2AZTA

Crystal structure of h176n mutant of human glycine n-methyltransferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
289
structure length
276
Chain Sequence
YRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDNRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Destabilization of human glycine N-methyltransferase by H176N mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glycine N-methyltransferase
total genus 78
structure length 276
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 2aztA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aztA02
4QPPA 5FTWA 4BLUA 3KQSA 5GIPE 4RTPA 1L3CA 2QE6A 3AJDA 3EVBA 3NJRA 4M38A 4RTJA 5K03A 3EVZA 5K05A 1VBFA 4RVDA 1TW3A 2BM8A 4C03A 4R6WA 3CJRA 3FUUA 1KPHA 3M6WA 3O4FA 5EEHA 3MERA 3UJ9A 1NW5A 3R3HA 2C7PA 1JSZA 4X1OA 1Y8CA 2EX4A 4KDRA 1P1CA 2YXDA 1EQAA 4G56A 3JWIA 4E2XA 4EK9A 4PYMA 5K0JA 2IFTA 2HWKA 5ICFA 5JR3A 4O29A 3TM5A 9MHTA 1XJ5A 2XYVA 3KQYA 5EHGA 2ZWVA 3M70A 3GGDA 1FP2A 4PCLA 4EQZA 2F8LA 3UA3A 2JHCA 4RTRA 4FS8A 1BOOA 5LQRA 1YFJA 4ER3A 1G8SA 2UYCA 1EIZA 3EMDA 1R00A 2AOUB 1MJFA 2OB2A 3A7EA 2DPMA 3MQ2A 4GBED 4PYQA 4BP3A 2AOTA 3LHDA 3LX6A 3IHTA 2P3LA 1JQEA 3LBFA 1UFKA 2AN5A 3VSEA 2YVLA 4DCMA 4DQ0A 4DA4A 1RJGA 2IDJA 2B9EA 3HCDA 3JWJA 5LQAA 4C04A 3BGDA 2I7CA 4E32A 5KQRA 4PYKA 3ELDA 5FCDA 1N7IA 3T7RA 1JG1A 2LD4A 4KRGA 3HCAA 4ATNA 4CKBA 3PTAA 1NW7A 2GA9A 2VDUE 2CMGA 3R24A 2FK8A 1R8XA 3ID6C 2G72A 2ZTHA 1PJZA 4FP9A 4P58A 3UJDA 5GINE 3JWHA 5U4XA 2PBFA 3B7PA 4CTJA 2P7IA 5C1IA 4C05A 8MHTA 4KIFA 4MTLA 5DX0A 5FADA 1VP9A 4A6EA 5DPMA 3EEOA 1F3LA 1NW8A 5HIIA 1G55A 4XUCA 4RYLA 2PXCA 3TM4A 3BUSA 5MHTA 4JXJA 4C07A 4HTFA 2YUIA 3VC2A 4X61A 2CL5A 3HVKA 5BW4A 4Z2YA 5ICCA 3PT9A 4XUEA 2Z6UA 5CUQA 5DXJA 4OBWA 4DCGA 2OZVA 5EG5A 1R8YA 3KQPA 2OXTA 5LQKA 3SR4A 2AOXA 2PX4A 1P1BA 3BKXA 3NW9A 3DXYA 3M6UA 2IPXA 5CIYA 2GPYA 3AY0A 3JWGA 3UFBA 2ZIFA 3DMGA 3DXZA 1HNNA 1SVUA 3ERCA 1G60A 1WG8A 4PNEA 3UJ6A 5GM2A 1ZGJA 2XVAA 2ZSUA 3HM2A 3M6XA 5DTMA 3GNLA 5E9JA 2AZTA 2OB1A 5EHIA 5IH3A 3PFHA 3EMBA 4RSRA 4YV2A 5HEKA 2ZZKA 3TQSA 4YMHA 4CWAA 1QYRA 3P71T 3S68A 1FJXA 4L7VA 1WZNA 3KQMA 2HNKA 2EFJA 3GXOA 5FULA 2GAFA 5HILA 4CKCA 2O0LA 4E33A 1BHJA 2IH4A 2E5WA 2R6ZA 3OZTA 3H2BA 2PSSA 3KPUA 5DTQA 1D2HA 1YUBA 3EVDA 5H02A 3DULA 3SXJA 4ER5A 2B78A 3P9KA 3P8ZA 3PLAE 3P9CA 2PX8A 4IWNA 1R74A 1NW6A 5E1MA 5EIFA 3G2PA 3DMHA 4PCAA 5T64A 1WY7A 5EPEA 1XCLA 2ZBQA 3C0KA 3KPJA 4DMGA 1YFLA 1DL5A 5ERGB 5LSAA 3HA3A 3REOA 4XUDA 5HFJA 1P39A 2O05A 1INLA 4P7FA 3AXSA 5DM0A 3UJ7A 3FZGA 4E31A 3FTEA 2G71A 2ONYA 5LQNA 1O9HA 1X1AA 4YUZA 7MHTA 3EVGA 1ZKDA 1D2GA 5CVDA 5KVAA 2UZ4A 4R6XA 2VS1A 5E2BA 3CGGA 3G7UA 3GIWA 2WA2A 3EGEA 3CVOA 2JG3A 1IM8A 2PGXA 3BWBA 4FR0A 3FYDA 3I53A 2NP6A 4P7KA 5ICEA 3KPWA 3E05A 1N7JA 2P35A 3A4TA 3HP7A 3LL7A 3MAGA 4MIKA 4Y2HA 2G1PA 2IBTA 2PJDA 5E9QA 1IXKA 3KU1A 1X19A 3KR1A 4XCXA 1P91A 2CKDA 2BR4A 3EPPA 3TKAA 3LCUA 5K0CA 2I62A 3LKDA 4HC4A 4HH4A 5DRYA 2C7OA 4AZVA 4OQEA 3LGAA 1SUIA 5GWXA 3A25A 2O07A 3PX3A 4MHTA 3UJAA 1QAQA 3FTDA 1V39A 2B3TA 1KR5A 3DTNA 4QVGA 2EJTA 4DZRA 3HA7A 1SQGA 3A27A 5KYGA 3B3GA 4HG2A 2ZWAA 3RIEA 3BWCA 2ZZMA 2IH2A 1XVAA 2V74B 3FYCA 3HCEA 1DUSA 3E8SA 4RV9A 3SSNA 2UYHA 5CCBA 3BWYA 1B42A 3ME5A 4DKJA 1L3IA 2GB4A 3G8BA 1ZGAA 3LBYA 3QOWA 2ZVJA 2Y1WA 2AVNA 3O31A 1NV8A 1KP9A 3SGLA 4HGZA 3I64A 4A6DA 4GC5A 3SX0A 4MQ4A 2H11A 3TKYA 1FPQA 3TRKA 3R6TA 4EMSA 4DM3A 3GRVA 4PYIA 3DLCA 3GDHA 4K6MA 5FA5A 2HMYB 3G2QA 3G8AA 3UA4A 1XDZA 2IBSA 4PONA 4V0RA 4QVKA 2B2CA 2VP3A 2FYTA 3RODA 3ELWA 2AN4A 3BZBA 1AQJA 3EGVA 2ZBRA 3SVZA 5KQSA 2OPBA 4RTSA 1SKMA 1O54A 5DSXA 1XXLA 1JG2A 2XVMA 4PGGA 1EG2A 4BLVA 3EVCA 3GU3A 3OE4A 2GS9A 1Q0TA 5IKMA 2XBMA 2IGTA 1QANA 3OZRA 3MGGA 3KQVA 3EGIA 2EG5A 2BR5A 3GCZA 2PV0A 5T6BA 4C4AA 2BH2A 1BKYA 5F2NA 4FSDA 5FA8A 4FT4A 2JHAA 3FPEA 3GJYA 4OQDA 5E1DA 4ZTBA 1M0EA 3TLJA 1FBNA 2NXCA 1X1DA 4RTMA 2K4MA 3RW9A 3O7WA 3NWEA 3CJTA 1EJ0A 2Z6QA 1TW2A 3DLIA 4KWCA 3KHKA 3KPVA 4CXMA 1SG9A 4YUYA 1VE3A 3R0QA 3KR9A 1NT2A 1JG4A 2C7QA 3VC1A 2ORED 1U2ZA 2O06A 2P3OA 3NWBA 5E8JA 3OCJA 3FPHA 3PB3A 3EVEA 1JR4A 5DX1A 3P97A 4EKGA 5K0BA 2FCAA 3KR0A 5FHQA 2PXAA 2WK1A 4IKPA 5CVEA 3FTCA 3FUWA 4LWPA 2HV9A 2NXJA 2GH1A 4RVFA 5EMJA 2Q41A 5HIKA 5CD1A 3R9XB 2ZCJA 2IP2A 5F2OA 1IY9A 2CWWA 1VPTA 2BM9A 4YMGA 2P40A 3HVHA 2GLUA 3I5UA 3KR2A 4RTLA 1I4WA 3C3PA 5JUWA 4EKIA 2NNWB 4F86A 5K0NA 5CCXA 1EJ6A 2H1RA 5K0GA 5BP7A 1NBHA 1YF3A 2P1DA 1AQIA 1QZZA 4RTQA 1D2CA 10MHA 3GRZA 2IH5A 3C6MA 2ZIGA 3BXOA 2ONZA 4GOLD 3FUVA 3EEYA 4GOND 4LECA 3DMFA 4RVHA 3TMAA 3UJ8A 4ER6A 3P2IA 4GUAA 2IDKA 4QTUB 5EMKA 5EKXA 1Z3CA 3WSTA 5DLYA 4P7JA 1ORHA 1XDSA 3OU6A 3FPJA 5F2KA 1AF7A 4RTOA 4IV8A 5HIJA 5K01A 3CCFA 1L3BA 4CTKA 4RTKA 3DR5A 1KPGA 3FUXA 3K0BA 3Q87B 2QRVA 3CC8A 2V7EA 3FUTA 4FT2A 4PINA 3A26A 4E2YA 4PWYA 4ER0A 2UYOA 5GOZA 4WXHA 3B3JA 2JJQA 3LCVB 2BR3A 1L9KA 3HA5A 2VZ9A 3P2EA 2N47A 3L8DA 3P2KA 3Q7EA 3QOXA 1VP3A 5EEGA 5FHRA 5EMMA 5P8WA 4R8RA 2OKCA 1VIDA 4PYOA 4KVZA 3FPFA 4GQBA 3VYWA 2QRVB 3B3FA 4PIMA 1NE2A 1KYWA 5EZQA 2YXLA 3EVAA 3KKZA 1JQDA 4POOA 2IIPA 3FTFA 4E30A 4H0NA 4AZWA 