2B0GA

Solution structure of drosophila melanogaster snf rbd2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
AQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Solution Structure of Drosophila melanogaster SNF RBD2
rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b0gA00
1WEZA 5EN1A 3THPA 1U1RA 3UCGA 2VONA 1N88A 1N8RT 1WWHA 1X4FA 3G96A 2KI2A 2MKIA 2DNYA 1WHYA 2RS2A 2M2BA 4TLQA 3CCSS 1SJQA 3S01A 3NMRA 4ZKAA 2DH9A 2RT3A 2NZ4A 2MKJA 1WEYA 2DGSA 4Z2XA 3IRWP 2LEAA 1FT8A 4QU7A 5GVQA 2DHXA 5CXTA 2MSSA 4M5DB 1X5TA 1U6BA 2MZSA 1HD1A 3EGNA 3G9CA 1H6KX 1Q7YT 4V19X 4OZ0A 3TP2A 2X1GA 1KOOA 2G1DA 2J8AA 1X5SA 2DO4A 2DISA 2LKZA 2CQ0A 1U1KA 1OWXA 4PR6A 2DNQA 1QVGR 1U1OA 4TU8A 1WHXA 5DDQC 1M5KC 2G0CA 2RS8A 2XNRA 1X4AA 3H2VE 2LA4A 2WBRA 1JMTA 1WG5A 2CQ3A 5GMKa 2FC9A 1VC0A 3UD4P 2ZJRQ 2M88A 5IFMA 1VQ4S 2DNLA 1YJWS 1YJNS 1WHWA 2GHPA 2MQPA 1UFWA 1P27B 3DXBA 2E44A 1M90T 3V4MA 1JJ2R 4OZ1A 4UQTA 1QVFR 2MZ1A 1Q81T 3UCZP 1NU4A 1OIAA 2U1AA 1X0FA 4YOEA 1PGZA 2X1BA 1WHVA 3TYTA 2J0SD 4WF9Q 5DDPC 1UP1A 3J7YU 4F02A 1YJ9S 1RKJA 2M4MA 3CPWR 2E5HA 1X4HA 3CCJS 2JVRA 2MZQA 2N7CA 3TO8A 3BO3A 2RRAA 3SDEB 1WTBA 1ZZFA 2KXNB 2DO0A 2DGUA 3MDFA 2CPEA 2MPUA 2YTCA 3CF5Q 1S72S 3SMZA 3CTRA 4YB1P 4WFNQ 2L41A 3MOJB 1WELA 2CPDA 2MQLA 5H1SV 4LIRA 2CQPA 3CXCR 1X4CA 3VAHA 3VAGA 2RUGA 1FJCA 2DGQA 3LPYA 3S8SA 1YIJS 1JJHA 2HGMA 4PRFA 2B0GA 1NO8A 2LXUA 2XS2A 3VAFA 2M52A 2MMYA 4CH1A 2MZTA 1U1LA 2M8DB 4J5OA 3EGZA 2AYGA 4IOAQ 4ED5A 1DZ5A 2KRRA 2M70A 3R1HA 1WF2A 2XB2D 1XN9A 5GAHU 2BZ2A 1KOHA 2N3LA 1HL6A 3P5TL 2RU3A 1VQKS 2D9PA 1URNA 2MQNA 3CC4S 2MB0B 2DGVA 1RK8A 2DK2A 2CPJA 5MLCV 4U67Q 3K0JA 1FNXH 1VQPS 3S7RA 2EVZA 1YITS 3JB9k 2DNKA 2VOPA 2E5JA 2X1FA 1FHTA 3P3DA 4YUDA 2HGNA 2MY8A 2MGZA 2DNNA 3HI9A 3CMAS 4F25A 2D3OR 1NJIT 1A9NB 3H2UB 2JWNA 1SXLA 2ZJQQ 3UWTA 2F9DA 3MD3A 1DRZA 2BOPA 4FXWA 3CCVS 3P49B 3D2WA 3CCQS 1BY9A 1U1MA 1F9FA 1S79A 1VQ6S 4BS2A 2M0GB 1M1KT 2KVIA 1PO6A 1X4EA 2MJUA 3G8TA 1VQNS 4QQBA 2DGXA 2CPFA 2RRBA 1VQ5S 4IUFA 2KRBA 1H2UX 2LXIA 1SJ4P 4WFAQ 3L3CA 2KM8B 1FJ7A 3CCRS 2JVOA 1P1TA 2F9JA 2YKAA 2LYVA 4Y0FA 3RW7A 2U2FA 1W2BR 2ZJPQ 2DNRA 5ITHA 2KH9A 1D9AA 3VAIA 4UY8T 2MZJA 1VQ7S 5D77A 2VODA 5LXRA 1DBDA 1QM9A 5HO4A 2MSTA 1X5PA 2KU7A 2MJNA 2K8GA 4C4WA 2E5IA 3NS6A 4CH0S 3I56S 2FHOB 1K73T 1VQ8S 4FXVA 1A7GE 1AUDA 2CQBA 3CCES 3CULA 2NLWA 2KG1A 3MUTP 3CC7S 2L08A 2SXLA 3ZZZA 2X1AA 5IM0A 3PIOQ 2OTLS 2KT5A 2DGOA 3ULHA 1U6FA 3J7ZT 2MQOA 2CPXA 2DNHA 1VBYA 5JVHQ 2YH0A 2MKKA 3VAJA 3OW2R 2MKSA 2AYBA 2XS7A 3UE2A 1M5OC 1WG4A 1U1QA 2G4BA 5DETA 2RQ4A 2MKCA 3P6YC 5GAGU 2A3JA 2M7SA 2N3OA 1KD1T 1H2VZ 2EK1A 3G4SS 1FJEB 4ERDA 2AYEA 3ZZYA 2AD9A 1UAWA 2MYFA 2J0QD 4WKRA 2M8HA 2YWKA 2KYXA 1K9MT 2XSFA 2GO9A 1X4BA 2CQDA 4IOCQ 1R8HA 3FEXB 2OSQA 3CC2S 1M5PC 4W90B 2YH1A 2MHNA 1X4DA 2MQMA 5LJ5Y 3PIPQ 3G71S 2UP1A 2DITA 4QPTA 5DM7Q 5DDOC 1ZZNA 3NNAA 1SJRA 2LQ5A 2LECA 2DB1A 2DNZA 2JRSA 1SJFA 2KXFA 3MUMP 3VAKA 2DNMA 2AYMA 1KQSR 4C7QA 3THTA 2DHAA 4TU7A 2D9OA 5HL7Q 2LCWA 3MURP 4QU6A 2F3JA 2LA6A 1M5VC 2MGZB 2OIHA 4CIOA 1U1NA 5DDRC 3NNHA 2MZRA 3UCUP 1JJ4A 3U1LA 3MXHP 4A8XA 5LSLA 1HD0A 2DHGA 3BEGB 2KM8C 5GAEU 2E5GA 5GADU 3G8SA 2O3DA 2EK6A 1DHMA 1O0PA 2MXYA 1H2TZ 1WF0A 4LMZA 2I2YA 2ADCA 1VQ9S 5BJRA 2QEXS 3NS5A 3S6EA 2DGTA 1U1PA 3B4MA 2Q79A 1N54B 1U2FA 3CCLS 2MQQA 2CQGA 5LJ3Y 2CQIA 2CQ2A 2CPZA 2JX2A 3EX7B 3UD3P 2ERRA 4P6QA 1VQMS 2CPIA 2DH7A 4WFBQ 3US5A 1X5OA 3BS9A 3CUNA 2OTJS 2CQCA 1K8AT 2J76E 2OJ3A 3CD6S 1D8ZA 3Q2TC 1FXLA 1L3KA 3SXLA 3R1LA 2KFYA 2LMIA 3G6ES 5CYJA 4TU9A 2CPYA 1VC6A 4PKDB 2QFJA 4W92B 3IWNC 1WF1A 2RVJA 4Y00A 3VAMA 1N52B 2L9WA 3NNCA 2DGWA 1YWXA 1WI6A 2CQ4A 2DNPA 2M9KA 2XS5A 5JVGQ 3U1MA 5CA5A 5LXYA 2DH8A 2FPHX 1G2EA 1UW4A 5IQQA 3HHNB 1HA1A 5IM0B 3CMES 2VOOA 2PEHA 4IO9Q 2ADBA 3MUVP 5FJ4A 4WCEQ 1YI2S 1VQLS 1B7FA 1OO0B 2OSRA 3SDEA 3VF0B 2CQHA 5DM6Q 2CQ1A 1Q82T 3FEYB 3I55S 3MI7X 2RQCA 1WG1A 1KC8T 2FC8A 1FO1A 1WI8A 3VALA 4CQ1A 1IQTA 4C0OC 3BO4A 1YHQS 3LQVA 4WIIA 1VQOS 3N9UC 2CPHA 2XNQA 1X4GA 1ZH5A 2DIVA 2CJKA 2KHCA 2RNEA 2HYIB 1Q86T 2DNOA 2HVZA 1VC5A 3RW6A 4F26A 1WEXA 1VBXA 3DLLQ 2KG0A 2MKHA 5LSOA 2FY1A 2KXHA 1R8PA 2DHSA 2K3KA 4EGLA 1OPIA 2MY7A 4RU2A 3CCMS 2LEBA 1CVJA 5D78A 2KN4A 2DIUA 3BO2A 2V94A 3R27A 2N82B 2QA4S 4LJMA 2DNGA 2HZCA 1VBZA 3Q2SC 3B4DA 2I38A 2HGLA 2PE8A 1SJ3P 3CCUS 1YTYA 3MD1A
chains in the Genus database with same CATH superfamily
