2B0GA

Solution structure of drosophila melanogaster snf rbd2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
b'AQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Solution Structure of Drosophila melanogaster SNF RBD2
rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b0gA00
1DHMA 1YJNS 1R8HA 1X4AA 2HGLA 2MQOA 1RKJA 1N52B 2FC8A 5DETA 5MLCV 1IQTA 3S01A 1X4FA 5FJ4A 2KH9A 1VQ5S 4YUDA 2M4MA 5GAGU 2MYFA 4F02A 2MQLA 2DGVA 3UE2A 3B4MA 3VF0B 4LIRA 2E5JA 5LXRA 3L3CA 1U6BA 2YTCA 1VBXA 2DNYA 3MOJB 3Q2TC 5GVQA 5BJRA 2YWKA 1U1QA 3NS5A 1PGZA 1VQLS 2LEAA 2CPEA 1UP1A 2D9OA 1VQOS 3LPYA 2XB2D 2DGQA 4ED5A 2DNRA 1FO1A 5JVHQ 1D9AA 3ULHA 1FT8A 3Q2SC 1WHWA 3I55S 3TO8A 3TYTA 2KXNB 1YIJS 3NNCA 3UWTA 1YI2S 5CA5A 5LSOA 3BEGB 2D3OR 2M8DB 4UY8T 1RK8A 1WG4A 2K8GA 2OSRA 2MZJA 4C4WA 3CC4S 1HD0A 5D78A 1M90T 1VQPS 2LEBA 3CCMS 1Q86T 4OZ0A 2KT5A 5LSLA 3BO3A 2HYIB 1URNA 2L9WA 2DNQA 2VOOA 4IO9Q 2M0GB 2N82B 4BS2A 3CCSS 2OTJS 2CQ4A 2DGOA 4WFBQ 1OWXA 2DNHA 2MPUA 1VQ8S 2DK2A 5IM0B 1PO6A 1SJQA 2RRAA 2MKKA 2XNRA 1X0FA 3MD3A 3BO2A 2DNNA 3CC7S 3HHNB 2KRRA 1VQMS 2RS8A 1FJEB 2VONA 3ZZYA 3MXHP 1FXLA 2MQMA 1WELA 2RUGA 1WF1A 1M5OC 1B7FA 3EGZA 5DDOC 2MKJA 1P27B 2KI2A 4EGLA 4UQTA 2JWNA 5DDPC 2AYBA 3MURP 1X4CA 5IFMA 1JJ2R 1X5TA 2V94A 4QPTA 2CQIA 2M2BA 3G71S 4WIIA 2N3OA 2B0GA 1SJ3P 1UFWA 2M52A 3IWNC 1P1TA 3CTRA 1YITS 4TLQA 1KOHA 1KOOA 2DHAA 1N8RT 1WTBA 2J0SD 1H2UX 1X4BA 2DH9A 1S72S 1WHYA 1N54B 3G96A 2ADCA 1U6FA 3G4SS 1FHTA 1U2FA 1VC5A 1JJHA 4TU8A 5HO4A 2F9DA 1SJRA 2LCWA 3EX7B 3NS6A 2L08A 2BZ2A 2CQPA 4P6QA 5LJ3Y 4FXWA 1FJ7A 2LYVA 2RVJA 2X1FA 2MGZA 3CCUS 3VAHA 5DM6Q 1F9FA 5GMKa 2DNKA 2A3JA 4FXVA 2F3JA 1Q82T 1YTYA 4Y0FA 1H2VZ 1KC8T 4F26A 2DO4A 4OZ1A 1KD1T 1U1KA 4CQ1A 5LJ5Y 2MZTA 2KVIA 4IUFA 2DGSA 3EGNA 1WF2A 1WWHA 2E44A 1JMTA 2CQGA 1DZ5A 3BO4A 2CQ3A 2MXYA 2M70A 3MUMP 4LMZA 5IQQA 1WHXA 1VQNS 1WI6A 2RQ4A 1K73T 2U2FA 5D77A 4WCEQ 1U1RA 2MKCA 3J7YU 3NNAA 2JVOA 1YJ9S 3NNHA 3S8SA 3UCGA 4CH0S 1VQ7S 2Q79A 2LXUA 2CPIA 1M5KC 3N9UC 3THPA 1K8AT 3HI9A 2HGMA 4U67Q 1N88A 2ERRA 1W2BR 2MQQA 2DGWA 3FEXB 3CCLS 2I38A 2DH7A 5DDRC 2RQCA 2E5GA 2U1AA 3SXLA 2M9KA 1U1MA 2RNEA 1YJWS 2XS5A 3CF5Q 2XS2A 1SJFA 3TP2A 1BY9A 2MY8A 2G4BA 4A8XA 4WF9Q 2UP1A 1ZH5A 1D8ZA 2FPHX 3H2UB 4Z2XA 1U1PA 2DB1A 2YKAA 2DNMA 1O0PA 1HA1A 2RT3A 2QEXS 2X1AA 1H2TZ 3MI7X 1Q81T 5ITHA 2MHNA 4IOCQ 5CYJA 2MMYA 1WF0A 2M88A 1DRZA 1X4HA 5CXTA 2AD9A 2M8HA 2GHPA 2KM8C 2DO0A 2HVZA 4ZKAA 2CQ2A 2KFYA 1QVFR 2NZ4A 1R8PA 2N3LA 1WEZA 3R1HA 5GAHU 2CQ1A 1AUDA 2PE8A 2DNLA 2X1BA 2KU7A 3J7ZT 1VC0A 4PRFA 3ZZZA 2KYXA 3CC2S 2DGTA 5LXYA 2AYEA 3PIPQ 3VAMA 2MJUA 3CD6S 2KG0A 2EK1A 2KXFA 3VAFA 2MGZB 1UAWA 2KM8B 4QU7A 2SXLA 4WFAQ 3CCQS 4QU6A 1HD1A 3G8SA 1VQ9S 2DHXA 2FHOB 4CIOA 3H2VE 2MSSA 3VAIA 1U1LA 3DXBA 1X4EA 1SXLA 2VOPA 2OTLS 1WI8A 3SDEA 2E5IA 2MSTA 3VAGA 2LQ5A 2ZJQQ 3P5TL 2MQNA 1QM9A 4Y00A 1A7GE 2QA4S 2DGXA 2JX2A 5EN1A 2J8AA 2LA4A 2MQPA 3S6EA 2CPDA 2DNZA 2OJ3A 2CPZA 2CPHA 1QVGR 5DM7Q 1VBZA 1M5PC 2MZRA 2CPXA 2DHGA 3THTA 4YOEA 1M5VC 3I56S 2LKZA 1NU4A 2KN4A 3UCUP 3P49B 3UCZP 1X5SA 2CQBA 2OSQA 2K3KA 1G2EA 2DNGA 5H1SV 3CCES 1FNXH 1HL6A 2X1GA 3G9CA 3CUNA 2DITA 1WHVA 3MUVP 2J0QD 1DBDA 3OW2R 2CQ0A 3K0JA 2MKIA 1VQ4S 4PR6A 2EVZA 1WG5A 2CPYA 1WEXA 2DISA 2QFJA 3LQVA 3R1LA 3CCRS 2ADBA 2OIHA 3G6ES 4V19X 2NLWA 1U1OA 2FC9A 1NJIT 3JB9k 2JVRA 2MKHA 1CVJA 3CULA 4LJMA 5DDQC 2KG1A 2FY1A 2YH0A 1NO8A 2LMIA 2PEHA 3NMRA 4ERDA 3RW6A 3FEYB 1OO0B 2MKSA 2CQCA 2E5HA 2GO9A 1VC6A 3G8TA 2RRBA 3V4MA 4C0OC 1X4GA 1KQSR 1YWXA 4TU9A 2G0CA 4RU2A 1Q7YT 2F9JA 2M7SA 3UD4P 3P3DA 1SJ4P 2CJKA 4W90B 4W92B 4WFNQ 2L41A 2D9PA 5GAEU 1OIAA 3RW7A 2EK6A 3VAJA 1UW4A 4YB1P 1WEYA 4TU7A 2G1DA 2KHCA 2LA6A 5GADU 2HGNA 3R27A 2CQDA 2RU3A 2O3DA 2I2YA 3BS9A 2J76E 1ZZFA 1M1KT 1H6KX 1S79A 2CQHA 3CCVS 2RS2A 3MD1A 1XN9A 2KXHA 3SMZA 1OPIA 2DNPA 1K9MT 1JJ4A 2KRBA 3U1LA 3CPWR 1VQKS 5JVGQ 2WBRA 3SDEB 1ZZNA 2JRSA 2HZCA 1A9NB 2CPFA 2CPJA 1VBYA 3S7RA 3B4DA 2DGUA 5IM0A 1X4DA 5HL7Q 1U1NA 2VODA 4QQBA 3CMAS 3US5A 2MZSA 4J5OA 1X5PA 2MJNA 4CH1A 2DIUA 3VAKA 2ZJPQ 2BOPA 3P6YC 3CCJS 2ZJRQ 3MUTP 2DNOA 3D2WA 2XSFA 3MDFA 2MB0B 4M5DB 3CXCR 2DHSA 1WG1A 1VQ6S 3PIOQ 3CMES 3IRWP 2MY7A 2YH1A 2MZ1A 2N7CA 2XS7A 4WKRA 2AYGA 1X5OA 4PKDB 2LXIA 2LECA 1L3KA 1FJCA 2MZQA 3VALA 4C7QA 3UD3P 4IOAQ 2DH8A 2AYMA 2DIVA 1YHQS 3DLLQ 3U1MA 2XNQA 4F25A
chains in the Genus database with same CATH superfamily