2OBFA 1RI5A 5CM2Z 1JSXA 1Q0SA 5B1SA 2YQZA 1ORIA 1X1CA 3BGVA 3DH0A 5LQCA 1UWVA 1ZG3A 4YV0A 3FRIA 1PRYA 3AWIA 2C7RA 1AV6A 3LDGA 1M6YA 3X0DA 2BZGA 4X63A 3FRHA 4LWOA 5E1OA 1XCJA 3OU2A 4F85A 1YB2A 3NDJA 3MCZA 4BY9E 3LECA 4R05A 1DCTA 2ERCA 5EOVA 5C0OE 2HTEA 3PVCA 1WXXA 4GOMD 4IV0A 2YXEA 1JTFA 1KPIA 1SQFA 3NVKI 4ISCA 4OBXA 4CKEA 1NBIA 2ZIEA 3ER9A 4QDKA 3F4KA 5T67A 4YUXA 3GRYA 2VDWA 5ICGA 3MTEA 3BKWA 1O9GA 3P9NA 1KIAA 3B89A 3ELUA 2HR1A 2ADMA 3PX2A 1G8AA 3KQOA 4YUWA 3LDUA 3NDIA 5DM2A 2YR0A 5EQJB 3U81A 3ANXA 3HCFA 2XYQA 3HEMA 2NP7A 3OFKA 3MTIA 4OA8A 3KQTA 1JTEA 5E9WA 3T0IA 2PKWA 2PVCA 1SUSA 1WS6A 1R6AA 3G2OA 1RJDA 3M33A 4AX8A 3G89A 2DULA 3HTXA 3C3YA 5EC8A 4PGHA 4M37A 3M4XA 2QM3A 3BGIA 2VDVE 4U7TB 2G8NA 2YX1A 2FK7A 5CVVA 1BC5A 3D2LA 1VQ1A 3KPYA 4HGYA 5FQNA 1OR8A 2ZZNA 2NXNA 3SSOA 5HOQA 2Z6AA 2PT6A 2AVDA 2PX2A 4FZVA 5DXAA 3V97A 1G38A 1H1DA 2PLWA 2AN3A 3SM3A 1RI3A 1RJEA 3A7DA 5GP1A 3C6KA 3OZSA 2ESRA 5CVJA 1WXWA 2P3QA 3GWZA 3LDFA 4MWZA 3ELYA 4AZTA 1HMYA 3HCBA 3OU7A 1RI1A 2O57A 3OFJA 3SMQA 3PS9A 3ER8A 3DOUA 4RTNA 4GF5A 5EGSA 4EVIA 2PX5A 2B25A 4QQKA 1G6Q1 1MHTA 4YV1A 1JQ3A 4ER7A 2PXXA 3GO4A 4RVGA 4C08A 4QDJA 1L1EA 4PIPA 4V0QA 3NTVA 3CJQA 3UJBA 5BXYA 2OY0A 4OX9Y 2NYUA 2AOVA 5EKUA 5GIOE 5EIWA 2ZLBA 3LCCA 4B17A 4Y30A 4M36A 4LG1A 2AOTB 3AXTA 4HRAA 5CVUA 3ORHA 5FUBA 1YZHA 3K6RA 5LQUA 4C06A 3QV2A 5C9ZA 3T7SA 4OA5A 5DRTA 1I1NA 5HZMA 5K0LA 1NV9A 3IEIA 4FSXA 3NMUF 5EZSA 3I58A 3E23A 3NVMB 1JG3A 3G5LA 3KQQA 4PYLA 4YUVA 4DF3A 5DX8A 5LQJA 1KXZA 2QYOA 1QAOA 3CKKA 1F38A 3UZUA 3T7TA 4AUKA 5GM1A 2Y1XA 5E8RA 4M7RA 1NW3A 4KDCA 3HVIA 4WVLA 2OYRA 5K0FA 2G70A 2NXEA 2P7HA 5M5BA 4GC9A 2AR0A 2FHPA 1ZQ9A 1KHHA 5D1NA 5LR6A 2FPOA 3LSTA 2H00A 2PWPA 2AOUA 4QQNA 1RJFA 4GOOD 5D1HA 2KW5A 3TOSA 3IYLW 4KW7A 3HVJA 5BW5A 5K8VA 2AS0A 3MCTA 5DM4A 1TPYA 3G2MA 4P7GA 3MHTA 2I6GA 3EVFA 3OPNA 5FWAA 2JHPA 3E7PA 1KYZA 1RI2A 2XYRA 3THSA 3GRRA 5FWDA 3UWPA 4PYJA 5DWQA 2PWYA 2A14A 3IV6A 3PFGA 4HTFB 2JH8A 1UIRA 2QY6A 4X60A 3V8VA 1XTPA 2ZW9A 4QPNA 1M6EX 2PY6A 5FQOA 2CMHA 3TFWA 4RWZA 2OO3A 3GRUA 5DT2A 3BWMA 1XDUA 5DSTA 2P8JA 3DP7A 4E2ZA 1EAMA 3BT7A 3DXXA 5KS2A 2AOWA 4HSGA 3KQWA 3LPMA 3OE5A 5EVJA 1VLMA 1T43A 5HIMA 4UOEA 2FRXA 3THRA 4FGZA 5K09A 2JH9A 2ZULA 3CBGA 2EJUA 3HNRA 4QTTB 2R3SA 1X1BA 2ZFUA 1FP1D 4GEKA 4NECA 4X41A 4BP1A 5DTRA 3I9FA 4F84A 4U7PB 4PYNA 5EMLA 5E1BA 3G5TA 3HCCA 4KIGA 1YZ3A 1N2XA 1VL5A 2WA1A 3SSMA 3UJCA 4BLWA 2PT9A 1ZHFA 1R18A 2YTZA 5G02A 1I9GA 3TPZA 5DM1A 1RI4A 2P41A 4E2WA 3M6VA 3G88A 3TR6A 3FPGA 5E2AA 4R8SA 4E70A 5K0EA 1QAMA 3B5IA 4AZSA 2ZBPA 3DUWA 3MB5A 3UBTA 1NKVA 3P9IA 3LKZA 2I9KA 2UYQA 4RX1A
chains in the Genus database with same CATH superfamily
1MX1A 2XWQA 1Y48E 1ZXLA 1SHJA 3HRIA 2EQBA 5KDDA 4YJ3A 2GUWA 3AM3A 4KYUA 3HDHA 1VBFA 3UCEA 4EPYA 3JXEA 3PWTA 1V8FA 4J4HA 4QWMA 3FUUA 3RJZA 4YRBA 1O97C 1XRQA 1W0JA 2CXTA 4MUNA 1NVAA 1G41A 1X15A 2NTVA 3D7RA 5BMOA 1E9FA 2X15A 4XOIA 1JEEA 1KMIY 1NLFA 2CUNA 4RHEA 1IVSA 5K8CA 1DC6A 1JVBA 2OCKA 3SU8A 4IQGA 4CEHA 5I7UA 4YRQA 1PZXA 2WVAA 3OO0A 5DLQC 5HKLA 1QRRA 1SC3A 1WDWB 5L3ZA 3I23A 2WW8A 2ZYDA 4HGNA 3KXDA 5KYVA 5HBRA 3EODA 4RSMA 4TPKA 5CNJA 3FCSB 4IDGA 1D6NA 1JT2A 2CXUA 3CE6A 3VYSB 1ABFA 1CY1A 3LT1A 2P3LA 2P5YA 2VT3A 5EJGA 1P45A 3GF4A 3PXGA 4PLHA 2VPTA 5AMXA 3TPCA 1QIGA 4R16A 2Q45A 3ZEIA 2OLEA 4FYYA 3RHTA 4PCUA 4C7KA 1QLJA 2ZSAA 4YWJA 3JQAA 3VR6A 3LSYA 3RF7A 3AB8A 1C1DA 1EM8B 3PTAA 3O03A 2GA9A 2CMGA 1N3BA 4OI1A 4CF7A 4QM7A 2JFZA 4EPWA 1FFCA 4RY9A 4QGBA 3HDTA 5A4AA 1NQOA 1E9CA 3UJDA 2J7PA 4XEHA 4XDZA 3ICOA 4C05A 5CB0A 2WAYA 2YYZA 4MTLA 4P4SA 3REGA 4PICA 4BTEA 1ZVMA 4EHAA 4L72A 2GYVA 4HJRA 3CLSC 1KKMA 3A1DA 3VSCA 3NWJA 4YRJA 1ZGBA 1Y3CE 4ZP1A 1K6MA 1P1BA 5BRAA 1B26A 1WY5A 1SBQA 2GT1A 4ZPJA 4ZYZA 4WKPA 4OSOA 4NFSA 3T7CA 2FR1A 3G49A 5B4TA 2RIPA 5JAMA 2V3CC 3DXZA 1J39A 2HXSA 2X8JB 3S5UA 1GQRA 3V7YA 5B57C 1LI7A 2OL4A 1FSFA 4ONEA 1KYYA 2PRKA 4K5QA 5KQLA 2C9YA 5EHIA 2DWCA 4PX5A 4MR9B 3IT2A 2OKGA 2C59A 3A9CA 4FOTA 5HEKA 3QXGA 3UC5A 3OJ0A 4F6RB 1UIMA 2Y8EA 4TQAA 5L4SA 3BTOA 4RC9A 2BEWB 2QUIA 3R23A 4E11A 3BMNB 1RP7A 2JGJA 2I8LA 2Z2YA 3SC2B 2G63A 1N9GA 3MPOA 4I55B 4YWHA 2W58A 4WADA 2I1VB 5JNUA 3T9DA 2C9OA 3U0VA 5B30A 4F6RA 3UJPA 3JQGB 1ESNA 1GPMA 3B1KA 1NQUA 4XWYA 1YR8A 1TIPA 2AXEA 3W1VA 3LKBA 4OAOA 1SBZA 1YKFA 1YIAA 2R65A 4O2LA 1KNQA 1PQUA 1XD8A 3GEGA 4Z86A 3UT5A 1GCOA 3WK6A 2X0NA 2QL6A 2H3HA 1RFGE 3HA3A 4G5HA 3TW8B 4ZICA 5G3ZA 5E2IA 2OCBA 1OROA 1J0CA 1KZYC 4RE6A 2IPLA 4YLYA 5BOSB 2Q4DA 5TX7A 2R25B 1I8TA 1THZA 1K5DA 4LXIA 3SD7A 3BXGA 3AFOA 1GUDA 4ZYVA 3EVGA 1TT7A 2DP4E 1WA5A 4HR7A 5DN6A 4B0OA 4C2BA 3DJYA 4R6XA 4LGCA 3U61B 1WV1A 5LYJA 2ZIUB 2IX9A 3W7VA 5AXDA 2CFCA 1QU2A 4EF6A 5J2TF 3BDVA 2BMDA 2LTAA 2R7MA 2O7VA 3OURA 3DEJA 3MAGA 5K2OA 3PC2A 5CIQA 5SY9A 3JCZA 1FLDA 3BRWD 5ALTA 1P91A 1W4LA 1UJNA 3WZLA 3PWSA 1LEHA 2FN8A 4ZJYA 1UP6A 3CB2A 3LKDA 4ND2A 3RS8A 4HC4A 3ZGVA 2AQHA 2PSDA 3CXRA 1F0KA 1XAHA 2JGDA 4AZVA 2D7JA 1DQRA 1FU7A 4DG9A 1UJCA 3A25A 4PPNA 1DRWA 1JHXA 1SZPA 3TLCA 2V7QA 4J0KA 2JLSA 4HY3A 4YACA 1QQ7A 2C2OA 1NYTA 1M76A 1XRRA 2RH4A 3C1TA 4TSKA 