4DN9A 2KO1A 3ETOA 5DO2A 2ZOFA 1Y5IB 5I3PA 1Y5NB 4WK3A 3DLKA 4FN5A 2VPYB 4YEAA 1WACA 2DGSA 2C22A 2OEMA 2FZCB 5GMEA 2X7IA 1HD1A 1GQEA 4ER8A 4BLGA 2J8AA 1VHFA 3HHLD 5DG8A 3W7BA 5IC4B 4B3RJ 2DNQA 2AHOB 3QRRA 2HIQA 5DDQC 1IBMF 2Y9HA 3A13A 3ONQA 2HWHA 4LF5F 1WHWA 5B0CA 1NK6A 3SBMA 3GONA 1QVFR 2VFUA 4KGKA 3OJUA 2B5JA 3J7YU 2FDNA 5DLFA 2NYHA 2UXDF 1JXLA 3ENQA 2G2ZA 3DLHA 3M9OB 3ELHA 3PW4A 1FDDA 1M1HA 3T6BA 3OTCA 3D9BA 4FZVA 1CLFA 3SMZA 4YB1P 1D9DA 1S1TB 1WELA 4ZMMA 5BYSA 4K4TA 2AV5A 2XMAA 2W1BA 4PCQA 3W3SA 3SFGA 3DLBA 2JFDA 5EUHA 3D3BJ 1BQXA 2PFDA 2GVDB 2MZTA 4Y3CA 3NGUA 2XTJP 4NYZA 4IOAQ 2CIMA 1W25A 2E1PA 2Z30B 4DR7J 4ECSA 1REGX 4IKAA 1KS2A 5G4DA 4RBVA 4OX9F 3CJ0A 2BX6A 2HVDA 1FFWB 3NCPA 3P96A 3MTKA 4Q43A 5JMNA 4JI1F 1U0HA 4B9NA 1N5VA 1V5IB 1YGYA 3LAKA 1LFPA 2HGNA 5KFJA 4M95A 3DLKB 4KQZA 2PIIA 3HJFA 3CMAS 4F25A 2HQCA 2JC1A 2XO6A 1UVLA 3IGNA 4DSKA 3HO1A 1AROP 4F04B 1R89A 4RZRA 1UZDA 4TYBA 5M2RA 3W62A 2ZOGA 4O3PA 3TWZA 2F63A 5E7OB 2U2FA 2QZ8A 3AA9A 5ITHA 1J2VA 3BQ0A 3HM9A 1X5PA 2HS4A 4RLEA 2P6TA 2CNKB 3UQSA 3K89A 3NS6A 2B5JB 4N8NA 3ZTQA 3T5JA 1NBEB 4YR3A 4WIQA 2CPXA 1VBYA 1R0BG 2COLA 4JB8B 4O3QA 2MKSA 2ZBQA 4PG7A 1LNQA 2IBOA 3QJPA 2V0NA 1Q53A 4JV5F 4WE1A 3G4SS 1J5EJ 4J9QA 3FRYA 2BW2A 2UV8G 1ZOTA 2M8HA 2ROGA 3OXFA 1MU2A 1PYOB 1SBRA 2G9OA 2ZHOA 4FXDA 2QFIA 1MSWD 2A2CA 2ALZA 2HK2A 1FX2A 4KV8A 2UVWA 2V2QA 1SJRA 3PW5A 4EYIB 3IP0A 4O3SA 1VJWA 1RB0A 1U0HB 3OTEA 1N0UA 3M7VA 4ZJQA 3R5CA 3ETMA 2VZ9A 1S1WB 3AAWB 4KTQA 2QLWA 2DHGA 2F4VF 1D0EA 1DHMA 3MMJA 2HHQA 1N6QA 3TVYA 1RKIA 5IV3A 1RHUB 4IR1A 3B4MA 1N54B 4PWWA 4URGA 4ECRA 4K59A 3PNIA 1X31C 4UZBA 1FXLA 3LO3A 3BH6B 3ILOA 1PCAA 1WC0A 3A3OB 3VAMA 1NKCA 1R27B 3HVTA 2DNPA 3V2UC 3PR5B 3CW2C 4ZVTB 1RAIB 2HQDA 3UI3A 3HP6A 3VF0B 5KFOA 4RW9A 4Y2AA 2ZBPA 3HD2A 1KC8T 4BBYA 2WCXA 4WP9A 1MROA 1IQTA 4WE1B 2UXCF 1VIXA 4WP3A 1ZM3A 1RHRB 5LL6d 1MU2B 1ZA1B 3MM6A 3RW6A 3JSMB 2IA6A 4TY9A 2HQIA 1ELOA 2V50A 3N6MA 4WZQA 4KV8B 5DRKA 3P5BP 2DIUA 5K5MA 2W7PA 2BABA 2EFNA 4M94A 3I5AA 4QR1A 4KO0A 3QJJA 1XEZA 2V8HA 4X65F 3S01A 3NL0A 2ROEA 3Q23A 4BDPA 1N6QB 1RWKB 2GJFA 3GR1A 4Z2XA 3T9ZA 5IOLA 2DHXA 1U6BA 1N36F 3BPSP 1OS5A 4RWWA 4W98A 1UEUA 2VBZA 1U1KA 3K8WA 3WZ0A 4RUCA 1NDLA 3JSBA 1R31A 4USKA 1JMTA 4MKBA 2GQCA 2ZH1A 1HR0J 3MZIA 4QIFA 4H4KC 2CDQA 2JHEA 1UTAA 3TJ8A 3HVTB 4YOEA 2CFXA 3KUHA 4P72A 2BJEA 1KLMA 3HT0A 2RRAA 4ZCMA 4RW9B 2BV3A 2DRAA 3MDFA 4U7UD 5A8WA 2YTCA 5EX3A 1UVIA 1MROB 5BXIA 5B0AA 1SC6A 3VGSA 5L9NA 1WKJA 3RRHA 3MM6B 2AEJA 1QUPA 1T0TV 1GMWD 1TUWA 1VRTA 5F8GA 1Y9OA 4ZS6A 2W2OP 3TOQA 2J7KA 1X7VA 2JEFA 2HHPA 3GJTB 5CZVA 4DDFA 2EBGA 3H98A 2B7BB 1HQEA 3CDEA 3CIZA 3IS9A 2KT3A 1RK8A 1Y10A 3OHAA 4C8LA 4KO0B 4F3OA 3JB9k 5HQLA 3F73A 4UW2A 3OVBA 2NUHA 3W9HA 2ZHBA 4WXOA 5E2QA 1SXLA 4Z7CA 3MFHA 1FI4A 5HVFA 2UUAJ 2ZH9A 2P9GA 1RAEB 2I5JA 3RBDA 4FBTA 2YWEA 3C3LA 3NBPA 2KRBA 4U6PA 4I2PA 3FCVA 2FLOA 1AFJA 4UY8T 2MZJA 2XG8A 4OJGA 4RBUA 2VICA 1SUQA 1AB8A 4J9NA 2F7VA 3J7YI 2ZVIA 1KLMB 2QG9B 3DI6A 3CCES 4Q0BA 4O4RA 4OJHA 4X66F 1HHQA 1OQ6A 3PIOQ 4TY8A 3KLGA 3ULHA 2K7KA 3RB3A 5A8WB 2F8EX 3X1LB 1C4AA 1SQGA 5C5JA 4X64J 3MCNA 5GAGU 4KHPF 1LWXA 3H42A 3QLHA 2AYEA 5ADZA 4B9VA 2APOA 4A8QA 4J9PA 3KWMA 4XDCA 1VRTB 1R8HA 4KBIA 3B54A 1FWLA 5FIIA 1HQEB 4AE5A 3IS9B 1SI9A 2AYMA 2YKPA 2HLTA 1L5UA 1KRPA 3KMSA 1S7IA 3MXHP 2FZKB 3FNNA 3WHIA 5T7LB 1IQZA 2KHDA 1VYAA 2FY8A 4A4JA 1RT6A 1I94J 5KT5A 3H4DA 3LALA 2FJVA 2BXJA 1TKZA 2DGTA 4DR1J 3TARA 2I5JB 5LJ3Y 4WU2A 1XMOF 2CPIA 4ELUA 3NBPB 4G1PA 4HT5A 1QAXA 4I2PB 1HNWF 4RW8A 1B7YB 5DGBA 3BDPA 1RJJA 4JP8A 3V4IA 2CA9A 1SUQB 2XMVA 4QWEA 4C6AA 1U26A 4WJBA 4PXDA 3DI6B 4Q0BB 4CLWA 4NLGA 5LXYA 1SVDA 4TY8B 3KLGB 3VZIA 3MUVP 1YI2S 2XMKA 2E5LJ 4HDHA 5DM6Q 1Q82T 1N5YA 2LQ8A 2M3DA 3PYEA 4R5PA 1WI8A 1ROFA 2IM3A 3R97A 2LDYA 3QLHB 4ECYA 1S9EA 2HFUA 2E9ZA 3DM2A 1FWPA 3DN9A 4JI5F 2HRYA 3GTYX 4ALZA 2BKOA 3OTBA 3T1HJ 5ETVA 3DHWC 4EI2A 3GJQB 4DJBA 1IJFB 3DDKA 3CCUS 2DKOB 1S0NA 2FYXA 4IH7A 2BJ9A 3UCGA 4MIBA 3T41A 4EO6A 3D6TB 3R5JB 4L72B 4UZCA 1F1BB 3MCSA 3M8SA 3R3TA 4ZKAA 4PABA 3C15A 1RT6B 5F9NA 3LTOA 1PC5A 4J37A 4ED3A 2IAJA 2R7OA 3AY0A 2MSSA 2WOMA 1N34J 3BQ2A 1TKZB 1Q7YT 1DQ8A 4QPXA 1Y7PA 2ZBCA 4B3OA 4CTAA 4N41A 3H2VE 2HQFA 3ZTSA 4U8YA 1CJKA 3V4IB 4EBCA 5HLFB 4FKYA 3LH2S 3QZ8A 2GMJA 1YJNS 5IWAF 3AB4B 2LDIA 2OPPA 1K1QA 3UCZP 3TUJC 2VA3A 4DL2A 2JLFA 1T7PA 1KEKA 2DXEA 4WF9Q 3KUEA 3RBEA 2HNZA 2QJ3A 1EQMA 3CPWR 2I0XA 5EGYA 2OP5A 5E5NA 4KGZB 1N5YB 4LF2A 1KQKA 3Q83A 1SV5A 5LMUF 3D1HA 4R5PB 1HBOA 3CTRA 3MEKA 4DPUA 3KJQB 2QT7A 1S9EB 2V8GA 4A8OA 3DM2B 4CLKA 2UXBJ 5AXNA 4I67A 3IRXA 4J9KA 2PSZA 2BM1A 2RMLA 1FE4A 4PXCA 4K2JA 1NPRA 2M52A 3R7NB 1JLBA 3OV7A 3TZWA 4DV7J 5HJYA 5IXUA 3K0JA 3JQKA 4YDDB 1YITS 1XTZA 1IVZA 2MLYA 3D68A 5C7PA 3C15B 2YX4A 1S6OA 3TUZC 4I7FA 1KR4A 4URSA 4JI3J 1UVKA 4KGXB 2C42A 1DRZA 1KN6A 1KTQA 4FXWA 4K4UA 2IJFA 1F9FA 3KHGA 4X4VA 4B3OB 4DSEA 4TYAA 3OVSA 4CTAB 4ILLA 4QQBA 1H2UX 2N4CA 3ZC4A 1L3VA 1KONA 1CJKB 5T41A 4G65A 2DCLA 2KH9A 2FQQB 2AU0A 5DS7A 2OPPB 3AOAA 2WW8A 3GSIA 3MGJA 1K73T 1C0TA 2HNZB 2V69A 2KG1A 2XEXA 4P2FA 3HHEA 2OTLS 2EFQA 4MK7A 2LLZA 1RAFB 2KT5A 4PYDA 3QGHA 1CC8A 1SV5B 2MKKA 1HBOB 1J5EF 3GFYA 2AYBA 2XS7A 3VGTA 4H4KA 4ZVFA 5D0GA 3E51A 3IRXB 2MYFA 5HBMA 4LSLA 2KKHA 1RWNB 3PX6A 3C19A 1X4BA 3CJTA 2BMBA 2M5YA 2A6MA 4K5RA 3CC2S 4WZMA 1JLBB 3KHLA 2Y1RI 2XLJA 3KJFB 5EWEA 3PXGa 3K5LA 1RXOB 2LQ5A 4CLFA 3AA8A 4QZVB 4P73A 5D0EA 4O23A 1LXJA 4ANCA 2FHJA 1JXEA 5DJBA 1M5VC 2GX8A 2W4PA 3NNHA 4FP9A 4I7FB 3QGGA 4ILRA 2VB6A 4QIVA 3BB5A 1U49A 1OY6A 4M8LA 1J27A 2VIHA 2E9TA 3GFHA 3WX8A 1VQMS 5KFEA 1NK4A 1C1CA 1RAGB 4DV5F 3DMJA 1FTCA 5EDWA 1VC6A 4L75A 1NPPA 2WB4A 1C0TB 2H9ZA 2UU9J 3LUYA 3T5HA 1X9WA 4JI4J 4PUOA 4EK2A 4PWDA 5C42A 3H20A 2B56A 1KSPA 3VALA 4ZITA 