2AZSA

Nmr structure of the n-terminal sh3 domain of drk (calculated without noe restraints)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2-SH3 adapter protein drk
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azsA00
3EHQA 4J9BA 2D8HA 1MV3A 2JXBA 2LX7A 2FEIA 2MCNA 1YWOA 1UJ0A 1E6HA 1H3HA 2O9SA 2GTJA 3GBQA 3C0CA 2CH4A 2JTEA 1N5ZA 2OJ2A 1CKBA 2P4RA 2YUOA 2O88A 5EC7A 3VS5A 2DL3A 4OMPA 2ED1A 5IHNA 1K9AA 2J7IA 2QDLA 1NEBA 1M3CA 2J6OA 3M0PA 2EYWA 3PVLA 2RNAA 2GQIA 4JPBW 2E5KA 1S1NA 1BBZA 2ESWA 3NHNA 1V1CA 2LJ1A 4J9HA 2DL7A 1FMKA 1AZEA 2C0TA 4K11A 1T0JA 3EG0A 1UG1A 1K4US 3VS2A 2KXCA 1KFZA 3RNJA 4ORZA 3O5ZA 4HVVA 1QKXA 1YNZA 1B07A 2DNUA 2HDAA 2JM8A 1AOJA 5GJVB 4CC2A 2L2PA 2OI3A 2DL8A 4Z88A 2C0OA 3PVQA 2YSQA 1M3AA 4R0KA 1X69A 2KXDA 4LUDA 1GBQA 1WI7A 1UUEA 1GBRA 4AFQC 1QWEA 1YCSB 2A08A 4E6RA 3PE0A 2JW4A 3VS3A 2I0NA 2LQWA 1SRMA 1KJWA 3UA6A 2RMOA 1UFFA 2XMFA 4JJCA 5FWBA 1X2QA 1NLPC 1ZUUA 2G6FX 3VS6A 2JT4A 4Z89A 3H0HA 1VA7A 2LQNA 3LH5A 2PTKA 2CUDA 3THKA 4F16A 5ECAA 4KRTA 1I1JA 2B86A 2DE0X 2LP5A 2K2MA 2VKNA 1ZBJA 4ESRA 4RTYA 1PNJA 2BZYA 1AWOA 1PWTA 2CREA 2LNHB 2NWMA 4M4ZA 4RTWA 3H0IA 2W10A 2RQWA 3EGUA 1UHFA 2LJ0A 2JMCA 3M0TA 1W70A 1X6GA 2K3BA 4AFUC 1UJYA 4J9GA 3EG2A 1T0HA 2D8JA 3QWXX 2F2VA 2CDTA 2KGTA 4J9EA 1T3SA 1WXTA 4HVWA 1WFWA 3VS1A 3UF4A 3IQLA 3NPFA 3CQTA 3A98A 1M8MA 2ROLA 3I5SA 3FJ5A 1CKAA 2C0IA 2SEMA 1GFCA 2OAWA 5I22A 1K0XA 3UA7A 1EFNA 3I9QA 4RTUA 2KRNA 2F2WA 2F2XA 1NEGA 2DL5A 3UATA 1ZUKA 4HXJA 1PKSA 1AWXA 2AKKA 2DF6A 5IXFA 4RTXA 2GGRA 1SRLA 4IIOA 1X27A 2L0AA 2EBPA 2FPDA 1UE9A 1HD3A 2KE9A 1E6GA 1VYVA 2J06A 4LUEA 2L3QA 1WDXA 3VS0A 1ABOA 1CSKA 4OMQA 1JEGA 3EG3A 2EKHA 2JMAA 2RQRA 3U23A 2RQVA 1BB9A 3M0RA 1AZGB 1Z9ZA 2EW3A 2DBKA 2H8HA 1YWPA 2DVJA 2D1XA 1QWFA 2O2OA 2VWFA 1FYNA 2FRWA 2W0ZA 4AG2C 1KIKA 1A0NB 2HBWA 2MIOA 4LN2A 2RPNA 2DYBA 1MUZA 4JZ4A 2O31A 4CC4B 1UDLA 4D8KA 1NG2A 2DA9A 1TG0A 3I5RA 1IO6A 1I07A 1Y57A 2KR3A 1AD5A 2AZSA 1TUDA 2IIMA 4GBQA 1JQQA 4HCKA 2YT6A 4OMOA 2ENMA 4J9DA 1T3LA 2A37A 2FPEA 2J05A 1OPLA 5IHIA 2AZVA 1H92A 2NUZA 2ABLA 1NYFA 2HSPA 4F17A 2KRSA 4X1VA 2EGCA 4D8DA 2D0NA 4JJBA 2KROA 3KFVA 3TVTA 1X6BA 1BK2A 4A63B 1SEMA 1ZSGA 2YDLA 2KRMA 2K9GA 2JS2A 5GJWB 2LCSA 1JU5C 4J9CA 1UECA 1M27C 1YP5A 2VVKA 2K79A 2RF0A 2O9VA 1ABQA 4DEXA 1JXMA 2YUNA 2YUPA 1WIEA 2HEQA 1AVZC 1QLYA 1W1FA 3R6NA 4LNPA 4F14A 5I11A 4FSSA 1WLPB 1WYXA 1VYUA 2SRCA 1K76A 1HSQA 4J9IA 2RQTA 2PZ1A 2X3WD 1X43A 1KSWA 2CSIA 2CUBA 1J3TA 2AKLA 3JV3A 1JO8A 3EHRA 1RUWA 2KYBA 1SPKA 1VYTA 2DLPA 4IIMA 2M51A 3ZL7C 2DBMA 4Z8AA 2YUQA 3H0FA 1LCKA 4QT7A 2EYZA 1ARKA 2RQUA 2V1RA 2BTTA 4RTVA 1SHFA 1GL5A 1GCQC 2GTOA 2KT1A 2EGAA 2DL4A 3M0SA 1QCFA 3H41A 5IHKA 2J6FA 1E7OA 2KBTA 2DILA 4OMNA 1B3QA 4OMLA 2HCKA 1ZLMA 1QKWA 2EPDA 2RN8A 2EYYA 1SSHA 1RI9A 1SHGA 2PNIA 4AFZC 1YN8A 2DMOA 3VS7A 1UHCA 2ECZA 1AEYA 2GNCA 2LJ3A 2FG0A 2BZ8A 4OMMA 1K1ZA 1U06A 1GCQA 2DX1A 2GBQA 1BU1A 1NM7A 4WCIA 3TSWA 1WXBA 4RTTA 2MOXA 2KYMA 1G83A 2FPFA 1U5SA 1M30A 4JZ3A 1WXUA 2LZ6B 1M3BA 3NGPA 1W6XA 2L3SA 3ULRB 3SHWA 3RBBB 2ROTA 5HCKA 4RTZA 2DRMA 4ZNXA 3VRZA 2A28A 1OOTA 2AK5A 4HVUA 4EIKA 2J6KA 1GCPA 1OV3A 2EVRA 2X3XD 1TUCA 1U3OA 1PRLC 2CSQA 1K0SA 1AWJA 1UGVA 1MV0B 1AWWA 2FRYA 1RLPC 4JJDA 3VS4A 3REAB 1OEBA 2K7AA 5FWCA 4AFSC 1H8KA 3I35A 1ZUYA 4RUGA 4DEYA 2JM9A 1PHTA 1PKTA 1PRMC 4LE9A 1NYGA 2CH4W 2CT4A 1Z9QA 2FO0A 3TSZA 3REBB 1UTIA 1G2BA 2ED0A 2KEAA 2BZXA 1ZX6A 5FW9A 3QWYA 2LMJA 2DM1A 2JS0A 3M0UA 1GRIA 1XOVA 2DJQA 1GFDA 1JXOA 3VRYA 1X2KA 2KT8A 3M0QA 3EG1A 2KNBB 4J9FA 5IXBA 4GLMA 1OPKA 4CC3A 4Y92A 4AG1C 1RLQC 2CT3A 2EYXA 1HJDA 2K6DA 2M0YA 1WX6A 1WA7A 2EQIA 1I0CA 2A36A 4CC7A 5L23A 2DRKA 3NMZC 2EGEA 1Y0MA 1NLOC 2V1QA 2L3PA 5IH2A 3SEMA
chains in the Genus database with same CATH superfamily
3L2WA 4X9CA 3OQ5A 1YWOA 1H3HA 2GTJA 2P84A 2QGFB 2KVQG 4KUIA 3TQ7P 5GAN4 2ED1A 5IHNA 1K9AA 1XNIA 1NEBA 4LXCA 3M4GA 4PJJA 3QHSA 3OYAA 1HK9A 5LJ3e 2GQIA 2ZZDA 1BBZA 1KHIA 3NHNA 4J9HA 1C1AA 1K73U 4C8QD 4BE0A 5KYYA 4QVCA 5GAN5 1PM3A 3HHTB 1BCMA 4D6WA 8ATCB 5HKCA 3DKMA 2LT1A 3J80E 2KXCA 3RKYA 2MPXC 3RNJA 1TTHB 2DNUA 3MCAB 5GJVB 4CC2A 1WZOA 2K2VA 2DL8A 2HD0A 3CCUQ 1WJSA 2WACA 1YHQQ 4M75D 3X25B 2OTJT 3JCMd 3QSUA 1YJNA 3G71Q 4LUDA 1IRXA 5GAN7 4C8QB 4EMKC 1GBRA 4KH1B 3CCQA 2FHDA 1VQ8T 1QWEA 1YCSB 2HL3A 1YBYA 3PE0A 1Y07A 3OMGA 1M1KR 3CBOA 2IG0A 1KJWA 3GP8A 1YI2A 4JJCA 1M9SA 2HL5C 3KUFA 3VS6A 4Z89A 2QEXQ 4M75B 1D09B 2E3HA 3CCJT 2RJCA 1UB4A 5GAMj 2CUDA 1I1JA 2DE0X 2VKNA 3BDUA 4TVRA 4JRKA 2OTLT 1AWOA 1QVPA 1TU0B 1WJRA 4M4ZA 4RTWA 1QCOA 4E7SA 4C92B 3H0IA 2PQWA 3EGUA 3JB9H 5I21A 3OYNA 2A0FB 2CP5A 3X20B 5GAMg 1BYMA 2YRDA 4E7LA 3HFOA 5KYXA 3J7AF 2CDTA 4XU0A 1WXTA 1W4SA 5KYWA 5I2MA 1VQKQ 1OU8A 1JJ2A 3ZFJA 3A98A 1M8MA 2CYZB 1VQ5A 3Q1JA 1YCYA 3PMTA 3S3OA 2B8AA 3OMCA 5I22A 4M7DD 4BD3A 4ZTFA 1NJIU 3I9QA 4MZPA 3CCVQ 1NEGA 2DL5A 5LJ3g 4C8QE 2KDSA 4OB0B 1Q86C 2L89A 2AKKA 2EBPA 2WSCE 4FT4A 1UE9A 1GXIE 2KSSA 3OS5A 3C95A 2QG9B 3H8ZA 2AIRB 2J06A 5HK3A 3OYDA 1KD1R 4A4EA 4XTZA 4OMQA 2HQEA 4N0AA 1MMDA 2RQRA 3E19A 4M7DB 1W2BA 3M0RA 3CC7Q 3CCLA 4KH0B 1M90U 3CPWA 1Q86R 4QVDA 4BE1A 4WF2A 2D1XA 1QWFA 2O2OA 1D0XA 4AG2C 4R56A 4C92E 1Q81U 2LVMA 2RPNA 4M77G 4JZ4A 2RK2A 1IZ6A 3EGDA 2ZPBB 1VQNQ 3JSCA 2CS7A 3VJPA 2IIMA 1G5VA 5CO7A 2K3XA 4OMOA 3OBWA 1OULA 3GPLA 5GAOl 3C12A 4M75C 5LJ5j 4PFOA 5IHIA 1G3SA 4OB2B 1H92A 3CCMT 2HSPA 1YIJT 4X1VA 2WSEE 1TUGB 3X28B 3EFSA 3DLMA 2QQSA 3OB9A 3CD6Q 1LNXA 2OTJA 3TEEA 2JS2A 2XK0A 4AMCA 2VGMA 2XI9A 4M7AD 4IURA 3FEOA 5LJ5g 4OGCA 2RF0A 4DOWA 3RUXA 1F1BB 3JCMf 1WHJA 4FM4B 2YUNA 2RI5A 2HEQA 1W1FA 3R6NA 4C8QF 1RL2A 3HL8A 2I2LA 3SD4A 4J9IA 3T9NA 2PZ1A 2X3WD 3QIIA 1KSWA 2CSIA 3CCET 3JB9G 4A53A 1KQSS 5GAMd 4M78D 4M7AB 1I5LA 4M7DE 3ZL7C 1OX8A 1XQHA 2DBMA 4PJOD 5CQXA 1VQPQ 5GAN6 5AYFA 4QT7A 2RQUA 2QI2A 1MGQA 4J6WA 2EAYA 2K5IA 2GTOA 1WPYA 3MP8A 3ME9A 2LQKA 4C92F 3E9FA 1ZLMA 3M59A 1TH7A 3BY7A 4M78B 2RN8A 1VQ4T 4RMOA 4UC4A 2FVUA 4BDYA 1YN8A 3CBPA 3MEWA 1YJ9Q 2ECZA 4MMLA 3S3MA 2LTOA 4OMMA 1K1ZA 1AT1B 1GCQA 4J8OA 1G8XA 2DO3A 9ATCB 2DAQA 4J6XA 1ZA2B 2MOXA 3SWNC 4AT1B 5CKDA 3JB9J 1U5SA 3OYLA 5CAIA 