3K2YA 3K57A 5MLCV 4JI0J 1X4FA 4KPYA 3KLFB 4QWCA 2M4MA 9RUBA 2XLIA 3SZ2A 2JDJA 2E5JA 1OSCA 3L3CA 1RE1B 1U6BA 1FDBA 4FNHA 5KFLA 1JIHA 3V4IB 3KWMA 1C4AA 1VQLS 3GCWP 1NHUA 1RWVB 4WKYA 4EYHB 1HR0F 1OQ6A 3JXOA 2R2UA 3IN5A 4LF6J 4CYUA 2HBZB 1YIJS 1FJGJ 2UXCF 1R27B 2BJDA 3AXMA 5KFRA 4FZVA 1TELA 4C4WA 3TUPA 3PDNA 3UPFA 1NDPA 2W2OP 5KG0A 2V68A 2WAQD 1TKXB 1X9WA 2F8MA 2BDPA 2HFNA 2HRUA 3KLEA 4IR1A 1LW0B 4ILRA 1FXLA 4A47A 2RUGA 2QRRA 3BPSP 3K89A 3J7Z5 4M5HA 2AF6A 2J9DA 2ZVIA 1V6HA 1ZAXA 3GV8B 4YB5A 3VZHA 2RKIB 3OHBA 4NXMJ 1MMNA 3NS7B 2HAFA 3QWUA 4QWAA 4F8RA 5DQGA 3C15B 5GMKa 3JSYA 1YTYA 2G1HA 3D68A 2I0XA 1U1KA 2KVIA 4G1QB 4C8MA 5EWEA 3OTDA 5E2QA 4B9SA 2DBBA 2HHSA 1KWMA 5IQQA 1VQNS 1WNEA 4RW7B 5HN0A 3U27A 5DLGA 3TVZA 3HHDA 3T5HA 1XNQJ 4DBQA 1RT1A 2CG4A 2PSZA 2BKOA 3PG9A 2DGWA 3FEXB 5EWFA 1O5JA 3R5AA 3CF5Q 2VG5B 2RJZA 2ZH3A 2IY5B 1T03A 3GYXB 3C19A 2W8KA 5BYRA 2Q6BA 3HXMA 4C8KA 2WOMB 4MK8A 2CJYB 1N34J 3RR8A 1JQGA 3RB3A 1SPBP 1CS4A 1FDAA 2P9GA 1DRZA 1YKWA 1ZM3A 3KLIA 5CXTA 4IYQA 2VC0A 1CPZA 3TI0A 1XK8A 3IBWA 4P74A 1SB6A 1YJRA 5E3CA 4Q43A 4XTTA 3CC2S 2OPRA 3DRSA 5MAOA 1IKWA 3CD6S 2QGFB 4YMEA 4CLKA 2V6AA 2B56A 3PCOB 3HSGA 4RBVA 4DR6J 3C14B 1RTHA 2IJFA 1TMJA 3DLGB 1HNZJ 4LSNB 3ONQA 3CGIA 1XEZA 3HHLD 1GAOA 3AQPA 2NXNA 3ZTRA 4NRTA 2MQPA 1S10A 3DOKA 1KSPA 2APOA 3GG0A 3N6NA 2BUNA 3I56S 2K3KA 1Q1KA 4USMA 1EARA 3H2LA 2IA6A 4ZVFA 2GVZB 2I5JA 5T41A 3LPEA 2QFJA 4H4KC 4CM2A 4USUA 4F3QA 4HYKA 1NJIT 2BX6A 4DUYF 2YH0A 1NO8A 5I3QA 3RW6A 3FEYB 4GRSA 1DTQA 2BR0A 1X4GA 2H5IB 4DL6A 4RU2A 1I1GA 2W2NP 1IBKJ 4Y2CA 1RLDA 3FVYA 3T5JA 3DM2B 1HBOA 1B70B 4K8RA 4YY3F 2QX0A 3L09A 2KB2A 3DRPA 5F8IA 1NDLA 1FK9A 1IKVA 3OL7A 4CLFA 4AL7A 1ZZFA 3MAAB 4MKVA 4O3PA 3SMZA 1JJ4A 1NMEB 2NUHA 3FSYA 2C2EA 5D4NA 5D15A 2J9CA 5F0WA 4C8LA 3ILJA 1FE4A 3GE9A 2NXJA 1F0XA 2ZM6F 4FDFA 2GIFA 1KLNA 3D2WA 2KJWA 3P4UB 4UZBA 3D6FB 1UPMB 4L75A 3CDAA 4LSLB 2B6AA 4EBDA 2BE2A 3OSPA 3ELHA 1BQNA 3W60A 1MROB 4HDHA 2XWYA 1NJXA 3DI6B 2J0WA 4DR3F 3RAMA 3U1MA 1KFDA 4ZVHA 2EFQA 1RKJA 3BSAA 2XZTB 2OAUA 4LFCJ 4OJHA 2V4JA 4DQQA 3VF0B 3J80U 1Y00A 1SH0A 3CJTA 2ZKTA 1RTDA 3LPYA 2XB2D 1NPKA 4QOTA 2W4PA 5EX0A 3KLHB 2YWGA 3BGLA 4HH0A 1UA1A 4USKA 4OYOA 2MZJA 1HI0P 3M2UB 4KFBB 3PEHA 1OSDA 3Q8QB 3TAMB 1Q5YA 2LFVA 3CCSS 1NHKL 1AT1B 5KG5A 2UVVA 3HP6A 3TUZC 1NSQA 3M8WA 3ET6B 3N5BA 3U7JA 3KHGA 3KJFB 3EGZA 4ZPVR 5HQMA 2AEFA 4NCBA 5IZHA 3GYNA 1KVJA 2M52A 4X4NA 1P1TA 1UWBB 5C24A 1EETB 4OHXA 2KO1A 3C6UA 4QWDA 1YBAA 1NH7A 3TANA 2BRLA 3TOQA 2GC8A 1VC5A 1JJHA 4TU8A 2N4DA 1NM2A 2YX7A 1UWAA 1XR5A 2VFSA 1EJ7L 1KP6A 3NL0A 2F3JA 1KC8T 2GO8A 4DR7F 1T3NA 3M05A 5ETOA 4KGKA 2RQ4A 1SV5B 4WCEQ 2CNLB 4DSEA 3MPWA 5BYQA 1CQNA 3SCLE 2CA9A 2CPIA 1KN6A 4R8UB 1K8AT 3HVRA 4RW8B 3CW2C 4DU8A 4OX8A 2ERRA 5LMNJ 2MQQA 4Z7CA 1HBMB 2DR8A 3QLHB 1YJWS 1C1BA 2LQ8A 1GTHA 1HBUB 2C22A 4RUHA 3M32B 4R25A 5KFOA 2WZ1A 1SVDA 1VI7A 3POTB 1H2TZ 2ILZA 5HBMB 2JEIA 2MMYA 2KFZA 1JNRB 1QSLA 4J9MA 4KHPF 2GHVC 4UQGA 4KV8B 3LO3A 4PXDA 3I87A 2HVZA 3RUBL 2XMAA 4PG5A 4PZVA 1OQ3A 1RT4B 3HHLC 4LF8F 2XEXA 1SC6A 4FPRA 4O3NA 4DPOA 4B3SF 2HVHA 3VAFA 4XPEA 2AWZA 5GMDA 5HATA 3LH2S 4WFAQ 1E6VA 3RB6A 4HI2A 3N28A 1EIYB 3R5JB 4DOZA 1CJTA 3UN5A 3C16A 1DQAA 4OZLA 3PX4A 2KL8A 5ETRA 3HHKA 3AA9A 4OYMA 4Y00A 2AZ3A 2DGXA 4FN5A 4CLPA 3DDIA 1TKTB 2IVMA 4ECSA 1F2HA 5D0GA 2DHGA 4YP3A 4JI1J 5KG6A 1FWLA 1UL3A 2IC3B 2ZKUA 3R7BB 1S6QA 3P49B 1ELOA 4CYUB 1I94J 3HF5A 5IV3A 1D8YA 2JEJA 3MTJA 2FLNA 1DARA 1KDNA 4QCLA 3SQGA 2XZWA 2COLA 3MWBA 3KDNA 1UVMA 3Q24A 3EWGA 4Q44A 4ANDA 1S49A 3T3FA 4CZCA 4DR1F 3HFZB 1GH8A 4CLSA 1SQFA 1S99A 2BBEA 2EFNA 3O5TB 3UD4P 1UTAA 2Q1LA 4J9OA 1S59A 4ZLPA 1CG2A 4MIAA 3GIKA 1X0PA 4FBUA 2YX1A 3ENVA 1VLOA 2OELA 5JJBA 4PG7A 4MK7A 1S79A 1HNIB 3OXLA 5HSPA 5B09A 5DRKA 5LSRA 2DR5A 4HACA 2MKYA 3S7RA 1JLCB 4B02A 1RT7A 2QE5A 3PTWA 5FDLA 1TZ0A 1CJVA 1LWXA 2HNZB 2W8LA 3J81U 3C2PA 4TY8A 4B9LA 4KT0C 5A8KA 5J2PB 3GFXA 3TR5A 2VL1A 3J80Y 2E9ZA 3EGVA 1WDDA 1SC4B 2RF2A 4LF4F 2AJ0A 1ZYQA 1ZA2B 5E0OA 1QD1A 3TZZA 4RNMA 3V6KA 4DL3A 3D1QA 4PQUB 4LIRA 3RTVA 3CJ3A 1Y5LB 4ATNA 3DLHA 5J1PA 3DCAA 1OS5A 4CO5A 2IVFB 3KLIB 5DZ7A 1HHSA 5C25B 3ULHA 1FT8A 2GHWA 4F67A 1WHWA 3CJSA 4J7CA 2F1FA 5CA5A 4Y2KA 1N5TA 3CC4S 1HD0A 2OPRB 3DRSB 1REVA 4P10A 3DLJA 4A4JA 3NCRA 3TUJC 4WE1B 1DY3A 4X66J 2RRAA 1X0FA 1CQMA 3CC7S 1FJEB 2IYIA 2UV8G 3MECA 3M30A 4C0HA 2PDAA 2FQQB 4H54A 1X60A 1GMUA 3AFGA 3HZGA 2VIHA 4TLQA 4CNZA 2OPPA 4WK3A 2AQ4A 4KH1B 3CJ4A 1X4BA 4X4VA 4Q0BB 2LCWA 2J5AA 4YFUA 2CQPA 3T19A 4X65J 2ZOGA 2I5JB 3OXFA 1T9XA 1U48A 3D3CJ 4OZ1A 4IUFA 4F0HA 4A8QA 2HURA 1FRJA 1HPZB 2KZZA 1T8EA 1PIEA 4Y34A 2MKCA 2RDJA 3BKUA 3Q22A 2IBKA 1YGYA 4ZK7M 2AIRB 1VJQA 1S1VA 4LRAA 4EBEA 2HGMA 1HI1A 3E51A 2X3DA 4QIWD 1FNOA 3DRPB 1FK9B 3RRHA 4LFBJ 4UF4A 2UUCJ 4DR5J 3T6BA 3H42A 4QBUA 2ILYA 4Y65A 1I6JA 2HNYA 4KC5A 3IWLA 1SQEA 1ROFA 2D3O1 1QUPA 2V2VA 3PW7A 4ICLB 3OLBA 3GILA 3CT9A 2V34A 3JYTA 2OO4A 2AD9A 4FP9A 2XCPA 3QT5A 1SJ1A 2CJQA 4MYUA 1TL3A 4J9KA 1WEZA 1AUDA 3GONA 3A8IA 4HHJA 2X1BA 3CJKA 1CC8A 1RWOB 3NKYA 5HMZA 2EK1A 5L1LA 3M7VA 3EUNA 3U1NA 1VQ9S 2ALYB 1K0VA 5HQ8A 1X4EA 1SXLA 3L4BC 5CQGA 2HS0A 2OTLS 1P9YA 3OR2B 1S6UA 2XYPB 1NK6A 1A7GE 1FVSA 2UXCJ 4DUTA 1GMWA 1H73A 4JI2J 1FRHA 3IRXB 2AJ2A 1ZM4A 1M5VC 4NRUA 4M5DA 2KN4A 1NKEA 2K1RA 5JXSA 3K5MA 2HK3A 3KYLA 1UW9A 2GGPB 4BCAA 4DUZF 3WC2A 4N7TA 4ZCMA 1VISA 1GT8A 2IVYA 1LW2B 4NX9A 4RZRA 1CVJA 2KG1A 2IDEA 4MIWA 5E3AA 4AUKA 2R7RA 1AZSA 1CJUB 2QA1A 2QMUB 2W9CA 3TQEA 4U9RA 1B7YB 4DCJB 3NY0A 3BKFA 1QJHA 3H5SA 1JLGA 2I6WA 3MM7A 3OTOF 2CWKA 5IT4A 5C24B 2YPYA 4DL4A 2G1DA 2KHCA 2ZVSA 4YN3B 2UZAA 2ZHAA 1KVKA 2F8HA 4IR9A 3MD1A 4DZDA 1C0UA 2JEGA 4OI1A 1LEOA 5E3PA 4RW4A 2DCUB 5EUHA 3IR7B 4JBCA 3DGPB 3B4DA 3J81Y 5HL7Q 1RBOB 3TZXA 2MJNA 4CH1A 