2B0GA

Solution structure of drosophila melanogaster snf rbd2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
AQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Drosophila melanogaster SNF RBD2
rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b0gA00
1VQPS 1WWHA 3RW7A 5GMKa 2MHNA 2CPYA 4OZ1A 2D9OA 1O0PA 2DGVA 2E5HA 2QA4S 1U2FA 3ZZYA 3JB9k 2VOPA 2FY1A 2XS2A 2PEHA 1VBXA 2E44A 1SXLA 2K8GA 1UFWA 2GHPA 2RU3A 4QU6A 3IWNC 3U1MA 1RKJA 5CXTA 1NO8A 1OPIA 3SXLA 2D9PA 2MKJA 3P5TL 1FNXH 2F9JA 3CC7S 2MZQA 2DITA 1WEYA 1FHTA 4A8XA 2L9WA 3P3DA 1VC5A 1VQNS 1M90T 5GVQA 2DNQA 1VQ4S 3B4DA 4OZ0A 2DGSA 1N52B 3SMZA 3U1LA 5DM7Q 5H1SV 2F9DA 2M7SA 2KFYA 1W2BR 4IUFA 1JJ2R 2L41A 4Y00A 1X4CA 2CPFA 2VONA 1FT8A 2OIHA 1VQKS 2XNRA 1U1MA 4W90B 2DGXA 2E5GA 1A9NB 1SJQA 2CQPA 3HHNB 1WHVA 1FJEB 1BY9A 3CULA 3CCJS 5JVGQ 2LECA 1YIJS 2KM8C 3UWTA 2RNEA 2MQOA 3G96A 2KRBA 2F3JA 1S79A 2DNNA 4WCEQ 2XB2D 2M2BA 4Z2XA 1VQMS 1P1TA 3CXCR 2X1GA 3MUVP 3FEYB 3R27A 4PRFA 1X4EA 2M0GB 1N88A 2DGWA 2M70A 4CH0S 1XN9A 2RS8A 2HGLA 2E5JA 4UQTA 3LQVA 1X0FA 1U6BA 2CPZA 1ZZFA 2YKAA 3THTA 2MPUA 1FJCA 5CYJA 4F25A 1WHWA 2DB1A 5EN1A 5GAHU 1WHXA 3B4MA 2EK6A 3DLLQ 3CPWR 2FPHX 2DHSA 4LIRA 2CQBA 2KG1A 1WTBA 3MOJB 2I2YA 2LXUA 2MQLA 2MKIA 1NU4A 2DHAA 1U1KA 2HGMA 3R1HA 3CCMS 2LYVA 5CA5A 3CCRS 3P49B 2MZ1A 2CJKA 1QM9A 2KRRA 1M5OC 1SJRA 2KVIA 2CQ2A 5DDPC 2ZJQQ 2CQCA 1X4GA 2DNZA 4CH1A 2CQHA 3UCGA 3I55S 3R1LA 2DGTA 2CQGA 5LSOA 2EVZA 2RRAA 4J5OA 3MURP 1VQLS 4UY8T 3G8SA 1X4FA 2JWNA 1OO0B 1U1LA 2OTLS 1M5KC 1G2EA 1DBDA 3CD6S 4U67Q 3NNAA 3CF5Q 1UP1A 2X1BA 3FEXB 2M52A 5LXYA 3G4SS 1A7GE 1DRZA 5DETA 1CVJA 1WHYA 2MZRA 2U2FA 1VC0A 2KXFA 2MKCA 1HD1A 1K9MT 4WF9Q 2NZ4A 2LMIA 2M9KA 3MD3A 3UD4P 2MB0B 2MSTA 2CPIA 2MZJA 2MQMA 