1M3BA 1YHQT 1W6XA 4A54A 1EX4A 2JN0A 3G71T 5HCKA 1QCNA 4HVUA 4F7UG 2J6KA 4E7IA 1OV3A 2EVRA 5CKFA 5DY9A 1QVGP 4E7HA 1VQMT 1QQJA 1K9MR 2Y90A 2CSQA 1UGVA 1MV0B 1AWWA 5GANj 2IVWA 1Q82C 4M7AE 2K7AA 5EG2A 5FWCA 3V7SA 4FCYA 1H8KA 2P4TA 3I35A 2JM9A 3TSZA 2FZGB 3REBB 1V29B 4M7DF 1KC8U 2BZXA 1ZX6A 5FW9A 3QWYA 2LMJA 3S6WA 3INZA 3VKIA 3G4SQ 2DTHA 4ZGJB 4E7KA 2DJQA 4M77A 5C6SA 3GNGA 3EG1A 5LJ5d 5GANg 2KNBB 3OYFA 4M78E 1IGQA 2GFAA 4Q5WA 5IXBA 1OPKA 1Q82R 4AG1C 1K8AR 1YIJA 1HJDA 2K6DA 2M02A 1WX6A 5KE2A 5L23A 3EFOA 2DXUA 5GMKe 5IH2A 2Z0WA 3EHQA 4J9BA 4QQDA 2GFUA 2O4XB 2JXBA 4FYXB 1VQKT 4C0DB 1ZHIA 1YFNA 3RMSA 2CZ0B 2XICA 3LWIA 2CH4A 5KYUA 2OJ2A 2O88A 3RMQA 5EC7A 3E1SA 1K73C 4OMPA 3L2RA 2X35A 4NOYA 4C5EA 3CCVT 2J7IA 3CMET 1OQKA 2QDLA 3FB9A 3QYHB 4KGXB 4PJOC 2BE7D 4HCCA 2WSFE 4LDYA 1VUBA 2RNAA 1VQ7Q 4JPBW 4PJLA 2E5QA 2ESWA 1VIEA 1Y96B 4FW1A 2JOYA 5DLOA 3HPWA 3RDVA 1PCXA 3C4SA 4QQGA 1AZEA 3OYMA 4RKUE 1K4US 5GAMf 3G6ET 4FU6A 3FC3A 3O5ZA 1G3WA 1YNZA 1B07A 2JM8A 2HDAA 5GAN2 1H3ZA 1AOJA 1S72Q 4M7AF 1G3YA 3QKJA 4Z88A 4KGZB 2ZPFB 5CIUA 2NUTA 4M75G 4LDWA 3GIBA 3MPUB 1M3AA 2E4HA 3M54A 4J5YA 3F70A 1WI7A 1VQ4A 2R58A 2A08A 2EYQA 2EJGA 4XTYA 3JCMJ 3V8JA 2LQWA 1Y71A 1BKBA 5IN1A 1B34B 2RMOA 4M78F 1UFFA 1D0ZA 1VQ9T 3M5AA 1ZUUA 2G6FX 5DLQE 4MDXA 3CC2T 4RCCA 2LQNA 4ZTJA 4EMKA 3CD6T 1BI0A 5GAOr 1HYOA 4KRTA 4Y28E 2K2MA 2D6FA 1I8FA 3OYHA 2CREA 2LNHB 4LD9K 2DIQA 2ATCB 4BUGA 1JJ2S 2QAZA 4FYWB 2DETA 1KHCA 3QDRB 2DZ9A 1VQMA 2GQVA 2DKGA 2Y4YA 2YLCA 3CCST 4F7UA 5GANd 1N8RU 2BIVA 1UGQB 1T0HA 2RB6A 3EG2A 3HRUA 2V8KA 3QWXX 3ZEHA 3TU4K 1ZA1B 2BUDA 4J9EA 1T3SA 2QQ9A 3BDLA 3CC4Q 2D0QB 1EZZB 2X9HA 4N4IA 1VQPT 5CKBA 3VU3C 2ZAEA 3CQTA 4J7IA 2ROLA 5IAYA 1M2VB 2HQXA 1QP3A 3UDCA 2C0IA 2V8IA 1OU9A 3HRSA 3UA7A 1W2BS 2RJFA 1EFNA 4RTUA 2KRNA 3UATA 1IXDA 1IHWA 3M53A 3CPWS 2MWPA 3QDFA 4OP0A 4IIOA 1X27A 5CKHA 5KYYB 5LJ5f 2F1LA 2X51A 2EQKA 5KYNA 3CXCA 1M90C 1YJ9T 1VQLT 4BI3A 2COWA 2MK5A 2L3QA 1QMCA 1JB0E 4V2SA 2CZ1B 3EG3A 2LCLA 5HY6A 1Q81C 1BCOA 2ZPHB 1QVFA 3GOXA 2LT4A 2VASA 2EW3A 4E47A 3PT9A 3CCVA 3CMEA 2FRWA 1KIKA 5CQYA 3FDRA 2MIOA 3MEAA 5I2SA 2O31A 5CVIA 4D8KA 2DA9A 3I5RA 4C92D 1Y57A 4HCZA 1AD5A 1TUDA 3FLGA 4GBQA 1JQQA 2YT6A 2MAMA 4P5NA 3CCRA 1T3LA 5GMKm 1LVKA 1OPLA 2DEUA 2AZVA 3G6EA 1M1GA 4F17A 1BI1A 2XKOC 4JJBA 4QW2A 1UGPB 3KFVA 4JS4A 3TVTA 5FU6B 3HSBA 1ZSGA 2KRMA 1YJWQ 2K9GA 3G4ST 2DERA 4BY6B 1UECA 1M27C 4M75A 3VUBA 2O9VA 1ABQA 2L8DA 4DEXA 5CK9A 4RG2A 4C0FA 4GLKA 2E1HA 5LJ3j 4FSSA 1RI0A 1WLPB 1WYXA 2QASA 1VQ9A 1VYUA 5FLXE 1TS9A 2RD1A 1HSQA 2RQTA 3OBYA 2QTVA 3CC2A 1WHHA 2AKLA 4IUVA 3CD6A 3EHRA 1VYTA 4PNOA 2DLPA 3OY9A 3OYYA 2XG8D 4Z8AA 1OYXA 4PJOG 2CZ7B 4PLLA 2YUQA 2NYSA 2CP2A 5A2QE 2DTOA 3H6ZA 2EYZA 3I55T 1VQOT 1ARKA 2BE9B 1SKUB 3VUZA 1GL5A 3X26B 4OGEA 4PJNA 4KUDK 2EGAA 3M0SA 3H41A 2J6FA 2QDYB 1ZBXA 3CCSA 4OMNA 4OMLA 1B3QA 3LLRA 2EPDA 4HA8A 2EYYA 1SSHA 1OX9A 1VQ7T 3HRTA 1YJNQ 1IGUA 1C6VX 2DMOA 2EQJA 2YLBA 2GNCA 1U1TA 5GANf 3CCQQ 3QXEB 2DD4A 4JJNK 1BU1A 1NM7A 4C8QC 2RHYA 2XIDA 4PLIA 1D0YA 3I56Q 4FIBA 1S72T 2FPFA 1YI2Q 4LD6A 3EAEA 1WXUA 3EGDB 1NPPA 4M7DA 2DK3A 3RBBB 3A1PA 7AT1B 3PMIA 2DD5A 2DRMA 1M1KU 3FJPA 4ZNXA 1VQLA 4RG8A 2RHUA 4CI0C 4EIKA 4N4GA 3SWNA 2HKNA 2X4JA 3QJ6A 2X3XD 1RAAB 1KC8C 1PRLC 1M5Q1 5L8RE 1K0SA 1AWJA 2FRYA 4JJDA 4C92C 2QA4Q 3CMAT 3HP9A 2Y4XA 2O01E 1ZUYA 1I4K1 1PRMC 4LE9A 4B9WA 3LW5E 1UTIA 1VQ8A 2DTIA 1G2BA 3JCMV 2CP7A 2JS0A 1LOJA 5M9OA 1B7TA 1JBMA 2X4XA 3OW2S 4PJMA 2YHTA 4A4GA 3VRYA 1R0CB 1VQ5Q 2H3JA 1D1AA 3LWHA 1WNLA 4J9FA 4JS5A 4Y92A 1RLQC 3CCJA 4L6V5 3A8GB 1LJOA 4DBQA 1TXQA 2XU8A 4CC7A 2V26A 3EGXA 3NMZC 2EGEA 2OTLA 2DJZA 2KK4A 2LCCA 1M8VA 4E2FB 1MV3A 2F5TX 5FRNA 3G4SA 2FEIA 2MCNA 5A0DA 3WVEB 2PUOB 2R5AA 1YITQ 2F5KA 3GBQA 1R8OB 3FRNA 4M7AA 2JTEA 1N5ZA 1KQSP 3CCLQ 2EJFA 2JTFA 5LJ3d 3JCMc 1JRIA 3KBGA 3M56A 4M7DC 3MP1A 1S1NA 3L2QA 4BI4A 1V1CA 2LJ1A 1KD1U 1FMKA 2EFIA 4KBMB 4K11A 1I81A 4C0ZA 5J3BA 4A4HA 4R55A 3ASKA 2F69A 2QK0A 1UG1A 1BIBA 2QGGA 4MZTA 2RK1A 4GY5A 3VS2A 3VYGA 3I55A 3CCUT 1VQOA 4ORZA 4HVVA 1QKXA 1Q86U 4PJOA 2P0QA 3EG9B 2OI3A 2EWNA 3OSVA 5J26A 2C0OA 2YSQA 3V8LA 3AT1B 2KMTA 1VQ7A 4ATOA 2OTJQ 3JCMe 2EJ9A 1UGSB 1TOVA 4M77D 2JW4A 1NBEB 1Q95G 2RH2A 2QEXT 4HKEA 2XMFA 1X2QA 5LL6S 3GLXA 2DFUA 4A4KA 2M1HA 1I5OB 4FYYB 4PFPA 2NUPB 3TREA 1LPLA 6AT1B 2VB6A 2PTKA 3THKA 1VOMA 2B86A 3A8HB 1ZBJA 1PNJA 3L2ZA 4NS5A 4M77B 2NWMA 3FIFA 1N8RC 2E10A 5GAOp 1MMGA 2PU9B 2W10A 3N5BB 3QYGB 3G7ZA 2GF7A 3CCMA 4CRIA 1D3BB 4M7AC 4ZN3A 2RHIA 2EKOA 3M0TA 2R5MA 4XTXA 1IB8A 1ZQ1A 1X6GA 3JCMh 2M0OA 3CMAA 5GMKl 4J9GA 8AT1B 1NZ9A 1V76A 2VXEA 4HVWA 1WFWA 1OI1A 3CXCS 3OS2A 3NPFA 3JB9D 5KYUB 3A5ZB 2JVVA 3MEUA 4M78C 5GAOq 3FJ5A 1CKAA 2SEMA 2R57A 3LYIA 2OAWA 1K0XA 2GCXA 4MDWA 1QVFS 3QG1A 2F2XA 3VYHB 1OZ3A 2ZGWA 3CCEA 1AWXA 2DF6A 3PGGA 4ELZC 1VQ6Q 4RTXA 5GAN8 4E7JA 2GGRA 4C8QG 1SRLA 2KE9A 1HXDA 1E6GA 1VYVA 3NFCA 4JLGA 3VS0A 1ABOA 3CC7T 1K73R 2K5LA 1JEGA 2OX7A 2EKHA 3U23A 2RQVA 1KK7A 4C0GA 1Y96A 2NUTB 4VUBA 3I56T 4PK4A 1YI2T 3PIOA 4MZMA 2DVJA 2BKDN 4M77E 2W0ZA 1VQNT 2DXBA 3RKWA 4XTVA 4IUPA 2DYBA 2P0PA 3KXTA 3OA6A 4FYVB 4C92G 1UDLA 1TG0A 1IO6A 4OMFB 2YRCA 2KR3A 5LJ3f 1WHGA 2ENMA 4J9DA 1K9MU 2A37A 3JAME 2QTXA 2RI2A 3O8VA 2E41A 3CCUA 3QO3A 2ABLA 1NYFA 4XAXB 2DVEA 2JNGA 2QA4T 2K57A 4D8DA 4JRQA 1YHQA 5GMKj 4BI8B 4KGVB 1QVGA 3M55A 1X6BA 1BK2A 3G71A 1YIJQ 4XU2A 2MI6A 1B34A 1MNEA 4FL6A 2ZCFB 2YDLA 4XU3A 3URGA 2LCSA 4J9CA 2JZ2A 2VVKA 4A4FA 1RAIB 3DB3A 3NTIA 1U8RA 1EIFA 2KI7A 5A0LA 4EMHA 4BB7A 3QZ5B 1Q82U 4F7UB 2VYTA 3L42A 3E9GA 1ZSZB 3M4YA 1XJWB 1K8AU 1AVZC 1QLYA 2QEXA 3D7SB 3P8DA 4C0DC 1K76A 3J81E 1NJIC 1U1SA 3OYIA 4J6YA 1D1CA 1JJ2P 1M2OA 2CUBA 1J3TA 3V7RA 2RJEA 1RUWA 4EMGA 2M51A 5GAMe 2VUBA 2MF2A 4M7DG 3H0FA 1WGSA 1YITT 1Q7YU 4JLIA 2X4YA 2BTTA 2HKQB 3PNWC 2PVOB 4Y91A 3CCLT 1MNDA 4FW2A 2DXTA 2DL4A 1QCFA 5IHKA 1NJIR 4M77F 2KBTA 4PFZA 2A7YA 2DILA 2HCKA 3OS1A 1M2VA 1QKWA 3RERA 1KG1A 1R0BG 3OYCA 2PNIA 4AFZC 4ZGDB 3VS7A 1IHVA 1W2BP 1UHCA 1VQKA 1AEYA 4BE2A 2JTMA 2QYZA 2LJ3A 1VQ4Q 2FG0A 2QQAA 2LNVA 4JUVA 3CPWP 1U06A 1RACB 2DX1A 2E64A 2HBPA 1N6AA 2GBQA 1SSFA 2YRVA 2KAFA 