2ZRKA 3TW8A 3A27A 2MINB 4FU0A 3GK3A 5EHQA 1SC9A 3L18A 3OLCX 1AZWA 2JLAA 3UT0A 1MC8A 1EUDB 1TT5A 1GPUA 4A8JB 3IALA 3BWYA 5KQPA 3R09A 1P17A 3EJWA 4P2BA 4ZARA 2PQ2A 4EI8A 1DKLA 2RG1A 5JSZB 3OC6A 2QP3A 4D4MA 2GVDC 1W5SA 4HGZA 2CMDA 2XNCA 2PUCA 3S99A 2A0YA 2R6AA 1RC0A 2EBWA 3AEQA 4UEJA 5TSDA 2FEPA 3F5SA 1J23A 2HMYB 3LC1O 2E18A 4UOZA 2H17A 3I61A 1A9RA 3PTLA 4QVKA 3NG1A 4TTSA 3LIPA 4XWGA 1CQZA 2AN4A 1YDFA 4HAIA 3KTAA 5AVVA 3VA7A 2YS6A 3KOWA 1ARZA 1PDVA 1QP0A 2ZCUA 3WVNA 4FFRA 3CNOA 2FOXA 2VDJA 1GCIA 3GLHE 1DRKA 1S2GA 3BH7A 3OE4A 4HADA 4OGFA 1IHPA 2X8BA 1GCUA 2GD0A 4D9MA 3OZRA 4NZMA 4TZKA 4PC6A 3EGIA 2EG5A 3LQRA 1JKJA 1U2PA 2P9YA 1SQ0A 2WPDA 4EA8A 4QZVA 2Z3ZA 3L0OA 4WKNA 4CJXA 2OOKA 4CIYA 2HFJA 4J3NA 4EELA 4B35A 5IH7A 1NVEA 1DCMA 1T29A 1PFQA 1F6WA 2F2TA 4HXEB 3DXFA 2XUOA 5CU7A 3UHFA 3ZJVA 1QBKC 1N2ZA 3RW9A 5DCWA 5I7AA 4B0PA 4A15A 3NWEA 1RDFA 3CG4A 1OX5A 4LYHA 2FUKA 1UEIA 2CCKA 3IKVA 1KETA 3QU5A 3SDZA 4XVUA 5G53C 4AN0A 3DDSA 3CEJA 4NCXA 1R88A 4CMEC 3SQWA 1FPMA 1O95D 5EXSA 3H2ZA 2XTMA 2VC2B 3FHOA 4CLRB 3DKKA 1U0LA 2GM3A 2XBLA 2IZ7A 1XUOA 5GIPE 1LSOA 4JLUA 2XUIA 4HFNA 4H77A 4YCSA 3F5DA 1DBWA 2CHEA 3MINA 5FPPA 3LNCA 1IDOA 3LX5A 4XD7A 1DDIA 3NCHA 2NYVA 4RY2A 1SXGA 4U4AA 5TT1A 1TCBA 2IP2A 4EI2A 1PNOA 3MOGA 1ISSA 3FRJA 1J0BA 2WEKA 5CA1A 4FHFA 1OILA 3FTQA 2X7XA 1I4WA 3GAMA 1XX6A 3ZE7A 4A6PA 1FXSA 5BV1A 2BSQA 4GLOA 2C3OA 3LQKA 5JSQA 4EARA 4GLFA 3CNHA 2YZGA 5B3JC 5EE9A 3MFYA 1TCCA 1R4MB 1X7XA 1BTOA 1ZM7A 4QFDA 4YGYA 3ZWNA 5BWCA 1NA5A 3ED1A 1PV2A 1T25A 3CN9A 3GGSA 4LK3A 2JF0A 4QTUB 4KV9A 4Y6OA 3ZEAA 3AHFA 4GBMA 3JQCA 4KL8S 5AYVA 4ZDWA 5IC4A 1ECCA 1AZSC 4ZEWA 4EJFA 1UXGA 1HDXA 1C3VA 2QM8A 2TSYB 4W8HA 4R2MA 4LJYA 3QKRA 1DV2A 1U6JA 2C97A 1JHYA 3X43A 1L4LA 2JVJA 1XMXA 3IQFA 3RVSA 3G02A 2JB9A 3FUXA 3JQ8A 4FEAA 2VT6A 3QVUA 4LXUA 5CLQA 1U7DA 5CEFA 3E7FA 4LF8B 1HZZC 5CITA 2GZ1A 1TC2A 1XDGA 4FC6A 4KOEC 3AM4A 3L7LA 4WD3A 5I9MA 2JI8A 1BIFA 4NMMA 1J5XA 4LTNA 4M0EA 4XJXA 2GPJA 3HPQA 1LDBA 1TF7A 1KH1A 3PHBE 4DMMA 2CMFA 2Q8QA 3N6RA 1Z74A 3EFEA 4JNKA 4BJ6A 4UXIA 4DL9A 2VTBA 4PHCA 1CZLA 2IODA 2FXVA 3IKTA 3TTXA 1KYWA 4UQPA 1WULS 2YJ4A 2JIZA 2QLFA 5H70A 3IP1A 2OV4A 1GFZA 1ZJ5A 1C9KA 1LTKA 1R6UA 1J1ZA 3I72A 4HX2A 2Z2ZA 1UJ4A 5JSYA 3SLKA 3A70A 1M33A 3TLKA 4E30A 4PX9A 3VOBA 5AUPB 3SJCA 1SHTX 3G17A 4QGSA 4TMZA 1Z5PA 4KH0A 3A58B 5HM6A 5JJBA 2GM4A 1PDWA 2NSJA 5BSMA 5ALZA 5TB5A 3WO0A 4WW0A 2DFLA 1DFHA 4JP5A 4EUNA 1UXHA 3CURA 2G7MC 4QARA 2Q8PA 4XFKA 4DCJA 2VUIB 1E63A 5HSGA 1O94A 4HWPA 2EATA 3E0XA 1Q0LA 4Z0HO 2NX2A 3DC2A 5FORA 2V7WA 1PJCA 2RAVA 2VNJA 4F85A 1LK0A 1L8XA 2RGNA 3E27A 3NUQA 5JAZA 4BY9E 4WN9A 4QREA 2VJAA 4D7AA 5B2EA 3A06A 2HJRA 5EOVA 2X76A 3K05A 3CLSD 2B1GA 2DJIA 3VHXA 4DT1B 3FYUB 5JI2E 1GEGA 5GMOA 3DTTA 3CU5A 4S1NA 4YREA 3UWDA 1RHRA 3HUEA 3N86A 3DWGA 1QFYA 3MSXA 5CYOA 5IARA 3VR6H 2ZIAA 3QM1A 3GNSA 4BU0A 1YIDA 4YJHB 4CL3A 5IKEA 4LGVA 2X8LA 1QIJA 1U02A 3LFTA 3UF0A 1YS7A 4GXRA 1DJNA 2N3ZA 2NG1A 1SUDA 2Q5CA 5KC9A 1MQ9A 3TEJA 1PR1A 4QPCA 2P2SA 5H1YA 3VGPA 3AJAA 4FONA 5IJ9B 3RRBA 3EZFA 3PXBA 4XIJA 2PZBA 3TINA 4Z53A 5SZKB 4TWBA 1OYYA 5BR7A 1AK2A 1GNSA 1MX9A 4EG0A 3U09A 3RSZA 2V54A 2ENUA 1GPLA 4JI1B 2YVKA 1FFWA 1JV2B 2ONJA 4L4UA 3TS1A 3KQNA 2OBNA 5BWOA 2YH2A 4NQZA 3OCZA 2XUFA 4GX2A 5HOQA 4OEHA 2N46A 3PD0A 1G38A 4A2PA 4AJOA 1KJIA 5F3DA 3PNOA 2QMYA 2ZIVB 5HF5A 3KQUA 3AY3A 1W59A 1VCMA 4M54A 5EINA 4L5CA 2IY8A 4CIDA 2AUMA 2ZT5A 2O8NA 5J59A 4EJ2A 2IK8A 2X4IA 3KQHA 1YE3A 4LX8A 4RPHA 3JZAA 4AWBA 5KO2A 4GF5A 4YRDA 2Y2VA 3L9WA 1XQXA 1CJMA 2QDXA 2W98A 2HSJA 2WSMA 2BLNA 2HF9A 4PC1A 1EWKA 1CY7A 5A6VA 4CV1A 1LQ2A 3MM4A 5H0IA 1XTUA 3HJNA 2OY0A 2AOVA 2GAAA 5ARCA 1FVHA 1SCAA 2FX5A 4O8ZA 4PX2A 3FOBA 3T35A 2XHEA 4ZI3A 1J42A 1I5EA 3LQQA 2P62A 4TKZA 5CVUA 5AJTA 4K9SA 4G97A 4WZBB 4QHSA 3KS9A 4WTOA 5H68A 1QHEA 4RMGA 1XRMA 1HYGA 1Z4JA 3FDFA 5E6SA 3A0UA 2AEEA 1DXHA 2HLHA 2ZAOA 2FDCA 5BMVB 3OHMA 1CJUC 3M8KA 4F97A 1RLTA 2C4VA 2BKVA 2OHGA 3AG5A 3X1MA 1FLAA 3RBVA 3IVGA 3IT3A 3NFRA 3QUCA 3GB9A 3UWSA 4W8GA 3IQIX 1LX7A 1Q0QA 1N5DA 4TLEA 3VC3A 3PGKA 2QN1A 5F51A 1YQWA 1Y5MA 2YHBA 4Y9TA 4AY2A 3HJBA 1MGOA 4LIPD 1IRIA 2OFPA 2WF5A 1BW9B 5DM4A 3U3ZA 1PHPA 3HXQA 3LVFO 4H3HB 2C4TA 1NVXQ 3EWIA 3F1KA 1YXMA 4WGGA 5LA6B 2QLTA 2CHGA 4DZTA 3KQLA 1KORA 2XB2A 5SY4A 4DANA 2BE9A 4HWSA 1N6KA 3FSGA 4JLOA 4DKXA 3GROA 1G59A 1A4XA 1PLLA 2DAPA 1GGHA 4IJQA 4NCNA 3V5NA 3R44A 1OH5A 4DR7B 5DWDA 4BFLA 1GTSA 1CNMA 5JY6A 2WAAA 1YZTA 4RUKA 4E2ZA 1S01A 1YVDA 1V96A 4P3KA 4F7WA 4MICA 1EAMA 5FPTA 1UPXA 3GV0A 1EMDA 2C2WA 1DPFA 1M72A 2HC9A 4B6OA 2FXIA 5FBWB 4TL8A 1ZJZA 2PUWA 3DS8A 5CT5A 2AD1A 3UFXA 3CUVA 1PL0A 1EFHA 1VPWA 3O4RA 3FKSD 1QIMA 1W96A 2X0FA 4BB9A 3ONDA 4MW6A 5F21A 1FP1D 1DKUA 3D5TA 4NECA 2CCJA 1Q77A 1WETA 1OTHA 4TM8A 1X13A 2YN0A 4UHFA 5E1BA 3H19A 5BW6B 1E1DA 3W2TA 1ZKMA 2YQ4A 3M1IA 2GZ2A 1ZHFA 3ZWXA 1U04A 1UDBA 2VXYA 3A4MA 1YR1A 3T7JA 4BKMA 3SJZA 2P41A 2HWWA 4MGHA 2H4YA 3S2EA 4R2HA 4F5ZA 2FSVC 5HZGA 2XKJE 5IC6A 5AUOB 1F0NA 3GGJA 1CRWG 1G66A 5I6DA 1J8YF 2GVNA 2X0DA 1QZ3A 2B98A 3TIXB 2IKSA 3TZLA 3ACDA 4QJBA 3F2VA 1N1MA 5E9AA 1FYWA 