2DNGA 2U1AA 2RQCA 2Q79A 3I56S 2L08A 4TU8A 3EGZA 1FJ7A 1WEZA 2DHGA 3NS5A 3VAJA 3CMES 5LJ3Y 1U6FA 3CCES 5DDRC 2RS2A 1Q81T 4F02A 3N9UC 4C0OC 3PIPQ 5HL7Q 1VQ5S 2FC8A 4QU7A 1KD1T 2NLWA 1JJ4A 2UP1A 4CIOA 1WG5A 2ADBA 3VALA 1YITS 4RU2A 2LXIA 4W92B 2YH0A 3CCSS 5JVHQ 1WF0A 2MQQA 5DDOC 2AYBA 2MKSA 1KQSR 1U1RA 3MUMP 4YB1P 2MKKA 1QVGR 1VC6A 3VAMA 2M8DB 3MI7X 2CQ3A 1PGZA 2FC9A 2ZJRQ 2CPXA 2MZTA 2HZCA 3D2WA 2KU7A 4FXWA 3BEGB 2KI2A 2JVOA 1YI2S 1R8HA 4C4WA 4ERDA 2J76E 1UW4A 2DGUA 4CQ1A 4TU9A 2XS7A 2D3OR 2MQNA 3J7ZT 3SDEA 2DNOA 1K8AT 2XNQA 5BJRA 2LKZA 3CC2S 4WKRA 2DO0A 3K0JA 3VAGA 1VQ8S 3VAHA 4LJMA 4ZKAA 2XS5A 3SDEB 2DNYA 2BOPA 1Q7YT 5MLCV 3BS9A 4WFNQ 1YHQS 2MXYA 1X4AA 1DHMA 3CC4S 2JX2A 2WBRA 2KXHA 2MJUA 1YJNS 1H2VZ 1N54B 2ADCA 1F9FA 2QFJA 2DNKA 1WEXA 3RW6A 4TU7A 1M5VC 2LA4A 3US5A 4IOAQ 2E5IA 4PKDB 4BS2A 1VQOS 2MZSA 2MQPA 2DIVA 2BZ2A 3NMRA 2LCWA 2HYIB 2MSSA 1RK8A 1VQ9S 4WFAQ 5GAEU 2KM8B 4WFBQ 4ED5A 4F26A 2MGZB 1H2UX 2CQ0A 2X1AA 1WF1A 3V4MA 2MYFA 1AUDA 1X5OA 2MMYA 2LEBA 2RVJA 1JMTA 1WI6A 1R8PA 2V94A 3ULHA 3G8TA 1WI8A 4QPTA 2KG0A 3LPYA 3J7YU 2FHOB 2MY7A 2QEXS 1U1OA 2VODA 2YH1A 2ERRA 3PIOQ 2DH8A 2DO4A 2PE8A 2YTCA 4P6QA 5LSLA 2RRBA 3Q2TC 2DNMA 1VQ7S 3MXHP 3CCVS 1VQ6S 2CPHA 2MKHA 1WG4A 1DZ5A 5LXRA 2SXLA 1K73T 2DISA 2M8HA 3S8SA 1SJ3P 2G4BA 1X5PA 1YWXA 3CCQS 1S72S 5D78A 1FO1A 1X4HA 2RQ4A 1HL6A 2JRSA 1P27B 2X1FA 4YUDA 2LEAA 2CQ1A 1VBZA 1FXLA 2MJNA 3BO2A 4WIIA 3G71S 2AD9A 5IM0A 1SJFA 2VOOA 2CPJA 5GADU 1KOOA 1PO6A 3TYTA 4YOEA 3MDFA 1M1KT 2MY8A 1ZZNA 2KHCA 2M88A 2G0CA 3BO4A 3S7RA 3EGNA 4PR6A 2CQ4A 4IO9Q 2N3OA 3TP2A 3OW2R 3G6ES 5D77A 2KXNB 5LJ5Y 1X5SA 3CUNA 2DIUA 1X4BA 2CQIA 1Q86T 3TO8A 4C7QA 2EK1A 1D8ZA 2KH9A 4IOCQ 3P6YC 1D9AA 1U1QA 3MD1A 2I38A 2N3LA 2J0QD 5IM0B 3VAFA 