5CYMA 3QZ7A 5D6GA 3O3LA 1G1XA 5HBMB 4TNOA 4LSLB 1H72C 2R2RA 1O51A 4BWJA 3RBZA 2R2SA 3RR7A 2IMWP 2ATCB 1SJ1A 2FY1A 3PR4A 1DTTA 2DHSA 2K3KA 2MHEA 3UPFA 1PBAA 4RU2A 1HI1A 4J9LA 3FEZA 4K0KF 3LANA 4CNYA 4QIEA 4DPYA 2V94A 3ZZUA 2HLUA 2HZCA 1YLXA 1JLCA 5DGAA 4GVLA 5EN1A 5KFMA 3K5OA 2KJVA 2C3YA 3BGOP 3W2VA 1WSRA 2QSWA 3DKDA 2RT3A 3M30A 1REVA 5IV4A 3IRWP 2LEAA 5I3QA 2E7VA 3IGVA 2EWHA 3KNGA 2BW7A 5AJ3J 1RTJA 1UJ6A 1H98A 1NH8A 1C1CB 2ZC3A 2GC8A 2WAQD 1IN0A 1MN9A 1HR0F 3DMJB 2XNRA 2XMUA 1FK9A 2HHHJ 1OMSA 5HK4A 4EBEA 2UZAA 3OPKA 2MQPA 3UDLA 3ZZRA 3VV2B 3MM7A 1Q81T 1S6PA 2WBMA 1RAJA 5DDPC 1BXNA 2V2KA 2RKIA 4CO4A 4PUOB 3TO8A 4PWDB 4ZPTR 5C42B 1R6VA 1HIYA 3IBFB 2V4QA 2AGQA 3CF5Q 3K17A 3TZZA 4J9SA 4DQRA 4WFNQ 1WC1A 2QLJB 2VBWA 5CYMB 3H40A 3DNCA 4LFAF 1DTTB 4K4YA 5J1PA 1XWLA 1YG0A 4O0IA 3H2LA 1U1LA 2IJRA 3G82A 1PJ5A 1NK9A 1SB6A 5GAHU 1GTEA 1JLCB 4H4OA 3K5MA 1CG2A 4ZDNA 1VMBA 4UUWA 2QLFB 2GMLA 3W2VB 4M5JA 3HI9A 5L9XA 4TQSA 4LREA 2XI2A 3M30B 3MAHA 1YJRA 1REVB 3R8YA 5MAOA 4ZPDA 4TN2A 4A8FA 2ZJQQ 2BACA 3SQOP 2KB2A 2GAHC 1JB0C 3CJRA 3KFWX 1RTJB 2DEJA 3MR5A 3FQKA 3FCWA 5AXMA 2Q6BA 2A2DA 4U7CA 1I6JA 1NKEA 1FJ7A 3BH7B 4Y0FA 1ZBTA 2VV5A 1FD2A 2NZCA 5LXRA 3PYGA 3MM7B 1F9EB 1S6PB 2KT2A 3EDQB 2OMLA 2IC3A 3M1VA 4KY3A 2FZGB 1D09B 2NLWA 2RKIB 3MUTP 3K57A 2VQFF 4ICLA 4B3SJ 1KQFB 3RZAA 3OXGA 2X1AA 2HHXA 4X64F 4JV1A 4KKOA 2E9RX 4KAIA 3J7ZT 3MPDA 3TVZA 4LT6A 3HSGA 1TKDA 1XIQA 1FJGJ 2G4BA 2W9AA 4ETXA 1T9VA 2XBPA 1CPZA 1EP4A 3HFKA 2IBKA 1T9YA 4JI6J 2HFSA 5IT4A 4NLRA 3ISZA 4GC6A 1CC7A 2GO9A 2JDJA 3G82B 4E2FB 3WC2A 1F9HA 4MAKA 4J7CA 3HSZA 3CE8A 4H4OB 2Y0SD 1BLUA 1AT1B 1N48A 3THTA 3MURP 1B64A 1OYDA 2DRBA 4ECZA 2HFNA 3D28A 5E3CA 3W5ZA 4U7UK 1WKLA 1R6YA 2C3MA 3RTVA 4AXJA 1S7HA 1O0PA 2R8IA 4HH1A 1H2TZ 4DL5A 5HAOA 5H9FK 3W60A 3C66A 2FVRA 2YWFA 2JL9A 3HLUA 3JS9A 3TX0A 2HAFA 1Y3JA 1S10A 4LF6F 4GC7A 2FVSA 2HRTA 2V2ZA 3OLBA 4J9OA 1U25A 5HQ8A 3NNCA 2IC3B 3M1VB 3QT8A 3VGVA 2E5LF 4ICLB 2DH8A 1UW4A 2HHVA 4KKOB 4I6AA 3SSRA 3GQCA 2R3VA 4IQXA 3D0GE 1LOUA 5A2QY 3VQTA 5KG7A 1EP4B 3EWGA 2O67A 1TELA 2IHR1 3JSYA 2HVZA 1QTMA 2VA2A 3T1HF 2DY9A 3N6LA 2FGOA 2W4CA 1DJ0A 3HD1A 1UFLA 1S48A 4HH0A 1HARA 2V63A 2LEBA 1PG5B 2QA4S 4LR7A 4O0NA 3KHHA 2D74B 2I38A 2HGLA 2YQ0A 2XYGB 4USMA 4PWUA 1N88A 2KI2A 5A8RA 4J90A 2DPJA 3QJLA 1PSDA 3LA0A 3AB2B 1D3WA 4RW6A 4MK8A 4J9VA 3GCXP 1PC4A 1X5SA 2DO4A 4P2MA 3WQPA 2D3UA 4BHQA 3ZO7A 1QVGR 4Z7YA 2VASA 4DLEA 4Y65A 2WVFA 1B0PA 2ZJRQ 1RT2A 2UV8A 1RTHA 1YJWS 2VF3A 1SKWA 1VBKA 1C1BA 3PW0A 2HVIA 4J9UE 4DX5A 1XBWA 5E41A 1JX4A 4JYAJ 5IT9Y 4CO2A 1U8WA 1RT1A 3SCLE 4W4MA 4Q2MA 4ZPWR 4NI2A 4EFAC 4X4UA 1TKTA 4WFZA 3I0SA 2RQMA 3I0RA 1KNZA 2UXBF 1KDNA 3P8BB 3HXMA 1SL2A 4FVCA 1NDCA 1X4CA 2ILZA 4B9UA 5F8NA 5L1KA 3OUYA 3MTJA 3AFGA 2LXUA 1XR6A 4I6WA 3PZPA 4YN3B 4JUZA 4DV6F 2W2NP 3M8RA 1HNZJ 1JLFA 1MWZA 1FRJA 5IC6B 3LGHA 2XCAA 3BKUA 3CJKA 4NLTA 2P8IA 2Z8QA 2X1FA 1UEKA 4JI3F 4USUA 2MGZA 1Q4RA 2VFRA 2VC1A 1A9NB 3IMQJ 4HACA 1LWEA 4P75A 4RW6B 2XYHB 2EPIA 1HMVA 3Q86A 5HMXA 4DV2F 3RAXA 1ZAVA 3RB4A 4DXLA 2E1MC 1UWBA 2B8QA 2ASDA 1SJ4P 3CD5A 2CADA 3L09A 2E1RA 1RT2B 1RTHB 2ZJPQ 3G6YA 2EKYA 4OYOA 1C1BB 1RTZA 3CULA 3GV5B 4FNIA 4P9SA 2SXLA 1RT1B 2R8KA 2HHSA 1R8BA 4NI2B 2FIUA 1TKTB 3I0SB 1YZ7A 1DLOA 1NEEA 3I0RB 2YH0A 4QIWD 3EJMA 3THVA 1HKAA 2MKCA 4ECTA 5IT0A 5BYQA 4JOUA 2NS1B 4A8MP 3M8YA 4F67A 3OUYB 2RDIA 2UUCJ 3DHXA 2XSFA 2ZH3A 5B0GA 1KQGB 3JQJA 1UWAA 4LF7F 2CQDA 5L1LA 3JTNA 5GAHI 1GXUA 1WC5A 1JLFB 1NLKL 2H5EA 3LGNA 1NK0A 2OH2A 2XHCA 3NY0A 4Y2KA 3CJKB 3OTOF 2HWTA 2ZH7A 1C2PA 1U47A 3KK1A 2D9OA 5KFLA 1N56A 2MGZB 5KFNA 1JJ4A 2ZEJA 3HFZB 1HYSA 4NYPA 3OL6A 4N47A 1W26A 4HACB 1AYEA 3PKYA 3IO1A 2BJ3A 3NMAA 4N76A 1HMVB 4OV6A 2PC6A 4B17A 3TAQA 3Q89A 2V5HG 3S6EA 2PA3A 5ETOA 1UWBB 4WBFA 1N4LA 2GAGC 2CJ9A 4UT4A 1ICEB 2K7JA 1P8GA 1VLOA 1W7WA 2LMIA 4EWTA 1S77D 2ZNZA 3PY8A 3RUBL 3ZXWA 2UU9F 3QBCA 3NOGA 1N52B 4JI4F 1K47A 4DI6A 3UDCA 2H65B 3CEDA 2VFTA 2VL1A 3NOCA 1VRQC 2ADBA 1VQLS 3IBCB 1OSCA 1DLOB 2OD6A 4IOBA 3PKMA 2ZUGA 2EI5A 3KK3A 2R9LA 3CJ4A 2HHUA 4XK8C 4F4WA 1LK7A 2YWHA 1BMQB 4C0OC 3LQVA 4NCAA 1IBKJ 3H5YA 3C14A 2Y1JA 3RRGA 3V6HA 4ID8A 1F3FA 3CB4A 1VC5A 4KC5A 4JI8J 3DLLQ 5CD4A 5SUHA 2QA2A 4NPOA 4EGLA 1NPKA 1RGVA 5G0RA 2AMCB 2GGPA 3W1YC 2O1PA 3CDBA 3R7BB 2AJ0A 1RWMB 4ATNA 2HVHA 3A8EA 5KFSA 3ISND 2QMXA 3KK1B 2WRMA 3FUYA 1BQMA 4DV0J 1N8RT 3MM5A 3KKFA 4TLQA 1HYSB 4ZPCA 5ETTA 3BN7A 1MW7A 2HFVA 3GFZA 3MM9A 5AJ3F 1FA0A 4B9SA 1I1GA 5CXTA 5KFTA 1N5TA 3TZYA 1H6KX 4JI0F 3TP2A 2X1GA 3D54A 1E6VA 2HHHF 3UO0A 2BRLA 2B9YA 1U1OA 3M8PA 5DQHA 4FYXB 4G6VB 3LW5C 4A46A 2E44A 3EXCX 3N28A 3LF0A 4NLQA 4ZVRB 1S12A 4ANDA 3CD7A 4HYKA 4V1Ak 2WSEC 2M4MA 2XCPA 1U2CA 3BO3A 4ZN1A 3O8WA 2DGUA 1EETA 3KK3B 3IR5B 1H7WA 1S72S 1TTHB 3MOJB 1UVJA 5L1IA 2ASJA 4QYZK 2IDEA 4R0JA 3WBZA 3C14B 5D4LA 3HMJG 1YIJS 5JJBA 4F0MA 1JLQA 4O44A 2Q6CA 3VGUA 1T94A 1U8SA 5G0RB 4CH1A 3T9NA 1QD1A 1S1UA 2F40A 1HBUA 2GGPB 3R2DJ 2KRRA 2M70A 4DR4J 2IY5B 4FS2A 1XN9A 1HPZB 4OYWA 4X62J 2G1HA 1T03A 2DGVA 3CO0P 1KTVA 3TX8A 1YQHA 1N5SA 3NKYA 1BQMB 1TV6A 1P1LA 