3FBEA 2LVWA 5J1EB 1CBKA 2ZJRQ 4NLDA 1C0TA 1R6VA 4ANEA 3ITHB 1PAEX 5K20B 2R2TA 4CO3A 4ZVPB 5KT6A 4WKRA 4ZVTB 1IBMJ 4ECWA 4JI8J 1UKUA 1U0SA 2MZQA 3CNQP 1Z1ZA 2ALZA 4LBHA 1FO1A 2B3TB 3H7HB 4F4ZA 3DMJB 2HGLA 2B4OA 3HD1A 2MQOA 1H38A 5C5JA 2IM2A 5IT0A 1U25A 5F8JA 5CCLA 2P6SA 3OT9A 1VBXA 1S9GA 3BYPA 2VG6A 1MSWD 2VJUA 2GQQA 4OLOA 1YZ7A 2AJFE 3Q2SC 3GU0A 1XTZA 2QL5B 2LEPA 1RWPB 1U09A 3Q8VA 4M63A 1H0HB 4IFYB 2UUAJ 1HW9A 3AHPA 2OTJS 2E29A 3BH6B 4M5NA 2I8EA 3HHNB 2DNNA 4UOFA 2KRRA 3TAQA 5KFMA 1WELA 1RT6B 5A2QU 1QTMA 1SIWB 1ZPWX 4OZ2A 1X4CA 4JP8A 2HHQA 2XMJA 3T1YJ 5A8RB 2C2ZB 4WIIA 2PA3A 3LP0A 4E0DA 2V8VA 1QUVA 4NZ6A 3Q83A 3IWXA 2IBOA 3EDRB 2KYZA 3FFIA 1RT5B 1KONA 2OKQA 1M1HA 2VJVA 2ADCA 1RJJA 2HLTA 4LF2A 5IXUA 3TAPA 4QIEA 1JLEB 4I6WA 5LJ3Y 3FBCA 4FF2A 1QSYA 1JLBB 4FXVA 4ZVUB 5KFVA 3A8EA 4DDFA 4F26A 2CZVC 3I4PA 3HHLA 2Q66A 4RW9B 1S12A 1WOOA 2Z4PA 4LBPA 3QBCA 3LP2A 5ETQA 1UJ4A 1VQ7S 3AA8A 1IN0A 1Q8IA 2ZH8A 5HLFA 8RUCA 2NREA 1T94A 2BJ1A 1DJ0A 1ZA1B 4ZJQA 3T1AA 1NRKA 4XIUA 1RB0A 3IS9B 3VHQA 1ZAVA 5B08A 1YJUA 4CLLA 5F3ZA 2PIIA 4FYVB 2KTQA 2D1CA 1SJFA 3D4JA 1BY9A 2ZM6J 4ZJOA 1ZH5A 4MH8A 3KXDA 4AE5A 3WX4A 1CSJA 1O0PA 2UXBJ 3I0SB 4WYLA 4HACB 2G2OA 3UO0A 2MHNA 2X51A 4JYAF 5C2GA 3ETOA 1WF0A 5KFFA 1Q8BA 3KUGA 4FNIA 1R0BG 4JI7F 1L3VA 1ZTTA 4LF7F 5F41A 4ANCA 3EVOA 2VFUA 4O3OA 2EFPA 1U26A 2VA3A 4AFFA 4NEZA 3ZZZA 1S7HA 3UVJA 4I68A 1FD2A 3PNIA 1VIOA 5A8KB 1PILA 1QSSA 3DLEA 1J5OB 2SXLA 4NA3A 3OUYA 2XY6A 5LL6d 3NWGA 5ETSA 1Q16B 1F3FA 3BQ1A 1ZM9A 3SBMA 1S6PA 1XBWA 3O3LA 3UW1A 1Y0HA 2RHQB 5C42A 3MM9B 4ECUA 3H5UA 1S9EB 1NNDA 4NXNF 3CD5A 3GV5B 2R2SA 4YOEA 1P1LA 2E9TA 2IAJA 3KHHA 2DR7A 4DPWA 2AEMA 3ZZPA 1VHIA 3JSRA 4J9LA 1HNVA 3MUVP 3ZC4A 4PAAA 1WG5A 1REVB 3PHEA 3R1LA 2QSWA 3G82A 2ZC3A 3CULA 2RMLA 2DRAA 4IFVB 3KNAA 1Q8KA 3NMRA 4WPAA 2POKA 2XWXA 1WC1A 1TQLA 7AT1B 1EP4B 1ZBTA 1T9VA 3FJ2A 4C0OC 2HHVA 3PVXA 2CNOB 1TK0A 4W90B 1BHNA 2EKYA 3NAHA 5K5MA 2IPOB 5KFGA 1NH8A 5GAEU 4EU0A 1RAEB 3EVWA 5CYQA 3LP1B 4X4OA 1WEYA 4EK2A 3Q23A 3EDQB 2AX0A 2YNHB 4KBIA 4J9NA 1IWAA 1I51B 2CJXB 1S0VA 3GZ7A 1MU2B 1NK4A 4P9SA 4H4MB 1MW7A 1EKRA 1MWZA 3M2RA 1TKDA 4J5OA 4RNFA 4PWDA 1A0OB 2ZJPQ 4L3KA 4OYWA 2V9WA 3P6YC 2W2QP 2XSFA 3FNNA 5A6PA 3BPDA 4GO7X 2FVCA 5BR8J 3F73A 2VPWB 2XG8A 5JMNA 5CHCB 1X5OA 1P8GA 4DLGA 4LF5F 1RAIB 4C8YA 4OI4A 3RBZA 2ZE2A 1MN9A 3AODA 5LMUJ 2ZBCA 3WX8A 4ZPAA 3QRPA 1PBAA 1HQEA 3OSNA 3THVA 3KK2A 4WXOA 1N6QA 4X4TA 1SH2A 2Z2LA 2W9BB 1U1QA 3H5XA 1SKSA 2EC2A 4RPFA 2AJ4A 1RWMB 3UFCX 4PXEA 1TL3B 3N01A 3OTCA 3Q89A 2BJ9A 4R0EA 4I56A 1K47A 1XNRF 3D9BA 1DTTA 1NPPA 2ZBPA 6AT1B 4PUOA 4OFZA 2KT5A 3QIPA 4HHUA 2L9WA 4OZJA 2A18A 2N82B 2D69A 1Z2LA 1IUJA 2FLLA 2DK2A 5IM0B 4NYOA 5IQ6A 1FFSB 2R8HA 4RNNA 1RHJB 4JI3F 2VPXB 1XMOF 2C3MA 1HKAA 2WTFA 3JQJA 1P27B 1V9OA 3FEZA 3ZFVA 2R8KA 1X5TA 1VMBA 1DURA 3DOMA 1IJEB 2NSBA 3D0GE 4UOCA 1YITS 5H9FK 4F0KA 2OPSA 1N8RT 2OEKA 1ZM2A 4ZVGA 2HRYA 2P2CB 4I7FA 4C2MA 4NLSA 2K1RB 2M3DA 3TVKA 1R0AA 3DNCA 4J9SA 2A3JA 2WCXA 4Y0FA 2E7WA 3QAEA 3RB4A 4BDPA 2J7WA 4CQ1A 2DGSA 3I0RB 3M9MB 1CJKA 3O8WA 3MAQA 2R8JA 4B3RF 2JVOA 4J91A 1G4CA 5B0BA 1EB0A 3EZUA 4PEOA 2W9CB 2QLWA 1RYRA 4GKJJ 4F50A 3J7A1 4I6YA 2E7VA 4JV0A 2A6OA 2J9DE 3MM8A 5T14A 1FFGB 5RUBA 3M6XA 3G6VA 3D66A 3MR2A 2OFGX 3N6MA 3HSDA 2FJVA 3KDOA 4RO0A 4QWBA 4O44A 1HNWF 4L3NA 2V63A 3K8VA 2VG7A 2X3GA 4O0IA 2FJXA 1VS3A 4OX9J 4ILMA 4F2SA 2FIUA 3IA0A 2J6SA 3PFEA 2ZUGA 1S57A 3QQCD 3TX8A 2KFYA 3RAQA 1HLWA 1TK5A 4CO2A 4DCPB 4Q2MA 3VZIA 2UU9J 3WIVA 1BGXT 4O0NA 2ZHBA 2Y1IA 1OYDA 3SFUA 3KLGB 3JQMA 1RACB 2EBEA 4CWBA 3W66A 4ZCIA 1LXJA 3ZNJ1 3UD5A 4DL5A 1YX2A 4C0BA 2PN6A 1RT2A 4UUXA 2A0FB 5C2CA 3MR5A 2R9LA 2XQCA 3NBPA 3W2VA 4QIVA 3B6BA 3NAIA 4DJBA 5EN1A 2J8AA 4RWWA 2XMUA 4HI1A 2CPDA 4R5PA 1T9TA 5HJXA 1VBZA 2BV3A 1ZETA 4K5SA 4CI0B 1DQ9A 4DX7A 5AE1A 1XQIA 3UCZP 5AXNA 1HMVB 3M8YA 1FEHA 3OL6A 1RWWB 3CCES 4K0KJ 5E33A 1WOPA 3K0JA 4WZQA 2L9NA 2HNDB 4WXWA 1QDUB 2VC1A 3LQVA 3G6ES 1JK9B 2C28A 3MCNA 2FY1A 2FDNA 4UOGA 3FC9A 4CP5A 3CVKA 3UN3A 3V6DA 4DX6A 4YR2A 4WK1A 2F9JA 3WBZA 5A8WB 1L3SA 2HFZA 1S1XA 4A46A 1N48A 3R2DJ 4DV5F 5J2MB 4X64J 3CD7A 4N8NA 5LM7E 3Q8UA 1G1XA 5I3UA 2XC9A 3TEGA 4B08A 1JLAA 1TK8A 1XN9A 2XYGB 2BA9A 1R8AA 4ETXA 2KRBA 3TWZA 2LQBA 1A9NB 5DQIA 1FKPA 4QYZJ 1R8BA 2GIQA 3I96A 2BJ8A 5J2NB 5CCMA 3GJSB 1F3VA 1HQUA 4P7VA 1TKZB 1TL7A 2RHSB 2LU2A 4IG3B 1IVZA 1W7WA 5K8OA 2NPFA 2MQ8A 1L3KA 1UVJA 4IDKA 2B8PA 2AYMA 5IWAJ 4WYWA 4B3OA 3DC2A 1DHMA 4EZ9A 4YHHF 1NJWA 2MYFA 1V3RA 3EMTA 5AE2A 2V8PA 4JV5J 1QAJA 3QO9A 2R7QA 3MOJB 5GVQA 4CO1A 1F2GA 4MFBA 4MYTA 4ES2A 5JUMA 1BMQB 4I2QB 4H4OA 3OLAA 5L8RC 4C3MA 3TYTA 3NNCA 2IYGA 5SUHA 1VLYA 2BE9B 5G0RA 4A48A 4A8OA 4RBUA 3BDEA 3SEOA 1YZ6A 1AXQA 3M9OB 1RTZA 1GX6A 3MD3A 5J2QB 3OD2A 4KSEB 5GAEI 1FXDA 2WW4A 3TRGA 3Q8SB 2F4FA 4QPTA 4NZ7A 3DDNA 1YG0A 4X4RA 1HWUA 2YKQA 4LF9J 5IT9U 2ATLA 5KFIA 2IAJB 5KOWA 3AOAA 2J0SD 2F7VA 4WU3A 4DV6F 1HARA 4KE5A 4ZIWA 1SJRA 3RU0A 3LALA 2C3YA 1HNVB 3FRZA 4ZHRA 2C3UA 4Q2LA 2WONB 5DM6Q 2YKPA 2JHEA 3QJLA 1PC4A 1N0UA 2XY7A 2HHWA 1B3TA 2XHWA 2NCKL 1WF2A 4EYIB 2P5VA 