;  3H0H A;  4ESR A;  3KFV A;  3CQT A;  3VS3 A;  2C0O A;  4OMO A;  1WXB A;  2KXD A;  2KRM A;  2DL4 A;  2EYW A;  2G6F X;  2KRS A;  2F2X A;  2ECZ A;  4LE9 A;  4HVW A;  1UJ0 A;  2DVJ A;  2RQU A;  2RQT A;  1NEB A;  2C0I A;  2ROT A;  2K79 A;  2FPF A;  2J6O A;  4F17 A;  5GJW B;  3VS5 A;  3VS6 A;  1ZUY A;  1MV0 B;  1WXT A;  1T0J A;  1T3L A;  3NGP A;  4JJB A;  1JU5 C;  2BZX A;  1N5Z A;  1BBZ A;  2KYM A;  4DEY A;  1AWW A;  1ZUK A;  1X69 A;  2JM8 A;  1ABO A;  4JJC A;  3VS4 A;  1Z9Z A;  3TSZ A;  4AFU C;  1K0X A;  1JXO A;  2J6F A;  4OML A;  1PWT A;  1SRL A;  1OEB A;  4RTZ A;  2FO0 A;  2CSQ A;  2EYY A;  1RLP C;  1GCP A;  1AD5 A;  4AFQ C;  3NHN A;  1X2K A;  3M0S A;  2D1X A;  1NYG A;  2LJ0 A;  3I9Q A;  1ZLM A;  1K0S A;  1QKX A;  4HXJ A;  2VWF A;  1H3H A;  4D8K A;  1M27 C;  4IIM A;  1W70 A;  2DRK A;  1B07 A;  1H92 A;  3UA7 A;  2F2W A;  1A0N B;  1VYU A;  2HEQ A;  4OMN A;  5L23 A;  1GFD A;  2EYZ A;  2YSQ A;  1OPK A;  2V1Q A;  1EFN A;  1Z9Q A;  2VKN A;  1HD3 A;  1PNJ A;  2CT4 A;  2DX1 A;  2X3X D;  3EG1 A;  1UDL A;  5IXB A;  2JS2 A;  2W10 A;  2LNH B;  1UHC A;  2KYB A;  3SEM A;  2AZV A;  2CUD A;  2DIL A;  1AWO A;  1I07 A;  2OAW A;  2RNA A;  1KIK A;  3VRZ A;  2CDT A;  4DEX A;  2BTT A;  3VS7 A;  2M51 A;  1YN8 A;  2DNU A;  2M0Y A;  1M30 A;  1U06 A;  1GBQ A;  4HVU A;  2FRW A;  4ORZ A;  2K6D A;  2JT4 A;  2HCK A;  4KRT A;  5HCK A;  2J6K A;  2CRE A;  1M3A A;  2DLP A;  2L3S A;  4LUD A;  4OMP A;  1AZE A;  3M0U A;  2X3W D;  2SRC A;  1UTI A;  1CKB A;  1AVZ C;  1PRL C;  4RTU A;  2LX7 A;  2O9S A;  4WCI A;  5IHK A;  1QLY A;  2DE0 X;  4Z8A A;  2PNI A;  1ARK A;  2J05 A;  2KXC A;  1MV3 A;  2O2O A;  4Y92 A;  3PVL A;  2RQR A;  2ABL A;  2EVR A;  1E7O A;  4JZ3 A;  1T0H A;  1H8K A;  2YUQ A;  1SSH A;  1GRI A;  4J9F A;  2JM9 A;  1JO8 A;  2JS0 A;  2JMC A;  4R0K A;  1JQQ A;  1X6B A;  2B86 A;  1W6X A;  4LN2 A;  1OPL A;  2YDL A;  1KFZ A;  2RQV A;  2D8J A;  3O5Z A;  3TSW A;  1GFC A;  2AKL A;  1K1Z A;  4E6R A;  3EGU A;  1WXU A;  5I22 A;  1WYX A;  2W0Z A;  2GTJ A;  1SPK A;  2LZ6 B;  2DF6 A;  2O9V A;  3SHW A;  2JW4 A;  2EGC A;  1UHF A;  1J3T A;  1YWP A;  1BK2 A;  2L3Q A;  4AFZ C;  2RPN A;  2FG0 A;  2YUO A;  2AK5 A;  2DL3 A;  1ABQ A;  2K9G A;  3I5S A;  3RBB B;  3QWY A;  1M3C A;  2FEI A;  