5CR2A 1WXBA 3WVDB 3PTAA 4ELYC 4KT0E 1M1KC 1G83A 5HK0A 4OB1B 3MKDA 3CPFA 1M90R 3L2UA 3NGPA 5GAMh 3RESA 2L3SA 1FMVA 1X6OA 3ULRB 1NPRA 3UT1A 4PL6A 2ROTA 2E6NA 4RTZA 1Q81R 1VIFA 4ANJA 3P8HA 4XQ3A 4F7UE 4C8QA 2A28A 1OOTA 4B6MA 2CZ6B 3CC7A 4E7ZA 1GCPA 4QQ6A 1M1FA 1U3OA 2V8JA 2COZA 3VS4A 3JB9F 3I56A 3REAB 1VQMQ 4DOVA 4AFSC 5LJ3h 4JRIA 4RUGA 4DEYA 3ZBDA 1PHTA 1NYGA 2CH4W 4M7AG 1Z9QA 2FO0A 3PFSA 4DA4A 2K4YA 1VQNA 3BW1A 1RAHB 4L59A 4EDUA 3NTHA 4HT8A 3GNFB 2VV5A 4IUTA 1ZSZC 4XTWA 3M0UA 3BE3A 1XOVA 3R6OA 2M9UA 5KYXB 2XDDA 5GMKi 3MHXA 1R77A 4C92A 2KT8A 3M0QA 1WQ7A 3DB4A 5LJ5e 1TSFA 2CT3A 4M78G 5KYWB 2E12A 3UPUA 2QA4A 1RAGB 1WA7A 3OYGA 1I0CA 2A36A 1WHLA 3PIPA 2QXFA 5GAN3 2V1QA 3QJYA 3SEMA 4C5HA 3JCMX 2A3LA 1RABB 4NL3A 2D8HA 3V7CA 2LX7A 3L2VA 5DM7R 1H641 1UJ0A 1E6HA 2O9SA 3V8KA 3C0CA 1M4ZA 3LX7A 2NLUA 5GAOn 1MMNA 2YUOA 1CKBA 2P4RA 1KD1C 5FROA 3VS5A 2DL3A 1N9RA 2PVDB 1UGRB 2J6OA 1M3CA 1RADB 2FB7A 1VQ6T 3M0PA 2EYWA 3PVLA 3L1AA 3CMEQ 3LGLA 1ACMB 2E5KA 2CP3A 1OZ2A 2DL7A 4F7UF 2PVGB 1VQPA 3WXMB 3JCMQ 2K3YA 2C0TA 4HT9A 1T0JA 2G3RA 3EG0A 5LJ5h 1PSEA 1MHNA 5IT9E 2RA2A 1YITA 4EPCA 1KFZA 3QPHA 3CCRQ 2LQ8A 2HQHA 5KCHA 2IPOB 1RAEB 2L2PA 4M75E 3G6EQ 3PVQA 5CCAA 2C06A 4WTOB 5D7UA 3HTRA 4R0KA 2YXYA 1X69A 3BFMA 2E3IA 1YJ9A 2KXDA 1GBQA 5KE3A 1UUEA 3GF5A 4AFQC 3M9QA 3SWNB 3LH0A 3QZ9B 4E6RA 5FU6C 3VS3A 2I0NA 3E2UA 1C0MA 1SRMA 4JRPA 3UA6A 2H3EB 5FWBA 1NLPC 4BY6C 3VV0A 4F04B 3HFNA 4LDVA 4IUUA 2JT4A 1BI3A 3H0HA 1VA7A 5AT1B 1VQ9Q 3LH5A 3MEVA 2DPPB 3EH1A 4F16A 5ECAA 2LP5A 2DIGA 2XDPA 3CC2Q 4ESRA 4RTYA 2BZYA 4DBHA 1PC0A 2CP6A 1PWTA 4FSXA 2YWWA 1KC8R 3JRZA 3A8LB 2RQWA 4ME7A 5FU7B 2HAXA 1UHFA 2LJ0A 2JMCA 1KQ2A 1N27A 1W70A 2JJ9A 3M57A 2FZCB 2K3BA 2ZPIB 3EGXB 4AFUC 1PD1A 2ZPEB 1UJYA 5J39A 3OW2P 4DBFA 3CC4T 2D8JA 3CCSQ 4LDUA 5GANe 2F2VA 2KGTA 3VS1A 3UF4A 3IQLA 4RCBA 4O6JA 1WJQA 1XTDA 3MP6A 1BIAA 2K5FA 3OSSC 3I5SA 4ZN1A 3JCMW 3META 1QW1A 1GFCA 1PD0A 3X24B 4N0AC 4M75F 3MJXA 2AHJB 4L5GA 1Y7XA 2F2WA 1ZUKA 3H9NA 2LDMA 4HXJA 4C5GA 1PKSA 5IXFA 2AT1B 2L0AA 1PG5B 2FPDA 4KULA 4YTLA 2LC4A 3NTKA 4MMKA 1FXXA 1HD3A 2X4WA 4M78A 4LUEA 3OYEA 1WDXA 2MYSA 1CSKA 2ZPGB 4PJOB 2HMAA 1VQLQ 2JMAA 4XU1A 1BB9A 2FZKB 2LRQA 1AZGB 1Z9ZA 5GANh 2DBKA 2H8HA 1IREB 1YWPA 1KQ1A 4NL2A 1FX7A 2VWFA 1FYNA 1K9MC 2DXCA 1QVGS 1VQ6A 1A0NB 2HBWA 4LN2A 2PUKB 3SFMA 1MUZA 4C5IA 4CC4B 4IKFA 3EG9A 1NG2A 1I07A 1VQ8Q 3A8OB 2AZSA 2CGHA 4HCKA 4FT2A 1P92A 2FPEA 2J05A 3UWNA 1S72A 4X34A 2P0KA 4BDZA 1FWZA 2NUZA 2KRSA 2DZCA 2EGCA 3AHUA 1G3TA 2D0NA 1O75A 2KROA 1YJWT 3CCJQ 3G1JA 3TCJA 4A63B 1SEMA 1FMWA 2LX9A 1K8AC 2QQBA 2L3RA 5GJWB 1JU5C 2RHXA 5FU7C 2OTLQ 1YP5A 2VC8A 2K79A 2VXFA 3SDZA 2NUPA 2VGNA 4N4HA 1JXMA 4QKUA 3CEYA 3EFOB 2OAUA 2YUPA 5D6WA 1WIEA 3P8BB 3QUIA 5I11A 4LNPA 4F14A 1WQWA 2SRCA 1Q7YC 3JB9I 1TWBA 2DEQA 1WHKA 4Z02A 1X43A 3ER0A 1D3BA 1N8RR 2COYA 3JV3A 1JO8A 4XTUA 1MMAA 2KYBA 1SPKA 4PJOE 2EIFA 2KY9A 4IIMA 2E65A 2E6ZA 3JCMb 5KCOA 1LCKA 2CKKA 3OW2A 1UEBA 2V1RA 2O4XA 1QP2A 4RTVA 4DQ2A 3S3NA 1SHFA 1GCQC 3I55Q 1VQOQ 2HNIA 1WHMA 2HSEB 1X75C 2KT1A 3CXCP 1Q7YR 1RAFB 1E7OA 1O9SA 1KQSA 1YJNT 4LDXA 3SB2A 5GAOm 3DLLA 2CP0A 3CC4A 1RI9A 2FL7A 1SHGA 3CCQT 3RR6A 1AHJB 4PKCC 3M58A 1D1BA 1QVFP 2BZ8A 3MO8A 3EFRA 2D9TA 3RIRA 1SG5A 4OVAA 3LGFA 3CCRT 4WCIA 3TSWA 4RTTA 3OS0A 2KYMA 2RO0A 4QVZA 2EQUA 3JCMg 3JCMP 1M30A 4II1A 4JZ3A 4BACA 2E70A 4HCBA 2MMPA 2LZ6B 4OB3B 1DJ7B 5GMKh 4JDSA 3SHWA 1X01A 3EH2A 3VRZA 4X9DA 5CKEA 4IUQA 4XK8E 2MWOA 5FRMA 2AK5A 2JUFA 2XHCA 2RM4A 4EMKB 5KH6A 3CBMA 1TUCA 1NE8A 5D6YA 5C0MA 3CCMQ 4M77C 1RLPC 1OEBA 4O5VA 4OF1A 3A8MB 2FYKA 1PKTA 2CT4A 1SF9A 1N9SA 2M16A 4PJOF 3CMAQ 2XD0A 2ED0A 2KEAA 2QQRA 2DM1A 5D6XA 4J83A 1GRIA 3OYJA 1VQ5T 2RHZA 1GFDA 4J7FA 4ZGEB 5A0GA 1JXOA 2KQWA 3C94A 3OYBA 3RKXA 2EQMA 1PSFA 1X2KA 3QBYA 4GLMA 4CC3A 2RJDA 2DYIA 3OYKA 2XDBA 2EYXA 2HZYA 2M0YA 3HKSA 4DBRA 2L5QA 2EQIA 1BI2A 1YJWA 2DRKA 3CCEQ 4B9XA 1Y0MA 1NLOC 1ZSZA 2RI3A 2L3PA
chains in the Genus database with same CATH topology
3EHQA 4J9BA 2D8HA 1MV3A 2JXBA 2LX7A 2FEIA 2MCNA 1YWOA 1UJ0A 1E6HA 1H3HA 2O9SA 2GTJA 3GBQA 3C0CA 2CH4A 2JTEA 1N5ZA 2OJ2A 1CKBA 2P4RA 2YUOA 2O88A 5EC7A 3VS5A 2DL3A 4OMPA 2ED1A 5IHNA 1K9AA 2J7IA 2QDLA 1NEBA 1M3CA 2J6OA 3M0PA 2EYWA 3PVLA 2RNAA 2GQIA 4JPBW 2E5KA 1S1NA 1BBZA 2ESWA 3NHNA 1V1CA 2LJ1A 4J9HA 2DL7A 1FMKA 1AZEA 2C0TA 4K11A 1T0JA 3EG0A 1UG1A 1K4US 3VS2A 2KXCA 1KFZA 3RNJA 4ORZA 3O5ZA 4HVVA 1QKXA 1YNZA 1B07A 2DNUA 2HDAA 2JM8A 1AOJA 5GJVB 4CC2A 2L2PA 2OI3A 2DL8A 4Z88A 2C0OA 3PVQA 2YSQA 1M3AA 4R0KA 1X69A 2KXDA 4LUDA 1GBQA 1WI7A 1UUEA 1GBRA 4AFQC 1QWEA 1YCSB 2A08A 4E6RA 3PE0A 2JW4A 3VS3A 2I0NA 2LQWA 1SRMA 1KJWA 3UA6A 2RMOA 1UFFA 2XMFA 4JJCA 5FWBA 1X2QA 1NLPC 1ZUUA 2G6FX 3VS6A 2JT4A 4Z89A 3H0HA 1VA7A 2LQNA 3LH5A 2PTKA 2CUDA 3THKA 4F16A 5ECAA 4KRTA 1I1JA 2B86A 2DE0X 2LP5A 2K2MA 2VKNA 1ZBJA 4ESRA 4RTYA 1PNJA 2BZYA 1AWOA 1PWTA 2CREA 2LNHB 2NWMA 4M4ZA 4RTWA 3H0IA 2W10A 2RQWA 3EGUA 1UHFA 2LJ0A 2JMCA 3M0TA 1W70A 1X6GA 2K3BA 4AFUC 1UJYA 4J9GA 3EG2A 1T0HA 2D8JA 3QWXX 2F2VA 2CDTA 2KGTA 4J9EA 1T3SA 1WXTA 4HVWA 1WFWA 3VS1A 3UF4A 3IQLA 3NPFA 3CQTA 3A98A 1M8MA 2ROLA 3I5SA 3FJ5A 1CKAA 2C0IA 2SEMA 1GFCA 2OAWA 5I22A 1K0XA 3UA7A 1EFNA 3I9QA 4RTUA 2KRNA 2F2WA 2F2XA 1NEGA 2DL5A 3UATA 1ZUKA 4HXJA 1PKSA 1AWXA 2AKKA 2DF6A 5IXFA 4RTXA 2GGRA 1SRLA 4IIOA 1X27A 2L0AA 2EBPA 2FPDA 1UE9A 1HD3A 2KE9A 1E6GA 1VYVA 2J06A 4LUEA 2L3QA 1WDXA 3VS0A 1ABOA 1CSKA 4OMQA 1JEGA 3EG3A 2EKHA 2JMAA 2RQRA 3U23A 2RQVA 1BB9A 3M0RA 1AZGB 1Z9ZA 2EW3A 2DBKA 2H8HA 1YWPA 2DVJA 2D1XA 1QWFA 2O2OA 2VWFA 1FYNA 2FRWA 2W0ZA 4AG2C 1KIKA 1A0NB 2HBWA 2MIOA 4LN2A 2RPNA 2DYBA 1MUZA 4JZ4A 2O31A 4CC4B 1UDLA 4D8KA 1NG2A 2DA9A 1TG0A 3I5RA 1IO6A 1I07A 1Y57A 2KR3A 1AD5A 2AZSA 1TUDA 2IIMA 4GBQA 1JQQA 4HCKA 2YT6A 4OMOA 2ENMA 4J9DA 1T3LA 2A37A 2FPEA 2J05A 1OPLA 5IHIA 2AZVA 1H92A 2NUZA 2ABLA 1NYFA 2HSPA 4F17A 2KRSA 4X1VA 2EGCA 4D8DA 2D0NA 4JJBA 2KROA 3KFVA 3TVTA 1X6BA 1BK2A 4A63B 1SEMA 1ZSGA 2YDLA 2KRMA 2K9GA 2JS2A 5GJWB 2LCSA 1JU5C 4J9CA 1UECA 1M27C 1YP5A 2VVKA 2K79A 2RF0A 2O9VA 1ABQA 4DEXA 1JXMA 2YUNA 2YUPA 1WIEA 2HEQA 1AVZC 1QLYA 1W1FA 3R6NA 