1U8SA 4LMZA 4CLTA 2U2FA 4DG1A 3E2EA 3PM9A 2XI2A 2QO3A 4PPDA 2Q79A 3N9UC 2RQMA 3W9HA 4OI6A 4RX6A 4I0WA 3W5ZA 1B64A 3MOZA 4U67Q 3JTOA 2HQFA 3ZTOA 3PYDA 3HT0A 2DH7A 4RW6B 2ABYA 1U1MA 5KFZA 2GJIA 1CEZA 3OQ2A 2FZKB 2J9EA 1J5EJ 3T1HJ 2JLGA 5K8MA 2OPQA 1S76D 2DB1A 1KQFB 2QEXS 2HHUA 3LWMA 4AT1B 2IJNA 2FJDB 1LWEB 4ECRA 2HSEB 3V81A 3LANA 4KPCA 1V3ZA 2OMOA 4FYDA 2KM8C 2DO0A 3AOBA 1N32F 2AT1B 4QZVB 4BWMA 1UZDA 2FD2A 2HHHF 2BRKA 3FBFA 3SCJE 3D67A 2WK4A 2DGTA 4NLVA 5KG7A 1IR1A 2FUG9 2FHOB 4CIOA 2BQ3A 4N8OA 2EW9A 1KKHA 2YWWA 3SDEA 3W2WA 5K14A 1RI7A 2LQ5A 3NWRA 3MGJA 1RCOB 4DL2A 4Y6IA 2LA4A 2L48A 1S1TB 2CPHA 1YRTA 3DHWC 3UI3A 3Q8PB 3R7SB 4M5LA 2VDHA 5IS2A 3VWSA 2XI3A 3NG8A 2X1GA 5T7LB 1HWJA 3VGSA 2KJVA 2V0NA 3CCZA 2CPYA 3KK3A 1BWVA 3QIPB 1AUSL 1H74A 2YNGA 1HNXJ 2CJAA 1AW0A 3JQKA 3LOUA 2E1CA 2ZOMA 4W92B 2O1PA 1WJ9A 1M1GA 2RDDA 2EK6A 3NOGA 4JI6J 1RABB 2QIFA 3M1VB 2YPZA 3BN7A 1Y5IB 2DEIA 2E1AA 5KFQA 4B9NA 2KXHA 2DNPA 4K4TA 3CPWR 5JVGQ 1S1WA 3QT8A 2HZCA 2EG1A 4PABA 4C11B 1LK7A 4PWUA 2UXDJ 4RNOA 1UMJA 3MDFA 2IFXA 4OZ3A 3BBFA 1VOMA 2DHSA 2CNKB 1E6YB 3IRWP 4ECXA 1O6XA 1PAUB 2FVSA 2XO7A 2IRXA 2YNFB 4DPXA 1RTJA 2LECA 2IM1A 1Y3JA 3IBFB 3GJQB 4CT8A 2R7UA 3MCSA 3M6VA 3MMAB 1YHQS 4PCQA 4YQWA 2CFXA 2FC8A 2HFOA 1JKHB 1XERA 3FZ2A 3KMSA 2BQRA 3QFHA 4B3TJ 5LXRA 2VD3A 3NGUA 4N5SA 1VRUA 2YTCA 3KOAA 2HQDA 3HZEA 4XAKA 1WUUA 3JAMY 1XJWB 1S0NA 5F8GA 5DJBA 4FVCA 4B17A 4DV0F 4DL7A 2DRBA 5AJ3J 4UUWA 2JNJA 1HI8A 2H5JB 3O6QA 1EQMA 3UWTA 3LA0A 3OFEA 4FBTA 2NUUG 2HQIA 1VJWA 1VQPS 2LEBA 1AFIA 1URNA 3D3BJ 2Z0GA 4URQU 3IGNA 1N33F 5KFYA 2M0GB 3F56A 2GW8A 1MNEA 3MAHA 3RG6A 2MKKA 2CNNB 4ECVA 2W2PP 2YY3A 3G6YA 3W2VB 3I5CA 4QR2A 4OHZA 4K4XA 2WVFA 1RLCL 5IFMA 3K17A 5CYMA 1T3OA 2M2BA 4IRCA 2B0GA 4OYZA 1U2CA 1UFWA 1SUQA 1KR4A 1TUVA 1KOHA 1WTBA 4J90A 3HO1A 4DV7F 2UUBJ 1H2UX 3CDBA 2B7CB 3NS6A 1UVIA 4Q8FA 4P6QA 4USVA 1N36J 4I1TA 1S0MA 4KO0A 3LF0A 4YR3A 4HEA9 1FKOA 2RUSA 2Y8WA 2YKNA 4OX7A 5B0EA 3V6DB 1U1RA 3BDPA 3DHXA 4QPXA 3HVTA 4OQJA 3NNHA 3UCGA 1FRMA 4ZVSB 2LLZA 3RRGA 4KKOA 4ID5B 3M2VA 1H7WA 5KFNA 3V6HA 2RQCA 2U1AA 4LUBA 3DRYA 3FSXA 2HLUA 3GP9A 3QSYB 3TP2A 5EGYA 1KBRA 3FMWA 2IRUA 3CMQA 1RBLA 3FKBA 5ITHA 1FKPB 2KT2A 3KK1A 1U2RA 2M8HA 5K8NA 4YB7A 1NKCA 4WJBA 2FZGB 2B51A 1UCNA 1PYOB 2DCLA 1DFDA 3MEEA 2VPYB 3PRDA 3HVAA 1B0TA 4CTAA 2MGZB 2EC0A 2PA8D 2G0IA 2EWHA 4UTGA 1R43A 2EFOA 2AGPA 2VOPA 3OVSA 3QFWA 1QAIA 3UQSA 1LFWA 3SV4A 1PKUA 4C9DA 3DDKA 1S5ZA 1RKIA 1DAXA 4KYZA 5H1SV 4QJVA 1HQ2A 1VGYA 3CCTA 4DCOB 4LFAJ 3H40A 3QMQA 4PR6A 1HFEL 3AQOA 2WSEC 2VKZG 4V19X 3KFWX 5C7PA 2W24A 2HS4A 3GFZA 4ERDA 2GO9A 4O4GB 5HVHA 4P2SA 4NEYA 4DFPA 1YWXA 2GZOA 2G0CA 4ETZA 3RRKA 5M2RA 1SJ4P 1ZOTA 4C3KA 4LR8A 3VGTA 4USJC 5I3PA 2PI5A 4JI0F 4EWTA 3ZNUA 2XULA 1RAJA 1RISA 1WOSA 2YNIA 1HWLA 1JJCB 3D7SB 3DOLB 3BN4A 3AD8C 1HBNB 2MLXA 1H6KX 2GX8A 4FF3A 2CQHA 3M4XA 3OVBA 2MTLA 2GAHC 4ED0A 1ZAWA 1LV5A 2DGUA 4LF6F 4FF1A 3T5KA 1FJGF 2ZBQA 4GO5X 5F0UA 4MKBA 1BQMB 2YVSA 2IM0A 4G65A 2CDRB 3MEGA 3KNGA 4OI0A 4HT7A 4WTYA 4I67A 1K0TA 3AJ2A 2ZBRA 1TV6A 1U47A 1TFYA 1Y7PA 2C2RA 3DRRB 3VALA 1TTHB 3LTOA 2ACMA 1X8DA 4MIBA 1IQTA 3FCHA 4F02A 3O44A 3ISND 2DXEA 3F0NA 1DLOA 1YJ7A 3PHTA 4NXMF 1EX8A 4I4BA 2YWKA 4A8KA 4DV3J 3KUEA 3WZ0A 1EQ0A 2DNRA 3CE8A 1U4BA 4AQYJ 2G2YA 3I55S 3TO8A 5LSOA 1M5HA 2XSJA 3BEGB 2VQFJ 2M8DB 1UVNA 4DX5A 4IKAA 4ECTA 1T05A 1NKBA 1Q86T 1GXTA 4OYPA 3AD9C 2JL9A 2CQ4A 3IXQA 1PO6A 4OHYA 3FGVA 1XNQF 1RTIA 1VQMS 3HSJA 2EPIA 3IFEA 2Z2MA 1FTCA 2V94A 4JI4J 2N3OA 1N5YA 1SJ3P 1IKYA 2QC3A 1IKXB 1F9EB 2VFTA 3NGDA 3DLKA 3NXZA 3M8RA 3VV2B 1RT3A 3H59A 4HVZA 1W25A 1QE1B 1PYSB 2EI5A 4LR9A 1U2FA 4X2BA 5ETVA 3GQCA 2IRYA 4TYAA 3OVAA 4FVMA 3KK3B 3FUYA 4MKYA 2MZTA 1CULA 4M5JA 3KHRA 2YNGB 3BGOP 4KRWA 1U0HA 4O4RA 2VPZB 2CVEA 3CIMA 3A1YG 1HNZF 4Q8EA 3ZTPA 4B9TA 3HPOA 5D6GA 1XMBA 4ZS6A 3RR7A 5DZ6A 4TY9A 4KIAA 4AXJA 1R6YA 5KFBA 4DV2J 1AB8A 5LOQA 1VFJA 4IG0B 5DLFA 4NE9C 1U1PA 1S1WB 3MI7X 4IRKA 4DLEA 2XO6A 2ZEJA 2ZD1A 1HYSA 1X4HA 2VHGA 2GHPA 2KHDA 2GVDA 2F63A 2NZ4A 4NCGB 3FCVA 2KU7A 2QMXA 3VAMA 3NEKA 1RAAB 1SC3B 4QU7A 4EFAC 3TA1A 4NLGA 5HROB 1IBKF 2V8HA 2YKMB 2YX4A 2MSTA 3P5TL 3MMCB 2YXLA 2C2NA 2B4PA 1BWEA 2DNZA 2OJ3A 2B9WA 2V8GA 4RNHA 1QVGR 2ROGA 2ZH1A 3QRRA 4OLPA 3THTA 2QV6A 2B4UA 1WSVA 3AD7C 1S1UB 3HHEA 1G2EA 1KLMB 3MZIA 5IOLA 3LUYA 5DG8A 4NASA 3R5GA 1T9UA 1UFKA 2FHMA 4W98A 2FYXA 1SI9A 3GFHA 4TVAB 5HP1A 5KFTA 1VRTA 2HBRB 3BGRB 3EVMA 3KLFA 3PW0A 3OXGA 3RB0A 4A8YA 1WD6A 5H9EK 3OJUA 1U49A 4E8UA 1Q7YT 3V4IA 4AL6A 2K06A 2H65B 1OY6A 4DFMA 4L76A 1OIAA 5K8PA 3ZO7A 2VBZA 4LFCF 2YWFA 1U45A 4I2PA 1BE4A 1YLXA 1NDKA 3QGPA 1NJZA 1IBLF 2HAIA 3CJQA 4ZP6A 2VICA 5KFEA 1S77D 1NZAA 4CDIA 1TKXA 5THWA 1GXLA 4LVNP 1T95A 1JLFA 2ZNZA 3CMAS 4OYAA 4DR4J 1X5PA 4WBFA 3OL8A 1ZTWA 4RKUC 3VAKA 2BOPA 1FKOB 2C2KB 2YKNB 3FK4A 4UW2A 4JI5J 2Y3YA 2GIRA 4X4PA 3CMES 1NB2A 2VBWA 3BGUA 3S1TA 2IHR1 4KKOB 4L74A 1FJCA 2RKIA 3UD3P 3FZBA 2VU5A 3BM7A 3D0HE 2Z57B 3IBCB 1YJNS 1XC9A 1FWKA 1N52B 1FF2A 2KH9A 3CEDA 3KG1A 1NXIA 3C15A 2MQLA 2EKNA 2HFSA 3PW2A 3ADAC 1RHKB 1YSJA 2FVRA 