2FRDA 1LBQA 2HNAA 5ICMA 3JQDA 2DPXA 1V9CA 2FQWA 1TW3A 2BM8A 1MO2A 3KKMA 1N5RA 1JA0A 1YJQA 2VPZA 4K3UA 1ZCBA 2IYSA 1U2DC 3QYAA 2Z9DA 5BV2P 4JLVA 4AIRA 2I6XA 4F3RA 4BJHB 1AY0A 2Z1DA 5SZIA 2IHBA 3TOVA 2IKQA 3ZWMA 3B9PA 3DUFA 2XZLA 2GEJA 1FP2A 4FWBA 4PCLA 2HIAA 1NUHA 5FI5A 2DUWA 1I6KA 3FHJA 2D3TA 3SNKA 3EGDA 1Q83A 1T4MA 4UBIA 3IE1A 4OB7A 1EIZA 2QRGA 4Q0MA 3I45A 2RGBA 4PPYA 4RZ2A 4TV9F 4D4KA 1EWQA 1BFDA 3QUTA 1Z56C 1QKIA 3IHTA 1UBKS 4EL0A 2RHHA 1GYQA 3GEIA 3NOVA 1E8MA 2P1ZA 2IDJA 4ND5A 4P3OA 3HCDA 1A5TA 1P8JA 2WYOA 2XZDA 4K2AA 1KTVA 3Q1LA 2MSNA 3HHPA 4LJ7A 4Q9HA 4ZC8A 4R9SA 1QCCA 4KRXA 1NIPA 2FZWA 3MA0A 1LPAB 2JEYA 2X6TA 2XRYA 4F3KA 3U60B 1BD3A 1SPXA 3AZPA 4BE4A 4BZWA 1K3FA 5KINB 3N7UA 3O5AA 1EGAA 4WY8A 2I3DA 4UBMA 2GD1O 1YBAA 2OP1A 3WSVA 4E4RA 4JL5A 4CTJA 1CZUA 1IAQA 1LBIA 1XTIA 3P0HA 4O2BB 1F9EA 2BFEB 1WX1A 1NW8A 5DPMA 5MF6A 1KYTA 5MHTA 4GP6A 4J16A 4WZAB 5KNDD 3QVMA 4J76A 2GHRA 3OKCA 1FP4A 1EVYA 3Q85A 4JKOA 1EUCB 3L4BC 4Q93A 4BMSA 3FZYA 4EB6B 2HAEA 2E55A 3ILHA 4MOWA 3RRNA 1R5BA 2ZI3A 2TMGA 3R7DA 3ZTTA 1T6NA 3BHIA 5JCJD 3OAAA 2OHOA 1Z2OX 2NPIA 2AHOA 1G9XA 1SVUA 2JCGA 2PL1A 2MSLA 3CINA 3M6MD 3LRTA 3QVGB 4J29A 4V2IA 5JZMA 4B4DA 4H6WA 2JL1A 3C7AA 1XHLA 4I1RA 2WM8A 5F77A 3NRBA 5IH3A 3RD5A 1MB4A 1ODIA 1HTWA 1OXTA 1DHTA 2HJSA 4NICA 3M3DA 4C7MA 4EWLA 1NJ8A 1BVUA 1Y3IA 1FMJA 3PEFA 5DOZA 1JYFA 4K9KA 4UOQA 5FLXA 1JALA 1EU1A 4Q7JB 1E32A 4BJ5A 2R97A 4DSUA 2IH4A 1ZC3A 3WBKA 4JUDX 1TMOA 2OCPA 4PSUA 5JSZA 4MPTA 2WHPA 3BQMB 3L7JA 4YIHA 4LJ5A 2IHKA 2NU9B 3R6WA 2CJWA 1DJPA 1WU7A 4LN1A 2FN4A 4L73A 2OFXA 1CZNA 1R0LA 2XUDA 2EKPA 4PFKA 1OHHD 4PG7A 1NX6A 4DA7A 3A9VA 1K89A 2KX7A 2PX8A 5E1MA 1BWQA 1IEXA 2AHRA 4HB0A 1XD2B 1BWSA 1R0SA 2Z0MA 2Y3IA 1KZHA 3BZWA 1KMHB 4WFKA 4Z4QA 4PLVA 4Y2JA 1T91A 3S70A 3ILSA 4E15A 3HLYA 3FTEA 5ECDA 3FJ1A 3TNFA 3KLNA 3DNMA 2CUTA 1B0UA 3GEMA 4HZGA 5T5QA 1Q7CA 1S9HA 4YUZA 2OMKA 3PNKA 1LKZA 2VP0A 4L75A 3VVBA 4CT4B 1D2GA 2PZJA 3Q7QA 4H2DA 3QVJA 5CCEA 2P2DA 4H3VA 3V42A 5I4BA 3FYDA 3I53A 2EZ8A 3D6MA 4LW8A 4MWOA 1M1YB 4DA9A 4F4CA 3BN3A 4URXR 2B3DA 5DASA 3ITDA 3RR2A 1T5SA 1Q3HA 4M1QA 1T2UA 2ACWA 2O8VA 1UMCA 3EC2A 4PZYA 4Q1DA 4M1ZA 4ENWA 2E6KA 2JJYA 1MEEA 4GM4A 4RD1A 1VLZA 1TJYA 4EEZA 2LIVA 4EUHA 2Q46A 2O07A 3F98A 4LRUA 4CKBB 2G36A 1TFRA 2A9JA 2VDMB 3UT6A 4KPUB 1VC2A 1L5KA 3WL6A 4B83A 4DS3A 1XTZA 4MHOA 3DVAB 4R8MA 2QQFA 3BWCA 2K7ZA 2FQQA 3JQBA 4JDUA 1LA2A 4YRKA 3JD1A 5AFSA 1ZQ1A 3NO4A 3QEOA 1T4BA 4C78A 1G16A 1YGPA 2Z2KA 2DCMA 4IF4A 4MR8A 4B09A 5BVGB 3BMXA 4ARZB 2AVNA 2CDCA 2HCRA 2RB4A 3BG5A 1QVZA 3ESCA 3UGJA 1MA3A 3UUFA 4A6DA 4F91B 2WG0A 2B21A 5CDGA 2HRDA 1QH0A 3KT8A 4GXNA 1WVGA 1ISFA 3C3KA 1H65A 1NN5A 4LXYA 4XGNA 4O02B 2J9XB 4YAWA 1R10A 4K6MA 4KNVA 1JPJA 3CF2A 3EB9A 3HCPA 5T57A 2O7RA 3P7MA 3PZBA 3HXPA 4MR9A 3HK2A 1GQSA 2FYTA 4B8ZA 3U7QA 1KK0A 3ZHZA 4ZEMA 3HGQA 3R5HA 5B12A 3ZDAA 1Z17A 3RU9A 4LF5B 1FIUA 4JHXA 5EJ9A 1PBTA 1R6TA 5FLKA 3S0JA 4MGKR 1BGXT 2QTVA 3AF0A 1NBMA 3GH3A 5FOTA 3WLOA 4Y1FA 3OQPA 2O7SA 4EHBA 5IKMA 3K4HA 4OBBA 1QANA 2EHJA 4H1HA 4J0FA 2RGEA 1NPYA 2VK4A 3BXHA 4C4AA 4WWHA 1J09A 5F9MA 2X6RA 3MAJA 1EK5A 2EQAA 1P0IA 4EEXA 4RJTA 1VJDA 1PJQA 4IXTA 1S2OA 2VPQA 4U5QA 2K5UA 1L5ZA 4UU1A 1L4MA 3VH4A 2IHZA 4LDZA 3RRJA 3N5KA 5D01A 2O5EA 4B6GA 3TLJA 3L93A 1KR2A 3DDZX 1S7CA 5D51S 5KJ6A 2YVUA 3H0EA 1ZMBA 1VCIA 1SKQA 3FYTA 2H5LA 4BTLA 3FOCA 2A92A 1UKBA 4YH1A 2GO7A 3OM8A 4A16A 1EGVB 4EGQA 2O1EA 3PNQA 1JJIA 1UM9B 2UZAA 1XAJA 2Z2JA 2GN0A 2DYKA 1VZ3A 5A0FA 3QFRA 5BNWA 3DE5X 3O8OA 5JJ5A 1PL7A 4HWGA 3UWOA 5IBQA 3GR6A 5DX1A 5TXGA 1P4GA 1T8WA 2EKBA 5FUYA 1ECLA 4W5JA 1L7QA 4GRDA 1E7SA 2CFSA 3CUEF 3VR4H 4X20B 1R3UA 1YA4A 2FG6C 2Q41A 1YE5A 2RGYA 3F3MA 3FZQA 3H5VA 4EY4A 4QDTA 3RS0A 1DWPA 4NZPA 2NVUB 3ZY5A 2D8AA 4I6JA 3AUXA 5CHEA 5AM4A 3W05A 4YMGA 3ZDXB 2P9EA 2O8FB 4X3OA 1XWIA 3PNYA 5HGXA 4KGVA 4M0KA 4CQJA 1P2TA 1Y37A 2EERA 1Q5PA 2F4NA 1M6VB 4MGEA 3UGKA 5BP7A 4CU2A 1S96A 2XDAA 3V8EA 5B1IA 1YF3A 1YMVA 2CY0A 3EDQA 2H2GA 1GR1A 1WEKA 2I76A 2X8WA 4WINA 3AIKA 1RYEA 5EP4A 3SLGA 2PKQP 2I3BA 3A3NA 2DERA 3KOOA 3O94A 1MLDA 1CZKA 2D0IA 3KDAA 1HF3A 3DDUA 4MS4A 5C53B 3CXUA 2VOEA 1HFEL 4GWKA 4DA6A 3QVGA 3AUJB 3TLZA 4MB6A 1PE0A 1DJOA 2JFNA 1DT5A 4ECEA 3DT6A 3BCHA 2VDNB 3H9QA 1EXVA 2HV8A 1Y3HA 3SHOA 1JHVA 3ZQ6A 2JJ2A 1SUCA 2OBYA 3EG5A 3E48A 1JGTA 3H11A 2XT6A 4P8RA 2Z30A 2D2VA 4YXWA 2BP7B 4ZCPA 4NE2A 1RRVA 4G07A 1XZMA 1OW3B 4XDYA 4JXZA 5ITWA 3PCRB 1MABB 5DBIA 4P4SB 2ZJ3A 3GMDA 4C6HA 3WISA 5JMTA 1YB7A 3OQMA 5E6RA 1IHUA 3ONWA 4K9QA 4Z7QB 4R9RA 2XXAB 2OCGA 3R4VA 3SJAA 3ZZNA 1RU3A 4G5YA 4BFXA 2C2BA 2BDTA 1KGSA 2ZRIA 3B2EA 4HQNA 1SC6A 3HU2A 1FA9A 2YJTD 3W79A 4L85A 1ZR2A 1HQDA 3PQ2A 3SYKA 2IW3A 1YK0A 4YR9A 5IF3A 1NP7A 4IX1A 2R6CA 4Q21A 3MRVA 3VHRA 1Z2CA 3BCSA 4OK3A 5CM2Z 2Q8NA 1DXYA 2RHCA 5CB8A 3BRSA 3D3QA 3RCBA 2O0HA 1V3TA 4RA6A 3DH0A 4FCCA 3PYLA 1UWVA 4NX2A 4TLLB 4CM9D 1PRYA 2AG1A 4F7DA 1U63A 4F71A 2GTPA 4ZDIA 2AK2A 3COSA 3K0SA 2HADA 5KSPA 2Y0DA 4M2LA 3RAGA 3U3JA 1RS0A 1XALA 3MTBA 1SCIA 2XTJA 1TQDA 2I87A 1W5AA 4KI7A 3MMSA 1SB9A 1UXKA 2DQSA 2V6MA 2XYGA 3JR7A 2YXPX 3ZDYB 2O2HA 