4LNPA 4F14A 5I11A 4FSSA 1WLPB 1WYXA 1VYUA 2SRCA 1K76A 1HSQA 4J9IA 2RQTA 2PZ1A 2X3WD 1X43A 1KSWA 2CSIA 2CUBA 1J3TA 2AKLA 3JV3A 1JO8A 3EHRA 1RUWA 2KYBA 1SPKA 1VYTA 2DLPA 4IIMA 2M51A 3ZL7C 2DBMA 4Z8AA 2YUQA 3H0FA 1LCKA 4QT7A 2EYZA 1ARKA 2RQUA 2V1RA 2BTTA 4RTVA 1SHFA 1GL5A 1GCQC 2GTOA 2KT1A 2EGAA 2DL4A 3M0SA 1QCFA 3H41A 5IHKA 2J6FA 1E7OA 2KBTA 2DILA 4OMNA 1B3QA 4OMLA 2HCKA 1ZLMA 1QKWA 2EPDA 2RN8A 2EYYA 1SSHA 1RI9A 1SHGA 2PNIA 4AFZC 1YN8A 2DMOA 3VS7A 1UHCA 2ECZA 1AEYA 2GNCA 2LJ3A 2FG0A 2BZ8A 4OMMA 1K1ZA 1U06A 1GCQA 2DX1A 2GBQA 1BU1A 1NM7A 4WCIA 3TSWA 1WXBA 4RTTA 2MOXA 2KYMA 1G83A 2FPFA 1U5SA 1M30A 4JZ3A 1WXUA 2LZ6B 1M3BA 3NGPA 1W6XA 2L3SA 3ULRB 3SHWA 3RBBB 2ROTA 5HCKA 4RTZA 2DRMA 4ZNXA 3VRZA 2A28A 1OOTA 2AK5A 4HVUA 4EIKA 2J6KA 1GCPA 1OV3A 2EVRA 2X3XD 1TUCA 1U3OA 1PRLC 2CSQA 1K0SA 1AWJA 1UGVA 1MV0B 1AWWA 2FRYA 1RLPC 4JJDA 3VS4A 3REAB 1OEBA 2K7AA 5FWCA 4AFSC 1H8KA 3I35A 1ZUYA 4RUGA 4DEYA 2JM9A 1PHTA 1PKTA 1PRMC 4LE9A 1NYGA 2CH4W 2CT4A 1Z9QA 2FO0A 3TSZA 3REBB 1UTIA 1G2BA 2ED0A 2KEAA 2BZXA 1ZX6A 5FW9A 3QWYA 2LMJA 2DM1A 2JS0A 3M0UA 1GRIA 1XOVA 2DJQA 1GFDA 1JXOA 3VRYA 1X2KA 2KT8A 3M0QA 3EG1A 2KNBB 4J9FA 5IXBA 4GLMA 1OPKA 4CC3A 4Y92A 4AG1C 1RLQC 2CT3A 2EYXA 1HJDA 2K6DA 2M0YA 1WX6A 1WA7A 2EQIA 1I0CA 2A36A 4CC7A 5L23A 2DRKA 3NMZC 2EGEA 1Y0MA 1NLOC 2V1QA 2L3PA 5IH2A 3SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHQ A;  4J9B A;  2D8H A;  1MV3 A;  2JXB A;  2LX7 A;  2FEI A;  2MCN A;  1YWO A;  1UJ0 A;  1E6H A;  1H3H A;  2O9S A;  2GTJ A;  3GBQ A;  3C0C A;  2CH4 A;  2JTE A;  1N5Z A;  2OJ2 A;  1CKB A;  2P4R A;  2YUO A;  2O88 A;  5EC7 A;  3VS5 A;  2DL3 A;  4OMP A;  2ED1 A;  5IHN A;  1K9A A;  2J7I A;  2QDL A;  1NEB A;  1M3C A;  2J6O A;  3M0P A;  2EYW A;  3PVL A;  2RNA A;  2GQI A;  4JPB W;  2E5K A;  1S1N A;  1BBZ A;  2ESW A;  3NHN A;  1V1C A;  2LJ1 A;  4J9H A;  2DL7 A;  1FMK A;  1AZE A;  2C0T A;  4K11 A;  1T0J A;  3EG0 A;  1UG1 A;  1K4U S;  3VS2 A;  2KXC A;  1KFZ A;  3RNJ A;  4ORZ A;  3O5Z A;  4HVV A;  1QKX A;  1YNZ A;  1B07 A;  2DNU A;  2HDA A;  2JM8 A;  1AOJ A;  5GJV B;  4CC2 A;  2L2P A;  2OI3 A;  2DL8 A;  4Z88 A;  2C0O A;  3PVQ A;  2YSQ A;  1M3A A;  4R0K A;  1X69 A;  2KXD A;  4LUD A;  1GBQ A;  1WI7 A;  1UUE A;  1GBR A;  4AFQ C;  1QWE A;  1YCS B;  2A08 A;  4E6R A;  3PE0 A;  2JW4 A;  3VS3 A;  2I0N A;  2LQW A;  1SRM A;  1KJW A;  3UA6 A;  2RMO A;  1UFF A;  2XMF A;  4JJC A;  5FWB A;  1X2Q A;  1NLP C;  1ZUU A;  2G6F X;  3VS6 A;  2JT4 A;  4Z89 A;  3H0H A;  1VA7 A;  2LQN A;  3LH5 A;  2PTK A;  2CUD A;  3THK A;  4F16 A;  5ECA A;  4KRT A;  1I1J A;  2B86 A;  2DE0 X;  2LP5 A;  2K2M A;  2VKN A;  1ZBJ A;  4ESR A;  4RTY A;  1PNJ A;  2BZY A;  1AWO A;  1PWT A;  2CRE A;  2LNH B;  2NWM A;  4M4Z A;  4RTW A;  3H0I A;  2W10 A;  2RQW A;  3EGU A;  1UHF A;  2LJ0 A;  2JMC A;  3M0T A;  1W70 A;  1X6G A;  2K3B A;  4AFU C;  1UJY A;  4J9G A;  3EG2 A;  1T0H A;  2D8J A;  3QWX X;  2F2V A;  2CDT A;  2KGT A;  4J9E A;  1T3S A;  1WXT A;  4HVW A;  1WFW A;  3VS1 A;  3UF4 A;  3IQL A;  3NPF A;  3CQT A;  3A98 A;  1M8M A;  2ROL A;  3I5S A;  3FJ5 A;  1CKA A;  2C0I A;  2SEM A;  1GFC A;  2OAW A;  5I22 A;  1K0X A;  3UA7 A;  1EFN A;  3I9Q A;  4RTU A;  2KRN A;  2F2W A;  2F2X A;  1NEG A;  2DL5 A;  3UAT A;  1ZUK A;  4HXJ A;  1PKS A;  1AWX A;  2AKK A;  2DF6 A;  5IXF A;  4RTX A;  2GGR A;  1SRL A;  4IIO A;  1X27 A;  2L0A A;  2EBP A;  2FPD A;  1UE9 A;  1HD3 A;  2KE9 A;  1E6G A;  1VYV A;  2J06 A;  4LUE A;  2L3Q A;  1WDX A;  3VS0 A;  1ABO A;  1CSK A;  4OMQ A;  1JEG A;  3EG3 A;  2EKH A;  2JMA A;  2RQR A;  3U23 A;  2RQV A;  1BB9 A;  3M0R A;  1AZG B;  1Z9Z A;  2EW3 A;  2DBK A;  2H8H A;  1YWP A;  2DVJ A;  2D1X A;  1QWF A;  2O2O A;  2VWF A;  1FYN A;  2FRW A;  2W0Z A;  4AG2 C;  1KIK A;  1A0N B;  2HBW A;  2MIO A;  4LN2 A;  2RPN A;  2DYB A;  1MUZ A;  4JZ4 A;  2O31 A;  4CC4 B;  1UDL A;  4D8K A;  1NG2 A;  2DA9 A;  1TG0 A;  3I5R A;  1IO6 A;  1I07 A;  1Y57 A;  2KR3 A;  1AD5 A;  2AZS A;  1TUD A;  2IIM A;  4GBQ A;  1JQQ A;  4HCK A;  2YT6 A;  4OMO A;  2ENM A;  4J9D A;  1T3L A;  2A37 A;  2FPE A;  2J05 A;  1OPL A;  5IHI A;  2AZV A;  1H92 A;  2NUZ A;  2ABL A;  1NYF A;  2HSP A;  4F17 A;  2KRS A;  4X1V A;  2EGC A;  4D8D A;  2D0N A;  4JJB A;  2KRO A;  3KFV A;  3TVT A;  1X6B A;  1BK2 A;  4A63 B;  1SEM A;  1ZSG A;  2YDL A;  2KRM A;  2K9G A;  2JS2 A;  5GJW B;  2LCS A;  1JU5 C;  4J9C A;  1UEC A;  1M27 C;  1YP5 A;  2VVK A;  2K79 A;  2RF0 A;  2O9V A;  1ABQ A;  4DEX A;  1JXM A;  2YUN A;  2YUP A;  1WIE A;  2HEQ A;  1AVZ C;  1QLY A;  1W1F A;  3R6N A;  4LNP A;  4F14 A;  5I11 A;  4FSS A;  1WLP B;  1WYX A;  1VYU A;  2SRC A;  1K76 A;  1HSQ A;  4J9I A;  2RQT A;  2PZ1 A;  2X3W D;  1X43 A;  1KSW A;  2CSI A;  2CUB A;  1J3T A;  2AKL A;  3JV3 A;  1JO8 A;  3EHR A;  1RUW A;  2KYB A;  1SPK A;  1VYT A;  2DLP A;  4IIM A;  2M51 A;  3ZL7 C;  2DBM A;  4Z8A A;  2YUQ A;  3H0F A;  1LCK A;  4QT7 A;  2EYZ A;  1ARK A;  2RQU A;  2V1R A;  2BTT A;  4RTV A;  1SHF A;  1GL5 A;  1GCQ C;  2GTO A;  2KT1 A;  2EGA A;  2DL4 A;  3M0S A;  1QCF A;  3H41 A;  5IHK A;  2J6F A;  1E7O A;  2KBT A;  2DIL A;  4OMN A;  1B3Q A;  4OML A;  2HCK A;  1ZLM A;  1QKW A;  2EPD A;  2RN8 A;  2EYY A;  1SSH A;  1RI9 A;  1SHG A;  2PNI A;  4AFZ C;  1YN8 A;  2DMO A;  3VS7 A;  1UHC A;  2ECZ A;  1AEY A;  2GNC A;  2LJ3 A;  2FG0 A;  2BZ8 A;  4OMM A;  1K1Z A;  1U06 A;  1GCQ A;  2DX1 A;  2GBQ A;  1BU1 A;  1NM7 A;  4WCI A;  3TSW A;  1WXB A;  4RTT A;  2MOX A;  2KYM A;  1G83 A;  2FPF A;  1U5S A;  1M30 A;  4JZ3 A;  1WXU A;  2LZ6 B;  1M3B A;  3NGP A;  1W6X A;  2L3S A;  3ULR B;  3SHW A;  3RBB B;  2ROT A;  5HCK A;  4RTZ A;  2DRM A;  4ZNX A;  3VRZ A;  2A28 A;  1OOT A;  2AK5 A;  4HVU A;  4EIK A;  2J6K A;  1GCP A;  1OV3 A;  2EVR A;  2X3X D;  1TUC A;  1U3O A;  1PRL C;  2CSQ A;  1K0S A;  1AWJ A;  1UGV A;  1MV0 B;  1AWW A;  2FRY A;  1RLP C;  4JJD A;  3VS4 A;  3REA B;  1OEB A;  2K7A A;  5FWC A;  4AFS C;  1H8K A;  3I35 A;  1ZUY A;  4RUG A;  4DEY A;  2JM9 A;  1PHT A;  1PKT A;  1PRM C;  4LE9 A;  1NYG A;  2CH4 W;  2CT4 A;  1Z9Q A;  2FO0 A;  3TSZ A;  3REB B;  1UTI A;  1G2B A;  2ED0 A;  2KEA A;  2BZX A;  1ZX6 A;  5FW9 A;  3QWY A;  2LMJ A;  2DM1 A;  2JS0 A;  3M0U A;  1GRI A;  1XOV A;  2DJQ A;  1GFD A;  1JXO A;  3VRY A;  1X2K A;  2KT8 A;  3M0Q A;  3EG1 A;  2KNB B;  4J9F A;  5IXB A;  4GLM A;  1OPK A;  4CC3 A;  4Y92 A;  4AG1 C;  1RLQ C;  2CT3 A;  2EYX A;  1HJD A;  2K6D A;  2M0Y A;  1WX6 A;  1WA7 A;  2EQI A;  1I0C A;  2A36 A;  4CC7 A;  5L23 A;  2DRK A;  3NMZ C;  2EGE A;  1Y0M A;  1NLO C;  2V1Q A;  2L3P A;  5IH2 A;  3SEM A; 