3S6EA 1URNA 1X4DA 2O3DA 1ZH5A 5FJ4A 1WELA 2CQDA 2G1DA 3CCUS 2DHXA 1M5PC 2OJ3A 2AYGA 2OTJS 1OIAA 2GO9A 4LMZA 1H2TZ 1L3KA 2AYEA 3UCUP 1YJ9S 1U1PA 2DH9A 2N82B 4V19X 1IQTA 3S01A 3DXBA 2A3JA 5DM6Q 1U1NA 2OSRA 2CPEA 4Y0FA 3HI9A 1WF2A 3NNCA 3CCLS 1B7FA 3BO3A 2LA6A 5HO4A 3H2VE 1NJIT 3THPA 2KT5A 2LQ5A 2DNRA 3VAIA 2CPDA 1H6KX 4M5DB 2N7CA 3VAKA 3Q2SC 2B0GA 1KC8T 4FXVA 2DNLA 3UCZP 4EGLA 5IFMA 2DNHA 3UD3P 2K3KA 1KOHA 2M4MA 1VBYA 3NNHA 2OSQA 3L3CA 5DDQC 3CTRA 2XSFA 1OWXA 2AYMA 1HD0A 3ZZZA 2KN4A 3H2UB 2DNPA 1YJWS 1HA1A 5GAGU 1SJ4P 1JJHA 2J8AA 3IRWP 4TLQA 3CMAS 4QQBA 3VF0B 1N8RT 1QVFR 3NS6A 1X5TA 5ITHA 2JVRA 2DGQA 3EX7B 2J0SD 2RUGA 5IQQA 2RT3A 2DH7A 2DGOA 3MUTP 2YWKA 2DK2A 2MGZA 2KYXA 2HVZA 2ZJPQ 1Q82T 1UAWA 1YTYA 3UE2A 2HGNA 3G9CA 1WG1A
chains in the Genus database with same CATH superfamily
1VQPS 2M3DA 1AZSB 4GO5X 4RW6A 2MHNA 3FZBA 4OZ1A 1RBLA 1BC6A 4MIWA 3D68A 3RB4A 1UA0A 1IUJA 2HBRB 4F3QA 5A8KA 5KG4A 3BGUA 2ZUGA 2E5HA 2KJWA 2QA4S 1U2FA 3PYGA 2XGQA 4LFAJ 2B8PA 1TFWA 3ZZYA 1U2RA 2F1FA 3LAKA 2GCFA 8AT1B 1CG2A 2IPOB 3MEKA 3SBMA 3KK3B 1V3RA 2QMWA 5LT5A 3OHBA 2HHPA 3D1HA 3TEHB 2KJVA 3U1MA 3V81A 3MEEA 5CXTA 4TY8B 3AD7C 2XC9A 5KFKA 4QIGA 4ID5A 2Z0GA 3SXLA 4UOGA 2YKPA 3BYRA 5SZTA 3J7AN 2CYYA 3WX8A 5GAHI 4RO0A 1FNXH 4QWEA 2NUUG 1S6QB 1X9WA 4FYXB 1NLKL 1S1XB 1WEYA 2KO1A 1DTTA 3J80Y 4CLLA 2HVDA 4HYKA 2R8GA 1VQNS 2CDRB 2XHWA 3GFZA 2GA7A 2HFSA 2ZOFA 2ZHBA 3VZIA 1QTMA 2GQ2A 3BSAA 1VS3A 4K5RA 5DGAA 3SMZA 3NEKA 4UY85 1XR5A 1TL3A 3JSBA 1EKSA 4HT7A 2I9SA 2MHEA 5DM7Q 2K7KA 4YN3B 3IMQJ 4NLWA 4DS5A 2XTJP 4OYXA 3TOQA 4DFMA 1W2BR 1KVKA 2L41A 5DQGA 5A76A 1JLCB 4MJKA 5BYSA 4ECYA 2EKNA 1YBTA 2N7YA 3M32B 2NS1B 2ZM6F 4FP9A 4O3PA 5CD4H 1OY8A 3H5SA 3ZZPA 1UEKA 3BSNA 2HRUA 3ILIA 