3MM5B 3JAMY 1OY8A 4CRJA 4EZ9A 3MM9B 1TKXA 4GO7X 2KFNA 4KRWA 3UWTA 4LBIA 1GX6A 1FRKA 1VRUA 1VFJA 4Q7AA 2BKPA 1BY9A 1E6VB 1VQ6S 3B8HA 3EPGA 4AQYJ 3M8PB 4E98A 2Z2LA 1YKWA 1W2BR 4PXEA 3A3PB 5HMYA 4DHVA 4C3LA 1YJTA 2B43A 2E66A 2MSTA 1NUEA 4IRCA 1EKSA 3BGLA 1TFWA 2RF2A 4EZ6A 1WOOA 1EETB 4JI7F 5KFKA 3OW2R 3UN2A 4A47A 2WONA 2BOAA 1M1GA 3TEGA 1JLQB 2DD8S 4O44B 3N5FA 3MEDA 4CLZA 5ETQA 1S1UB 1HBUB 1JKHA 3D6FB 4DLGA 3MEEA 3NNAA 1LW2A 1T03B 1VCTA 3UDVA 1S49A 3A8KA 4ZCIA 3CSKA 1Q8BA 1R43A 1TV6B 4NMLA 4C7QA 4N5SA 4TQRA 4LQ9A 3ET6A 5DDRC 1FF2A 3G6XA 5LSLA 4M63A 2KM8C 3L9ZA 1TKXB 4NRUA 4DS4A 1B99A 3QO9A 4NXMJ 1KVIA 3AQOA 1Q79A 2NREA 3CJQA 1VRUB 2CRLA 2DR6A 2CQIA 1YZ6A 4QCLA 3W2WA 3U02A 1U7LA 3ZTRA 2J76E 3CD6S 4TLRA 5KOWA 3TANA 4CLYA 1T05A 3G6ES 2CPYA 3I9V9 3OT9A 3UFCX 3IWNC 4LRBA 1XMQJ 4AYBD 1YK9A 2B9WA 2BJ8A 5F8IA 2HNDB 4DV3J 2RF2B 2PMHA 4NLXA 1ACMB 3CMES 4L76A 3I55S 4ZCKA 3BSAA 3P45B 1NM2A 4NX9A 2WONB 2FB0A 5D3GA 4I1TA 3ZFVA 2RNEA 2Z56B 3MEDB 4DQSA 3TJ9A 4F26A 2V8VA 3NGDA 4OYBA 3H90A 3DFEA 1PAUB 3QFHA 4M5NA 1JKHB 3CNQP 1SQEA 3CCMS 1R8CA 3MEEB 4WU3A 2KN4A 1LW2B 2OFGX 4LVOP 2H5IB 3SQGA 2PN6A 2JLEA 4ZOSA 3HHLC 3DLEA 1XC9A 3ET6B 1N0VC 3F44A 3G2XA 5L39A 3G96A 1ZPVA 2LQJA 3QT6A 4YB6A 2DR5A 4QU7A 2HS0A 3BJYA 1JWWA 4DZDA 4OZ0A 2CJQA 2D41A 3BSNA 3W5YA 3Q8PB 2DISA 2JJ4D 3W2WB 3UD5A 5C25A 3AD7C 4YHHF 3HULA 2DVIA 1LWFA 4KHRA 5GMKa 1T05B 4YY3J 1SKUB 3OR2A 1VQ4S 2QLBB 2DNLA 3FMWA 1TP7A 4TVAB 2WW4A 3NAHA 4OZ1A 1U48A 3SI8A 2B8PA 2EW9A 2VBXA 3BF4A 4G1IA 2YQ1A 1WC4A 4X4TA 3FZ2A 2Y1LB 5HP1A 2MZQA 2GMHA 4H4MB 2DO0A 2YBVA 4YMEA 4ETZA 1RLCL 5E0OA 5D8HB 2VUGA 1UJ5A 2L41A 5FLXU 4ZVGA 3TUPA 1B0TA 3C16A 4IH5A 5D3GB 1LW0A 2IM1A 4C2MA 1HWKA 1NO8A 1RLDA 2BEFA 2CWKA 1HNZF 1F5BA 4GMKA 3KXDA 2M8DB 4J5OA 3R1HA 4LRCA 1HL6A 3SQGB 4C9DA 2HZAA 4I6YA 5MLCV 4MK9A 5H9EJ 2W24A 3DLEB 3S1TA 2DNKA 3T5LA 4OJ1A 1QSLA 3IR7B 4ES1A 4EYHB 3PACA 3T1YJ 2XWYA 4PPDA 4N8OA 3UN3A 2RD5C 3CWJA 2VDHA 4D3GA 3H4BA 1IKVA 1SC4B 1NK5A 3JTOA 1U1MA 3M6WA 5C25B 3TA1A 3FVYA 1NKBA 3C2PA 1WOSA 1LWFB 1P1TA 2LYVA 3D0IE 3VR1A 3HX9A 1D9AA 1SIWB 1DBDA 4OLOA 3BYRA 4MIWA 1YSJA 3AJDA 4FBUA 2HKEA 2C2MB 4KSEB 3VTIA 1Q5YA 2P6SA 1GXTA 4OHVA 4IFYA 4N56A 3CVKA 4LRDA 2XY6A 5HP1B 4DR6F 4GKKF 3SZ2A 3N4WA 4LF1A 2C2ZB 1T9TA 5E33A 5JVHQ 4DUZF 1L3TA 3VAJA 1IWGA 1ZM4A 3HSDA 2RQ4A 3P6YC 2OO4A 1JLEA 3C16B 1RWOB 3FSXA 1Q8LA 1LW0B 1EX8A 3ILLA 2NPFA 2VU5A 4XPCA 4FS1A 4EO8A 2LXFA 4FYYB 1D9FA 4DFKA 5LJ5Y 1CULA 5C24A 4XTTA 3UR0A 1F0XA 2VG7A 1A0OB 1FCAA 3MR3A 2DNMA 4M5GA 5F3TA 1S6QA 2OIHA 3Q8UA 5KG1A 2J7WA 1XR5A 4Y34A 4A8XA 5GADU 2RQKA 1H7XA 4HTJA 1IKVB 2HEKA 5DLGA 2BQUA 2CWXA 4CLLA 2QEXS 4DUYJ 4NOHA 1U2FA 7FDRA 5CZXA 2CQ2A 5HJXA 2HQGA 2CNLB 2W8KA 2OTJS 4CP5A 3SXLA 2QV6A 3RRKA 2FVPA 2XC9A 1Q0NA 1TAUA 3RB0A 1FE0A 1HBNA 4IFYB 3RAMA 4GO5X 2FJAB 3PFOA 2IM0A 2HQ3A 2ZC4A 1FWKA 3TW0A 3AXMA 3MR7A 4HHJA 3PG9A 2R4FA 4O3NA 1JLEB 3RU0A 5F9LA 4ZK7M 1JLGA 4HVZA 4JI8F 1CQMA 2BBEA 4FYDA 1N5QA 2KHCA 1Q86T 3BGFA 4OZLA 3D4JA 2UVVA 4GKJJ 3N79A 1CULB 5C24B 5KFQA 2PFFB 5K8NA 3BO2A 2VG7B 4DV0F 4ED2A 1RHJB 2F5GA 1V9OA 4M1KA 1S6QB 1SH2A 1G6BA 1SL0A 2MKIA 2RHQB 3FJ2A 4DZ6A 1GNKA 1S1WA 2C3OA 3EXYA 2WSCC 5FDLA 4V19X 2OEKA 2GIQA 3OJSA 5F8LA 2QTWA 3MWBA 2LKZA 2QGFB 5AE2A 4DQPA 1JIHA 3DDNA 5K8MA 2VG5A 2C2DA 4QIGA 2G0CA 2RS8A 1RI7A 4I69A 4LSZB 4GRSA 2IM2A 4NWBA 1QTNB 2QA4G 2OHDA 1I51B 1X0FA 1RAAB 1HBNB 4HKQA 2W4DA 3ZZPA 4DR5J 2EFOA 3DC2A 1Z2LA 2MPUA 3FFIA 1RA6A 5KFRA 4ZHRA 3RR8A 2UUTA 1TL4A 2JNJA 4MT1A 3FK4A 3MMAA 2AWZA 3W65A 5H1SV 1JLGB 3MCMA 2KVQE 1FJCA 2PI5A 1QE1B 5IQ6A 1MLAA 3FCHA 1YRXA 4X62F 1MMLA 3LP2A 3MPUB 4RUBA 3EGZA 3QPIA 3JSMA 1DZ5A 4H54A 2ZBIA 3PFEA 3DDIA 3PV8A 3UNYA 2W2PP 2YNHA 4DU7A 6FD1A 1FDNA 2E5JA 3TR5A 3OR1A 2MY8A 2RUSA 4O4GA 2IDLA 1FEHA 2D3ZA 1Z4UA 2P9EA 3KLFA 3CJ2A 2DJWA 3V6KA 4NMXA 5FDLB 1T02A 2BOPA 3W64A 1VQSA 5IZHA 3HHLA 2ZVSA 2KVIA 1TK5A 2VG5B 3TVKA 4LSNA 2LXIA 3OQ2A 2KM8B 2IVMA 1IBMJ 2YKAA 2NR0A 4PG8A 1JK9B 4DFMA 2V8DA 2K8GA 4C4WA 1NXIA 4UF4A 4FVMA 2B4VA 3N6NA 2CQBA 3R6GB 3ZZZA 2UXDJ 2GV1A 4HLBA 3GE9A 1RA7A 1S9GA 3FFIB 4PYAA 4ZHRB 4DV1J 3MMAB 2YVSA 2N3OA 4ED1A 1FJEB 4UQGA 2R8GA 2KYXA 4NA2A 5AXLA 3ZZ0A 4K8RA 2Y0BB 5B0FA 3HFVA 2ZM6F 3GSDA 3LP2B 4LFBJ 4F36A 2MHNA 2ZKUA 2W7OA 5BR8F 2AIRB 4QPTA 2HBRB 3M8WA 4P2XA 2NYIA 1L3UA 3MAQA 4NEZA 3MUMP 3K5PA 2YNHB 3VAKA 3OR1B 4QU6A 4BCAA 4O4GB 3PHTA 3BBBA 2B6AA 1U02A 3KLFB 2O3DA 2ZNYA 4DV4J 3M2VA 2MXYA 2QC3A 3D5MA 1VQ9S 1S0OA 2Z2MA 5GMDA 3HHLB 5DQGA 2CPZA 3CDUA 3K5NA 4LSNB 3T19A 2CQCA 1XMQF 4LVNP 1Q7LB 3T6JA 3E3XA 1FD8A 2XZWA 4NCGA 2RJZA 3UVJA 2HFZA 5B0EA 2AJ4A 3DOKA 2RHSB 2FJXA 1BE4A 2EC0A 3U1MA 3SIPB 3AXKA 4RNHA 1Z2ZA 2XMWA 2ILYA 4A8YA 1B7FA 1S9GB 2BVZA 3JYTA 1RT7A 3EM1A 3TJAA 3BKFA 3KLIA 1RHMB 3W66A 3GG1A 3GYNA 2K1RB 3BO4A 2HURA 3W8PA 2R7VA 2CPHA 2XNQA 2CXEA 3GV8B 1ZH5A 3QYYA 4GVBA 4WTYA 2J9DE 5CYQA 1FVQA 2HPUA 4NA1A 4F0HA 3MMCA 5KFHA 1IJEB 4FF4A 3B4DA 1SJ3P 2FJBB 2O5DA 3GIJA 4O3RA 3C46A 2VJUA 1PYTA 5CH7B 2B6AB 4USWA 3R5BA 3M2VB 1CJUA 2Y3YA 2BYCA 1NJYA 2YKNA 2F4VJ 4DSLA 5T7LA 1YRUA 2CJXB 