#chains in the Genus database with same CATH topology
 3L2W A;  4X9C A;  3OQ5 A;  1YWO A;  1H3H A;  2GTJ A;  2P84 A;  2QGF B;  2KVQ G;  4KUI A;  3TQ7 P;  5GAN 4;  2ED1 A;  5IHN A;  1K9A A;  1XNI A;  1NEB A;  4LXC A;  3M4G A;  4PJJ A;  3QHS A;  3OYA A;  1HK9 A;  5LJ3 e;  2GQI A;  2ZZD A;  1BBZ A;  1KHI A;  3NHN A;  4J9H A;  1C1A A;  1K73 U;  4C8Q D;  4BE0 A;  5KYY A;  4QVC A;  5GAN 5;  1PM3 A;  3HHT B;  1BCM A;  4D6W A;  8ATC B;  5HKC A;  3DKM A;  2LT1 A;  3J80 E;  2KXC A;  3RKY A;  2MPX C;  3RNJ A;  1TTH B;  2DNU A;  3MCA B;  5GJV B;  4CC2 A;  1WZO A;  2K2V A;  2DL8 A;  2HD0 A;  3CCU Q;  1WJS A;  2WAC A;  1YHQ Q;  4M75 D;  3X25 B;  2OTJ T;  3JCM d;  3QSU A;  1YJN A;  3G71 Q;  4LUD A;  1IRX A;  5GAN 7;  4C8Q B;  4EMK C;  1GBR A;  4KH1 B;  3CCQ A;  2FHD A;  1VQ8 T;  1QWE A;  1YCS B;  2HL3 A;  1YBY A;  3PE0 A;  1Y07 A;  3OMG A;  1M1K R;  3CBO A;  2IG0 A;  1KJW A;  3GP8 A;  1YI2 A;  4JJC A;  1M9S A;  2HL5 C;  3KUF A;  3VS6 A;  4Z89 A;  2QEX Q;  4M75 B;  1D09 B;  2E3H A;  3CCJ T;  2RJC A;  1UB4 A;  5GAM j;  2CUD A;  1I1J A;  2DE0 X;  2VKN A;  3BDU A;  4TVR A;  4JRK A;  2OTL T;  1AWO A;  1QVP A;  1TU0 B;  1WJR A;  4M4Z A;  4RTW A;  1QCO A;  4E7S A;  4C92 B;  3H0I A;  2PQW A;  3EGU A;  3JB9 H;  5I21 A;  3OYN A;  2A0F B;  2CP5 A;  3X20 B;  5GAM g;  1BYM A;  2YRD A;  4E7L A;  3HFO A;  5KYX A;  3J7A F;  2CDT A;  4XU0 A;  1WXT A;  1W4S A;  5KYW A;  5I2M A;  1VQK Q;  1OU8 A;  1JJ2 A;  3ZFJ A;  3A98 A;  1M8M A;  2CYZ B;  1VQ5 A;  3Q1J A;  1YCY A;  3PMT A;  3S3O A;  2B8A A;  3OMC A;  5I22 A;  4M7D D;  4BD3 A;  4ZTF A;  1NJI U;  3I9Q A;  4MZP A;  3CCV Q;  1NEG A;  2DL5 A;  5LJ3 g;  4C8Q E;  2KDS A;  4OB0 B;  1Q86 C;  2L89 A;  2AKK A;  2EBP A;  2WSC E;  4FT4 A;  1UE9 A;  1GXI E;  2KSS A;  3OS5 A;  3C95 A;  2QG9 B;  3H8Z A;  2AIR B;  2J06 A;  5HK3 A;  3OYD A;  1KD1 R;  4A4E A;  4XTZ A;  4OMQ A;  2HQE A;  4N0A A;  1MMD A;  2RQR A;  3E19 A;  4M7D B;  1W2B A;  3M0R A;  3CC7 Q;  3CCL A;  4KH0 B;  1M90 U;  3CPW A;  1Q86 R;  4QVD A;  4BE1 A;  4WF2 A;  2D1X A;  1QWF A;  2O2O A;  1D0X A;  4AG2 C;  4R56 A;  4C92 E;  1Q81 U;  2LVM A;  2RPN A;  4M77 G;  4JZ4 A;  2RK2 A;  1IZ6 A;  3EGD A;  2ZPB B;  1VQN Q;  3JSC A;  2CS7 A;  3VJP A;  2IIM A;  1G5V A;  5CO7 A;  2K3X A;  4OMO A;  3OBW A;  1OUL A;  3GPL A;  5GAO l;  3C12 A;  4M75 C;  5LJ5 j;  4PFO A;  5IHI A;  1G3S A;  4OB2 B;  1H92 A;  3CCM T;  2HSP A;  1YIJ T;  4X1V A;  2WSE E;  1TUG B;  3X28 B;  3EFS A;  3DLM A;  2QQS A;  3OB9 A;  3CD6 Q;  1LNX A;  2OTJ A;  3TEE A;  2JS2 A;  2XK0 A;  4AMC A;  2VGM A;  2XI9 A;  4M7A D;  4IUR A;  3FEO A;  5LJ5 g;  4OGC A;  2RF0 A;  4DOW A;  3RUX A;  1F1B B;  3JCM f;  1WHJ A;  4FM4 B;  2YUN A;  2RI5 A;  2HEQ A;  1W1F A;  3R6N A;  4C8Q F;  1RL2 A;  3HL8 A;  2I2L A;  3SD4 A;  4J9I A;  3T9N A;  2PZ1 A;  2X3W D;  3QII A;  1KSW A;  2CSI A;  3CCE T;  3JB9 G;  4A53 A;  1KQS S;  5GAM d;  4M78 D;  4M7A B;  1I5L A;  4M7D E;  3ZL7 C;  1OX8 A;  1XQH A;  2DBM A;  4PJO D;  5CQX A;  1VQP Q;  5GAN 6;  5AYF A;  4QT7 A;  2RQU A;  2QI2 A;  1MGQ A;  4J6W A;  2EAY A;  2K5I A;  2GTO A;  1WPY A;  3MP8 A;  3ME9 A;  2LQK A;  4C92 F;  3E9F A;  1ZLM A;  3M59 A;  1TH7 A;  3BY7 A;  4M78 B;  2RN8 A;  1VQ4 T;  4RMO A;  4UC4 A;  2FVU A;  4BDY A;  1YN8 A;  3CBP A;  3MEW A;  1YJ9 Q;  2ECZ A;  4MML A;  3S3M A;  2LTO A;  4OMM A;  1K1Z A;  1AT1 B;  1GCQ A;  4J8O A;  1G8X A;  2DO3 A;  9ATC B;  2DAQ A;  4J6X A;  1ZA2 B;  2MOX A;  3SWN C;  4AT1 B;  5CKD A;  3JB9 J;  1U5S A;  3OYL A;  5CAI A;  1M3B A;  1YHQ T;  1W6X A;  4A54 A;  1EX4 A;  2JN0 A;  3G71 T;  5HCK A;  1QCN A;  4HVU A;  4F7U G;  2J6K A;  4E7I A;  1OV3 A;  2EVR A;  5CKF A;  5DY9 A;  1QVG P;  4E7H A;  1VQM T;  1QQJ A;  1K9M R;  2Y90 A;  2CSQ A;  1UGV A;  1MV0 B;  1AWW A;  5GAN j;  2IVW A;  1Q82 C;  4M7A E;  2K7A A;  5EG2 A;  5FWC A;  3V7S A;  4FCY A;  1H8K A;  2P4T A;  3I35 A;  2JM9 A;  3TSZ A;  2FZG B;  3REB B;  1V29 B;  4M7D F;  1KC8 U;  2BZX A;  1ZX6 A;  5FW9 A;  3QWY A;  2LMJ A;  3S6W A;  3INZ A;  3VKI A;  3G4S Q;  2DTH A;  4ZGJ B;  4E7K A;  2DJQ A;  4M77 A;  5C6S A;  3GNG A;  3EG1 A;  5LJ5 d;  5GAN g;  2KNB B;  3OYF A;  4M78 E;  1IGQ A;  2GFA A;  4Q5W A;  5IXB A;  1OPK A;  1Q82 R;  4AG1 C;  1K8A R;  1YIJ A;  1HJD A;  2K6D A;  2M02 A;  1WX6 A;  5KE2 A;  5L23 A;  3EFO A;  2DXU A;  5GMK e;  5IH2 A;  2Z0W A;  3EHQ A;  4J9B A;  4QQD A;  2GFU A;  2O4X B;  2JXB A;  4FYX B;  1VQK T;  4C0D B;  1ZHI A;  1YFN A;  3RMS A;  2CZ0 B;  2XIC A;  3LWI A;  2CH4 A;  5KYU A;  2OJ2 A;  2O88 A;  3RMQ A;  5EC7 A;  3E1S A;  1K73 C;  4OMP A;  3L2R A;  2X35 A;  4NOY A;  4C5E A;  3CCV T;  2J7I A;  3CME T;  1OQK A;  2QDL A;  3FB9 A;  3QYH B;  4KGX B;  4PJO C;  2BE7 D;  4HCC A;  2WSF E;  4LDY A;  1VUB A;  2RNA A;  1VQ7 Q;  4JPB W;  4PJL A;  2E5Q A;  2ESW A;  1VIE A;  1Y96 B;  4FW1 A;  2JOY A;  5DLO A;  3HPW A;  3RDV A;  1PCX A;  3C4S A;  4QQG A;  1AZE A;  3OYM A;  4RKU E;  1K4U S;  5GAM f;  3G6E T;  4FU6 A;  3FC3 A;  3O5Z A;  1G3W A;  1YNZ A;  1B07 A;  2JM8 A;  2HDA A;  5GAN 2;  1H3Z A;  1AOJ A;  1S72 Q;  4M7A F;  1G3Y A;  3QKJ A;  4Z88 A;  4KGZ B;  2ZPF B;  5CIU A;  2NUT A;  4M75 G;  4LDW A;  3GIB A;  3MPU B;  1M3A A;  2E4H A;  3M54 A;  4J5Y A;  3F70 A;  1WI7 A;  1VQ4 A;  2R58 A;  2A08 A;  2EYQ A;  2EJG A;  4XTY A;  3JCM J;  3V8J A;  2LQW A;  1Y71 A;  1BKB A;  5IN1 A;  1B34 B;  2RMO A;  4M78 F;  1UFF A;  1D0Z A;  1VQ9 T;  3M5A A;  1ZUU A;  2G6F X;  5DLQ E;  4MDX A;  3CC2 T;  4RCC A;  2LQN A;  4ZTJ A;  4EMK A;  3CD6 T;  1BI0 A;  5GAO r;  1HYO A;  4KRT A;  4Y28 E;  