1SUQB 5I3UA 1JKHA 1SJQA 1S1XA 1XNQF 2ROGA 3X1LB 4LR7A 4C3MA 4CZCA 1TAQA 4RJVA 1KVIA 3UWTA 4LF5F 2R7TA 1SPBP 5IV4A 4OX8A 3G96A 3N0VA 5T7LB 5ETQA 3MM5A 2W7PA 2ZH3A 1FTRA 4C11B 1KP6A 1OSCA 1S97A 2HAIA 3AXMA 1RADB 4ANCA 1GFWB 1KQGB 4Z2XA 1P1TA 2HFZA 3IM8A 1RTZA 1PYTA 4IH6A 2FHJD 3R27A 4K8RA 4JI5J 1B70B 3NGRA 1X9MA 2ABYA 2DGWA 2Y0BB 4KV8A 2EWHA 4H4MA 3S1TA 5ADZA 3KUHA 4YP3A 4NCBA 4G3IA 4QWBA 5BYQA 1S9EB 3OHAA 1RAOA 4WIQA 4LSLA 4W98A 1B4SA 3V6JA 2E5JA 1T3OA 4UQTA 1P8GA 1BWVA 1B99A 1RT3A 2CPZA 4IH5A 1UVIA 2OUGA 1JLEB 3THTA 4DDFA 4USKA 1UVMA 3EWGA 2V5HG 2FLOA 3KLGA 1VRQC 3HFKA 3IM9A 5EN1A 1S9GB 2J9EA 3EDRB 3A8IA 5AXMA 5HJYA 3DDIA 3BN4A 3DLLQ 3F41A 3CPWR 2FPHX 4PABA 2YQ0A 4DV1F 4IG3B 2DHSA 2V69A 2QIFA 3TX8A 2ASLA 3MOJB 3KLHA 1D3WA 2R7VA 3EVWA 2I2YA 1RTHB 3MAHA 2IYIA 1RAJA 3C6TA 2VQFJ 1QAJA 2UXCJ 2VBZA 3R1HA 2BX6A 2P5VA 4IKAA 4MMOA 1KQKA 3R9LA 3KK1A 3HVRA 5KTQA 2QA4G 2UUAJ 1HARA 1PSDA 2RHQB 4GKJF 1NSKL 2B4VA 2WTFA 3NLCA 3DKDA 3B78A 1MROA 5E7OB 2KRRA 2CJKA 1M5OC 3ADAC 4RWWA 4G6VB 2YNGA 2GC8A 1T8EA 2DR8A 4LF7F 1TUGB 2LLZA 1FDAA 5FLXY 1FDNA 3LP0B 1FFSB 4LFAF 4HI2A 1NSPA 3QNWB 1RTIB 2HQIA 2YKOA 2N4CA 3HHLA 3OTDA 3M8WA 4ID8A 4A46A 3AFGA 4J5OA 1R8CA 3FK4A 2ZE2B 1YQHA 3UDCA 5ETSA 1HYSA 2JWNA 1WC4A 3THVA 2P2CB 3BGRB 3PG9A 4C98A 5JXSA 4YB7A 3DLGA 3DMJB 3HHLC 3LGMA 3G6XA 1DQAA 3AB2B 4WPAA 2LEPA 3CJ2A 5L1KA 1RTIA 2OAUA 3RBEA 5H9EK 3MM7A 2RHSB 1UP1A 1Y0HA 5HMWA 2YNHA 3LAMA 3UVJA 2NXEA 4M5MA 1HNVA 1T9TA 1KBRA 1W26A 2CXEA 2BEFA 2M52A 4LREA 1RISA 4PXCA 2UXDJ 1RWVB 2HRYA 2O1PA 1NDLA 1PG5B 4ED2A 4NRUA 2HLUA 2JLEA 3DOLA 4ZVHA 4ZCKA 2HWTA 3BM7A 4IO1A 5B0BA 3HMJG 1H38A 1PAUB 1ZPWX 2OHDA 3PO5A 2F7VA 1AYEA 4EI2A 2QA1A 1NAQA 3AAWB 5L1LA 4C9DA 3QJJA 3T9NA 4PPDA 4PZVA 3HZEA 