2HDA A;  4AG1 C;  1QCF A;  1K4U S;  2DBK A;  4CC4 B;  1QWE A;  2K3B A;  2O88 A;  1VYT A;  3UF4 A;  1JEG A;  4LNP A;  5FWB A;  1X43 A;  1G83 A;  2C0T A;  1RLQ C;  4CC3 A;  3ZL7 C;  2J06 A;  2JMA A;  1E6H A;  5FW9 A;  4AG2 C;  1K9A A;  4J9I A;  2EYX A;  2CH4 W;  2DJQ A;  4EIK A;  1SHF A;  3R6N A;  1M3B A;  2E5K A;  2K7A A;  3VS0 A;  2A08 A;  2KT8 A;  3RNJ A;  4RTV A;  1TUD A;  4M4Z A;  2GNC A;  2YUN A;  4CC7 A;  2MIO A;  4OMM A;  1ZX6 A;  2KEA A;  2FPD A;  1HSQ A;  2EPD A;  4Z89 A;  1AWJ A;  1WI7 A;  1T3S A;  1NM7 A;  2D0N A;  2EQI A;  1GCQ C;  1SEM A;  3H0F A;  1UGV A;  3NPF A;  2OI3 A;  2LP5 A;  1KSW A;  1WLP B;  4RTT A;  4J9B A;  4JJD A;  2CSI A;  3H0I A;  4HCK A;  1ZUU A;  2LQW A;  3QWX X;  1WIE A;  2EGA A;  2BZY A;  2PZ1 A;  3VS2 A;  2GBQ A;  3PVQ A;  2KNB B;  1MUZ A;  2DRM A;  1NG2 A;  2ED1 A;  1TG0 A;  3GBQ A;  1I1J A;  4ZNX A;  1YWO A;  2DL8 A;  2ROL A;  5IHN A;  2LMJ A;  1YNZ A;  2J7I A;  1PKS A;  1SRM A;  1Y57 A;  2ENM A;  1UEC A;  1PRM C;  2A28 A;  3PE0 A;  2A37 A;  1UUE A;  5IHI A;  2L2P A;  4RTW A;  4GBQ A;  1K76 A;  1ZSG A;  1BU1 A;  1UFF A;  4X1V A;  4JZ4 A;  1B3Q A;  5IH2 A;  1UE9 A;  4J9C A;  2LJ3 A;  2PTK A;  2XMF A;  2EGE A;  3NMZ C;  2YUP A;  1OOT A;  4QT7 A;  2CUB A;  1AZG B;  1FMK A;  1CSK A;  2HSP A;  1JXM A;  2KGT A;  3THK A;  1SHG A;  1WX6 A;  2GTO A;  4FSS A;  3M0Q A;  2DBM A;  2D8H A;  3UAT A;  2ESW A;  4J9G A;  2ED0 A;  4J9H A;  3REA B;  1X27 A;  2RQW A;  2CT3 A;  3EHR A;  2LQN A;  1RUW A;  2KR3 A;  3A98 A;  3EHQ A;  2RN8 A;  2YT6 A;  2AZS A;  2BZ8 A;  2RF0 A;  3FJ5 A;  1XOV A;  1IO6 A;  1NLO C;  4LUE A;  1UJY A;  1AOJ A;  2HBW A;  1W1F A;  2GGR A;  4K11 A;  5EC7 A;  2DL7 A;  1VYV A;  3EG3 A;  1BB9 A;  1GBR A;  5I11 A;  5GJV B;  2OJ2 A;  3M0T A;  2DMO A;  1U3O A;  2KRN A;  5FWC A;  4CC2 A;  3H41 A;  2NUZ A;  1PHT A;  2JTE A;  2DL5 A;  2GQI A;  4A63 B;  1S1N A;  2FPE A;  1KJW A;  1RI9 A;  1LCK A;  3VS1 A;  1QWF A;  1U5S A;  1ZBJ A;  3IQL A;  4OMQ A;  1HJD A;  1CKA A;  1YP5 A;  2DA9 A;  3JV3 A;  4IIO A;  2F2V A;  2MOX A;  2EKH A;  3I35 A;  2KT1 A;  4J9D A;  1NEG A;  2V1R A;  2VVK A;  1WFW A;  3LH5 A;  4F14 A;  2A36 A;  2LCS A;  1X2Q A;  3REB B;  2CH4 A;  2I0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...