1GDTA 3LW8A 3E1SA 3O38A 1NVDA 1KPIA 1OAOC 1WPRA 2HMSA 3PNLA 5B3LA 3B85A 2FPRA 1M34E 4DUYB 4FJ0A 3F4KA 1ZNXA 3GRAA 4EX7A 3BTSA 3VR2A 3WYBA 3AMVA 1WD7A 1QP8A 1DTWB 1OX4B 2R751 2Y1OA 2YR0A 1KSJA 3GDGA 1S4QA 2NV2B 3C16C 2Z43A 3EOBI 4JC8A 2Q3MA 5BV0A 2F6RA 3MGBA 4HWOA 4AX8A 1RJDA 5CW2A 5IS2A 3FAKA 3A4IA 3ZE8A 4IIEA 3VX4A 1Z13A 3HN6A 5JV5A 2PL3A 1TAUA 1DP4A 3EK2A 3IEPA 1M3SA 2YX1A 2SKDA 3GLSA 4L02A 1NURA 3REFA 3G9UA 5G2OA 5C46F 2DUMA 1BC5A 4NMXB 4UFNA 5I7WA 5DGTA 5FQNA 5KVQA 4NAVA 3PA8A 3V97A 1JHUA 5BR8B 1MOPA 1DC7A 4C7VA 4LJ9A 4DVGA 4HWRA 3IIKA 3OP1A 4WZ6A 2IHVA 2DLDA 4WCVA 2A3RA 4RLFA 4XVQA 5LB2A 3SNHA 2H9YA 1K0UA 3SMQA 1X8JA 4YV7A 3FBGA 2ARKA 3UUEA 3ZWPA 3RIYA 3RSHA 3RADC 3DOUA 1SBYA 2I8CA 2V58A 2IGBA 1LLUA 3JZDA 2H4JA 1L5WA 2HM7A 5J47A 2PV7A 5EMNA 3M9WA 3N53A 2HI0A 1T34A 3QFCA 1M2EA 3I4LA 2JAXA 4P9NA 6REQB 5JWHA 2CDBA 1K7YA 1MIOA 1ESCA 3E3NA 2ST1A 4HEA1 2GLTA 2HO4A 4ZGGA 5L4LA 5JJCA 3H5AA 3JW8A 3KUUA 1UKZA 2C2HA 1Z7BA 2EJWA 2CK3A 4M36A 4OMUA 2F8SA 2EKLA 2R84A 2YC4C 1JLKA 5COBA 3MRSA 4TSRA 1NMEA 3K6RA 1BHQ1 2BGLA 4IRUB 1G7CA 5K3FB 4D92A 5L45A 1P6XA 1M2VA 2WM3A 1V2HE 1JG6A 2BP7A 3LHIA 5HZMA 4TMVA 2O2ZA 2GXQA 3I73A 1VCOA 1HZJA 3E23A 3SYNA 5PNTA 1IWBB 5I8PA 5JAHA 3ZXYA 4ETIA 1L7AA 2RK6A 2VJOA 1FFEA 2Q6OA 2D4AA 3EUWA 1C14A 1PW7A 1MAVA 4AUKA 4YPVA 4BQOA 2G6BA 2BMEA 1E64A 3DCIA 5M5BA 4HH1A 2WWWA 1GV0A 1SRRA 3M3HA 5CFOA 5AW3A 1KOJA 1WUYA 4EW2A 4YEDA 1GGMA 2BZSA 2QIPA 2W6NA 3IUNA 4C1NA 4EL5A 2K87A 1PLKA 3A04A 2A3NA 1Y9ZA 2REBA 2WJ3A 4YAOA 1B1AA 5F73A 5J1SB 1YS9A 3F73A 1M6VA 1I1HA 4LUCA 4YMLA 1ZU5A 2VK1A 4HEHA 4QRHA 4B6PA 5I7FA 3IEVA 4JBGA 1XTPA 2HXYA 2O4UX 3LT4A 4ZANA 1KMMA 1UMBA 3DLAA 3IUMA 1SBNE 1ZUWA 2AMFA 1T10A 1UKCA 3BZUA 3I4FA 4WT7A 3GCWA 4LYJA 2BM0A 3ITNA 1RM5A 2A9VA 2BHLA 1P5HA 4WLNA 5HS6A 5AW0A 5I51A 1J1UA 1S8FA 4W5OA 3BT7A 2MINA 3WYAA 1XDDA 3ZWAA 2BFBB 4RF4A 1KAHA 3AUYA 3OE5A 5BQFA 1QBGA 3NIDB 2Y66A 4P3NA 3EXG1 2PGAA 1L7BA 4L27A 4DQUA 4JB2A 5FNVF 1J24A 1D8TA 2GETA 3QW2A 4B81A 3TX6A 4RJLA 4BBZA 1NPDA 3GIDA 3RROA 2NZVG 3ZY3A 1P81A 3CR8A 4ZYTA 3B9RA 1R27A 1YJCA 2WA1A 2VF4X 5JS1A 1TM4E 4YPOA 5BN5A 3CUUA 3VPSA 1WHTB 4NH0A 1RI4A 3VZRA 2F1RA 2FNAA 3QPCA 5HMMA 3TB6A 5I9NA 4FD2A 1GU0A 4B3MB 3PQ6A 2ODWA 1Q0RA 1XO1A 3QEMA 3CLTD 2O8BA 1DDOA 2ZUSA 1Q84A 4MKXA 1LNSA 1F4VA 1R64A 3UGQA 4AD8A 4YBZA 4LPSA 2I6FA 2P9QA 5K4HA 5KOYA 1KJYA 4YYZA 4D2IA 4BLUA 2F67A 1AX9A 3KB6A 4NCKA 2MOKA 3H1PA 3M34A 3EVBA 3FWHA 1O4VA 1L1FA 1IAVA 4GD3Q 1UWCA 4LY3A 5KX5A 1PT5A 2EX4A 3KE8A 3WY9A 5A2GA 4P0PB 4MH0R 2YXDA 4ZT6A 3RIHA 3VRHA 1LUAA 1PG2A 5JH7A 4Q9DA 4O29A 4JUAA 1AA9A 1CFZA 2ZWVA 3F8SA 3CNNA 1Z45A 2I03A 3UA3A 4LWZA 3GZ4A 3GJ7A 3KBBA 4IGEA 1HC7A 4Y6SA 3UHAA 3GRFA 3PFWO 3DL7A 5BRNA 1KVUA 3N76A 1KEZA 4ENQA 5JROA 2C58A 2C0CA 5BSEA 1UK9A 3CPHA 3GLHA 1BE1A 4P93A 2QMUA 3HHEA 4KQWA 1NXVA 1X1RA 2D0PB 4DQ0A 3TLXA 2PJRA 5B1YA 3T3DA 1QIKA 3JWJA 4AL4A 4IQ4A 4INOA 1ZBQA 1X1TA 2GYYA 3DP9A 3FXAA 3PUHA 4FIZA 4URUR 1DX9A 1OZGA 2AKYA 2ON6A 2QMQA 3ELDA 1XFDA 1JG1A 3MUFA 3UXEA 2XY4A 5GOTA 3IHLA 3PXAA 2I4TA 3FFBA 2EGUA 3HCWA 2WT9A 3P20A 1BE0A 2PM8A 1KJNA 1EDBA 3T5DA 4R0MA 4RCZA 3JWHA 1SU7A 3A1FA 1D0IA 5LQSA 4YP6A 1H9AA 8MHTA 2HD4A 1U1EA 4YB8A 1GAWA 2BM1A 1SZDA 3D6UA 5A04A 1JMVA 3TX2A 4DV7B 3FZEA 5HIIA 5TQVA 4RYLA 4MAFA 2R7LA 4X61A 1UOOA 3LLMA 4BFTA 3KWJA 1IN6A 3BFPA 1XVVA 2A5DA 2QW8A 2RGXA 5JC8A 1C0LA 2HR1A 3KQPA 2ZPAA 4IDBA 1PKXA 1NF8A 3SR4A 3BKXA 2PX4A 1YNOA 2W2LA 3OE1A 4DMCA 3S3TA 2CDRA 1L4GA 2QD3A 4IRMA 5EFZA 3KUKA 1E9VA 1JHPA 2C5BA 3Q3IA 3T9AA 3R7AA 3DMGA 4LVOA 5JJLA 2DBRA 3ERCA 3JQAB 4RS3A 2C5AA 4FB5A 2C77A 4Z4CA 1JQBA 2FPUA 4S1OA 3OJLA 1QFMA 4RNDB 4M6WB 4BATA 3C3DA 4BGEA 2QEQA 3PUWA 4DZZA 3EFOB 4DDMA 3V55A 3P71T 3RVDA 2X7JA 4OREX 4B34A 1NI4B 4KWIA 4L7VA 5FI0B 3B6KA 4OOEA 4E33A 1KI9A 3DEIA 1CF9A 1E1YA 2IF2A 4DEXA 1ZSVA 3NBKA 4R2IA 1PD1A 4X1IA 3H2IA 1BEEA 3FYUC 4LMBA 4XVHA 3GLRA 4XYBA 1LI5A 4ZA2A 4CQMD 3E9RA 5JQGA 1YL5A 3JQ7A 3UG7A 1EBFA 1BCSA 3U49A 3U7IA 4M8SA 1F06A 3L0IB 4LXQA 1MV8A 3IQEA 2ISSD 4EF4A 3LIIA 4MQFB 1MDFA 1S02A 2VXCA 3HUDA 3PGMA 4YLEA 4N01A 5EPEA 1PR3A 2YJ3A 4UCQA 4BV3A 3WL3A 2DEUA 4JB8A 4UPDA 4ARVA 5ECGC 1X7ZA 3OTOB 3STHA 5AWFC 2CNNA 1ORVA 3LRXA 2NO1A 2XZPA 3W5VA 4A8PA 4HQ6A 4JT4A 5GONB 4GI5A 1QHNA 1GZDA 1U1IA 4QXAA 2ZI4A 5DWVA 1XK6A 3ADOA 3W5IA 5AHOA 3KYBA 5KTMA 1SD5A 1XQ6A 3BGSA 3PIIA 3L8GA 4W7HA 3ZZMA 4Y2HA 5JNWA 2W2LD 4KX5A 2OC4A 2WHYA 4IICA 1XMPA 4EUKA 3LY9A 4CLOB 4XCXA 1ONPA 1JR3D 2CKDA 2X5OA 5AHKA 2YYAA 2YZ7A 1TD1A 3KB2A 2YIDA 1RJWA 3ZV5A 1IHXA 3J7AC 5DRYA 1H9CA 2W8BB 5GWXA 1E61A 1PJBA 1F1BA 2PFGA 3J80A 1FSZA 2I3ZA 1JHOA 4GGOA 3EZYA 1Z6AA 4N9QA 1SXHA 4XQEA 3AQIA 3WB2A 2OECA 2VAWA 4QVGA 5CJ2A 5KCMA 4YJDA 1PX0A 3HQ4O 1UBUS 3CG0A 2WE7A 2PD6A 3EQ7A 1ZD8A 3HCEA 2QJFA 4CG2A 2RIRA 4ABYA 2NAPA 3WE7A 1K7EB 1NRJB 2C31A 4LSGA 1VSVA 1FX0B 4Q3BA 3GJ3A 1KP9A 5I3CA 3C3BA 4MRAA 2PMBA 1HTBA 5H9VA 2REQB 4FE4A 1R50A 3RKUA 4JJ8A 4AI6A 3DBVO 3JALA 1OTYA 1RVV1 1PWXA 4JASB 2XUPA 4TUYB 5DLPA 3R2JA 4FYKA 3RODA 4TYYA 3RYIB 3LZDA 1FW8A 3WLTA 3C7DB 1IYZA 1QLWA 4KXQA 4JLJA 1ZY2A 5AI8A 