2R8GA 4ZVEA 2DNYA 3PYEA 4G1QA 4BC7A 1GEHA 3PFOA 4GC7A 3T9NA 3C6TB 4X62J 4RW7A 1D9AA 4ELTA 2Q43A 3MM5B 1KNZA 1Q79A 3GWCA 5LSLA 1M5SA 2RU9A 2DGOA 3ZZOA 2WRMA 3MEDB 1K44A 4PWWA 3OR1B 2VG5A 1XR6A 4GVLA 3D6MB 3QT7A 2BE7D 2ZDPA 5LMNF 2WOMA 3IMQJ 5E3RA 2NR0A 1SKWA 3CTRA 3AY0A 1MMLA 3TJAA 2DHAA 4EI2A 2ZH2A 1V5VA 3EICA 3KJVB 4U7UK 1RWXB 2HHPA 2W9AA 1S9FA 2WHOA 2P9EA 2DRDA 1FJ7A 4K7QA 4ZLJA 5KFSA 4M94A 4LREA 1PJ5A 4NZ0A 2KT3A 2K7KA 3C14A 1HIYA 3DLGA 1JB0C 3J7AN 4LSNA 4Y2MA 2DO4A 1FA0A 4M8LA 1JMTA 2N7YA 2HFUA 3OL9A 3KJNB 1KQGB 4K4WA 3B82A 1RHQB 4CH0S 1OY9A 3TEHB 3SSRA 2CXEA 1FFWB 3HI9A 4LT6A 2VKRA 3GIRA 4W4MA 1B4SA 4NLUA 1BLUA 2F4VJ 4M5IA 2A2CA 2E5GA 2W7PA 3OJSA 1X7VA 4FF4A 2MY8A 4A8XA 1YRXA 3NOCA 3KLEB 4WWSA 4JI1F 3LW5C 2RT3A 2JSXA 1VQSA 4IOCQ 3QT6A 4K2XA 3HJFA 1F60B 3OPKA 4DS4A 1Y5NB 2ZHOA 4KGVB 5AXMA 4LRBA 4OJ3A 1Z4UA 5KG3A 3DM2A 5AT1B 2MJUA 4GVBA 2YWHA 2PT0A 1H3DA 5KT2A 1HD1A 1FX2A 2MSSA 1KHVA 7FDRA 3SYZA 1IXKA 3MAAA 3M8PA 2V9KA 3ICLA 4QIFA 4DWIA 1W2IA 2ATCB 2VFRA 4NLQA 1RA6A 5D3GA 4ZP8A 3QJPA 1XMQJ 1DLOB 3QPIA 3ZTSA 1TL5A 4V19J 4KQZA 1RT1B 3KKFA 4LSLA 1UVKA 1FEEA 2BACA 3G9CA 1MROA 1DBDA 4NLRA 4RBTA 4DSKA 4X4QA 1T03B 3CCWA 2ADBA 4O3QA 2E7XA 1Y3KA 3AXKA 3CJ0A 5DDQC 1CS4B 4J9UE 1RTIB 5DG7A 3CJ8A 2GJFA 2CQCA 1VC6A 2HG4A 5HMXA 4F4XA 2XBPA 5L39A 2CKWA 4DS5A 4NMXA 1F5BA 1IKWB 4MT1A 4DV4J 3CDUA 3KLHA 3D0IE 3HDSA 3PX6A 2CQDA 2RU3A 1RTHB 1NZ8A 3BS9A 2Z30B 5ETNA 1QTNB 2GJ2A 2F8EX 3M2UA 4NMLA 5ETKA 1KRPA 2V69A 4KFBA 3TAMA 1FRIA 2WBRA 5FIIA 3DOKB 2BJ3A 4RUAA 2FHKA 3DU6A 3ET6A 1GK8A 4OJ1A 2FHJD 2HBYB 1NK0A 3CXCR 4B3MJ 1WG1A 4F7VA 3VQSA 3AJ1A 3W62A 4X66F 3EPIA 3GB0A 4PKDB 1UWBA 2NPIA 2MEWA 3P45B 2V8DA 4EO6A 2B9YA 4IOAQ 1YVFA 3PO4A 3IC1A 2IM3A 5HANA 4DX8H 4K4ZA 1OYEA 2PO4A 3FRYA 3CB4A 1TVRA 1DTQB 3J7YI 1YDLA 1NB7A 5I4MA 5AXLA 1FERA 2CPEA 5L9XA 1UP1A 2ZD1B 3ENWA 1CLFA 1SV5A 4X65F 1RQ0A 4QR0A 2GVDB 1HBOB 4N56A 3GCXP 4UY85 4R8UA 4C98A 4RW8A 1IKVB 4UY8T 2OSRA 3LWLA 4FYWB 4OZ0A 2WVBA 2DNQA 4F2RA 1KTQA 1HBMA 2HZAA 4K4YA 3QLHA 2MPUA 4P71A 1FNMA 1HBUA 3M32A 1B7FA 3JSBA 3POTA 3R97A 2KI2A 4C48A 1NCLA 4UQTA 5HBMA 2B9XA 4EGLA 1D1UA 1JJ2R 1RAGB 3AOCA 2CQIA 2GV1A 2B6AB 2OFHX 3RBEA 2BE2B 1GMWD 1BQNB 2UUCF 1V5IB 2VV5A 1NBEB 4WFZA 1RT4A 3R9LA 3G96A 3G4SS 3EX7B 1KVIA 4ZVOB 4FXWA 3J81j 3VAHA 1HR0J 3BYRA 2V4JB 5HP1B 1H2VZ 2P6TA 1Q95G 1VRTB 4NLOA 4AD6A 1DZ5A 2MXYA 2O01C 1RTDB 1WHXA 2V67A 1B99A 2NYHA 4RWXA 1TKTA 1CC7A 1N0VC 4EMDA 2R42A 1Q0NA 2IC3A 5BXIA 1W2BR 3BZQA 2IMWP 3IAS9 2I38A 4I2PB 5DDRC 3Q8YA 4TKTA 4JI2F 2YQ3A 3BH7B 4ZOSA 1TFWA 3SQOP 2RAQA 1URRA 4NYZA 2J0XA 2L3MA 2UUWA 4ZLNA 2VQEF 4DI6A 1SL0A 1Q81T 2UVWA 2GNKA 4XDCA 3MPYA 1JLFB 3W64A 1VBKA 2DPIA 3UNYA 5D0EA 3C6UB 4EO8A 2NXEA 2PE8A 4QW8A 2NYIA 1TMMA 3J7ZT 4PRFA 1FDDA 5KFKA 4DF4A 1XR7A 4ER8A 4CLWA 2XTJP 5HQLA 2DHXA 3ILIA 3BV8A 2DYAA 1HNIA 5DGBA 4DSJA 1TL1A 1S6OA 2E5LF 3MM6A 2ZWPA 1JLCA 4D3HA 2RB7A 4CCHA 5HI7A 2QLFB 1PCAA 2BEFA 4F36A 3MTKA 4EBCA 3H98A 1D3WA 2HNZA 1OY8A 5CAAA 5CZXA 2ROEA 4UT4A 3D5MA 3VCDA 1SQGA 5J2PA 2IA0A 1C1BB 2MKIA 3IGVA 3L7OA 5KT7A 2WSFC 2WBMA 2DY9A 1NK9A 2CAJA 2LMIA 3OFGA 3QAUA 1X9MA 1Q8LA 2XLKA 1IBMF 2W1BA 2E5HA 4PQUA 4JI8F 3G8TA 2RRBA 1ZPVA 1NK8A 2HKEA 2D9PA 4OV6A 5C25A 3N4WA 3EGWB 4HR2A 3M8SA 2ZZNA 3EPGA 3JTNA 2H48B 2VBXA 3EXCX 2CZ9A 1E6VB 2AU0A 4YDXA 1TAUA 2Y9HA 3BGFA 1CJTB 3C16B 1OPIA 4KJIA 2HK2A 4WE1A 2CPFA 3W5XA 5CD4A 4A8FA 2R7OA 3PV8A 5KFDA 4EEYA 2MZSA 2DTJA 9ATCB 1FESA 3MUTP 3HULA 3HSZA 2D7SA 2UUAF 1OMSA 1S6QB 3F41A 4RLEA 1RBAA 3M6WA 4DUYJ 3MR7A 1RUSA 2ZZMA 2N7CA 2HVDA 2BQUA 2GQCA 3SQGB 3G8QA 3BBBA 1NEEA 5KG4A 4Q0BA 1RSCA 2PGCA 4FXDA 3GIJA 3T1YF 3DKDA 1VK3A 3H90A 4F25A 3E3XA 2NSCA 4MMOA 1PG5B 1VQ5S 2WVEA 4YY3J 3W8GA 2BXJA 4K59A 5A76A 2I1RA 2DEJA 1HPZA 3NS5A 1X9SA 2V2QA 4ED5A 2XMTA 4J9RA 2KXNB 2C2OB 5ADZA 3A3OB 3PKYA 2V2ZA 2EFVA 4C3LA 1L3UA 1M90T 1WACA 4ZPTR 3V5RA 1Q53A 2F40A 4GVBB 4IO9Q 2W2MP 1S4FA 1SBRA 1VCTA 1OWXA 4J9QA 1W26A 3EM1A 2OP5A 1HWIA 3H4DA 3M8PB 1RT7B 5FDLB 4YEAA 3NLCA 4Q5VA 1CJVB 4DR3J 2CJ9A 1LXNA 3I5AA 4ICLA 3EZ5A 1FKAF 3UDEA 5D3GB 3NGSA 4TY8B 4URGA 4DFJA 3TX0A 1Q7LB 5H9FJ 4TLRA 2ROPA 2UXBF 2RF2B 3PYFA 2O67A 2UVRA 5M2PA 4XPCA 2X1FA 3CCUS 2C42A 2CRLA 2ACYA 4ZP9A 1Q82T 2HVEA 3AAWB 1B0PA 2B7BB 3CJ2A 2XMMA 3OR2A 3KTQA 3GR1A 5D77A 3ZZTA 2Z56B 3IRXA 4QIGA 1WKKA 2LXUA 4KGMA 3HCXA 1IBLJ 3GMGA 1RADB 3NP5A 2DR9A 4CRJA 1N88A 1S7IA 3BR9A 1MWYA 2UUTA 4PG8A 4ZIVA 3NMAA 5DGAA 1R89A 4F3MA 2GGPA 5HK4A 2ZFHA 3PRBA 2AKWB 3MECB 3M30B 2DNMA 3W63A 1LW2A 3QZ8A 1WORA 2XYHB 3W61A 1D9DA 5ETLA 1NDCA 2M88A 1F5CA 1IJFB 4DQPA 2IMOA 1CJUA 2OPPB 4OMFG 4DR7J 2DNLA 4G3IA 2XLJA 1SKUB 4HLBA 2R3VA 2AYEA 4ID8A 6FDRA 2JC0A 1T0TV 2CG8A 1U1LA 2XGQA 1U02A 2C2DA 3KG4A 3JSMA 1DQ8A 1GTEA 4ED8A 3DGPA 2HW3A 5KFPA 1TVRB 4R0JA 1LWCA 2QMWA 3CO0P 1WC3A 4QYRA 5J1EA 1S1VB 2LKZA 2XMVA 1NU4A 3PO5A 3UCUP 3A4TA 2ZC4A 2OSQA 3ITHA 2AGQA 3TA2A 2H3EB 4U8YA 3B8HA 3OFHA 1R7IA 2J0QD 3QNWB 4KHPJ 2CQ0A 2M5YA 1JWWA 1JXVA 2QT7A 3P5BP 4OI2A 3GJRB 4DV1F 3ZZ0A 2C3PA 3FCWA 2HNYB 2MKHA 3JB9k 5BR8F 4LF8J 4NWBA 4LJMA 1L3TA 3MR3A 