2Q3PA 1U4BA 4XPEA 1LFWA 4HL9A 2CUYA 1VIOA 5D15A 2R7QA 2CQ0A 4B3TJ 4DWIA 1OWXA 4YY3F 4RUAA 1YX2A 2YNFA 1NDKA 4AL7A 3QQCD 1FDBA 2NXCA 2DRDA 3UD4P 3Q8SB 3MOZA 2OGUA 4NCGB 3UVJB 4HT7A 5DQIA 3DXBA 3DOKB 3V4MA 4MH8A 1U2RA 4K2XA 4IH6A 4ANEA 1NU4A 1H0HB 1CS4A 1NB7A 1X4HA 2B9XA 2JOQA 3JYTB 3OVAA 5LMNF 1RT7B 3F0NA 4C3MA 5KFGA 3KLIB 2BR0A 1RQ0A 5AE1A 5IS2A 4LIRA 4ZLNA 2A6OA 2R7TA 4BWMA 3VAHA 4GVBB 1WTFA 5J2QA 5CYQB 2UXCJ 2PA8D 1S4FA 3A12A 2GVZA 3PCOB 4FPRA 2QL5B 1TU0B 3MMCB 5E3QA 2MEWA 3LP1A 4IRKA 3FMBA 1EJ7L 4C97A 1K44A 2H4YB 1FRIA 3D6MB 3KDNA 4ZPVR 2GQ2A 2Y1IA 3QRQA 3T1YF 2CNNB 5DG7A 5L1JA 4PG4A 3P3DA 1JJCB 1RSCA 2Y8WA 1B70B 4X65J 1CJUB 3PX4A 4USTA 2YKNB 4L6V3 2R7WA 1U09A 3CJ3A 1N36J 5F8HA 5KG6A 2YNFB 1XR7A 1VQ5S 3M2RA 4RKUC 2F9JA 4KHMA 4MIAA 4CO3A 3U1NA 4LR9A 5C2CA 3C6UA 5HLFA 4NLSA 3HZEA 3HVRA 3SSQA 1CS4B 1A7GE 3J81j 3O44A 2ASLA 5K14A 3KYLA 3I96A 4C8ZA 3ICLA 5D4OA 3R5AA 3MFIA 3A8JA 1KD1T 2QO3A 3NP5A 1QUVA 2NSBA 2ATLA 4KH0B 5J2QB 1HNVA 2AD9A 4R25A 5T14A 1XK8A 2WVDA 2GVZB 3CGIA 5KG5A 1YBTA 3PVXA 2XO7A 4RUHA 2AKWB 3LP1B 1SIZA 1M5PC 1GMWA 1FTRA 4M5KA 1C4CA 2DBBA 2FHKA 4A8SA 2XYPB 4ZVUB 4IYQA 1FESA 2LCWA 2F3JA 3JXOA 2ZWOA 3UCUP 1UPPA 2EBEA 3OLAA 3CJ5A 4DUYF 1EZZB 2J6UA 4LMZA 1SH0A 1PIEA 1MMDA 1Q5VA 2ADCA 4V19J 2VDIA 4RBTA 3HKWA 3OFFA 1MWYA 4B3RF 3IAM9 4QR0A 4USVA 5HROA 2LFVA 3DRYA 1RZMA 2GIFA 3BS9A 1AZSB 4WPAA 3M2RB 5B7WA 4BC7A 2XI3A 5E3AA 2VPXB 2XGPA 2RDJA 3H0PA 4LF8J 3BBFA 3Q8YA 3C6UB 4ZP6A 1XJWB 1WC3A 1EKRA 3PEJA 5K14B 2MDAA 3L95X 3ZNJ1 1E6YA 3EICA 2CYYA 4WCEQ 4ECWA 2RQCA 2JLGA 4IRDA 4K4XA 3HPOA 2PI4A 2EKNA 1GT8A 1FRHA 2NPIA 4WKYA 1HNVB 1RHQB 3CDAA 2J0XA 3IM8A 2CJKA 2HYIB 4GKJF 3MCOA 3BGUA 1BWEA 4KIAA 4DR7F 2MY7A 3HVWA 3R9LA 3WDOA 4X4QA 2NQPA 2I9SA 2C3PA 2PE8A 3DCAA 5CCMA 2VPWB 4KPYA 3GWCA 5E3PA 3NRBA 1WWHA 2OPSA 2G2YA 3QAEA 2NZ4A 2A0FB 1IKXA 4KH1B 4NEYA 2BDPA 3EGNA 2CKWA 1DAXA 5HROB 4O3OA 4DR3J 3MECA 2OUGA 1WHXA 1IR0A 1G3OA 4KB7A 2PDAA 2AQ4A 4P74A 1LQ9A 1RBLA 3SYZA 4CO0A 1HHTP 1HNWJ 3Q0AA 1HLWA 4DR5F 3QT5A 2J8SA 3RYLA 4F02A 4F4XA 1VK3A 3M6VA 1E6YB 3PJXA 4CYUA 3K8VA 1WTBA 2F65A 4NXNJ 2V9KA 1CJVA 2R7XA 3E2EA 2V34A 4KE5A 4QWDA 4C8MA 1N32J 4OJ3A 3S8SA 4ED0A 2HGMA 4F2SA 2B0GA 5KFDA 1ZA2B 2AT1B 3R5DA 4OZJA 2E1CA 5KFFA 1H74A 3H5UA 4OL8A 5F0UA 4WWSA 3PEHA 3HVAA 4JI2J 2JC0A 3GV7B 2CPJA 1PAEX 5CQGA 3S7RA 4OHXA 1TQLA 2VOPA 1SKSA 3DRPA 4YUDA 2OPSB 4IDKA 7FD1A 1S97A 1IKXB 3LPEA 4UTGA 3FBBA 2E7XA 4AUKA 4CM0A 1TK8A 1QJHA 5B0DA 3MECB 3M8ZA 4OYXA 1TMMA 2ZH5A 5U47A 4RNOA 4ELVA 4IO1A 3HHDA 4QW8A 4ZLPA 4JV0A 1R7IA 3ZNUA 1RWXB 4U95A 2IRXA 3VAIA 3A8IA 2VODA 4PQAA 3TAPA 2Q43A 4DL0C 1T9WA 2W2QP 3EVWA 3M32A 5IWAJ 2N4DA 2FHOB 1FKPA 4FXVA 1NHVA 1AUDA 1FKAF 4X4OA 2VKRA 3PYDA 2AX0A 4C8YA 4CYUB 4DV1F 2IYGA 1PJ6A 2CJYB 2DNHA 4ECUA 3OTDA 3UE2A 1S99A 1CJVB 5LMUJ 2HBYB 2VD3A 5GAGI 2F4FA 4C8OA 3TUIC 1T8EA 1UA1A 1UAWA 4LFBF 1GK8A 1FKOA 3ITHA 3FKBA 1K9MT 3UDEA 2P9CA 2L9DA 2MQMA 2DITA 2RE1A 2B4PA 4AFFA 4QWAA 2ALYB 2JRSA 4EUVA 3SV3A 2JFKA 4RNFA 1IKYA 3C8YA 4J9RA 1UJ4A 1Y3KA 4UOFA 5RUBA 5ETLA 3DRPB 4DV4F 4IDKB 9RUBA 3PX0A 1TK0A 4KGVB 5GAEU 4OX6A 1WF0A 3H5XA 1X8DA 4F2RA 4MKAA 2AW0A 2MQQA 4DSIA 3G6VA 2ERRA 3JQMA 4P6QA 2VH7A 4I68A 2GJIA 2AJ1A 3QIDA 2LU1A 1EARA 3AD9C 2OJ3A 4ZA1A 5HVGA 2AGOA 2W9CA 4LIWA 1Z1ZA 3D67A 2DPIA 4DFPA 3OSPA 5KT3A 2QRRA 3LWLA 3M32B 2DGWA 1FKPB 4NLUA 2J9CA 2M9KA 4PAAA 2BRKA 5CA5A 1T95A 3KUGA 3KG0A 3K58A 3EDRB 3HHNB 1R3NA 2BJ1A 3I5CA 1WORA 2VQEJ 1OO0B 4URQU 4E8UA 2A10A 2CQ1A 1SCJB 1OJ4A 1Q95G 2L9NA 3MI7X 4L3NA 3M05A 4OI3A 4K5SA 4QWCA 2VFSA 4P7VA 4ILMA 3QRPA 2LP4A 2DR9A 2EG2A 2DIVA 1FKOB 3BM7A 3ITHB 2EFGA 1RE1B 3J80Y 4OV1A 1WEXA 1VBXA 2QLXA 4KYZA 3OSNA 1CVJA 2WTFA 3R27A 1D8YA 1XMBA 3NGKA 4ED6A 2NXJA 3ENAA 3D7SB 3ENWA 1IKYB 3DYAA 1YTYA 3MD1A 1YJUA 2P2CB 1NK7A 1FXDA 4C98A 2VC0A 4L73A 3AOCA 4QW9A 1FDAA 1WEYA 2WVEA 1KVJA 3K7RA 1SH3A 2E7WA 4DCJB 5GVQA 2UUAF 1K0TA 3GIRA 3RJMB 4CT9A 4B3TF 3CD0A 1XQIA 1DFDA 3I82A 3DRXA 4TU8A 2WHOA 1QAIA 4YP3A 2W9CB 4DV5J 2J6SA 4OIXA 1HWIA 1G7CB 3OBIA 1YBAA 1P27B 1UKUA 3NCRA 4J9MA 4DN0A 1HWUA 1PGZA 1UL3A 2OMOA 1UP1A 1BQNA 1BHNA 4NL5A 1MG7A 3J7A1 4B3MJ 2ZITA 2KXNB 1K0VA 3RG6A 4HR2A 5K8OA 4OHWA 2Z2ZA 2XHWA 1CQNA 3DXSX 3PO4A 1NNDA 3QWUA 4USJC 1RHKB 2RUGA 5EWFA 3QFWA 1JJHA 2CVIA 2ZD1A 1AXQA 4QWBA 1M5HA 2MMYA 1L3SA 2DY1A 2ZZTA 1FRXA 3OFGA 2GW8A 4DFJA 4BC9A 1ULRA 4NZ0A 4K0KJ 2WVCA 4QYZJ 2GA7A 2MB0B 3DYAB 1PKUA 2XSJA 2YX1A 3GU0A 2C2EA 2JSXA 1KWMA 2IVYA 2D3OR 1NJIT 1IBCB 4KFBA 1I94F 4KT0C 8RUCA 3M2UA 5HMZA 1HFEL 4AT1B 4P7TA 4DR1F 2OPRA 1UA0A 1GAOA 4EU0A 1DQAA 1HNIA 4NE9C 4AXIA 4Q8FA 2KDOA 3G8TA 2HS3A 2D1CA 4ZLLA 3I31A 5K8PA 3J80U 4CLSA 1P9YA 1SKRA 4U9RA 2Z4PA 2YPYA 2AZ3A 1PILA 1RWVB 2BKNA 1V6HA 4UY85 1JQGA 5FD1A 3QIPA 1BQNB 2CJBA 1VHIA 3NWGA 1U6FA 4IG0A 2ACMA 4TXSA 1BUXA 1NAQA 1Y11A 2F8HA 2ZH8A 1U1QA 4AL5A 5D4NA 2M7SA 5H9EK 1S0MA 2MQ8A 3FDSA 4X84A 1ZYQA 2X51A 1HQ2A 3GYXB 2FJEB 1C0UA 3POTA 2BE2A 2ZD1B 4LFAJ 1BC6A 3UNGC 4RNNA 4QR2A 2YH1A 2PT0A 3LAMA 3G71S 4NZ7A 1OPZA 2IFXA 4ES3A 4HI2A 2ZDOA 1NDPA 2FJDB 2XSJB 2DHAA 1PJ7A 2XY5A 