2K2M A;  2D6F A;  1I8F A;  3OYH A;  2CRE A;  2LNH B;  4LD9 K;  2DIQ A;  2ATC B;  4BUG A;  1JJ2 S;  2QAZ A;  4FYW B;  2DET A;  1KHC A;  3QDR B;  2DZ9 A;  1VQM A;  2GQV A;  2DKG A;  2Y4Y A;  2YLC A;  3CCS T;  4F7U A;  5GAN d;  1N8R U;  2BIV A;  1UGQ B;  1T0H A;  2RB6 A;  3EG2 A;  3HRU A;  2V8K A;  3QWX X;  3ZEH A;  3TU4 K;  1ZA1 B;  2BUD A;  4J9E A;  1T3S A;  2QQ9 A;  3BDL A;  3CC4 Q;  2D0Q B;  1EZZ B;  2X9H A;  4N4I A;  1VQP T;  5CKB A;  3VU3 C;  2ZAE A;  3CQT A;  4J7I A;  2ROL A;  5IAY A;  1M2V B;  2HQX A;  1QP3 A;  3UDC A;  2C0I A;  2V8I A;  1OU9 A;  3HRS A;  3UA7 A;  1W2B S;  2RJF A;  1EFN A;  4RTU A;  2KRN A;  3UAT A;  1IXD A;  1IHW A;  3M53 A;  3CPW S;  2MWP A;  3QDF A;  4OP0 A;  4IIO A;  1X27 A;  5CKH A;  5KYY B;  5LJ5 f;  2F1L A;  2X51 A;  2EQK A;  5KYN A;  3CXC A;  1M90 C;  1YJ9 T;  1VQL T;  4BI3 A;  2COW A;  2MK5 A;  2L3Q A;  1QMC A;  1JB0 E;  4V2S A;  2CZ1 B;  3EG3 A;  2LCL A;  5HY6 A;  1Q81 C;  1BCO A;  2ZPH B;  1QVF A;  3GOX A;  2LT4 A;  2VAS A;  2EW3 A;  4E47 A;  3PT9 A;  3CCV A;  3CME A;  2FRW A;  1KIK A;  5CQY A;  3FDR A;  2MIO A;  3MEA A;  5I2S A;  2O31 A;  5CVI A;  4D8K A;  2DA9 A;  3I5R A;  4C92 D;  1Y57 A;  4HCZ A;  1AD5 A;  1TUD A;  3FLG A;  4GBQ A;  1JQQ A;  2YT6 A;  2MAM A;  4P5N A;  3CCR A;  1T3L A;  5GMK m;  1LVK A;  1OPL A;  2DEU A;  2AZV A;  3G6E A;  1M1G A;  4F17 A;  1BI1 A;  2XKO C;  4JJB A;  4QW2 A;  1UGP B;  3KFV A;  4JS4 A;  3TVT A;  5FU6 B;  3HSB A;  1ZSG A;  2KRM A;  1YJW Q;  2K9G A;  3G4S T;  2DER A;  4BY6 B;  1UEC A;  1M27 C;  4M75 A;  3VUB A;  2O9V A;  1ABQ A;  2L8D A;  4DEX A;  5CK9 A;  4RG2 A;  4C0F A;  4GLK A;  2E1H A;  5LJ3 j;  4FSS A;  1RI0 A;  1WLP B;  1WYX A;  2QAS A;  1VQ9 A;  1VYU A;  5FLX E;  1TS9 A;  2RD1 A;  1HSQ A;  2RQT A;  3OBY A;  2QTV A;  3CC2 A;  1WHH A;  2AKL A;  4IUV A;  3CD6 A;  3EHR A;  1VYT A;  4PNO A;  2DLP A;  3OY9 A;  3OYY A;  2XG8 D;  4Z8A A;  1OYX A;  4PJO G;  2CZ7 B;  4PLL A;  2YUQ A;  2NYS A;  2CP2 A;  5A2Q E;  2DTO A;  3H6Z A;  2EYZ A;  3I55 T;  1VQO T;  1ARK A;  2BE9 B;  1SKU B;  3VUZ A;  1GL5 A;  3X26 B;  4OGE A;  4PJN A;  4KUD K;  2EGA A;  3M0S A;  3H41 A;  2J6F A;  2QDY B;  1ZBX A;  3CCS A;  4OMN A;  4OML A;  1B3Q A;  3LLR A;  2EPD A;  4HA8 A;  2EYY A;  1SSH A;  1OX9 A;  1VQ7 T;  3HRT A;  1YJN Q;  1IGU A;  1C6V X;  2DMO A;  2EQJ A;  2YLB A;  2GNC A;  1U1T A;  5GAN f;  3CCQ Q;  3QXE B;  2DD4 A;  4JJN K;  1BU1 A;  1NM7 A;  4C8Q C;  2RHY A;  2XID A;  4PLI A;  1D0Y A;  3I56 Q;  4FIB A;  1S72 T;  2FPF A;  1YI2 Q;  4LD6 A;  3EAE A;  1WXU A;  3EGD B;  1NPP A;  4M7D A;  2DK3 A;  3RBB B;  3A1P A;  7AT1 B;  3PMI A;  2DD5 A;  2DRM A;  1M1K U;  3FJP A;  4ZNX A;  1VQL A;  4RG8 A;  2RHU A;  4CI0 C;  4EIK A;  4N4G A;  3SWN A;  2HKN A;  2X4J A;  3QJ6 A;  2X3X D;  1RAA B;  1KC8 C;  1PRL C;  1M5Q 1;  5L8R E;  1K0S A;  1AWJ A;  2FRY A;  4JJD A;  4C92 C;  2QA4 Q;  3CMA T;  3HP9 A;  2Y4X A;  2O01 E;  1ZUY A;  1I4K 1;  1PRM C;  4LE9 A;  4B9W A;  3LW5 E;  1UTI A;  1VQ8 A;  2DTI A;  1G2B A;  3JCM V;  2CP7 A;  2JS0 A;  1LOJ A;  5M9O A;  1B7T A;  1JBM A;  2X4X A;  3OW2 S;  4PJM A;  2YHT A;  4A4G A;  3VRY A;  1R0C B;  1VQ5 Q;  2H3J A;  1D1A A;  3LWH A;  1WNL A;  4J9F A;  4JS5 A;  4Y92 A;  1RLQ C;  3CCJ A;  4L6V 5;  3A8G B;  1LJO A;  4DBQ A;  1TXQ A;  2XU8 A;  4CC7 A;  2V26 A;  3EGX A;  3NMZ C;  2EGE A;  2OTL A;  2DJZ A;  2KK4 A;  2LCC A;  1M8V A;  4E2F B;  1MV3 A;  2F5T X;  5FRN A;  3G4S A;  2FEI A;  2MCN A;  5A0D A;  3WVE B;  2PUO B;  2R5A A;  1YIT Q;  2F5K A;  3GBQ A;  1R8O B;  3FRN A;  4M7A A;  2JTE A;  1N5Z A;  1KQS P;  3CCL Q;  2EJF A;  2JTF A;  5LJ3 d;  3JCM c;  1JRI A;  3KBG A;  3M56 A;  4M7D C;  3MP1 A;  1S1N A;  3L2Q A;  4BI4 A;  1V1C A;  2LJ1 A;  1KD1 U;  1FMK A;  2EFI A;  4KBM B;  4K11 A;  1I81 A;  4C0Z A;  5J3B A;  4A4H A;  4R55 A;  3ASK A;  2F69 A;  2QK0 A;  1UG1 A;  1BIB A;  2QGG A;  4MZT A;  2RK1 A;  4GY5 A;  3VS2 A;  3VYG A;  3I55 A;  3CCU T;  1VQO A;  4ORZ A;  4HVV A;  1QKX A;  1Q86 U;  4PJO A;  2P0Q A;  3EG9 B;  2OI3 A;  2EWN A;  3OSV A;  5J26 A;  2C0O A;  2YSQ A;  3V8L A;  3AT1 B;  2KMT A;  1VQ7 A;  4ATO A;  2OTJ Q;  3JCM e;  2EJ9 A;  1UGS B;  1TOV A;  4M77 D;  2JW4 A;  1NBE B;  1Q95 G;  2RH2 A;  2QEX T;  4HKE A;  2XMF A;  1X2Q A;  5LL6 S;  3GLX A;  2DFU A;  4A4K A;  2M1H A;  1I5O B;  4FYY B;  4PFP A;  2NUP B;  3TRE A;  1LPL A;  6AT1 B;  2VB6 A;  2PTK A;  3THK A;  1VOM A;  2B86 A;  3A8H B;  1ZBJ A;  1PNJ A;  3L2Z A;  4NS5 A;  4M77 B;  2NWM A;  3FIF A;  1N8R C;  2E10 A;  5GAO p;  1MMG A;  2PU9 B;  2W10 A;  3N5B B;  3QYG B;  3G7Z A;  2GF7 A;  3CCM A;  4CRI A;  1D3B B;  4M7A C;  4ZN3 A;  2RHI A;  2EKO A;  3M0T A;  2R5M A;  4XTX A;  1IB8 A;  1ZQ1 A;  1X6G A;  3JCM h;  2M0O A;  3CMA A;  5GMK l;  4J9G A;  8AT1 B;  1NZ9 A;  1V76 A;  2VXE A;  4HVW A;  1WFW A;  1OI1 A;  3CXC S;  3OS2 A;  3NPF A;  3JB9 D;  5KYU B;  3A5Z B;  2JVV A;  3MEU A;  4M78 C;  5GAO q;  3FJ5 A;  1CKA A;  2SEM A;  2R57 A;  3LYI A;  2OAW A;  1K0X A;  2GCX A;  4MDW A;  1QVF S;  3QG1 A;  2F2X A;  3VYH B;  1OZ3 A;  2ZGW A;  3CCE A;  1AWX A;  2DF6 A;  3PGG A;  4ELZ C;  1VQ6 Q;  4RTX A;  5GAN 8;  4E7J A;  2GGR A;  4C8Q G;  1SRL A;  2KE9 A;  1HXD A;  1E6G A;  1VYV A;  3NFC A;  4JLG A;  3VS0 A;  1ABO A;  3CC7 T;  1K73 R;  2K5L A;  1JEG A;  2OX7 A;  2EKH A;  3U23 A;  2RQV A;  1KK7 A;  4C0G A;  1Y96 A;  2NUT B;  4VUB A;  3I56 T;  4PK4 A;  1YI2 T;  3PIO A;  4MZM A;  2DVJ A;  2BKD N;  4M77 E;  2W0Z A;  1VQN T;  2DXB A;  3RKW A;  4XTV A;  4IUP A;  2DYB A;  2P0P A;  3KXT A;  3OA6 A;  4FYV B;  4C92 G;  1UDL A;  1TG0 A;  1IO6 A;  4OMF B;  2YRC A;  2KR3 A;  5LJ3 f;  1WHG A;  2ENM A;  4J9D A;  1K9M U;  2A37 A;  3JAM E;  2QTX A;  2RI2 A;  3O8V A;  2E41 A;  3CCU A;  3QO3 A;  2ABL A;  1NYF A;  4XAX B;  2DVE A;  2JNG A;  2QA4 T;  2K57 A;  4D8D A;  4JRQ A;  1YHQ A;  5GMK j;  4BI8 B;  4KGV B;  1QVG A;  3M55 A;  1X6B A;  1BK2 A;  3G71 A;  1YIJ Q;  4XU2 A;  2MI6 A;  1B34 A;  1MNE A;  4FL6 A;  2ZCF B;  2YDL A;  4XU3 A;  3URG A;  2LCS A;  4J9C A;  2JZ2 A;  2VVK A;  4A4F A;  