3DMJA 2MLZA 3M9NB 4B3SJ 4PYDA 3JYTB 4LRFA 4AXIA 2OHDA 5KG2A 2JJ4D 1KQSR 1FCAA 2G0JA 4DR2F 3I5BA 3SSSA 5ETPA 3PKMA 4ALZA 3M6UA 3CJKB 4LR7A 3UN2A 5LMUF 2LDIA 5A2QY 4OZNA 3L95X 1WTFA 3IR5B 4ZVRB 5KFJA 4JOUA 3O1LA 2F65A 3LAKA 3MPDA 2O3DA 2PEBA 2X7IA 1SCJB 4IFYA 1K9MT 4Y2AA 2B4VA 4C8OA 3DYAA 4P75A 1PJ6A 3Q8RB 5KFWA 5F3TA 1U1NA 3US5A 4EUVA 5B7WA 2UVUA 1RT6A 1LKZA 3DU5A 2QYCA 4M5DB 4F4AA 4N41A 3K59A 1VQ6S 5A8RA 1FD8A 2PI4A 2QA4G 4CO4A 4DR1J 3D6TB 3T6JA 1RT5A 4PG4A 4XO0A 4BLGA 2HWIA 3ISZA 1PC5A 2NS1B 4HT5A 4C7QA 4ES1A 1FWPA 4BWJA 4LQ9A 2DIVA 1JLEA 1QAYA 1X4AA 3S01A 1F9HA 3W9JA 1JLBA 2H51B 4ZCKA 4DFKA 1AZSB 4J9PA 2Y1LB 4RW9A 5BJRA 4RJVA 1PGZA 2LEAA 3CSKA 1JLGB 3UDCA 3MM7B 2FJEB 2ZITA 3R5CA 4ECZA 2IIHA 2IJRA 5L9NA 4DQSA 1VHFA 4MKAA 2K8GA 3PACA 2R7SA 4ZP7A 1C0UB 2VB6A 3IS9A 3X3UA 4RW4B 1T9YA 4JV2A 2AMCB 4WP9A 1B0VA 4YB6A 2H9ZA 5KG1A 4GKJF 3PEJA 2AW0A 1YRUA 4NCAA 1TL1B 3I0SA 4LF4J 3MM6B 4XK8C 1C0TB 2JWNA 1KFSA 1Y4ZB 2ZBIA 3DLBA 1TR0A 3T5LA 3D1HA 4P2MA 3AT1B 3TA0A 5KT3A 1MG7A 1C4CA 3K5OA 3NGRA 5ETTA 4U6PA 3GIMA 3ZXWA 2DD8S 3GSDA 3ILLA 1Z2ZA 1GMVA 3UDVA 3MEKA 3IG1A 4OX9F 2BM1A 1BXNA 1UEUA 2RVJA 5D4OA 1J5OA 3ILOA 1K1QA 4GKKF 4M1KA 3T41A 2AEJA 5EWGA 3H20A 1WWHA 3GG1A 1S9GB 2VG6B 2E44A 2UU9F 3R5BA 2AGOA 1UETA 3I4HX 4Y3CA 4OIXA 1K73T 3MM9A 2GS8A 4C8NA 3ENAA 1S9EA 5FLXU 1NSAA 1D9FA 2J7UA 3KJQB 3VQTA 3D1OA 4RL1A 2KDOA 2GMLA 3AH6A 1G7CB 2E1MC 4MTPA 4IO1A 3FQLA 1UJ5A 2PFFB 1N56A 2P8IA 2QJ3A 3I32A 2G4BA 4WF9Q 3HJVA 2QFIA 3I6PA 3PXGa 1AROP 2FPHX 2GA7A 2NXUA 4IFVA 2PFDA 4K0KF 3LP0B 4ZN1A 1EP4A 1BD6A 4I64A 3FFIB 3IM8A 1OJ4A 4LRDA 5GAHU 1YBUA 4OI3A 1VC0A 3PYGA 5L46A 3LP1A 2VF3A 5E3QA 1L5UA 4QW9A 3CCQS 2YNHA 3UNGC 2Y0BB 3SCIE 3X1LB 3H2VE 2BABA 3VAIA 3HHLB 1MU2A 2XZDB 4KHRA 1LNQA 3QRQA 2VDIA 4H4MA 2YQ0A 2ZJQQ 2MQNA 2ZH5A 3BKTA 1SH3A 3LP2B 4X64F 2PC6A 2QA4S 4WIQA 5KFXA 4BC9A 2PMZD 2FHJA 5HLFB 4C8ZA 1MLAA 2AJ1A 2CPXA 3W1YC 1LWFA 1R0CB 1EKSA 3CO9A 5GMEA 1X5SA 4OHVA 2JFDA 3EZOA 8AT1B 3H8YA 2Q3PA 1U8WA 4LVOP 1UEVA 4KR0B 2BM0A 1U7LA 2E1RA 4G6VB 1IR2A 2H5EA 7FD1A 4P52A 3CCRS 1WC5A 2FC9A 2J8SA 4RU9A 4DMZA 2FVPA 3A3NB 4P72A 4FYYB 4WFYA 2ZH4A 3MMJA 4IH6A 4OX6A 2NQPA 2YKOA 4TU9A 4ECQA 4KGZB 4NLYA 2W9BA 3JS9A 3TJ9A 5IWAF 3UVJB 2GAGC 4QWEA 1RWNB 4ELVA 4YB1P 3W9IA 4H4KA 1Y11A 3DLEB 4AYBD 5AE3A 4JV5F 1TP7A 5GADU 1FVQA 3OUYB 2VH7A 3PZPA 3TVYA 2L9DA 4L73A 1S6PB 2JRSA 2H54B 4B9UA 3K8WA 3NRBA 5C42B 5IM0A 4TXSA 3SSQA 4QQBA 3BR8A 3PJXA 4DUZJ 1GXUA 1XWLA 3NGKA 4DN0A 4P2XA 2R7WA 3PY8A 3H4BA 3H5YA 2ASLA 1U24A 4ENOA 1RAFB 1ACMB 2VQEJ 1FRLA 4TN2A 4NI2A 4HKQA 2Y0SD 1UJ6A 3CDWA 3G82B 2EXUA 2CDQA 4M95A 4O3SA 4BBYA 3GPAA 3QWPA 3OTOJ 4LF9F 2C3OA 4S0MA 2VASA 2Z2YB 1MN7A 1JLQA 3I0RA 4X4UA 3RYLA 4NA2A 1NPRA 3VR1A 3K5LA 3PRVA 2DGQA 5CYQB 1IBCB 5KT4A 1RK8A 4N76A 2K3IA 5D78A 2FLPA 2BKPA 4FYXB 2E5LJ 5F8NA 2HYIB 2ZUAA 1WC6A 3D28A 2E1PA 2ZZTA 4BS2A 2HVIA 1VQ8S 4JB8B 1IQZA 2OH2A 4TNOA 1UEKA 3R6LB 3C3LA 3M2RB 4UOHA 4FKXA 2MQMA 4PWDB 4K4VA 3JSMB 1M5OC 4K2JA 2ZWOA 4KGXB 2DR6A 1WC0A 4PXCA 1LWCB 2HPUA 3K58A 2G2ZA 1N5VA 1J5EF 3T1HF 1U6ZA 4X84A 1KOOA 4Y2IA 4HDGA 1YJTA 2DH9A 1S72S 3WDOA 2ZE2B 5HO4A 2PD1A 2FJBB 2HIYA 2JEFA 2LYVA 3K5NA 3KLGA 3VTIA 1HQEB 4DSLA 5FLXY 1R3NA 3KK2B 1TU0B 3TNVA 1N6QB 1KD1T 3EGNA 1H72C 2AV5A 2JH3A 2OD4A 3E01A 1HHTP 3BO4A 4MAKA 2EBGA 1BC6A 2BW7A 3IO1A 1S0OA 3S8SA 3LGMA 3M8ZA 1RAOA 5D0HA 3TARA 1M0SA 1DTTB 3Q0AA 4PUOB 2QZ8A 4WP8A 1HMVA 1FI4A 4XDDA 1NSKL 3CCLS 2A1BA 3TW0A 1VK8A 4I69A 2RNEA 2W4CA 2AJQA 2FY8A 2UP1A 2HNDA 3H2UB 3DGVA 1RAHB 1HA1A 2W25A 3BF4A 1VRQC 3DYAB 4X4SA 4B9MA 3MMBA 4DHVA 5KAKA 1NJYA 4E2FB 3GIIA 3DOMB 5K9FA 1I5OB 3MPUB 2OPSB 4AL5A 3RZAA 4I7FB 5A8WA 2OI2A 5CH7B 2OD6A 3TUIC 2KYXA 1IM4A 4A8SA 2LXFA 5LXYA 1D09B 3PIPQ 1R0AB 4DSIA 3WC0A 5J2MA 5L1KA 4KH0B 1HNXF 3HD2A 3A13A 4K4UA 3V2UC 4DN9A 3OTEA 3HVWA 2HMIA 4ED1A 2R4FA 4OYBA 1CJKB 3FDSA 1PSDA 4F4KA 3FMBA 4Z7YA 3D6HB 4USHA 4USTA 1QM9A 4JI6F 2JX2A 3HFKA 1VIXA 5J2NA 1QY7A 5BYSA 2MZRA 5D8HB 4URSA 3QIDA 3R3TA 2CQBA 1TKZA 2DNGA 2HS3A 3MM8B 4IG3A 1GFWB 4JYAJ 1HL6A 1RP5A 3CUNA 1WHVA 2UXDF 4DPUA 4JI7J 5F9NA 1VQ4S 2EVZA 5J1NA 4LF7J 4O44B 1ZS6A 4ES3A 2JVRA 2VG7B 3HLUA 1RU2A 1RHMB 1P9QC 4CO0A 2V50A 1T7PA 2YQ1A 1OO0B 4HTJA 5HMWA 1UPPA 1VDHA 2Z58B 3RBDA 2QLXA 3IR6B 3VGUA 4WFNQ 2QSFA 4JV1A 5G4DA 4ED2A 4I2QA 4DXLA 2R7XA 2RRNA 2BANA 2ASJA 3C66A 2EG2A 3RGIA 4B3TF 2HGNA 3KLVA 1TAQA 4NXNJ 1MWQA 5IT9Y 1RT2B 3IG1B 2CWXA 1S97A 4RR5A 5F8HA 2FGOA 3NBPB 2HHXA 4ILLA 3SCKE 1GX5A 1BQXA 5AJ3F 5GAHI 5J2QA 4R5PB 3EXYA 3L7UA 3A8KA 2WB4A 3CCJS 1LFPA 3BSOA 1NK7A 1REGX 4K4SA 1I3OB 2ZOFA 2AYGA 4YDDB 4A8WA 1F1BB 4RUCA 3BJYA 5L1IA 1G6BA 4WZMA 3CIZA 1V3SA 3W8PA 1UZHA 2B8QA 2DKOB 3HMJG 2XNQA 4ZMMA 2W7OA 1J27A 2WONA 3UE2A 1KHWA 2EFGA 4HL9A 2H4YB 3DFEA 2UUBF 1Q4RA 4NA1A 5KT5A 3Q2TC 4TQSA 1RU1A 3QYYA 3BREA 1S1XB 1AFJA 1N36F 5JVHQ 2K7JA 3NCQA 2BJ7A 5I3UB 3SIPB 1JLAB 5DS7A 3NCPA 1EAYC 3K7RA 2WW8A 1T02A 4PG6A 1WSRA 4RW6A 3AB4B 2DNHA 3L7PA 2XY5A 1SJQA 4IH5A 3HX9A 4RUBA 2RS8A 4LF5J 3RBXA 1SL2A 1WF1A 3DN9A 2XHCA 3CD0A 5DDOC 3VVUA 1HQUB 3BQ0A 2QA2A 