1GGJA 2X2FA 2ZBRA 2OPBA 4RTSA 3KKPA 1TZJA 3QTBA 4XH9B 3K0CA 1A8IA 2RE8A 2RC6A 2XMRA 3PI7A 4MVYA 1YH3A 5CT6A 3IB6A 2XUGA 1R0XA 4YXFA 1GEEA 2GKSA 2GASA 3HKBA 2ZR7A 3EOAI 5ER9A 5FBQB 3KHTA 4IXDA 3ZV7A 4C7JA 4D9JA 4KPGA 3K9LA 3GCZA 4GI1A 3U4QB 1XEAA 4YAFA 1Y5NA 4UM5A 4FSDA 4QYIB 5KQMA 4B48A 1DJQA 3VHQA 2G5PA 1GZVA 5FJIA 1TADA 2HKIA 1MABA 2VPIA 1CUGA 1HOXA 1N92A 2GAJA 1N77A 4X85A 3ZWVA 4P4LA 3C2QA 5LOVA 1TW2A 1FEZA 1P9WA 5IJAA 6ADHA 4FYJA 1HLDA 1SG9A 1Y4ZA 3IKJA 4GMKA 3E9NA 3EPJA 1TYCA 4HATA 2WJWA 4MMZB 1EVZA 1GAQA 2O06A 3I9KA 4U7WA 3WKBA 1PAUA 4YJ2A 3QEBZ 2BKLA 1P2BA 4CQNA 2B20A 4RHXA 3EG9A 4DLLA 4Z1OA 1LSSA 2EV9A 2JAWA 3N8DA 4LWPA 1TNDA 4BNVA 1DIRA 3EIXA 1RQXA 4KKVA 4RVFA 4M7OA 3PHJA 5LBIA 1PJ3A 2CWWA 1NF9A 2BZ1A 4ZT4A 3ZD8A 1VBMA 2FUCA 5BSWA 1JVNA 2P40A 2H1SA 3HI4A 5FFMA 5JUWA 1WL8A 4EKIA 2AE2A 5ED4A 4N54A 4JC5A 3ABOB 4EGSA 1E77A 1N5MA 2E82A 4G09A 4W8OA 4QSHA 3NI2A 2P1DA 2P79A 4O4LF 1EP3B 1UADA 1ZVJA 4BKOA 5K8UA 1D2CA 4L5IA 1V4BA 1JBKA 3IE0A 5LIRA 2BISA 1KA9H 1D4ZA 3H5WA 2ZS7A 5KVVA 4GOND 1NPTO 2N42A 1B76A 3TMAA 3HLKA 1JG7A 3PEEA 4YCBA 1UH5A 1A5AB 2HU2A 3RUEA 1E3LA 4NYJQ 1ZMRA 4OMDA 4WESA 3AERA 4YT4A 2OVFA 5JALA 4OHFA 4P6VF 3AM5A 1YE8A 2H7CA 3O90A 4WN3A 4RTKA 1YZUA 2XUQA 2UKDA 4F5EA 2IS2A 2O8CA 1RYFA 2ODTX 2ZUDA 4IJ6A 3ZNPA 2C5SA 1P7PA 1S4MA 3DOJA 4H35A 3BJIC 1QDUA 2XMPA 7ABPA 3A26A 1GD1O 3ZXIA 1T5HX 4M0PA 1Z18A 4B4OA 1A8UA 1JI3A 1OAKA 3B3JA 3DNPA 2FRVA 1P0PA 3TQRA 3VISA 4BEVA 3G5UA 1RWXA 3GHHA 3P2KA 5FHRA 2HWYA 3MLEA 1F12A 1P8AA 4EP1A 1YFJA 1NG9A 1QZXA 1WVIA 4PYOA 2YCLA 1XZDA 2HQ1A 2RCYA 2ZE5A 3CONA 5F5XA 4PFJA 4AM8A 5C3MA 2FX2A 3HZOA 1N75A 3IRVA 3U4GA 2IXTA 3ZI0A 4PIMA 4BZQA 2G8LA 1O5TA 4KWHA 1JQDA 1U2GA 4Y9UA 4YRGA 4YP7A 3BULA 5A5EA 1Q7RA 1W34A 2OC9A 2F9LA 4EW6A 5FWNA 3AJRA 1XZIA 2NO0A 4C2UA 3LQYA 2OCXA 2GR9A 2O2CA 3T1TA 1YFZA 3QIAA 4LK2A 1O8CA 3NZEA 1B14A 1FRQA 1TVEA 1ZL2A 4HRYA 2AUTA 5LQCA 3ADCA 1QLHA 4QBGB 9ATCA 4CKWA 4NCAA 5EESA 4WFIA 1NRWA 3TNLA 1HT1E 4OHBA 5T4BA 3N87A 2BL4A 3SXUB 2I7XA 4BQPA 2IYUA 2VYQA 1DRUA 2X41A 2WSSD 3HP1A 3MCZA 2QM0A 3RFUA 3GMTA 3LQ4A 5EPOA 3GFBA 3QYJA 5U9CA 3QHAA 2B0CA 1SWWA 1XU7A 3NALA 4RQBA 3LP8A 3HR7A 4TKMA 2WI8A 2ZIEA 5EHXA 3VSDA 1AKNA 3WL7A 3B20A 2VDWA 4N7JA 1PT6A 1R0YA 2ZWMA 1G8JA 2ES4A 4OK5A 1L4YA 1EFVB 3CR7A 3PX2A 3RS3A 2GCGA 3NV7A 1LNZA 2Q2QA 3QXSA 4MB2A 4DLPA 3IJPA 2BGUA 3HKDB 4JYCA 2XSZD 4KNWA 1E6UA 3AV3A 3E58A 4TTVA 5A3VA 3Q72A 3WBBA 5LUAA 1XYYA 4ZZ3A 3O82A 4FYHA 3EW9A 2YWEA 4KQ1A 1W6UA 4PGHA 1N25A 5JLAA 4WNAA 5LJIA 1XI2A 3A8TA 5IM4F 1WPXA 2J41A 3L06A 3M83A 1EWVA 2FK7A 4JL8A 4TSFA 1K98A 1R0BA 3C8UA 4I50B 4K9NA 3MXOA 4N12A 4KG7A 4OOFA 3GDFA 4QQFA 3DV2A 2ZR0A 3IPCA 1TE2A 4Q34A 3MT7A 4QBFA 5GJVC 5GQSA 5REQB 5CFRA 3RB8A 3MIIA 1RI3A 4QBKA 2UVPB 3ZWBA 4LOHA 4ANFA 5E3IA 1LSUA 3STUA 4WOJA 5HR5A 4BFCA 2CXPA 2J31A 5DHUA 4LYYA 2P5UA 2AZMA 3C70A 4L28A 1O1YA 1ZH4A 2JJ1D 4V39A 4ZHQB 3NHZA 3N2KA 1K6XA 2RAPA 1Y3AA 4FSHA 2I0FA 4P35A 5AK6A 3R7SA 3TQQA 5BNZA 5K8TA 4CM8A 1U8YA 3GL9A 3IILA 4RDIA 4ZZ2A 4GKJB 3KEGA 1IUPA 3AERB 5KHLB 4JEMA 4MSUA 2XB6A 1MGPA 1J2TA 5D3MA 1XZJA 3T06B 3TSYA 1BU5A 4GYWA 5EIWA 3LPLA 1JDVA 2QN3A 3ZLTA 2XDQA 5FTNA 2AR9A 1OLUA 2EG9A 4A3SA 4AKEA 5SYMA 4D9HA 5EIHA 3AUTA 1FDTA 2XH8A 2KJQA 3H9CA 4C20A 4DUPA 4CI9A 2D5IA 3VNVA 2BGTA 1NV9A 2PDAA 3W06A 3V2UA 2BGWA 3KUDA 1U1DA 4BYMA 1UBEA 4TL9A 4EYOA 5LQJA 4OYYA 2QD2A 1T9AA 2QYOA 2ZE8A 1IQUA 4GNKA 3ZNQA 3VBCA 3DE1X 2G3YA 3A3YA 4M8KA 3IPRA 2NU7B 3PDIA 4WERA 4BO6A 4KR2A 1XTTA 2IY9A 3TRDA 1OPRA 2V65A 3ZXUB 1C2YA 3MRTA 2R8BA 2JH3A 3PDHA 1EHIA 4ZVQA 5EQTA 4CLHA 821PA 3AVUA 3V46A 4F8EA 4PPFA 3JYLA 1PT9A 2IYPA 1CUEA 2JJ2D 2SCUA 2NAFA 2DPGA 1A8QA 1DBRA 2WYWA 4Y3UA 1IWOA 2V4MA 4RABA 3IYLW 3HVJA 1J97A 1X74A 4OHOA 3O92A 4RHTA 4BWVA 1HE1C 2BCGY 3MJFA 3OPNA 1NFRA 1GUAA 1R1DA 2R8EA 2XMCA 3B36A 3THSA 1OC2A 2DECA 1II0A 2PWYA 2YL2A 4QYTA 1XZEA 4XLLA 5JLJA 2ODQA 3K2IA 4HH0A 2PR7A 3CCCA 5C8YB 4L8YA 1YDGA 5AVQA 2BFEA 2C92A 3P96A 3ZHVA 2CD7A 5FQOA 1RP1A 4DPMA 1KRWA 1J8DA 1P7ZA 2P8JA 3CVYA 4HQRA 3ZJUA 4QEZA 3TRIA 4FQ5A 1SXPA 4CMAA 3V80A 1VHLA 1VXRA 2XA1A 4HDMA 4MK4A 3RFFA 2CLFB 5LWQA 4XB2A 4NTZA 1E94E 4KIWA 1T9CA 3CBGA 2AX4A 4LGMA 1PZHA 2H4FA 4S2UA 2QLMA 4IHJF 2GBFA 3EDCA 1PT7A 3ESRA 3L8CA 4F84A 3ZHXA 5EMLA 3RT1A 3W8DA 7YASA 1G8FA 2QVXX 1CQJB 3M7IA 3VZCA 1GG5A 5LUBA 4HAOA 3LLCA 3PPXA 2G1KA 1WXFA 2C5FA 2NO6A 4Z3OA 2KYRA 1P7WA 3EQ8A 3WGJA 5DM1A 3SE7A 1HEUA 4C7OA 1YU9A 4XX0A 5FOXA 4OK6A 2PO7A 4U7DA 1SXJD 2IU3A 3QHPA 3C7KA 1GFWA 2WABA 3DONA 3PQFA 4S1PA 1YD7A 5I5GA 1V26A 3DOHA 4QO8A 4OFZA 3RGWS 3C1AA 3V8RA 4PO1A 1IXYA 1BYUA 1G3UA 2ZYTX 2ZBFA 3I9MA 5CP8A 2VOJA 3T1OA 4EY6A 1PVOA 3DT8A 3ACBA 3DDWA 4MW4A 2E1RA 3I1IA 4C03A 1E69A 2FFAA 5K20A 2EC5A 3HY4A 3SHQA 2I99A 1P7CA 3DHYA 4QTYA 3FVVA 1FS5A 3JWIA 3TOCA 4GSYA 1Z39A 3WV5A 2C8LA 1TO2E 1F2UA 4XIYA 1DZIA 2FHSA 3WJ2A 4CF6A 3GPLA 2J87A 4D5EA 3GGDA 1NM5C 1SXJC 4AUEA 2XLCA 1FYDA 1ZIOA 4LDAA 1JDBC 1D6MA 3R1IA 4NZ9A 5HJ2A 3DZFA 4EY3A 3SXUA 2W11A 3N3BC 3NR2A 5KNBD 3RLFA 1QO0A 2ASVA 2IYEA 1LS1A 4LMRA 3TBHA 2V1UA 1PYDA 4B3FX 3ZU6A 1JIIA 