3OT9A 2DNGA 2U1AA 1MN7A 4ZPVR 3FBEA 2G0IA 4IFYA 4UW2A 2ASJA 3IS9B 1YRXA 1FCAA 4UZCA 3RB6A 5IT9U 3V6DA 2FHJA 4EUVA 1WEZA 1NKCA 3NS5A 3VAJA 5F3TA 1RWXB 2KYZA 4O0IA 4FS1A 5LJ3Y 4N5SA 4LVOP 4UT4A 5IT9Y 1W2IA 1T95A 1U0HA 4EK2A 2K06A 4B3MJ 4N76A 4LF5J 1VQ5S 1TKTB 3KJQB 4I7FB 2DR5A 3DI6A 1U6ZA 4LR8A 4ZVUB 3IA0A 5KG1A 1NRKA 2CJ9A 2FC8A 3OR1A 4W4MA 1KD1T 2UP1A 1R6VA 4Y3CA 1XK8A 4KO0A 3ZNUA 2ADBA 2LQJA 4OZJA 4PQUA 2VUGA 4EWTA 4DSJA 2HNDB 4O3RA 3EGVA 3JXOA 3CCSS 5JVHQ 4JI5F 3U1NA 5DDOC 3BGOP 3DXSX 4CO2A 2Z2ZA 4X66F 3KHLA 1U1RA 1KQSR 1RHQB 2XO7A 1TP7A 3C3LA 1WOSA 3T19A 2Z58B 4B9MA 3VAMA 1RT1A 1RWUA 2VFUA 3A1YG 1MMNA 3OTEA 3W5XA 1WOOA 2J0WA 2FC9A 2ZJRQ 5HK4A 1AFIA 1VCTA 3DHXA 2MZTA 5F8MA 1R27B 1PAEX 2B5JA 5ETNA 5U47A 3OD2A 1OYEA 4GVBB 3MR3A 3CCTA 1J5OB 1RI7A 5A8RB 2KI2A 3MMJA 1HWUA 1HNXF 3BKTA 3MM8A 4USTA 5J2MB 4DFKA 3LALA 3AHPA 4TU9A 4O3QA 1RAEB 2RRNA 2C42A 2GJ2A 2WVEA 2D3OR 5FLXU 2GMLA 2HNZB 2GIFA 1TKZA 1X60A 1QY7A 2AEMA 2UXCF 2WVFA 5FDLA 4F2RA 2LKZA 5B0FA 3OFFA 1FESA 1QAYA 4M1KA 4XO0A 2W8LA 2DO0A 2R9LA 4DU7A 1C0TB 4HR2A 4DSLA 2FJAB 2R7WA 3U02A 2J7UA 1H0HB 2VPXB 2HQCA 4RW8B 1T0TV 2W9AA 4KAIA 4EZ6A 3DLBA 3R2DJ 4LBHA 1TVRA 2XZDB 3MZIA 1T9UA 1ZTTA 3C8YA 2IMOA 1IJEB 4LVNP 3SDEB 3TANA 2MDAA 4Q43A 4I64A 2W9BA 1FNMA 5KT5A 1DTTB 1YBAA 4DV0F 3JAMY 2Z57B 1R8AA 3EICA 3RAQA 1S6QA 5MLCV 3CDUA 3BS9A 2B9XA 3FDSA 4J9RA 1YHQS 1TKDA 4NL5A 4RX6A 2QTWA 3NY0A 1HNZJ 2XY7A 1L3VA 4PQUB 2QGFB 2GGPB 1XNRF 3KG1A 3CE8A 1UFLA 3MMBA 4ZPCA 2Y1JA 1NK5A 4PUOA 2IIHA 4JI1J 5KFOA 4D3GA 1B0VA 3MMCB 3GJSB 3OJSA 3MR6A 4RLEA 4K4SA 1K0TA 3TA1A 1TL4A 3RW6A 4DL3A 3Q8PB 2EI5A 4OHZA 3US5A 4USIA 4DFPA 3NMAA 2BJ9A 2BQ3A 3KOAA 2BVZA 3SEOA 4DPYA 3GG0A 2WK4A 4URSA 3JTNA 2XMAA 1XEZA 1N0UA 4ZJQA 3JSMA 