1LWEA 5HVFA 2AYBA 5GADI 1TL7B 4HH1A 4D3GA 3QGIA 4MK9A 1FDNA 1LWFB 1Y9OA 4DV1J 4ED4A 3L9ZA 1WHYA 4IDKB 1N54B 2QLJB 3BB5A 3R5DA 3W3SA 2F9DA 2LDYA 2BZ2A 2P9CA 2W4DA 1PBUA 4B3OB 3P96A 3MFHA 4DQRA 2NXCA 3G6XA 1PJ7A 4DR2J 2B5JA 2DNKA 3OFFA 1NLKL 3QO9B 1NHVA 1XNRJ 3AJDA 3I31A 2CQGA 4Y28C 5HAOA 2CQ3A 4MFBB 4LQ3A 3GJTB 4OL8A 3NNAA 3PJ9A 4DZ6A 4H4OB 3M8QA 1S1TA 2MHEA 4JI3J 4LBIA 2RDIA 5G0RB 1XMOJ 2MLYA 2CUYA 5KOXA 5I42A 2M9KA 5T7LA 1WKLA 2XS2A 2H4WB 1UA0A 2OUGA 5KFCA 3VVTA 2VUGA 4OYXA 2E66A 5E41A 3EYZA 3GYGA 4LFAF 2D41A 5B0AA 2WVDA 5D0RA 1AA1B 1R8CA 3KUHA 2CQ2A 4OZ5A 4ECYA 1R8PA 1WKJA 1N5SA 4N77A 3R1HA 2JLFA 2RH3A 3A12A 4DF8A 4LRCA 3VGVA 1P6TA 3D54A 2KG0A 3JTPA 2KXFA 4ZHRB 3M1VA 1O51A 4B3RJ 1UAWA 3K5PA 4ZPWR 4NI2B 3PR4A 1YBTA 3DXBA 4NLTA 3WIUA 2DVIA 4B9VA 4DSFA 2QLBB 1HW8A 5F8MA 4A8MP 3GTYX 2IDLA 4C11A 4DG1B 3S6EA 1JLQB 3GLJA 3FQKA 2CPZA 5DM7Q 3TZWA 3OV7A 1HNWJ 3CJ5A 1E6YA 2LP4A 3R8YA 1FNXH 4MJKA 2BVZA 2OEMA 1HHQA 4ZPDA 2HEKA 2DITA 2JC1A 2WVCA 2YNFA 4F0MA 5DO2A 3R6GB 2OPQB 2DISA 1UVLA 1IR0A 3MMAA 4P2FA 4NLXA 1KQKA 2OIHA 1A6LA 2QL7B 4GMKA 4IQXA 2HQ3A 1JKHA 3V81B 2VZ9A 2ASDA 2XMKA 5H9EJ 1N5QA 4CNYA 4JUZA 2CJKA 3OHAA 2C1EB 3ETMA 4ZCLA 4CH7A 4GKKJ 4DPTA 1C2PA 3TQ1A 3R7NB 2JZ5A 1M1KT 3CCVS 1FTRA 4FKYA 3A3PB 2CJBA 4DV3F 1VQKS 5DQHA 2E9RX 3SDEB 3W2WB 5K14B 2CPJA 4AQYF 1C1CA 4NPOA 1WDTA 2VQFF 2DIUA 3E01B 3N5FA 2PMHA 1QAXA 1PYTA 5F8LA 2XGPA 3MCMA 5KTQA 4FPIA 1N34F 1JXEA 1UFLA 1RZMA 2VFVA 4KAIA 1RWKB 2LXIA 1OPZA 2N4CA 3QSIA 2CIMA 2RQKA 4I6AA 4ZA1A 5FD1A 4KY3A 4WU2A 4ED7A 4JI4F 1J2VA 3MCOA 5HMYA 5DETA 4DV5J 5FJ4A 4YUDA 5GAGU 2DGVA 1KTVA 3B4MA 4LF1A 2R8IA 2CZ4A 1EZZB 2KZMA 2RILA 4DR6F 4NLWA 3HKWA 1XIQA 3HK2A 3MMBB 5IC4B 4C97A 3QGGA 5L1JA 1VQOS 3FSIA 4OYIA 1Q5VA 3H25A 1K1SA 3HM9A 3GSIA 3N6LA 3W7BA 3ZZUA 2D3OR 4ID5A 2AHOB 1WG4A 3OBIA 1G3OA 3CCMS 2VOOA 1Q78A 3DRXA 3HT3A 4GC6A 2CYYA 4WFBQ 2HMIB 1F5AA 2ZH9A 1IM6A 2AP6A 2XNRA 3BO2A 2VONA 3ZZYA 3MXHP 2GFFA 2LQJA 5EDWA 3PR5B 2K2PA 6FD1A 5DDPC 3MURP 1SKRA 4J37A 1Y10A 3G71S 1FE0A 4DV2F 3LGNA 3ZTQA 3TZYA 3IWNC 4YHHJ 3R2CJ 5M2UA 3BQ2A 1RTJB 2QTWA 4USIA 4K50A 5A0YA 4G1IA 2L08A 1RXOB 3KHLA 5IC6B 3UR0A 2KKHA 4U96A 4M5GA 2MGZA 5A6WA 1RDRA 1T9WA 3SFGA 2DY1A 2NZCA 2FJWA 1IWGA 1VRUB 4CM0A 2VBYA 4KHMA 2YWEA 2M70A 3MUMP 2ZH6A 5AXKA 1KEKA 3J7YU 3G86A 2WB1D 1GNKA 3W5YA 1TL4A 1M5KC 3KG0A 2RD5C 3PW5A 2BANB 5B0FA 3UR3C 4IOBA 3ZZRA 2AX1A 2OEJA 3SXLA 3AB2B 3H0PA 2XMWA 2XS5A 1NAQA 4ZDNA 2R2RA 3JAMU 2FVQA 2EEYA 4Z2XA 3PJWA 2JOQA 2X1AA 4DV6J 2AZ1A 3W65A 2V5HG 1H7XA 2CADA 5CYMB 2DHHA 5E7OB 2HRTA 4O4GA 1SUQB 1VQYA 1SC1B 3EJMA 3B78A 1FX4A 3WQPA 2N3LA 3RJMB 2PMWA 2CQ1A 4YS2A 2V2KA 2HHTA 4ED6A 4ED3A 4IRDA 4K5RA 2G9OA 1NSPA 5CD4H 3G8SA 2HBQB 1O8BA 2I9SA 3DOLA 4KO0B 1HBNA 5KFHA 1LW0A 3WHIA 1WI8A 3CDEA 2R7TA 2V4QA 3VAGA 4C6AA 3HVTB 2A6MA 3CWJA 5E5NA 1M5PC 1BQMA 3NGTA 3ISNC 4CLUA 2GCFA 2ZDOA 2F5GA 2ZNYA 3M2VB 1X31C 1APSA 3B54A 2KFNA 3MHYA 1T11A 3DXSX 4DR4F 1RA7A 2FTRA 1N32J 3DRRA 1WEXA 3MFIA 3CJRA 3I9ZA 1TUWA 1FRKA 4JI5F 2D3ZA 4OJGA 2HHHJ 4U7UD 4Q7AA 5D4PA 1S4EA 2PEHA 1JNZB 1WC4A 2QYGA 3KK1B 3PX0A 3E8OA 2GQ2A 4ELUA 2OLWA 1YK9A 2O5DA 1NK5A 3P3DA 3F44A 2HQGA 3MEEB 2Z2ZA 2GMHA 1UW4A 2H1YA 2B9EA 2QN6B 4CTAB 4L6V3 4TU7A 3R27A 2JLEA 2I2YA 2A10A 1VYAA 5CZVA 2RSQA 4FS2A 1SL1A 3U1LA 4X62F 2CVIA 4CT9A 1ZZNA 3QATA 3GV7B 2MDAA 1VBYA 2QL9B 2JFKA 2B5JB 1X4DA 4QYZK 2VODA 4N47A 1TUGB 4DPYA 2A2DA 3EE3A 4ZVQB 4U8VA 2DNOA 4YR0A 2MB0B 3G2XA 2DPJA 3MF5A 3PIOQ 3M8QB 4EZ6A 2YH1A 3ENQA 4PPZA 4NOHA 1IKXA 4USWA 2GMJA 3FBBA 2XCAA 1QE1A 3LGHA 5I42B 2UV8A 2DH8A 5B0CA 4WP3A 4NL5A 1R8HA 1QLNA 2OGUA 2ZH7A 1RGVA 2QG9B 2ASYA 4NLPA 3IP0A 4PYAA 2D9OA 2HWHA 3Q86A 2HWTA 5U47A 2BKNA 1YI2S 2YNIB 2J6UA 2GVZA 1YQHA 3LAMA 3BO3A 5IV4A 4WFXA 2R7VA 2FLOA 3IAM9 4IG0A 1I94F 4CLYA 3N79A 4Q45A 2J7KA 3V6JA 3UDLA 2B43A 1GQEA 1ICEB 3MEGB 2MKJA 4DL0C 3T9ZA 2FZCB 3BSCA 2F4VF 3G87A 4IH7A 4O23A 2HZVA 4LIWA 5L38A 1TV6B 1VR6A 4ZPCA 4NCGA 2DJWA 1LQ9A 4O3RA 1U6FA 1FHTA 2LQ9A 2YBVA 4DV0J 3C8YA 1YJVA 4ZN3A 1F9FA 5HROA 3A8JA 2YKMA 5EHHA 5LJ5Y 2FJAB 3MPVA 2XM3A 3QZ7A 1RHRB 1EHWA 5LT5A 3OTBA 3MMCA 1N33J 4U7CA 1WI6A 3I82A 4ZLLA 1YJ9S 1MMDA 3MR6A 3THPA 2DXDA 2XSJB 4NYPA 2D3UA 4ITSA 3I9V9 2FB0A 3DI6A 1S1UA 5GAGI 1F6TA 4LSZB 1T05B 1KLMA 2V4RA 2RIJA 4FS1A 3C46A 1XMQF 5HVGA 1D8ZA 3KMQA 2Y8YA 4V1Ak 2J6TA 2YKAA 3GFYA 4DV7J 1C1CB 1S48A 3BGRA 5HJYA 5CYJA 3BSNA 4F4YA 4E98A 1N5YB 1IKYB 4ZKAA 3DLKB 3PW4A 3RAXA 1JXLA 1QVFR 4QR1A 4F3OA 4DU7A 1RT3B 1HWKA 1N4LA 4F04B 2BMBA 1BUXA 1AYEA 1SIZA 2BYCA 1FRXA 2KM8B 1JX4A 4QU6A 4ZJLA 4M5MA 2BJEA 2FGCA 4KB7A 1CULB 4OHWA 2Q6CA 2G13A 2E5IA 4U95A 1U0HB 1RHUB 2C2MB 4DQIA 4DV4F 4KTQA 3BBCA 5F9LA 1EETA 1RWUA 3QJJA 5KFAA 2WSCC 4TYBA 4Z37A 2OMLA 4P73A 2W01A 4HHHA 4F4WA 3U02A 4IQMA 4P7TA 2HFVA 2LU1A 3OW2R 2Y1JA 1RYSA 1R31A 2Z8QA 3N0VA 4J9VA 5KFUA 2NLWA 3IM9A 1U1OA 4B3MF 3HKZD 4M5KA 3O2IA 5EX3A 1H98A 2MKSA 1HYSB 1KS2A 4L72B 3V4MA 1LOUA 3HFVA 2M7SA 4PQAA 2L41A 3SV3A 3C6TA 3RW7A 1FXRA 3VAJA 2DT9A 2O66A 2VA2A 4G1PA 4HTIA 1NUEA 2LA6A 5B0GA 5SZTA 1LK5A 5A0YB 3P8BB 3MM5A 2D74B 2J76E 5DG9A 2BW2A 2RS2A 2W7AA 3QGHA 5D4LA 4WTOB 2HQCA 4CLZA 3TJ8A 3MEDA 3OR1A 2Y1RI 4UZCA 4LFBF 4KV8A 4PXBA 2BOAA 1RCXB 5ETMA 3GR0A 5CABA 4DR5F 1ITPA 1ULRA 4OV1A 4TQRA 4DEZA 4ZITA 2MY7A 2MZ1A 2XS7A 8ATCB 2HIQA 4ZPBA 4BHQA 1D0EA 5B0DA 2KVQE 3KJVA 2DXFA 2RE1A 3DLLQ 3SI8A