5L8RC 3GYGA 4KFBB 4OMFG 2DCUB 2OELA 3M2UB 1H3DA 4FYVB 4PPZA 2FVQA 1N34F 2AJQA 3Q24A 1BD6A 4ZLJA 3AQPA 3NAIA 2OPRB 1IKWA 4IFVA 3DOMA 1HNIB 2GZOA 2ACYA 2JX2A 2DH7A 4WFBQ 5KT6A 5KFUA 4LF8F 5ETKA 4LQ3A 1L3KA 6FDRA 2RVJA 6AT1B 1CEZA 5A6PA 2QL7B 3QGIA 4I2QA 3SEOA 3QIPB 1G2EA 1HA1A 2VQFJ 4IG0B 2OSRA 2GHVC 2HNYA 1FO1A 4OLPA 2QYGA 2KL8A 2V67A 2LQ9A 3N9UC 2RRNA 2J0WA 2IIHA 4C8KA 2DXDA 3ISNC 3R7SB 1C0UB 3POTB 2BE2B 1V3SA 2UVUA 2DNOA 3D66A 2AEFA 2O01C 2PMZD 2KZZA 2B9EA 5DZ7A 2EC2A 5D78A 1U0SA 4DV7F 2NXNA 2BJDA 4LF4J 3B6BA 2C28A 3PRVA 3J81Y 4A48A 2ZDPA 2C2NA 1WEZA 1DTQA 2I1RA 5B0BA 2H3EB 5J2PA 3OL8A 1X4FA 5GAEI 1WHYA 2RS2A 2M2BA 3NMRA 4ECXA 2ZH2A 2O66A 1FT8A 4RL1A 4DR3F 1IKWB 4IFVB 4KPCA 3DOMB 2G1DA 4CLUA 3R6LB 5A2QU 3PRDA 4CZCA 1TUGB 3NWRA 3L7OA 3QNWB 3PTWA 1S9FA 4LF6J 1VC0A 4KGMA 4OX7A 1Q78A 1EIYB 3FBEA 2ZKTA 1X9SA 2U1AA 4I2QB 3KTQA 1GMVA 1KHWA 2IVFB 1YJ9S 4DX7A 4NXNF 2FUG9 4DSJA 3GIIA 2CNOB 1K1SA 4F4YA 1UETA 4CWBA 3W9JA 2HNYB 4QJVA 1N32F 3BR9A 2W2MP 4DPTA 3TA0A 4OI0A 3TZXA 3VAGA 1CJTA 3EVMA 2DGQA 1WD6A 3G86A 4MTPA 4Q45A 2ZHAA 3HCXA 5L38A 1B0VA 3MPVA 1URRA 3G87A 4UUXA 1S5ZA 4JI2F 1ZS6A 4ED5A 1WF2A 2XB2D 1KFDA 4C11A 1VQKS 2D9PA 5KAKA 2A1BA 1WDTA 1NK8A 1DTQB 2FHJD 3M8QA 2HAIA 2KJWA 3ADAC 5DG9A 1UEVA 5J2PB 3M4XA 3FSYA 4F4AA 3AJ2A 1ZAXA 2UUBJ 2DNNA 2QA1A 5IT9U 1NSQA 5A0YA 3H2UB 3H5SA 3NS7B 2RH3A 1HQUA 2H48B 4FKXA 4YR2A 3CCVS 1S79A 4ZP7A 2RU9A 4CNZA 1X4EA 1H73A 2QMWA 4RW8B 4LUBA 3VVTA 2JVOA 3TQ1A 1LV5A 3D0HE 5J2NA 3J81U 1G4CA 5F8MA 3GCWP 3FC9A 4F3QA 3NLCA 2A18A 5I42A 2OI2A 2DGOA 5ETSA 2POKA 3C6TA 2QIFA 1EHWA 3FQLA 1VR6A 1RAOA 4N7TA 4C8NA 1GMUA 3A3NB 1H2VZ 1CJTB 1N33J 4YFUA 3MM8A 2W25A 1WJ9A 1IWAA 1QSSA 4A8WA 3ZZTA 3BR8A 1X4DA 5E3RA 1X60A 4C11B 4DV6J 4NLYA 3W61A 2IPOB 5D0HA 4YQWA 1YJVA 4UOCA 2DEIA 2DR7A 2HSEB 3M8QB 3PJWA 1HPZA 3H8YA 1UVNA 2LA6A 2MZRA 5KT7A 2V2VA 3U1LA 2IAJB 3SCIE 3V6JA 5A0YB 5EWGA 2WOMB 3G8SA 2UUWA 1HQUB 5KFZA 1UFKA 3BBCA 4LBPA 2Q79A 3CCLS 1WDDA 5I3UA 1KKHA 3NEKA 4DV2J 2V9WA 1GFWB 2RSQA 4NYOA 1HWLA 3CUNA 1S76D 1S4EA 3W8GA 1S1VA 3Q2TC 4P2SA 4FPIA 5J2NB 4ZP8A 2KTQA 4W92B 2VG6A 1TFYA 3O1LA 4QBUA 1NSAA 2BA9A 2AF6A 4KR0B 2VQEF 2XS5A 5JVGQ 8ATCB 1RWPB 4P10A 1OQ3A 5I42B 1VISA 5FJ4A 3H59A 3C6TB 3H7HB 2VBYA 2G0JA 3MR2A 2IRYA 4CQ1A 3EZUA 4WIIA 5HVHA 4OYPA 1U6ZA 3MM8B 5HANA 2MLZA 3D3CJ 2OPQA 4KJIA 1RBOB 1PYSB 4X4SA 2MKHA 1R8PA 4RNMA 4DEZA 4LF7J 3HKZD 3OD2A 1X0PA 1HBMA 2N82B 2LEPA 1IR1A 2XLKA 5J1NA 3OTOJ 1U1RA 5ETNA 1FFGB 4L74A 5HSPA 2DNYA 5M2UA 1VS3A 3CCSS 1LXNA 1SJQA 4ELTA 2RILA 1ZTTA 3AODA 2XZTB 5A6WA 4WP8A 3CT9A 5I3UB 3EZOA 4NRTA 4ZVEA 4PR6A 5KT4A 4MYTA 2AP6A 3TI0A 2VKZG 2ABYA 1S1VB 2WB1D 1M0SA 2CQ3A 5EX0A 1P9QC 1F5CA 2M88A 3FGVA 5IFMA 4NCBA 3DRSA 2X3DA 2VG6B 1NSPA 4DPXA 1UFWA 3IA0A 1WSVA 4Y2IA 4UQTA 3IN5A 1OIAA 3VWSA 4B3MF 4OI2A 5CD4H 3TYTA 4ED4A 4B3SF 4OHYA 1RKJA 8AT1B 2HNDA 3CCJS 3DLJA 2XMJA 1TL1A 1FJGF 4FF2A 4ZJLA 5KFVA 2D3O1 1Y0HA 1RTDA 4PG5A 3KG4A 4JI6F 3KNAA 1F2HA 4E0DA 4ZPAA 3IFEA 2D69A 2OPQB 2L3MA 3UW1A 3N0VA 4FF1A 3K2YA 1LWCA 1KBRA 4DCPB 1HBMB 3BKTA 4XDDA 3OL9A 4ID5A 2DK2A 5ETMA 1FNXH 1VQPS 2Q66A 1FNMA 3CIMA 2BE7D 3KMQA 2HFOA 3PRBA 2L48A 3DLGA 4C3KA 3KLHA 1T9XA 4USIA 3KJNB 1VDHA 1QY7A 3AD8C 1O5JA 2W8LA 4ZJOA 5KT2A 5AE3A 4JI0J 2YKQA 4XO0A 1Y00A 1B4SA 3ENVA 1VQNS 2DGXA 2RRBA 3O6QA 4RX6A 1S59A 3R5GA 1R8AA 2DXFA 5KG3A 2DNRA 3DRSB 2GCFA 3GIKA 2RIJA 2PEBA 5D77A 3LWMA 1ZTWA 2YY3A 5HO4A 1OYEA 3HK2A 4CH7A 3GJSB 4ZCLA 1HNXJ 3I56S 2GFFA 2FLPA 1TAQA 3CC7S 1VK8A 2OAUA 2L08A 3KG1A 2FHMA 3MMBA 3PW7A 1HWJA 3JAMU 1TL1B 2MQOA 3BREA 4H4MA 2F8MA 1RTDB 3J7Z5 2EK1A 3ZZYA 2GIRA 4OYMA 1SPBP 4WK1A 2C3UA 2YWKA 2QSFA 2LQBA 1S57A 4XIUA 4IOCQ 1LWCB 3FEXB 4W90B 4N77A 3CMQA 2B4OA 1TL5A 3T1AA 4P52A 1ZZNA 3PYFA 1LEOA 2HHTA 2LECA 2DB1A 2DNZA 4ID5B 1SJFA 3HSJA 4UOHA 3I6PA 1KQSR 5HL7Q 2D7SA 3DLGB 4DUTA 3B78A 3IC1A 4NLDA 3KLHB 1A6LA 4CIOA 5KOXA 4DX6A 3F56A 3O5TB 3BEGB 2E5GA 2OD4A 2HVEA 2IRUA 2Z2YB 2WZ1A 3SCKE 2I2YA 4NLWA 1DARA 2OLWA 4M5DA 1AUSL 3IBWA 4PQUA 5LT5A 4M5HA 2W01A 3NGSA 1NB2A 4ECQA 3BQ1A 2JEGA 1FK9B 5LSRA 3IWXA 5DZ6A 1D8ZA 1LK5A 3R1LA 1FX4A 2FTRA 1GH8A 4TU9A 4PKDB 2W9BA 4WFXA 2QFJA 1WF1A 4ZIVA 3LOUA 5F8JA 2BE9B 2XZDB 3L7PA 2R7RA 1WI6A 2CQ4A 4JYAF 2BM0A 1NCLA 1D1UA 3KDOA 2Z57B 3MMBB 3OL7A 4Q5VA 4NASA 2HWIA 3SDEA 4RO0A 1FEEA 1I5OB 3FEYB 5F3ZA 1WOPA 2QX0A 2XULA 4JI7J 2FC8A 5M2PA 1F6TA 2V6AA 2EEYA 2E29A 1EAYC 2R8HA 4PG6A 3BZQA 1VLYA 4QYRA 1Y4ZB 3QSYB 1U24A 3QGPA 4G1QA 4ENOA 4M5MA 4CO1A 3BV8A 4DL4A 4X4RA 3KHRA 5LSOA 4LF4F 3IM9A 1S1XA 2KYZA 4ZVPB 3BYPA 3Q2SC 4K50A 3MPYA 4CT8A 5K9FA 4OZNA 2VONA 2BANA 3BGRA 3TQEA 3FZBA 2J6TA 3G8QA 1O6XA 3GG0A 1NHUA 1JNRB 3A1YG 3EZ5A 5KFBA 1FXRA 1QLNA 3D1OA 4M5DB 1RTIA 4PQUB 2Z0GA 1KOOA 1KLNA 2JH3A 3TRGA 1HW8A 4PZVA 3IXQA 4DR2J 1MWQA 4LFCJ 1X4AA 4DPOA 4Q2LA 1WG5A 1Q8KA 2FC9A 1ITPA 3EMTA 3GIMA 3TEHB 4J91A 2NXUA 2W9BB 4K7QA 3CCZA 4FF3A 2MZ1A 3K59A 2R7UA 3I4HX 2X1BA 1FERA 2HG4A 2YWWA 2V4JA 1GTHA 4HI1A 4B9LA 1GX5A 2N7CA 3D6HB 3EVOA 3GJRB 3SDEB 5B09A 3GR0A 4RWXA 2OFHX 2WVBA 2CPDA 4ITSA 3MAAA 2HIYA 2MQLA 5A76A 