2JJ4D 2BV3A 2ATCB 1EB0A 2MQPA 3WC2A 3ISND 1MMDA 2DIVA 2JFKA 2V8HA 2RUSA 2BW2A 2BZ2A 3FKBA 3GWCA 3ISNC 1HQEA 2ZUAA 4G1IA 2VG7A 4U9RA 3D4JA 2HYIB 2HIQA 3DYAB 2HVHA 3MPUB 5KAKA 1JLEA 1SL2A 2V34A 3PY8A 3PHEA 5F0WA 1Q16B 1Q53A 2FZGB 5IC6B 2DR7A 4ECUA 1Y10A 3D6MB 4RW7A 2X3DA 4G1PA 4NLUA 5B0DA 1TU0B 4ICLB 4X4UA 2CZ9A 2Q6BA 2MTLA 1CS4A 1SQGA 2BJDA 2NXCA 2YKNA 2A10A 2H5JB 2X1AA 1D1UA 1KNZA 3UI3A 3MCOA 4WYLA 3CJ8A 1HBOB 3ZXWA 4NA2A 4NEYA 1YK9A 1S48A 1LWXA 3WIUA 4PXDA 2BE7D 4ZS6A 1DURA 1KS2A 5K8MA 4NXNF 2IHR1 2RB7A 1WI6A 2HPUA 2ZE2A 2VASA 1Q8LA 4OX7A 3DGVA 1DFDA 1NZ8A 4RW9A 4QW9A 1HI0P 1WI8A 2H65B 4QPTA 5HATA 2L9DA 3J7YU 4DV3J 2KTQA 2QEXS 3BPDA 5B7WA 1U1OA 5J2QA 1ITPA 1VK3A 2HW3A 4DCPB 2OKQA 5L8RC 4UUXA 4O3OA 1SUQA 5D8HB 3D3BJ 3PIOQ 5KFHA 1GX5A 4DXLA 2OD4A 2DH8A 5CABA 3DN9A 4J9MA 4B3OB 1S59A 4P6QA 2FYXA 3KJNB 1R89A 1PJ5A 2RRBA 3QAEA 4Y65A 2BQRA 4JB8B 1X31C 4NLYA 4PXEA 4R0JA 2JEFA 1JXVA 3BGFA 4JI0F 1XBWA 3VGSA 3KK2A 2CVIA 3SQOP 4X84A 1EJ7L 5C25A 2FJWA 2CPHA 3T1HJ 1WG4A 3JTOA 4IOBA 5LXRA 2SXLA 3AY0A 2PDAA 3U7JA 3PCOB 2M8HA 3S8SA 1SJ3P 4WFYA 2WRMA 1HNXJ 3CCQS 1S72S 2DEJA 2JC0A 5D78A 1FO1A 5HN0A 3IN5A 4O44B 4DLEA 1P27B 1Q4RA 3KJFB 4KSEB 4HLBA 4YUDA 4K4XA 1VBZA 1ZBTA 2B9YA 2GMJA 4WP3A 5EWGA 4YDXA 4ZLNA 3DRRA 3G6VA 4DUYF 3VVTA 1GTEA 2ZFHA 2VOOA 3D28A 1TL1A 4JI4J 2CPJA 3GFXA 5HVHA 4L3NA 1UJ6A 2RQKA 2C2DA 1KOOA 1F9EB 2ZBCA 1PO6A 4F4KA 4YOEA 4JV5J 2CFXA 1ZZNA 1M1KT 2VG7B 4M8LA 4RW4A 4PG7A 4YMEA 3OTOJ 2BJ8A 1DTQA 3LA0A 4PR6A 2N3OA 3W2WA 4XK8C 4BC9A 4DV0J 4OZ3A 3L7OA 4KB7A 1WORA 1YZ6A 2GIQA 4QR1A 2KXNB 3V6DB 4J7CA 4C8OA 4P72A 1FXDA 1UW9A 4NXMF 1S1TB 3TX0A 3MEGA 4RNMA 2EK1A 1MNEA 4OHYA 2RH3A 2YKMA 3M2RA 3CO0P 3G2XA 2I6WA 4RW4B 4K0KJ 3MMAA 5KFXA 3MD1A 2H1YA 5KFNA 