1RAI B;  3DB3 A;  3NTI A;  1U8R A;  1EIF A;  2KI7 A;  5A0L A;  4EMH A;  4BB7 A;  3QZ5 B;  1Q82 U;  4F7U B;  2VYT A;  3L42 A;  3E9G A;  1ZSZ B;  3M4Y A;  1XJW B;  1K8A U;  1AVZ C;  1QLY A;  2QEX A;  3D7S B;  3P8D A;  4C0D C;  1K76 A;  3J81 E;  1NJI C;  1U1S A;  3OYI A;  4J6Y A;  1D1C A;  1JJ2 P;  1M2O A;  2CUB A;  1J3T A;  3V7R A;  2RJE A;  1RUW A;  4EMG A;  2M51 A;  5GAM e;  2VUB A;  2MF2 A;  4M7D G;  3H0F A;  1WGS A;  1YIT T;  1Q7Y U;  4JLI A;  2X4Y A;  2BTT A;  2HKQ B;  3PNW C;  2PVO B;  4Y91 A;  3CCL T;  1MND A;  4FW2 A;  2DXT A;  2DL4 A;  1QCF A;  5IHK A;  1NJI R;  4M77 F;  2KBT A;  4PFZ A;  2A7Y A;  2DIL A;  2HCK A;  3OS1 A;  1M2V A;  1QKW A;  3RER A;  1KG1 A;  1R0B G;  3OYC A;  2PNI A;  4AFZ C;  4ZGD B;  3VS7 A;  1IHV A;  1W2B P;  1UHC A;  1VQK A;  1AEY A;  4BE2 A;  2JTM A;  2QYZ A;  2LJ3 A;  1VQ4 Q;  2FG0 A;  2QQA A;  2LNV A;  4JUV A;  3CPW P;  1U06 A;  1RAC B;  2DX1 A;  2E64 A;  2HBP A;  1N6A A;  2GBQ A;  1SSF A;  2YRV A;  2KAF A;  5CR2 A;  1WXB A;  3WVD B;  3PTA A;  4ELY C;  4KT0 E;  1M1K C;  1G83 A;  5HK0 A;  4OB1 B;  3MKD A;  3CPF A;  1M90 R;  3L2U A;  3NGP A;  5GAM h;  3RES A;  2L3S A;  1FMV A;  1X6O A;  3ULR B;  1NPR A;  3UT1 A;  4PL6 A;  2ROT A;  2E6N A;  4RTZ A;  1Q81 R;  1VIF A;  4ANJ A;  3P8H A;  4XQ3 A;  4F7U E;  4C8Q A;  2A28 A;  1OOT A;  4B6M A;  2CZ6 B;  3CC7 A;  4E7Z A;  1GCP A;  4QQ6 A;  1M1F A;  1U3O A;  2V8J A;  2COZ A;  3VS4 A;  3JB9 F;  3I56 A;  3REA B;  1VQM Q;  4DOV A;  4AFS C;  5LJ3 h;  4JRI A;  4RUG A;  4DEY A;  3ZBD A;  1PHT A;  1NYG A;  2CH4 W;  4M7A G;  1Z9Q A;  2FO0 A;  3PFS A;  4DA4 A;  2K4Y A;  1VQN A;  3BW1 A;  1RAH B;  4L59 A;  4EDU A;  3NTH A;  4HT8 A;  3GNF B;  2VV5 A;  4IUT A;  1ZSZ C;  4XTW A;  3M0U A;  3BE3 A;  1XOV A;  3R6O A;  2M9U A;  5KYX B;  2XDD A;  5GMK i;  3MHX A;  1R77 A;  4C92 A;  2KT8 A;  3M0Q A;  1WQ7 A;  3DB4 A;  5LJ5 e;  1TSF A;  2CT3 A;  4M78 G;  5KYW B;  2E12 A;  3UPU A;  2QA4 A;  1RAG B;  1WA7 A;  3OYG A;  1I0C A;  2A36 A;  1WHL A;  3PIP A;  2QXF A;  5GAN 3;  2V1Q A;  3QJY A;  3SEM A;  4C5H A;  3JCM X;  2A3L A;  1RAB B;  4NL3 A;  2D8H A;  3V7C A;  2LX7 A;  3L2V A;  5DM7 R;  1H64 1;  1UJ0 A;  1E6H A;  2O9S A;  3V8K A;  3C0C A;  1M4Z A;  3LX7 A;  2NLU A;  5GAO n;  1MMN A;  2YUO A;  1CKB A;  2P4R A;  1KD1 C;  5FRO A;  3VS5 A;  2DL3 A;  1N9R A;  2PVD B;  1UGR B;  2J6O A;  1M3C A;  1RAD B;  2FB7 A;  1VQ6 T;  3M0P A;  2EYW A;  3PVL A;  3L1A A;  3CME Q;  3LGL A;  1ACM B;  2E5K A;  2CP3 A;  1OZ2 A;  2DL7 A;  4F7U F;  2PVG B;  1VQP A;  3WXM B;  3JCM Q;  2K3Y A;  2C0T A;  4HT9 A;  1T0J A;  2G3R A;  3EG0 A;  5LJ5 h;  1PSE A;  1MHN A;  5IT9 E;  2RA2 A;  1YIT A;  4EPC A;  1KFZ A;  3QPH A;  3CCR Q;  2LQ8 A;  2HQH A;  5KCH A;  2IPO B;  1RAE B;  2L2P A;  4M75 E;  3G6E Q;  3PVQ A;  5CCA A;  2C06 A;  4WTO B;  5D7U A;  3HTR A;  4R0K A;  2YXY A;  1X69 A;  3BFM A;  2E3I A;  1YJ9 A;  2KXD A;  1GBQ A;  5KE3 A;  1UUE A;  3GF5 A;  4AFQ C;  3M9Q A;  3SWN B;  3LH0 A;  3QZ9 B;  4E6R A;  5FU6 C;  3VS3 A;  2I0N A;  3E2U A;  1C0M A;  1SRM A;  4JRP A;  3UA6 A;  2H3E B;  5FWB A;  1NLP C;  4BY6 C;  3VV0 A;  4F04 B;  3HFN A;  4LDV A;  4IUU A;  2JT4 A;  1BI3 A;  3H0H A;  1VA7 A;  5AT1 B;  1VQ9 Q;  3LH5 A;  3MEV A;  2DPP B;  3EH1 A;  4F16 A;  5ECA A;  2LP5 A;  2DIG A;  2XDP A;  3CC2 Q;  4ESR A;  4RTY A;  2BZY A;  4DBH A;  1PC0 A;  2CP6 A;  1PWT A;  4FSX A;  2YWW A;  1KC8 R;  3JRZ A;  3A8L B;  2RQW A;  4ME7 A;  5FU7 B;  2HAX A;  1UHF A;  2LJ0 A;  2JMC A;  1KQ2 A;  1N27 A;  1W70 A;  2JJ9 A;  3M57 A;  2FZC B;  2K3B A;  2ZPI B;  3EGX B;  4AFU C;  1PD1 A;  2ZPE B;  1UJY A;  5J39 A;  3OW2 P;  4DBF A;  3CC4 T;  2D8J A;  3CCS Q;  4LDU A;  5GAN e;  2F2V A;  2KGT A;  3VS1 A;  3UF4 A;  3IQL A;  4RCB A;  4O6J A;  1WJQ A;  1XTD A;  3MP6 A;  1BIA A;  2K5F A;  3OSS C;  3I5S A;  4ZN1 A;  3JCM W;  3MET A;  1QW1 A;  1GFC A;  1PD0 A;  3X24 B;  4N0A C;  4M75 F;  3MJX A;  2AHJ B;  4L5G A;  1Y7X A;  2F2W A;  1ZUK A;  3H9N A;  2LDM A;  4HXJ A;  4C5G A;  1PKS A;  5IXF A;  2AT1 B;  2L0A A;  1PG5 B;  2FPD A;  4KUL A;  4YTL A;  2LC4 A;  3NTK A;  4MMK A;  1FXX A;  1HD3 A;  2X4W A;  4M78 A;  4LUE A;  3OYE A;  1WDX A;  2MYS A;  1CSK A;  2ZPG B;  4PJO B;  2HMA A;  1VQL Q;  2JMA A;  4XU1 A;  1BB9 A;  2FZK B;  2LRQ A;  1AZG B;  1Z9Z A;  5GAN h;  2DBK A;  2H8H A;  1IRE B;  1YWP A;  1KQ1 A;  4NL2 A;  1FX7 A;  2VWF A;  1FYN A;  1K9M C;  2DXC A;  1QVG S;  1VQ6 A;  1A0N B;  2HBW A;  4LN2 A;  2PUK B;  3SFM A;  1MUZ A;  4C5I A;  4CC4 B;  4IKF A;  3EG9 A;  1NG2 A;  1I07 A;  1VQ8 Q;  3A8O B;  2AZS A;  2CGH A;  4HCK A;  4FT2 A;  1P92 A;  2FPE A;  2J05 A;  3UWN A;  1S72 A;  4X34 A;  2P0K A;  4BDZ A;  1FWZ A;  2NUZ A;  2KRS A;  2DZC A;  2EGC A;  3AHU A;  1G3T A;  2D0N A;  1O75 A;  2KRO A;  1YJW T;  3CCJ Q;  3G1J A;  3TCJ A;  4A63 B;  1SEM A;  1FMW A;  2LX9 A;  1K8A C;  2QQB A;  2L3R A;  5GJW B;  1JU5 C;  2RHX A;  5FU7 C;  2OTL Q;  1YP5 A;  2VC8 A;  2K79 A;  2VXF A;  3SDZ A;  2NUP A;  2VGN A;  4N4H A;  1JXM A;  4QKU A;  3CEY A;  3EFO B;  2OAU A;  2YUP A;  5D6W A;  1WIE A;  3P8B B;  3QUI A;  5I11 A;  4LNP A;  4F14 A;  1WQW A;  2SRC A;  1Q7Y C;  3JB9 I;  1TWB A;  2DEQ A;  1WHK A;  4Z02 A;  1X43 A;  3ER0 A;  1D3B A;  1N8R R;  2COY A;  3JV3 A;  1JO8 A;  4XTU A;  1MMA A;  2KYB A;  1SPK A;  4PJO E;  2EIF A;  2KY9 A;  4IIM A;  2E65 A;  2E6Z A;  3JCM b;  5KCO A;  1LCK A;  2CKK A;  3OW2 A;  1UEB A;  2V1R A;  2O4X A;  1QP2 A;  4RTV A;  4DQ2 A;  3S3N A;  1SHF A;  1GCQ C;  3I55 Q;  1VQO Q;  2HNI A;  1WHM A;  2HSE B;  1X75 C;  2KT1 A;  3CXC P;  1Q7Y R;  1RAF B;  1E7O A;  1O9S A;  1KQS A;  1YJN T;  4LDX A;  3SB2 A;  5GAO m;  3DLL A;  2CP0 A;  3CC4 A;  1RI9 A;  2FL7 A;  1SHG A;  3CCQ T;  3RR6 A;  1AHJ B;  4PKC C;  3M58 A;  1D1B A;  1QVF P;  2BZ8 A;  3MO8 A;  3EFR A;  2D9T A;  3RIR A;  1SG5 A;  4OVA A;  3LGF A;  3CCR T;  4WCI A;  3TSW A;  4RTT A;  3OS0 A;  2KYM A;  2RO0 A;  4QVZ A;  2EQU A;  3JCM g;  3JCM P;  1M30 A;  4II1 A;  4JZ3 A;  4BAC A;  2E70 A;  4HCB A;  2MMP A;  2LZ6 B;  4OB3 B;  1DJ7 B;  5GMK h;  4JDS A;  3SHW A;  1X01 A;  3EH2 A;  3VRZ A;  4X9D A;  5CKE A;  4IUQ A;  4XK8 E;  2MWO A;  5FRM A;  2AK5 A;  2JUF A;  2XHC A;  2RM4 A;  4EMK B;  5KH6 A;  3CBM A;  1TUC A;  1NE8 A;  5D6Y A;  5C0M A;  3CCM Q;  4M77 C;  1RLP C;  1OEB A;  4O5V A;  4OF1 A;  3A8M B;  2FYK A;  1PKT A;  2CT4 A;  1SF9 A;  1N9S A;  2M16 A;  4PJO F;  3CMA Q;  2XD0 A;  2ED0 A;  2KEA A;  2QQR A;  2DM1 A;  5D6X A;  4J83 A;  1GRI A;  3OYJ A;  1VQ5 T;  2RHZ A;  1GFD A;  4J7F A;  4ZGE B;  5A0G A;  1JXO A;  2KQW A;  3C94 A;  3OYB A;  3RKX A;  2EQM A;  1PSF A;  1X2K A;  3QBY A;  4GLM A;  4CC3 A;  2RJD A;  2DYI A;  3OYK A;  2XDB A;  2EYX A;  2HZY A;  2M0Y A;  3HKS A;  4DBR A;  2L5Q A;  2EQI A;  1BI2 A;  1YJW A;  2DRK A;  3CCE Q;  4B9X A;  1Y0M A;  1NLO C;  1ZSZ A;  2RI3 A;  2L3P A; 