1RT3A 1RACB 2UUCF 2ZBRA 1RT5A 4G1QB 2UVRA 2V8PA 4DPWA 1NJXA 4CLPA 1S1XB 2EFPA 5CHCB 1FVSA 4A8KA 4PXBA 3AHPA 2RU3A 3A4TA 1PBUA 2PD1A 3OFHA 2UUBF 4U67Q 5JXSA 1LKZA 3WIVA 3P4UB 3AOBA 2BANB 2JZ5A 3BGRB 2DTJA 1FFSB 4RPFA 2YKOA 3RBXA 3H25A 3B82A 3R2CJ 4ED7A 4G3IA 4ZIWA 2F9DA 3MD3A 1RTIB 1UCNA 3OXLA 1F2GA 3I4PA 4BS2A 3BN4A 1M1KT 4OI6A 2HBZB 4WTOB 3HJVA 2CPFA 4YHHJ 4CCHA 2Z58B 2B4UA 3CCRS 5HN0A 3HT3A 1IR2A 3RW7A 3BSOA 3DU5A 4JBCA 3EYZA 2YWGA 2ZUAA 2DR8A 1QAJA 4HTIA 4USHA 4CH0S 2HZVA 1VQ8S 2V4JB 1ZETA 1AFIA 2XM3A 1W2IA 5IM0A 1IM6A 1RP5A 3KK2A 2FLLA 3Q22A 4YB5A 1IXKA 1QSYA 3W5XA 1M5OC 1WG4A 4L3KA 1N33F 1T9UA 3MAAB 1XERA 1IBKF 1CSJA 1RT3B 1VJQA 3QAUA 2H4WB 4Z37A 4HHUA 1RT5B 2MLXA 3OFEA 4K4SA 4DX8H 2N7YA 1Q1KA 2CZ4A 4R0EA 1QE1A 5L46A 4DF4A 3PIPQ 4FDFA 4I64A 5DM7Q 1NHKL 2E1AA 2C1EB 3HHKA 5A8RB 2GQQA 3WIUA 2DHHA 4TU7A 1RISA 2H5JB 5C2GA 5D4PA 3V81A 2RAQA 4K4ZA 5HQMA 4F0KA 1YBUA 4DG1A 4LF9J 3GLJA 4F4KA 5BJRA 3NS5A 4MYUA 2CQGA 4LRAA 4LRFA 2YQ3A 3N5BA 1EB0A 2AJ2A 4YDXA 1JXVA 2I6WA 1FRLA 1K8AT 1XNQJ 3FBFA 3VVUA 4DBQA 3J7AN 1TMJA 1RYRA 3JTPA 3W63A 2ZOMA 3AH6A 1YWXA 2YNIA 4B9TA 3PM9A 2EFVA 4IQMA 5KG2A 4QOTA 2FPHX 5IQQA 5IM0B 2GJ2A 3N01A 3KK2B 4DR6J 1IBLJ 4GKKJ 2R2UA 2CQHA 5CAAA 4DUZJ 2LU2A 3LP0A 2Q1LA 1YHQS 1VQOS 1I3OB 4DSFA 3SSSA 3HZGA 1HI8A 4F50A 2ZFHA 2KXHA 3VZHA 2ASYA 4DR4F 2NUUG 4ZPBA 4CLTA 1S0VA 4WFYA 1UPMB 1VI7A 2RDDA 1JNZB 4UOGA 3ZTPA 1F3VA 1Y5LB 2WSFC 1NH7A 2K3IA 2ZH4A 2BJ7A 4OYZA 5LOQA 5CABA 1XNRJ 2BQRA 1RBAA 3BPDA 1LWEB 3V81B 2CJAA 4DS5A 2MKJA 4YB7A 4DG1B 5A8KA 2C2RA 1X5TA 3TA2A 3IG1A 4X4NA 2XMTA 2LVWA 3G9CA 3GFXA 1VOMA 2FJWA 3T5KA 4AQYF 3DGPA 4MKYA 4EMDA 4Q44A 2YXLA 1M5KC 3DRRA 4NZ6A 2LA4A 1DQ9A 2MTLA 3I87A 4ZVQB 2GHPA 2YPZA 1M90T 2HRUA 4LF5J 5EHHA 2YNIB 3DGVA 1KHVA 2J0SD 3GP9A 5KFCA 3DU6A 1MMNA 4DL3A 5ETRA 3CDWA 4F8RA 4DQQA 3VHQA 1DURA 4M5IA 5F0WA 1ZZFA 2B3TB 2BQ3A 2CPEA 4U96A 3LP0B 3DOLA 1V5VA 3EPIA 4ZN3A 3NCQA 3D1QA 4Y2MA 3CXCR 3Q8RB 2K2PA 4OYAA 2IMOA 1MNEA 2CZVC 4ED8A 2K1RA 3QT7A 1RUSA 3EE3A 5KFIA 2I8EA 4MJKA 1JLAA 3CO9A 2R8JA 3CCWA 3O2IA 2FGCA 1KOHA 2CG4A 3QATA 1URNA 3CC4S 4DOZA 3MHYA 3KLVA 5KG4A 3SV4A 2EVZA 1NJWA 3KJVA 2XGQA 4OX9J 4B9MA 3Q8VA 1FNOA 4DF8A 3NGTA 4NXMF 4JI1J 2JWNA 4LR8A 4Y28C 4OX8A 3X3UA 4I4BA 5A8KB 4DQIA 3U27A 3IG1B 3EGWB 1GXLA 2YKMA 3P49B 4ZVHA 3CCQS 5KTQA 4Y6IA 3DGPB 2AZ1A 1PO6A 1F60B 1RDRA 2MJUA 1M5SA 1SC3B 3DRRB 3TNVA 4IUFA 3GB0A 4OI1A 5D0RA 1ZAWA 4WYWA 1HNXF 2CVEA 1RCXB 1QM9A 4B02A 4DV3F 3FBCA 1TL3A 5ETPA 4RW4A 1TR0A 4OQJA 1RT4A 3PJ9A 4OHZA 2H54B 2C2OB 4TKTA 3OHBA 1B3TA 3DOLB 3U7JA 5F41A 4PEOA 1V3RA 5HMWA 2OEJA 4B08A 5B08A 1UZHA 3HDSA 2F1FA 4JV5J 1RU2A 1HW9A 1JLAB 1SC1B 2BUNA 2UP1A 1AW0A 3PHEA 2HK3A 2GHWA 1TUVA 2X3GA 1OSDA 2KXFA 4AD6A 3MPWA 4CM2A 4CDIA 3KJVB 4CO5A 2XLIA 1U1NA 1NZAA 3PDNA 4D3HA 3E01A 1H38A 5GADI 1EQ0A 1HHSA 3RAQA 5HATA 4OFZA 3NG8A 5I4MA 2YKMB 1CBKA 4DL7A 1RYSA 4RJVA 3EX7B 3UD3P 1T3OA 3US5A 1X5OA 2J7UA 2OKQA 3MEGA 2HW3A 2V68A 3KOAA 3CJ8A 2KFYA 1GEHA 3I9ZA 1SL1A 5LM7E 4Y00A 2QL9B 7AT1B 2L9WA 1ZM2A 2VFVA 1TL3B 2ZWPA 4ZVOB 1RCOB 4RW4B 2NCKL 3CJSA 1RT4B 2ZE2A 2VOOA 1S6UA 2IYIA 3JSRA 2NSCA 1BGXT 2W7AA 2HHWA 1WG1A 1WKKA 4HDGA 3F41A 4MKVA 4JV2A 3AJ1A 4X4PA 2CDRB 1UVMA 3L7UA 3MR6A 1Q16B 2FVCA 1T3NA 3GMGA 2QN6B 2KG0A 1OY9A 1OPIA 2R2TA 4I0WA 2ZM6J 3M6UA 5BR8J 4X2BA 3V5RA 1P6TA 1O8BA 2DT9A 2QE5A 3THPA 4RW7A 1MN7A 2ZZMA 2KFZA 3WX4A 1T11A 3E01B 2DH9A 1QAYA 5KFPA 5FLXY 4ZP9A 3QSIA 3ZTOA 1TVRA 2PO4A 1AA1B 2MZSA 1RABB 4DR2F 4IR9A 2V4RA 4LFCF 2AEMA 3T3FA 4MMOA 4MFBA 2R42A 3SFUA 4LBHA 3VCDA 2J5AA 3MEGB 1VGYA 3LGMA 5J1EA 5J2MA 5KFXA 2WBRA 3V6DA 4C0BA 1AZSA 2HBQB 3EGVA 5K20B 1RWUA 2G13A 1NMEB 2PGCA 3UN5A 1JJ2R 1NSKL 3VQSA 1R0CB 3TAMA 2G2OA 1WHVA 3ILIA 2DYAA 2ZE2B 4R8UA 2E5HA 4EBDA 2JVRA 3M9NB 1IM4A 5AXKA 2K06A 4HHHA 2YNGA 4F3MA 3RB6A 2GNKA 1KFSA 2GO8A 2AJFE 3E8OA 1F5AA 2J9DA 4NLOA 2WK4A 2CQPA 2XMMA 4F7VA 1KVKA 4OZ5A 3LPYA 4ES2A 3HF5A 9ATCB 4XAKA 3I32A 3GZ7A 4PRFA 3QWPA 2VHGA 2EXUA 2XS2A 3VAFA 1RADB 1J5OA 3KLEA 3Q8QB 2AYGA 1R0AA 2FD2A 2QMUB 2BZ2A 4RU9A 2N3LA 3P5TL 2HMIA 2MQNA 1X9MA 4RW7B 2XQCA 2CZ9A 3AT1B 5KFWA 1YVFA 4FNHA 1QDUB 4S0MA 1FHTA 3FSIA 3QO9B 3M9MB 3I5BA 4OYIA 2Y8YA 4I56A 1TVRB 5HI7A 3IR6B 2JEJA 1RAHB 3QMQA 4NLPA 4FYWB 4C48A 2JEIA 1HI0P 3D2WA 4MFBB 1V3ZA 4NLVA 2ZZNA 5KFAA 2KZMA 2M0GB 1SQFA 4OI4A 2VPZB 5J1EB 5J2MB 2CAJA 4IG3A 2ROPA 4WFAQ 3V6DB 3L3CA 4DU8A 2XWXA 4WYLA 1YJ7A 1DY3A 1UMJA 4EEYA 1VQ7S 2EG1A 3GILA 2KU7A 2MJNA 3FRZA 3TAMB 1Q8IA 2E5IA 2AGPA 5KG0A 1TL7A 2CG8A 5H9FJ 1YRTA 4R8UB 4DL6A 1YDLA 4CI0B 1UW9A 1APSA 3UR3C 2G0IA 1NRKA 2YNGB 3GPAA 2RB7A 4X66J 5LMNJ 5DETA 2A3JA 1VQYA 1TZ0A 4ERDA 4U8VA 3RGIA 2J0QD 4WKRA 5SZTA 2MKYA 4KHPJ 4AL6A 2P5VA 1J5OB 4ZVSB 2OSQA 3KLEB 1R0AB 3ZZOA 5DDOC 3EUNA 2HMIB 1NZ8A 4OZ2A 2IJNA 3PO5A 2C2KB 4Q8EA 4Y2CA 2QYCA 1WNEA 4M5LA 3BDEA 2AX1A 4LF9F 1HD0A 2H1YA 2EK6A 1WC6A 1WUUA 1U1PA 3W9IA 5KFYA 2IA0A 1XNQF 4HEA9 1RWWB 2YX7A 2VJVA 4IG3B 2NXEA 3OR2B 4NA3A 3CCTA 1XMOJ 5CYJA 3IWLA 1IUJA 4DMZA 3IAS9 4YR0A 1TL7B 2FLNA 2R7SA 1IBLF 2B7CB 3SCJE 5CCLA 2GS8A 4ECVA 4P71A 4DCOB 2PEHA 4IO9Q 4WXWA 2XY7A 5THWA 5BYRA 4C0HA 1RU1A 2J9EA 5JUMA 1NJZA 1S1TA 4YS2A 1KP6A 1U45A 3WC0A 3M6XA 3PW2A 3BSCA 5AT1B 1X4GA 3ILJA 2PMWA 4K4VA 2H51B 4RR5A 2ZH6A 3L4BC 1ZPWX 2GVDA 2B51A 3NXZA 1ZM9A 4F4ZA 1BWVA 3MF5A 4LJMA 2DNGA 4K4WA 1XNRF 1FRMA 1VBZA 4JI5J 4OZ3A 3NGRA