1F3FA 3MMCA 2W01A 4JI1F 2GFFA 3QYYA 1LK5A 5IM0B 5F8GA 1X4DA 2D41A 2O3DA 3MMBB 4NYPA 1RJJA 2XYHB 1E6VB 2GHWA 2I5JA 1NKBA 2V9WA 5F8NA 3GJRB 1CJTA 1G7CB 3OXFA 3T5JA 1SJ1A 3IRXA 3L95X 1GXUA 1U02A 1GMWA 2L9NA 4WP9A 1NHKL 4AE5A 1UMJA 2GO9A 2AYEA 3UCUP 1MN9A 3OL7A 1RA7A 2IDEA 1WTFA 4QIEA 4U6PA 4ANEA 4MK7A 1C0UA 2N82B 4LF8F 4V19X 1IQTA 3D0HE 4ZCMA 1HWKA 1G6BA 3DXBA 3KMQA 5DS7A 3BGRA 3Q0AA 4EO8A 4FBUA 2A3JA 4DR4J 1V3ZA 5DM6Q 1SKRA 3GIKA 3KLIA 1BE4A 2P6TA 4I6YA 4U8VA 2A6MA 4ENOA 4IDKB 4M5DA 2CPEA 3MCMA 5D0RA 3CCLS 4ZA1A 4YFUA 4H4OB 5J2MA 1AUSL 3H2VE 1NJIT 2LU1A 1K1SA 3THPA 2KT5A 1S7HA 1C1BB 4HI1A 2ZH6A 2LQ5A 2O01C 2W8KA 5CYQB 4OI3A 3KLIB 2E29A 3A3OB 2NZCA 5L1JA 2K2PA 5C24B 3MEEB 3VAKA 3DRPA 3Q2SC 2B5JB 3DC2A 2B0GA 4B08A 3BQ1A 2EXUA 3PNIA 3BGLA 2CNOB 4MKAA 1KC8T 3NGUA 4U7CA 1KWMA 5IFMA 4ILLA 1BD6A 2DNHA 3UD3P 3A12A 1KEKA 2ZC4A 1EETA 2V4QA 1QD1A 3M30B 3EGWB 4ZDNA 2MB0B 5IQ6A 4JI2J 3EZ5A 2OSQA 2WZ1A 2XBPA 5AXNA 4QIFA 4WFZA 2HS3A 2R2RA 4FF2A 1E6VA 2I5JB 4LRCA 1UEVA 3H2UB 5B08A 3MHYA 1YJWS 1SIWB 3NGTA 2J8AA 2JDJA 3IFEA 5CZXA 4PYAA 4TLQA 2VPWB 2IDLA 4K4WA 3D0IE 2HWIA 3AXKA 3HKWA 3OR1B 4I68A 5CCMA 5C5JA 3RBZA 1TK5A 2VL1A 1X5TA 1Q8IA 2AIRB 5ITHA 2JVRA 2VDHA 2HG4A 2E9TA 3ENAA 4NZ6A 5E3AA 1FX4A 1RHUB 1YRUA 3HJVA 2V4JA 1T05A 3JTPA 2F4FA 2UXBJ 2RT3A 2V50A 1VGYA 4DL6A 1T9VA 3JYTB 3MUTP 4DQIA 3HJFA 3MEDB 3O44A 4ALZA 2KYXA 2VG5A 5DZ6A 4WJBA 2HVZA 3HULA 3DOMB 3DMJA 3SCKE 1RTJB 4JI4F 3UE2A 3VZHA 4MKBA 3RBDA 3G9CA 1F2HA 1H72C 4KE5A 1UWBB 2R2TA 1QUPA 4EFAC 4DSKA 5E5NA 1VDHA 2B9WA 2CPYA 2ZH2A 2J8SA 3H40A 3GONA 1B64A 2OEMA 3SI8A 1O0PA 5KG6A 1UVNA 1S1UB 2DGVA 3A8KA 3FQLA 1F60B 4PG5A 4ZP8A 5MAOA 4P52A 2FVCA 4OI2A 3JB9k 1HHQA 2LVWA 2HHQA 3QZ7A 1ZPVA 3OBIA 1VBXA 2HLTA 5CYMB 