3CZQA 3M4YA 4KQKA 4GZ5A 4KE8A 5FP0A 3R7WA 1T1SA 1HQCA 1Y3BE 2O14A 4RETA 1U7TA 1GVHA 4H27A 3TQCA 1NKTA 4BTVA 1QGED 3JPYA 2WE8A 5GONA 1ODSA 1Z4MA 1IXZA 4BGUA 2V59A 4QEKA 1C5KA 2H06A 3E2IA 2UZ0A 3K32A 5FCDA 5EJ7A 3EIUA 4KRGA 2FZ5A 4RDHA 5KNBH 1RAAA 1U9IA 1WM1A 1ZN9A 2NUPA 4RGQA 3TOXA 1JLMA 1CLEA 3P19A 1OC4A 4ADSG 1TZBA 3JAWA 1VMIA 4MVJG 2YRFA 2C4UA 2XE7A 1UR5A 1H5UA 1DAHA 4EG5A 4NYMQ 3SYMA 1G5QA 1G55A 3P32A 1P9NA 4J90A 1QMPA 5E3JA 3CUSA 3NHFA 1EE9A 2CBGA 3OKPA 5DTIA 4C07A 1DPGA 5C52B 4LRXA 4OJQA 3PT9A 4D9NA 3FWKA 5FDFA 4IFEA 4JLAA 4W9NA 2QL5A 2LKCA 1MUUA 1ODTC 5HXAA 5LQKA 2BEUA 3EFOA 2W93A 1JLSA 2P5TB 3L92A 3NW9A 3OQHA 4IIGA 4C43A 4IG4A 1HX7A 2GPYA 1XQVA 3GJ4A 4DEVA 5KHOC 3SOZA 2Q07A 2XGOA 1KARA 5DNAA 4MA4A 1X7DA 2HREA 4LXHA 4B45A 4JYMA 3A1CA 2G06A 5AXBA 1BZYA 4WX2B 1QX3A 3M6XA 3SC3A 4LHEA 4ZKEA 4CM4A 2CNBA 1QB8A 1T24A 3BFXA 1HGXA 1ZD9A 4G89A 1ADCA 3WNCA 1VHWA 3F46A 4QWWA 5AH0A 2WWYA 4MYUA 3DL2A 3Q3JB 3OIYA 4QOGA 4CQLB 1Z4OA 2VI5A 2DG2A 2EFJA 3KQMA 3WLIA 2YV1A 2HCFA 3F6BX 2E5WA 3OZTA 2FWJA 3G82C 3T38A 4WLUA 2YS7A 3BMNA 4GYJA 5JDIA 3TO5A 1BKDR 3MCWA 3GZNB 5DLDA 3VPDA 4ER5A 3UMSA 1R74A 2VDOB 4C0KA 3CNQS 2QLJA 1E1RA 3OE7D 3CT6A 3UMRA 4YX9A 3AY6A 2KB0A 1CZHA 2VHTA 1CEEA 2W71A 2XE4A 2CUKA 4PTLA 5A03A 3UCXA 5AVRA 1NNEA 1SA0B 3ZI4A 2PZ8A 1NGSA 2IOQA 4GPBA 1VA4A 4G37A 4PLGA 1ZISA 1T2EA 4UUNA 4U7FA 4AMVA 2VCHA 5EIOA 3RI3A 2FZEA 4HUTA 1LNQA 4M1EA 3H6HA 1WVMA 5EYPB 1KDVA 3TTTA 5ALRA 5CVCA 4Z7JA 3HG7A 3NB0A 4XOUA 3M2PA 2IVZA 2WNIA 2X8AA 2PU7A 2EZ4A 4NKRA 2ZJBA 3IXQA 4OLHA 4PZCA 2PUTA 2HO5A 4A2QA 5ICEA 2R87A 3KP1A 5C3UA 1RWPA 2IXGA 4MVWA 1A9YA 3KL2A 1IXKA 4D0NA 2C4KA 2VWPA 3L4JA 3IAXA 4TLBA 1U0JA 4G36A 2FWMX 1YAHA 2QSJA 3T5MA 1VHDA 3M6FA 3NATA 2W42A 2BGKA 2YOFA 2INGX 3L0ZA 4ND8B 3U6KA 3ZQKA 4DV3B 1J8MF 2FFRA 1UXIA 4Z3DA 1WQ3A 4R0VA 4DWJA 3TNDA 2XWPA 4EFLA 5IK2D 5G3YA 4NDNE 2RHGB 4EIWA 4C29A 2AJDA 4GSLA 3PU6A 4FR2A 4PS1A 1EZ1A 3VH1A 3T5GA 3EARA 3GOQA 3FYCA 4JI7B 1WAMA 2VO1A 4TUYA 4P1ZA 3NDPA 3MAAC 4RCVA 1G4AE 1IPHA 3IPAA 1T0IA 4F21A 2ZWOA 4CKZA 2FPPA 3EASA 4NS4A 1FXWF 1JS1X 1BXRA 4FLMA 1IRXA 1QPZA 2GM9A 2Z4RA 1A9XB 1AS0A 1EFLA 1M1NB 1LPNA 2OK7A 4N8EA 2FPGB 2FEXA 5HNKA 4DSAA 3U4DA 1GM5A 2J4FA 4AROA 5EE5B 5JTTA 1Z4KA 3R0IA 2QNBA 1LWOA 3Q0EA 3KYCB 5KYWA 1JR6A 4FZ5A 5MN6A 1UJMA 1IE3A 2OUKA 1S8OA 2Q1TA 3AEKB 4RKWA 3DWIA 1Z07A 5BOVA 3JWPA 1FYVA 2V4UA 3QJ5A 3D6JA 3B8HA 1YB4A 3ABIA 3QE0A 5CM9C 6REQA 4KXNA 3RKRA 4LF9B 4RYDA 4ED9A 2PLFA 3V48A 1DEAA 3FPBA 3UB2A 1WXIA 5HTKA 5BYKA 4E51A 4O5OA 3LUBA 2IGTA 1E0JA 4BLPA 2ZJ1A 1W2GA 5AQEA 2BR5A 4GDMA 4BNUA 1GTVA 2ZTUA 3MWEB 2FG7C 2JFVA 1LD3A 5E4TA 2HGZA 4C4RA 3K20A 4OPMA 4C89A 4DIOA 2MYTA 1Q12A 2G1UA 1V1RB 2Y6VA 3CLTC 3DGFC 1II8B 1NHWA 4P5EA 3GGCA 4ZTBA 1L4UA 3URKA 1E5QA 5AM1A 4YS6A 5TF0A 1AKYA 1NDQA 4BVLA 5KHAA 2B1RA 3U7RA 3X1DA 4JCOA 3NIGB 4UM7A 4PLWA 3RIXA 3TTVA 4RD2A 2QD5A 1FQWA 1PGPA 3U4QA 1BNCA 1D9ZA 5CT4A 2VQEB 3F67A 4KRYA 1JFFB 1Y1LA 5CAEA 2PZGA 1XSEA 2NVOA 4MUJA 4ABTA 3VAAA 3JU3A 3Q3HA 1AQLA 3PB3A 2P9HA 2O3TA 3WMGA 4PQRA 4PRZA 2Q28A 3KR0A 4IV5A 2JI7A 4LHSA 4PR0A 2D7DA 4YJ2F 1HUQA 4F2PA 3R9IA 2HQRA 2GJKA 3MZ0A 1GGKA 1P1RA 1U4OA 3SQOA 1UWKA 2BI7A 2J9ZB 2YWHA 3DZBA 3FKSA 4O5AA 2JGRA 2H3EA 1W1IA 2PKYX 4MMXB 5DM70 1EQ2A 3IV9A 3WWOA 1MO4A 3JATB 3ZCXA 1YB6A 1JQKA 4S04A 3PHHA 5CCXA 1J0DA 1L5SA 4O8CA 1NBHA 1Y1PA 3KJXA 3C1UA 4HB3A 4HUQA 4QHTA 2CKMA 3ES9A 4B4KA 1PTKA 1AKWA 1G20E 3SBXA 2QRQA 3D3WA 2RK4A 4JOBA 4RTQA 4NG5A 2HBZA 3KEMA 2OUIA 1ZINA 2BEVB 4QASA 4DIEA 4BNKA 5JMOA 3AETA 4N49A 2HHHB 4ZVLA 1XOIA 2ZRCA 3B5EA 1KH3A 3K1AB 2W6JD 3QG1A 4NI5A 1QE3A 1E20A 4P7JA 1RQLA 3ASZA 4K46A 4YMWA 2CNWA 3AIIA 3N7AA 3IAUA 3EIWA 4YQYA 1OBFO 3RV4A 3FOAA 4WJZA 3QVSA 5J5AA 4LCBA 4FKZA 1I7DA 1HDZA 4OB6A 1TRKA 3O8BA 4NS1A 1WD5A 1RXVA 1E2KA 2OGZA 4I50A 1GJRA 2R8XA 2AFIB 3RH0A 4E2YA 4U5XA 5CLJA 1EZZA 3OPYA 4HDRA 1H2ZA 4X0EA 5EWMB 5F7OA 2WDPA 2J08A 1L9KA 3OZDA 4OUDB 1S2LA 4RXTA 4WNCA 2ALJA 1L8OA 2NPFA 1BRMA 1LQTA 2Z56A 3DMRA 5EMMA 3T15A 2H07A 4JI5B 1CJVC 3I2HA 4GQBA 1J6UA 4YGXB 1EA7A 3L7YA 1UDWA 7MDHA 2Q6TA 1T36B 1AZLA 1Q3TA 2QRVB 1PQ4A 2XYPA 4MQMA 6ABPA 1FTQA 4UNPA 1FFSA 6LDHA 3IOMA 1I3NA 2PBRA 3Q3CA 3ZKWB 5HKOA 5IFLA 8ADHA 2FZVA 2OFOA 3DFKA 4DQVA 1TM1E 1NNI1 1SQ5A 1XJQA 2FZCA 2V0GA 3UK1A 3X44A 1Q0SA 1WLSA 1NONA 3T5PA 4HHEA 3LTEA 5CT8A 2YQ5A 3E7XA 5CDFE 3NHRA 3PC7A 4QECA 5L6LB 4XUGB 5FUMA 2C7RA 4DBLE 2PFKA 4QUGA 4BBPA 1A69A 1D5WA 2NLOA 2PUHA 4YCDA 3SHWA 1NUPA 3GELA 3U7JA 4MRRA 1KWKA 1J5EB 5GADl 1P5FA 3A14A 4EG8A 4Q6BA 3FWNA 4M21A 4TQGA 5ALYA 3UPDA 1TJ4A 1CQXA 2WUDA 1SXIA 2ILVA 3DPSA 2Q62A 4R05A 3VJRA 4RS4A 3DEYX 3CRZA 3QLJA 3LGXA 4X20A 2HDWA 2LCFA 2PUAA 2JKVA 1E1RD 1IIBA 4HCJA 5KSZA 1K5HA 3I83A 4OBXA 4IIJF 2V3VA 1JAIA 3LPAA 3ETJA 4QGGA 5HKKD 1DX6A 1MP0A 1AHPA 3GRYA 2XLBA 3OEED 2M32A 2O7QA 3R3VA 2JK0A 3ELUA 3TCXB 1BQ3A 3VI3B 1H2HA 2KSQA 2R1VA 4GMFA 2JGNA 3FCUB 3GW8A 3HNPA 5AW9A 3VR5H 5JTUA 1DXQA 3KD3A 1I01A 4FLEA 2NYRA 3IUSA 4H4EA 3TD9A 4B80A 4WCFA 4OP3A 4RVCA 4ZOQI 4Y7DA 3HEAA 2PVCA 3M33A 1EH5A 2P2GA 2VSQA 3AKDA 2HLNA 1C4WA 2XITA 3G89A 