chains in the Genus database with same CATH topology
1YJNS 2CDQA 1XC9A 4M95A 4O3SA 1N52B 3K2YA 2ZBCA 3QWPA 4BBYA 5MLCV 1FF2A 3K57A 1X4FA 4KPYA 4LF9F 2C3OA 3KLFB 2VASA 4ZPAA 4QWCA 2M4MA 3CEDA 2KH9A 3KG1A 3OSNA 1HQEA 2MQLA 2XLIA 3THVA 3PW2A 3SZ2A 2JDJA 3KK2A 2E5JA 1JLQA 1OSCA 4WXOA 3L3CA 1YSJA 1N6QA 2FVRA 1U6BA 4X4TA 2R8GA 4ZVEA 3I0RA 1SH2A 1FDBA 2DNYA 4FNHA 4G1QA 4BC7A 2Z2LA 5KFLA 1JIHA 4X4UA 3V4IB 3RYLA 3KWMA 3PFOA 4NA2A 2W9BB 1U1QA 3H5XA 1C4AA 3VR1A 1SKSA 4GC7A 1VQLS 3T9NA 3C6TB 2AJ4A 1NHUA 4RW7A 3K5LA 2DGQA 4WKYA 5CYQB 4EYHB 1D9AA 1OQ6A 3UFCX 2R2UA 1HR0F 3IN5A 4PXEA 1TL3B 3N01A 3OTCA 1YIJS 2UXCF 4R0EA 1R27B 2BJDA 4I56A 5KFRA 4FZVA 1XNRF 5KT4A 4ELTA 2Q43A 1RK8A 3MM5B 1KNZA 1Q79A 4C4WA 1DTTA 4N76A 2K3IA 5D78A 2FLPA 3GWCA 4PUOA 3PDNA 3UPFA 4OFZA 2KT5A 5LSLA 2HYIB 3QIPA 5F8NA 1M5SA 2L9WA 3D28A 4OZJA 5KG0A 2A18A 2N82B 4BS2A 1Z2LA 2RU9A 2DGOA 3ZZOA 2WAQD 1IUJA 2FLLA 2HVIA 1TKXB 2WRMA 3MEDB 1VQ8S 1X9WA 2DK2A 5IM0B 4NYOA 2F8MA 5IQ6A 2BDPA 2HFNA 1IQZA 3OR1B 2HRUA 2OH2A 4TNOA 2VG5A 3KLEA 3C3LA 4IR1A 3M2RB 2R8HA 4RNNA 1LW0B 4JI3F 4ILRA 1FXLA 2MQMA 2VPXB 4PWDB 1XR6A 4A47A 1XMOF 2C3MA 4K4VA 2RUGA 3JSMB 2ZDPA 5LMNF 1M5OC 2WTFA 2WOMA 1P27B 1V9OA 3FEZA 2QRRA 3ZFVA 3J7Z5 2R8KA 1X5TA 1VMBA 4PXCA 2AF6A 1LWCB 2HPUA 5E3RA 2J9DA 3K58A 1DURA 3DOMA 1IJEB 2NSBA 1V6HA 2NR0A 1SKWA 1N5VA 3D0GE 1J5EF 4UOCA 3CTRA 1U6ZA 3T1HF 1YITS 4X84A 3AY0A 1MMLA 2OPSA 1KOOA 2DHAA 4Y2IA 1N8RT 2ZH2A 4HDGA 1YJTA 1ZAXA 1ZM2A 4ZVGA 2HRYA 4I7FA 4C2MA 2DH9A 4NLSA 3KJVB 3GV8B 1S72S 4YB5A 3VZHA 2RKIB 3OHBA 1MMNA 3WDOA 4U7UK 2ZE2B 2HHPA 2K1RB 2PD1A 5HO4A 2W9AA 2M3DA 1S9FA 2WHOA 3QWUA 3TVKA 2FJBB 2P9EA 1R0AA 2JEFA 4QWAA 1FJ7A 2LYVA 4F8RA 3K5NA 3KLGA 3DNCA 5KFSA 5DQGA 4M94A 5GMKa 3VTIA 4J9SA 1HQEB 4NZ0A 2A3JA 2K7KA 2KT3A 3JSYA 4DSLA 2WCXA 5FLXY 3DLGA 1JB0C 1R3NA 4Y0FA 1YTYA 2E7WA 3QAEA 4LSNA 4Y2MA 3TNVA 3KK2B 2DO4A 1FA0A 2J7WA 3RB4A 1N6QB 2I0XA 1U1KA 4CQ1A 1KD1T 2KVIA 2DGSA 3EGNA 3I0RB 4M8LA 3M9MB 4G1QB 2AV5A 2JH3A 2OD4A 3E01A 3OTDA 4C8MA 5EWEA 1JMTA 5E2QA 1HHTP 2N7YA 4B9SA 3O8WA 3OL9A 3BO4A 2DBBA 1KQGB 4MAKA 2HHSA 2EBGA 5IQQA 1VQNS 1WNEA 4RW7B 3MAQA 5HN0A 4K4WA 2R8JA 3B82A 4B3RF 2JVOA 3U27A 5DLGA 1BC6A 3TVZA 3HHDA 3T5HA 3IO1A 1S0OA 3S8SA 5B0BA 4CH0S 3SSRA 3EZUA 2W9CB 2QLWA 1RYRA 3HI9A 3LGMA 3TARA 1M0SA 4DBQA 1RT1A 4F50A 2CG4A 4LT6A 4I6YA 2VKRA 3J7A1 1DTTB 2PSZA 3Q0AA 4PUOB 2QZ8A 4NLUA 1BLUA 1HMVA 4JV0A 4XDDA 2J9DE 3MM8A 5T14A 2DGWA 2A2CA 3FEXB 3CCLS 2A1BA 3TW0A 2E5GA 2W7PA 5EWFA 1O5JA 3OJSA 1VK8A 4I69A 3M6XA 2RNEA 2W4CA 1X7VA 3R5AA 2AJQA 3G6VA 3CF5Q 4FF4A 2MY8A 4A8XA 1YRXA 2VG5B 3KLEB 2UP1A 2RJZA 2ZH3A 3MR2A 2HNDA 2OFGX 3N6MA 1T03A 3GYXB 3H2UB 2FJVA 4JI1F 4QWBA 4O44A 2W8KA 1HNWF 4L3NA 3LW5C 1HA1A 2RT3A 2JSXA 3K8VA 5BYRA 2W25A 2VG7A 2Q6BA 3BF4A 3DYAB 2WOMB 4X4SA 3HXMA 4C8KA 4MK8A 4B9MA 2X3GA 4O0IA 1VQSA 2FJXA 3RR8A 4IOCQ 3MMBA 1VS3A 4DHVA 5KAKA 4K2XA 4ILMA 4F2SA 1NJYA 3RB3A 3HJFA 2FIUA 1FDAA 1F60B 3GIIA 2P9GA 3IA0A 1DRZA 1ZM3A 3KLIA 2J6SA 5CXTA 3PFEA 4IYQA 5K9FA 2VC0A 1CPZA 2ZUGA 3OPKA 3TX8A 4DS4A 3TI0A 2KFYA 1XK8A 3IBWA 1Y5NB 2OPSB 3RAQA 2ZHOA 5AXMA 4AL5A 3RZAA 1TK5A 4I7FB 5A8WA 4OJ3A 1SB6A 1Z4UA 4CO2A 1YJRA 5CH7B 2OD6A 5E3CA 4Q2MA 5KG3A 3TUIC 4Q43A 2KYXA 1IM4A 3VZIA 3CC2S 4A8SA 2LXFA 5LXYA 2OPRA 3DM2A 3PIPQ 3DRSA 5MAOA 1BGXT 1IKWA 2MJUA 3CD6S 4YMEA 2ZHBA 1R0AB 2Y1IA 4DSIA 2YWHA 3WC0A 3SFUA 5J2MA 5L1KA 2PT0A 1H3DA 5KT2A 3KLGB 2B56A 2EBEA 1HNXF 4RBVA 1HD1A 4ZCIA 1LXJA 4K4UA 3V2UC 4DN9A 2MSSA 3HVWA 3OTEA 2HMIA 1KHVA 1RTHA 2IJFA 4ED1A 3DLGB 7FDRA 4DL5A 4LSNB 4C0BA 2PN6A 1RT2A 4UUXA 3SYZA 1IXKA 2R4FA 2V9KA 3M8PA 3MR5A 2R9LA 3ICLA 3NBPA 3W2VA 3FDSA 1PSDA 4F4KA 3FMBA 3ONQA 3CGIA 4QIFA 4DWIA 1XEZA 3HHLD 1W2IA 2VFRA 4USHA 4QIVA 1QM9A 1GAOA 4JI6F 4NLQA 3AQPA 1RA6A 3NAIA 4DJBA 2JX2A 5EN1A 2J8AA 4NRTA 4RWWA 2XMUA 3HFKA 3DOKA 4HI1A 2MQPA 1S10A 2CPDA 5D3GA 4R5PA 1VIXA 4ZP8A 1KSPA 3QJPA 1DLOB 5J2NA 1QY7A 5BYSA 1VBZA 3QPIA 2MZRA 5D8HB 4URSA 2BV3A 1ZETA 4K5SA 2APOA 3GG0A 1TL5A 4V19J 3N6NA 4KQZA 1RT1B 2BUNA 3I56S 4CI0B 1DQ9A 5AE1A 3QIDA 3R3TA 3UCZP 2CQBA 1TKZA 2K3KA 2DNGA 2HS3A 3KKFA 5AXNA 1HMVB 4LSLA 1FEHA 1UVKA 3OL6A 1FEEA 3MM8B 3CCES 2BACA 4IG3A 1Q1KA 1HL6A 1RP5A 5E33A 3G9CA 3CUNA 3H2LA 1WHVA 1MROA 1DBDA 4NLRA 4RBTA 2IA6A 3K0JA 4WZQA 4ZVFA 2UXDF 2I5JA 4DSKA 5F9NA 1VQ4S 2L9NA 2EVZA 2HNDB 5T41A 5J1NA 4WXWA 4X4QA 1T03B 2QFJA 3CCWA 2VC1A 3LQVA 4H4KC 4O44B 2ADBA 4F3QA 3G6ES 4HYKA 1JK9B 4O3QA 4ES3A 2E7XA 1Y3KA 1NJIT 2JVRA 2VG7B 2C28A 4DUYF 3CJ0A 5DDQC 2FY1A 2YH0A 1NO8A 3HLUA 2FDNA 1P9QC 4CO0A 1T7PA 5I3QA 1RTIB 5DG7A 3CVKA 1OO0B 3FEYB 3RW6A 2CQCA 3V6DA 4HTJA 1VC6A 1DTQA 5HMWA 2HG4A 2BR0A 4YR2A 1X4GA 5HMXA 4DL6A 4F4XA 4RU2A 1I1GA 4WK1A 2F9JA 2XBPA 3WBZA 3RBDA 5L39A 4Y2CA 2CKWA 5A8WB 2QLXA 3IR6B 4DS5A 4WFNQ 2QSFA