#chains in the Genus database with same CATH homology
 3EHQ A;  4J9B A;  2D8H A;  1MV3 A;  2JXB A;  2LX7 A;  2FEI A;  2MCN A;  1YWO A;  1UJ0 A;  1E6H A;  1H3H A;  2O9S A;  2GTJ A;  3GBQ A;  3C0C A;  2CH4 A;  2JTE A;  1N5Z A;  2OJ2 A;  1CKB A;  2P4R A;  2YUO A;  2O88 A;  5EC7 A;  3VS5 A;  2DL3 A;  4OMP A;  2ED1 A;  5IHN A;  1K9A A;  2J7I A;  2QDL A;  1NEB A;  1M3C A;  2J6O A;  3M0P A;  2EYW A;  3PVL A;  2RNA A;  2GQI A;  4JPB W;  2E5K A;  1S1N A;  1BBZ A;  2ESW A;  3NHN A;  1V1C A;  2LJ1 A;  4J9H A;  2DL7 A;  1FMK A;  1AZE A;  2C0T A;  4K11 A;  1T0J A;  3EG0 A;  1UG1 A;  1K4U S;  3VS2 A;  2KXC A;  1KFZ A;  3RNJ A;  4ORZ A;  3O5Z A;  4HVV A;  1QKX A;  1YNZ A;  1B07 A;  2DNU A;  2HDA A;  2JM8 A;  1AOJ A;  5GJV B;  4CC2 A;  2L2P A;  2OI3 A;  2DL8 A;  4Z88 A;  2C0O A;  3PVQ A;  2YSQ A;  1M3A A;  4R0K A;  1X69 A;  2KXD A;  4LUD A;  1GBQ A;  1WI7 A;  1UUE A;  1GBR A;  4AFQ C;  1QWE A;  1YCS B;  2A08 A;  4E6R A;  3PE0 A;  2JW4 A;  3VS3 A;  2I0N A;  2LQW A;  1SRM A;  1KJW A;  3UA6 A;  2RMO A;  1UFF A;  2XMF A;  4JJC A;  5FWB A;  1X2Q A;  1NLP C;  1ZUU A;  2G6F X;  3VS6 A;  2JT4 A;  4Z89 A;  3H0H A;  1VA7 A;  2LQN A;  3LH5 A;  2PTK A;  2CUD A;  3THK A;  4F16 A;  5ECA A;  4KRT A;  1I1J A;  2B86 A;  2DE0 X;  2LP5 A;  2K2M A;  2VKN A;  1ZBJ A;  4ESR A;  4RTY A;  1PNJ A;  2BZY A;  1AWO A;  1PWT A;  2CRE A;  2LNH B;  2NWM A;  4M4Z A;  4RTW A;  3H0I A;  2W10 A;  2RQW A;  3EGU A;  1UHF A;  2LJ0 A;  2JMC A;  3M0T A;  1W70 A;  1X6G A;  2K3B A;  4AFU C;  1UJY A;  4J9G A;  3EG2 A;  1T0H A;  2D8J A;  3QWX X;  2F2V A;  2CDT A;  2KGT A;  4J9E A;  1T3S A;  1WXT A;  4HVW A;  1WFW A;  3VS1 A;  3UF4 A;  3IQL A;  3NPF A;  3CQT A;  3A98 A;  1M8M A;  2ROL A;  3I5S A;  3FJ5 A;  1CKA A;  2C0I A;  2SEM A;  1GFC A;  2OAW A;  5I22 A;  1K0X A;  3UA7 A;  1EFN A;  3I9Q A;  4RTU A;  2KRN A;  2F2W A;  2F2X A;  1NEG A;  2DL5 A;  3UAT A;  1ZUK A;  4HXJ A;  1PKS A;  1AWX A;  2AKK A;  2DF6 A;  5IXF A;  4RTX A;  2GGR A;  1SRL A;  4IIO A;  1X27 A;  2L0A A;  2EBP A;  2FPD A;  1UE9 A;  1HD3 A;  2KE9 A;  1E6G A;  1VYV A;  2J06 A;  4LUE A;  2L3Q A;  1WDX A;  3VS0 A;  1ABO A;  1CSK A;  4OMQ A;  1JEG A;  3EG3 A;  2EKH A;  2JMA A;  2RQR A;  3U23 A;  2RQV A;  1BB9 A;  3M0R A;  1AZG B;  1Z9Z A;  2EW3 A;  2DBK A;  2H8H A;  1YWP A;  2DVJ A;  2D1X A;  1QWF A;  2O2O A;  2VWF A;  1FYN A;  2FRW A;  2W0Z A;  4AG2 C;  1KIK A;  1A0N B;  2HBW A;  2MIO A;  4LN2 A;  2RPN A;  2DYB A;  1MUZ A;  4JZ4 A;  2O31 A;  4CC4 B;  1UDL A;  4D8K A;  1NG2 A;  2DA9 A;  1TG0 A;  3I5R A;  1IO6 A;  1I07 A;  1Y57 A;  2KR3 A;  1AD5 A;  2AZS A;  1TUD A;  2IIM A;  4GBQ A;  1JQQ A;  4HCK A;  2YT6 A;  4OMO A;  2ENM A;  4J9D A;  1T3L A;  2A37 A;  2FPE A;  2J05 A;  1OPL A;  5IHI A;  2AZV A;  1H92 A;  2NUZ A;  2ABL A;  1NYF A;  2HSP A;  4F17 A;  2KRS A;  4X1V A;  2EGC A;  4D8D A;  2D0N A;  4JJB A;  2KRO A;  3KFV A;  3TVT A;  1X6B A;  1BK2 A;  4A63 B;  1SEM A;  1ZSG A;  2YDL A;  2KRM A;  2K9G A;  2JS2 A;  5GJW B;  2LCS A;  1JU5 C;  4J9C A;  1UEC A;  1M27 C;  1YP5 A;  2VVK A;  2K79 A;  2RF0 A;  2O9V A;  1ABQ A;  4DEX A;  1JXM A;  2YUN A;  2YUP A;  1WIE A;  2HEQ A;  1AVZ C;  1QLY A;  1W1F A;  3R6N A;  4LNP A;  4F14 A;  5I11 A;  4FSS A;  1WLP B;  1WYX A;  1VYU A;  2SRC A;  1K76 A;  1HSQ A;  4J9I A;  2RQT A;  2PZ1 A;  2X3W D;  1X43 A;  1KSW A;  2CSI A;  2CUB A;  1J3T A;  2AKL A;  3JV3 A;  1JO8 A;  3EHR A;  1RUW A;  2KYB A;  1SPK A;  1VYT A;  2DLP A;  4IIM A;  2M51 A;  3ZL7 C;  2DBM A;  4Z8A A;  2YUQ A;  3H0F A;  1LCK A;  4QT7 A;  2EYZ A;  1ARK A;  2RQU A;  2V1R A;  2BTT A;  4RTV A;  1SHF A;  1GL5 A;  1GCQ C;  2GTO A;  2KT1 A;  2EGA A;  2DL4 A;  3M0S A;  1QCF A;  3H41 A;  5IHK A;  2J6F A;  1E7O A;  2KBT A;  2DIL A;  4OMN A;  1B3Q A;  4OML A;  2HCK A;  1ZLM A;  1QKW A;  2EPD A;  2RN8 A;  2EYY A;  1SSH A;  1RI9 A;  1SHG A;  2PNI A;  4AFZ C;  1YN8 A;  2DMO A;  3VS7 A;  1UHC A;  2ECZ A;  1AEY A;  2GNC A;  2LJ3 A;  2FG0 A;  2BZ8 A;  4OMM A;  1K1Z A;  1U06 A;  1GCQ A;  2DX1 A;  2GBQ A;  1BU1 A;  1NM7 A;  4WCI A;  3TSW A;  1WXB A;  4RTT A;  2MOX A;  2KYM A;  1G83 A;  2FPF A;  1U5S A;  1M30 A;  4JZ3 A;  1WXU A;  2LZ6 B;  1M3B A;  3NGP A;  1W6X A;  2L3S A;  3ULR B;  3SHW A;  3RBB B;  2ROT A;  5HCK A;  4RTZ A;  2DRM A;  4ZNX A;  3VRZ A;  2A28 A;  1OOT A;  2AK5 A;  4HVU A;  4EIK A;  2J6K A;  1GCP A;  1OV3 A;  2EVR A;  2X3X D;  1TUC A;  1U3O A;  1PRL C;  2CSQ A;  1K0S A;  1AWJ A;  1UGV A;  1MV0 B;  1AWW A;  2FRY A;  1RLP C;  4JJD A;  3VS4 A;  3REA B;  1OEB A;  2K7A A;  5FWC A;  4AFS C;  1H8K A;  3I35 A;  1ZUY A;  4RUG A;  4DEY A;  2JM9 A;  1PHT A;  1PKT A;  1PRM C;  4LE9 A;  1NYG A;  2CH4 W;  2CT4 A;  1Z9Q A;  2FO0 A;  3TSZ A;  3REB B;  1UTI A;  1G2B A;  2ED0 A;  2KEA A;  2BZX A;  1ZX6 A;  5FW9 A;  3QWY A;  2LMJ A;  2DM1 A;  2JS0 A;  3M0U A;  1GRI A;  1XOV A;  2DJQ A;  1GFD A;  1JXO A;  3VRY A;  1X2K A;  2KT8 A;  3M0Q A;  3EG1 A;  2KNB B;  4J9F A;  5IXB A;  4GLM A;  1OPK A;  4CC3 A;  4Y92 A;  4AG1 C;  1RLQ C;  2CT3 A;  2EYX A;  1HJD A;  2K6D A;  2M0Y A;  1WX6 A;  1WA7 A;  2EQI A;  1I0C A;  2A36 A;  4CC7 A;  5L23 A;  2DRK A;  3NMZ C;  2EGE A;  1Y0M A;  1NLO C;  2V1Q A;  2L3P A;  5IH2 A;  3SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...