3JQ9A 2F59A 4PG4A 3RIGA 5IJ0B 3PEYA 3DOFA 4WNIA 5D87A 5AI4A 1SUWA 3AW9A 4URWR 2RBKA 3OIDA 3OJCA 2OSBA 3NHJA 4G0OA 2XKKA 4ITUA 2PT6A 3PUJA 1NE7A 1NYLA 4LTMA 3SYTA 2K2QB 3ZOZA 5G4KB 3H5IA 1F51E 5B7QA 5HQ3B 2Q4BA 4JK3A 3ELYA 3FJOA 3DQZA 3OU7A 2GBPA 1YZFA 3HZHA 3VNRA 4DMRA 4Q3NA 5CEEA 1W581 1ZS9A 3L9XA 4GFDA 4MQEB 5I01A 3EH1A 3HXLA 3TZCA 3H8VA 1O94D 3O4IA 4OIFA 4TWJA 3UNXA 3CVUA 2C2YA 5F78A 1VE6A 5DF1A 5F1YA 1E3SA 1U0FA 4O2AB 4V0QA 2YWBA 5BUCA 2GFQA 3PKIA 1KO7A 3KHSA 3ZE2B 4MS4B 3DZGA 5A5VA 1TQ6A 2PL5A 5C5IA 5T7BA 1DCFA 3FBTA 2VQ3A 4QJ5A 4LG1A 2XNHA 3AXTA 5JYDA 4CEJA 3BE4A 3VDXA 1OH7A 1BA3A 3DEZA 4ZO7A 3C4JA 5LQUA 4DLXA 3A9RA 5A06A 2RHLA 2OENG 5KUTA 3VU3A 4D43A 3ZQJA 3IMCA 3DEAA 4NFYA 5AVOA 3WLKX 1R16A 2BSAA 3T7IA 1OU0A 3PPVA 2GYWA 4RLHA 4OF4A 2QORA 1U5BB 1SCJA 2VPXA 1ZJ6A 1OZHA 2PWZA 4PC3A 5JYBA 4JCCA 5TQ2B 3RLIA 4KSBA 1A77A 4WVLA 4MRPA 4DJ5X 4GC9A 5F9HA 2WZDA 1MOZA 1ZQ9A 4F4UA 1ZITA 2BBOA 2WU8A 2XOEA 3UK7A 4FFVA 4FWTA 3R75A 3HKCA 1WCWA 3PVSA 1SURA 1KP3A 1XTSA 1FOEB 2BGMA 1NBMD 1T26A 1GP2A 2IIBA 2UDPA 1IY8A 3FNHA 4UBJA 4AURA 2WAMA 4KFTA 3WAJA 3QEMB 1MXFA 5KREA 4MTCA 4XQCA 3I09A 1NTRA 2FE4A 4JI6B 2G08A 3IV6A 3E61A 5K9ZA 4MVJE 1WSBA 1QORA 3NXSA 2QX7A 4X60A 1C4OA 1KO8A 4HMPA 3V7FA 4DDVA 3NT2A 1BS9A 2WIGA 2D7CA 3DCYA 2NU8A 3DEFA 2R62A 4Y6PA 2GILA 2PY6A 2C4MA 5CNMA 5FUVA 4TYNA 3ETDA 1Z12A 1TTQB 3K9CA 4RWZA 3SF0A 1OUMA 2JGFA 1YKSA 3OIFA 2G9QA 3AI7A 4D44A 2A58A 3EZ6A 3JRWA 1GUZA 2DFTA 2QZ4A 1WPGA 5DGIA 4BMPB 3E8XA 1ILEA 2OT3B 1UBRS 1VKRA 1CP3A 3HN2A 2ZM6B 1UEXC 2F00A 5K09A 4G26A 4Y2SA 4NBNA 2L17A 1YQGA 1AN9A 3NAMA 3QY9A 2JZOA 4PYNA 4IEEA 4LZLA 1FX0A 4RGVA 5COQA 2H9AA 4IHJA 3M81A 1NWHA 1N2XA 3D59A 1BVRA 3MEQA 4I5DA 4PANA 2DB3A 1U28C 3MJ4A 3ZCVA 4W7SA 3GFVA 3DHEA 1K2VN 1R4AA 2V4ZA 1RPTA 3PSAA 3RYFB 4CBVA 5FNZA 4DR1B 2CHUA 2H4WA 3GAAA 2DX7A 5HA5A 3DAOA 2IOFK 3RQIA 3NTRA 4KXWA 1UP4A 3SM9A 4E70A 1E79D 4J7CA 4Z0PA 5K3CA 1F2TA 2GPSA 3OUZA 4IS3A 4B8YA 3HJTA 4Q4HB 4EPVA 4R83A 1M54A 2JFUA 4F60A 1PX2A 4BX3A 3QLUC 2ZYGA 4QOIA 4MQLA 2GSWA 4WJKB 1SD2A 5IULC 1WIWA 3HYLA 1TTPB 1L4KA 1NZJA 1RZVA 1V41E 4FHZA 4FMCB 3EVZA 5HCIA 2GD6A 1LLQA 4EPTA 1F2TB 3W6UA 1IC6A 1XA0A 2HWUA 2R6HA 1MQAA 4FFLA 1T4GA 1DEHA 4LBWA 4QSMA 2GXAA 1JSZA 2FV8A 1CY8A 1TZ2A 4FDAA 4TLCA 1TVCA 4AP6A 5JH7F 3DAPA 3OTWA 1KU0A 3C5HA 3UN1A 4G5QA 3WIEA 3GFOA 3AOGA 5EXEA 2ZCVA 5H3CA 3FPLA 4BRSA 2IH2A 4KQ2A 4HQOA 1C30A 3PUXA 4WKOA 1AXGA 3QNUA 3VPFA 4UPEA 1FDOA 1SUFA 5G0SA 1FX1A 2PRSA 1H2EA 4H6XA 3GJ8A 5JT1A 3QQ5A 3A4LA 2JIPA 2X0RA 1K2WA 1RM0A 1XMVA 3C41J 3IAHA 4JJIA 1FJ2A 2ZTMA 1CRLA 3ROQA 1DEOA 2H4ZA 3JVUA 2RBGA 3R6GA 3T3GA 4M83A 3OT1B 2DPHA 3JYHA 1P2DA 2PUFA 3DLPX 1GQ2A 4OD0A 4JLSA 3EXEA 5A4JA 4YN3A 2VH2A 4OLJA 1VE5A 4DG5A 2I7CA 3CEAA 5HHTA 3NIWA 4TQ9A 2LP4Y 2RB5A 4ATNA 5EHNA 2YJZA 5BN1A 3ID6C 2DOKA 3W7BA 4P54A 3K2BA 3O2QB 3WQRA 1K97A 5MN5A 5GINE 3IA7A 5ARBA 3W5DA 3NH6A 1XTBA 3UHOA 1DQNA 4TQUS 4UC0A 3BA1A 3C5CA 4H1VA 3KKLA 4QJIA 2OZKA 4JITA 2H1WA 4R2XA 1DOZA 1RRMA 4URYR 1HO3A 3HJAA 4BN5A 5ICCA 4AP5A 1TFUA 2RGCA 1ZL0A 1Z06A 2FKNA 4GPZA 3IBTA 4EJSB 2IYQA 5KWVA 3OZCA 2OXTA 4AYXA 2VBFA 1L6RA 3N8HA 2WPNA 3HLTA 4L16A 4MQ6A 4V0OA 2X0JA 3UFBA 4Q7EA 2ZT8A 4N6NA 1AH2A 4A82A 3O8QA 5AW5A 2D2IA 1UXJA 5BUSA 4YQZA 3KTAB 1PT8A 4IIJA 1G2PA 2X1HA 4B2IA 4M9QA 1Z7GA 4DHWA 3GFSA 1NQVA 3HBMA 3PFHA 1PK8A 1WP9A 4DSNA 3TQSA 1RXYA 3VZQA 4D3XA 1HEIA 2IUEA 3PYMA 5KYWB 1U0SY 5YASA 4RVNA 3RRFA 1SIOA 2X19A 5H81A 3U26A 4CKCA 1I9CA 4Z54A 5JEEA 3MGKA 5IJZA 1U7OA 3NBUA 5DW3A 1MORA 1Y7HA 2A57A 1D03A 3ADPA 4K1XA 3KLOA 2G5TA 3D4IA 3FYSA 4XTRA 1FQJA 5C5DA 3HDGA 1WRBA 1OVMA 2XOKD 3ETLA 2PLAA 3Q88A 1R4NA 4D8VA 4LZZA 2I7DA 1UFRA 2WLTA 2W4QA 4TTTS 2CFTA 1TKBA 5DYWA 1TLFA 1WDKA 3DHWC 3U4CA 3REOA 5LZ4A 1L5MA 1SG6A 4HGPA 5HFJA 1P39A 2PH5A 3J81k 2HPHA 4KHZA 1TAHA 4E31A 4Y2PA 1K4MA 1KJQA 1MRSA 4FTWA 4KXMA 1UQRA 3HI6A 4CN9A 3HSYA 4Q9LA 1UBHS 4QDUA 3TIFA 4OQYA 5FTMA 3NHUA 3WLAA 1CBUA 2E4YA 1IM2A 2OWDA 2R86A 3LD9A 5TF4A 3CGGA 4UFPA 2GLXA 5DMHA 4BFZA 2IXAA 3ZY2A 4G4SP 1IOWA 1F6BA 1AB6A 1D09A 2I6TA 2O2JA 4D98A 2BI4A 3H42B 4X6LA 5H4HA 1TDJA 2BFFB 3STWA 1FLVA 3PL5A 4IS2A 3N2YA 2YWJA 4Y0AA 3RE1A 1ZOSA 4OP1A 4WVFA 4E5DA 1CYEA 3BC1A 3QE3A 4KFCA 1AVTA 3AKYA 2FMHA 2O5RA 1EDOA 4OQEA 1N0WA 3LGAA 1T9DA 4BNHA 4XM2A 3GRKA 4AF6A 4MHSA 1J33A 2QAGC 2ETXA 3R76A 1W75A 4AMBA 1KZ6A 3HKDA 5B58T 4YDQA 3MCAA 2D13A 1E1CB 2CMKA 1ZD2P 3FLEA 3R5FA 3HA7A 3ZWCA 4WEQA 4PO3X 2WYVA 3HYSA 1OWOA 1PJTA 1UBGA 1PEYA 4J1TA 4NJMA 4NNJA 2XUAA 1XEFA 2IOYA 3PRHA 3W3AD 1JUDA 1NLYA 2DBVO 3EISA 1XJ0A 1YT5A 1ADJA 4X6YA 4C76A 2PVPA 1IULA 3UM9A 3TR5A 5KPDA 3TJRA 2C2GA 2Z5LA 4HTAA 2P11A 3VR4A 3ZWDA 3SGLA 1G1MA 3AH8A 3O7MA 5JPCA 2RK3A 3K9QO 3D64A 1GAEO 4Z49A 2VR1A 4PFQA 2ID9A 2JBAB 3EXHB 3PRJA 3E2MA 4ZQBA 3WG9A 5IAAA 1JB1A 1AMOA 5A3QA 4M0CA 5IUNC 1DQZA 2QRJA 3G2QA 3OX2A 1OYOA 4P22A 3TH5A 4LYGA 4BMVA 5KWEA 1DEXA 3G2NA 1X9GA 2IQIA 3NKVA 3R7LA 5ITZA 3R9KA 3S2GA 1SG0A 2VLIA 4UNSA 1M67A 2GBLC 2HBYA 3NEYA 4KNYA 3GFRA 5B7GA 4NE7A 1JG2A 1VJTA 2QQ0A 2VPPA 3IBFA 4D4JA 2VHQA 3ZC3A 3IAFA 1N1DA 2OBMA 3E9QA