chains in the Genus database with same CATH topology
4DN9A 2KO1A 3ETOA 5DO2A 2FJBB 2O5DA 5J1NA 3GIJA 1U1RA 2ZOFA 4O3RA 3C46A 1Y5IB 4PWUA 5I3PA 1N88A 2KI2A 1Y5NB 5CH7B 2DNYA 4WK3A 5A8RA 3DLKA 4FN5A 5M2UA 1VS3A 2B6AB 3CCSS 1LXNA 1SJQA 4ELTA 2DPJA 3QJLA 3R5BA 1PSDA 2VPYB 3M2VB 4YEAA 2RILA 1WACA 2DGSA 2BYCA 1NJYA 2C22A 2YKNA 1ZTTA 4DSLA 3AB2B 5T7LA 1YRUA 2Q3PA 1U4BA 1D3WA 1LFWA 4XPEA 4RW6A 1HD1A 5A6WA 4HL9A 1GQEA 4MK8A 3CT9A 5I3UB 1PC4A 2J8AA 1VIOA 1VHFA 1X5SA 2DO4A 3HHLD 2D3UA 4BHQA 5DG8A 4NRTA 4ZVEA 2R7QA 2CQ0A 4DWIA 1OWXA 3W7BA 4YY3F 4PR6A 2DNQA 5KT4A 4RUAA 1QVGR 2VASA 2AP6A 4MYTA 2HIQA 2YNFA 3TI0A 5DDQC 4DLEA 2VKZG 4Y65A 2ABYA 4AL7A 1IBMF 1B0PA 1S1VB 1FDBA 2WB1D 3ONQA 1M0SA 2HWHA 4LF5F 2CQ3A 5EX0A 3UD4P 2ZJRQ 3Q8SB 1P9QC 1F5CA 2M88A 3FGVA 5IFMA 1RT2A 2UV8A 4NCBA 1RTHA 1YJWS 3DRSA 1WHWA 5B0CA 2VG6B 3MOZA 1NK6A 4NCGB 5DQIA 4HT7A 1UFWA 3IA0A 3DXBA 3DOKB 1SKWA 3V4MA 4MH8A 4Y2IA 4UQTA 1U2RA 4K2XA 3IN5A 1C1BA 4IH6A 1QVFR 2VFUA 1NU4A 1OIAA 3VWSA 4KGKA 4B3MF 3PW0A 2HVIA 4OI2A 5CD4H 3OJUA 1H0HB 1XBWA 3TYTA 2B5JA 5E41A 1JX4A 3J7YU 1NB7A 4B3SF 2FDNA 5DLFA 5IT9Y 4OHYA 1RKJA 1JXLA 2UXDF 3ENQA 3DLHA 2HNDA 1X4HA 4CO2A 2B9XA 2JOQA 3CCJS 3M9OB 1RT1A 3SCLE 4ZPWR 4Q2MA 3DLJA 3PW4A 1FDDA 4EFAC 4X4UA 3T6BA 3OTCA 3JYTB 1TKTA 3OVAA 5LMNF 1RT7B 4WFZA 3I0SA 4C3MA 2XMJA 5KFGA 1TL1A 4FZVA 1FJGF 1CLFA 3KLIB 2RQMA 3I0RA 3SMZA 4FF2A 1KNZA 2BR0A 5KFVA 4YB1P 2UXBF 1D9DA 1RQ0A 1S1TB 1Y0HA 1WELA 5AE1A 4ZMMA 1RTDA 5IS2A 5BYSA 4PG5A 3HXMA 3KG4A 4LIRA 4JI6F 4K4TA 1SL2A 3KNAA 2AV5A 4E0DA 4FVCA 1X4CA 4BWMA 3VAHA 2R7TA 4ZPAA 2ILZA 4B9UA 5F8NA 1WTFA 5J2QA 4PCQA 5CYQB 5L1KA 3W3SA 3SFGA 3IFEA 3DLBA 3OUYA 2JFDA 3MTJA 2PA8D 1S4FA 2OPQB 5EUHA 4FPRA 2LXUA 1BQXA 2L3MA 3UW1A 3N0VA 4FF1A 3K2YA 1XR6A 3MMCB 4I6WA 3PZPA 2MZTA 4Y3CA 5E3QA 3LP1A 4JUZA 1LWCA 4DV6F 4IRKA 4NYZA 4IOAQ 2CIMA 1W25A 3FMBA 3M8RA 1HBMB 1JLFA 1MWZA 4ECSA 4C97A 4IKAA 1FRJA 4XDDA 3OL9A 1KS2A 5G4DA 4RBVA 1FRIA 4ZPVR 4OX9F 3CJ0A 2GQ2A 4ID5A 2XCAA 2DK2A 3CJKA 2Y1IA 4NLTA 1FNXH 1VQPS 3NCPA 3P96A 3T1YF 2Q66A 3MTKA 4Q43A 1FNMA 3CIMA 4JI1F 4B9NA 3KMQA 5DG7A 2HFOA 5L1JA 3PRBA 1N5VA 2Z8QA 2X1FA 4PG4A 1YGYA 3LAKA 3P3DA 1LFPA 2HGNA 2L48A 3DLGA 4C3KA 3DLKB 5KFJA 2MGZA 4KQZA 3KLHA 2PIIA 4JI3F 1Q4RA 2VFRA 2VC1A 3HJFA 3CMAS 4F25A 2JC1A 1UVLA 1A9NB 4USIA 3IGNA 3PX4A 4DSKA 2YKNB 4L6V3 1LWEA 3HO1A 2R7WA 1AROP 4RW6B 1QY7A 1O5JA 2EPIA 2W8LA 1HMVA 5HMXA 1U09A 4DV2F 3RAXA 1ZAVA 3CJ3A 5KT2A 3RB4A 2E1MC 5AE3A 2YKQA 4XO0A 5F8HA 1R89A 5KG6A 1Y00A 1UWBA 4RZRA 2YNFB 1VQNS 3ENVA 1XR7A 4TYBA 2DGXA 2RRBA 5M2RA 2ASDA 1VQ5S 2ZOGA 4O3PA 3M2RA 1SJ4P 3CD5A 3O6QA 4RX6A 4RKUC 1R8AA 2F9JA 5E7OB 3L09A 5KG3A 2E1RA 2U2FA 4KHMA 1RT2B 2QZ8A 3AA9A 1RTHB 2DNRA 5ITHA 2ZJPQ 3G6YA 3DRSB 2GCFA 3GIKA 2RIJA 4MIAA 2EKYA 4CO3A 1J2VA 3U1NA 3BQ0A 5D77A 3HM9A 3LWMA 1ZTWA 2YY3A 5HO4A 3C6UA 1C1BB 1X5PA 2HS4A 4RLEA 3HK2A 2P6TA 4CH7A 5HLFA 3UQSA 4ZCLA 4NLSA 3HZEA 3HVRA 3NS6A 3I56S 2B5JB 4N8NA 3SSQA 1A7GE 2GFFA 2FLPA 3CULA 1TAQA 3O44A 2ASLA 3GV5B 3CC7S 1VK8A 2OAUA 2L08A 3KG1A 5K14A 3T5JA 4FNIA 2SXLA 3KYLA 1RT1B 3I96A 4YR3A 4C8ZA 2FHMA 2R8KA 2HHSA 3MMBA 1R8BA 3PW7A 1HWJA 2FIUA 1TKTB 3I0SB 1TL1B 2MQOA 2CPXA 3ICLA 1VBYA 1DLOA 2COLA 5D4OA 1NEEA 3BREA 3I0RB 2YH0A 4QIWD 4O3QA 3R5AA 2MKSA 3THVA 4H4MA 3MFIA 4PG7A 2F8MA 2IBOA 1RTDB 3J7Z5 2MKCA 4ECTA 5IT0A 1KD1T 2QO3A 3NP5A 3QJPA 1QUVA 2NSBA 2V0NA 5BYQA 1Q53A 4JV5F 2EK1A 4WE1A 3G4SS 4JOUA 2ATLA 5J2QB 3ZZYA 2NS1B 4A8MP 1HNVA 2AD9A 4R25A 5T14A 3FRYA 2BW2A 2UV8G 4F67A 2GIRA 2RDIA 1XK8A 3OUYB 4J9QA 3DHXA 1ZOTA 2C3UA 2M8HA 4WK1A 2ROGA 3CGIA 3OXFA 1MU2A 2YWKA 1SBRA 2XSFA 2QSFA 5KG5A 2ZH3A 2LQBA 2G9OA 3PVXA 5B0GA 1KQGB 2ZHOA 4XIUA 4LF7F 2CQDA 2XO7A 4FXDA 4RUHA 4IOCQ 3LP1B 5L1LA 1LWCB 3FEXB 1MSWD 1SIZA 1M5PC 4N77A 2A2CA 2B4OA 4W90B 3JTNA 5GAHI 1TL5A 2ALZA 1FTRA 3T1AA 1GXUA 1JLFB 1C4CA 4KV8A 2H5EA 2UVWA 2DBBA 1ZZNA 3LGNA 1NK0A 1SJRA 3PW5A 2OH2A 4EYIB 2FHKA 4O3SA 2HHTA 2LECA 2DB1A 2DNZA 4A8SA 4ID5B 1SJFA 4Y2KA 3CJKB 3OTOF 3I6PA 4IYQA 1VJWA 2HWTA 2ZH7A 1KQSR 3OTEA 1C2PA 1U47A 1FESA 1N0UA 3KK1A 2D9OA 5KFLA 2D7SA 2LCWA 5HL7Q 2F3JA 3DLGB 1N56A 3B78A 3IC1A 4NLDA 2MGZB 3KLHB 1A6LA 4CIOA 5KOXA 3R5CA 2VZ9A 1S1WB 3UCUP 3AAWB 5KFNA 1JJ4A 4KTQA 2QLWA 3F56A 1HYSA 3O5TB 2DHGA 3BEGB 4NYPA 3OL6A 2EBEA 2E5GA 4N47A 2F4VF 3OLAA 3CJ5A 4DUYF 1D0EA 1DHMA 3MMJA 2HHQA 3PKYA 1N6QA 2OD4A 3IO1A 2J6UA 2IRUA 3NMAA 3TVYA 4LMZA 1SH0A 3SCKE 4N76A 2I2YA 4NLWA 1MMDA 1DARA 1HMVB 2ADCA 1RKIA 2OLWA 2PC6A 4V19J 4B17A 4M5DA 3TAQA 4RBTA 3IBWA 3HKWA 4PQUA 2V5HG 3S6EA 4IR1A 3B4MA 1N54B 5LT5A 2PA3A 3OFFA 1MWYA 4URGA 3IAM9 4QR0A 4ECRA 5HROA 4B3RF 3DRYA 4ECQA 3BQ1A 1UWBB 2JEGA 4K59A 1FK9B 5LSRA 3BS9A 1N4LA 3M2RB 3IWXA 5B7WA 3PNIA 2CJ9A 4M95A 1FXLA 1D8ZA 4BC7A 2XI3A 5E3AA 1LK5A 2VPXB 2XGPA 2K7JA