2QV6A 1RTDB 4ZHRA 1ULRA 3D6HB 3M32A 1RZMA 2E44A 1YJVA 1VQSA 2F5GA 4M5NA 1IBCB 2K8GA 3PX4A 1UFWA 4QU6A 3RYLA 2YXLA 1JLBB 4DV4F 1HYSB 3IWNC 2MLYA 3KK2B 4DUZF 2IM3A 4DMZA 1CBKA 1DAXA 2KB2A 3GMGA 3QSIA 1NK8A 4DG1B 1RKJA 4JI8J 2QG9B 5J1PA 2D74B 5KG0A 5HVGA 5IWAF 1XMQF 4PYDA 1JLGB 1RTHA 1Y7PA 2BKNA 4QOTA 4A8OA 2MZQA 5CYMA 4F2SA 2E9RX 4B9NA 3BZQA 4ZIVA 2IVMA 5CD4A 1REGX 3FSYA 3RB0A 5LMNF 1S6PB 2BABA 2HQGA 1U24A 2NXJA 4CTAB 2DGSA 1N52B 2DTJA 2H9ZA 4HH1A 3SSRA 4ZMMA 2B56A 3H2LA 2PEBA 3MM9B 2VG6B 3C19A 3R7NB 3ITHB 4M5LA 2F9DA 1GNKA 1HNIA 1VISA 1LK7A 3UN3A 3SSSA 1OMSA 3PACA 4HACA 3W61A 2VA3A 4LBIA 4Y00A 3KNGA 3CJ5A 4IUFA 1LQ9A 2ZBQA 4RUBA 1XMOJ 5DJBA 4KPYA 2VONA 5M2RA 1S9EA 2C2ZB 2AJ2A 4YR3A 2OIHA 2ILZA 4K2XA 3BV8A 3R5AA 4H4MB 5KFPA 5DGBA 1E6YA 2DGXA 4RBVA 1A9NB 2QLBB 4IQXA 2ZHAA 2WB1D 2NPFA 1UA1A 1WHVA 4C48A 4ETZA 1FJEB 1BY9A 2W4PA 3H4BA 4LR9A 1YIJS 1MWQA 2RIJA 3N5BA 1RGVA 4QIWD 3UFCX 2KRBA 2EPIA 1S79A 2F3JA 4ED6A 4E2FB 3QSYB 2P9GA 2HAFA 3TW0A 4LSLB 1WC6A 3PYEA 1C4AA 2W9CA 3L09A 1N48A 2ZH1A 4JP8A 4I2QA 2XB2D 2VIHA 1VQMS 3GTYX 4RUAA 3MPDA 2X1GA 4LF2A 1RHMB 4WU2A 4N56A 3KTQA 4A8MP 1ZYQA 4J9VA 3DDNA 4KKOA 1X4EA 4ZPAA 1N88A 1YG0A 2XI2A 3FNNA 1XR6A 3O6QA 4CH0S 2IA0A 4DV7J 3WDOA 2RS8A 4KJIA 1TKXA 2RU9A 3G8QA 5K14A 2Q43A 4L76A 1CJUB 3LO3A 3TAMB 3CW2C 2MPUA 4ZK7M 1IN0A 1FJCA 3O3LA 1FKOA 3AJDA 4I0WA 1SCJB 1ZAXA 1WHWA 2VB6A 3G82B 3HXMA 1RACB 3H5UA 4FZVA 5GAHU 2P8IA 1WHXA 5IT0A 2C2MB 3TUJC 4AQYJ 1FRKA 2YNIA 1QE1A 4M5JA 1IKVA 3ZZRA 5GMEA 5GMDA 3DRSB 3M8SA 4C8YA 2KG1A 1RAFB 2DCLA 2J7WA 4H4OA 4X2BA 2LXUA 2MKIA 3LWMA 5FIIA 1IR1A 4NWBA 3P49B 2LYVA 5CA5A 1Q95G 3C16B 3MPWA 2OPSA 3MGJA 3ENWA 4USMA 3I82A 2GAHC 4WBFA 3PR4A 1M5PC 2ZZMA 1D9DA 1NXIA 4ES1A 1U8WA 1UZHA 4C3LA 1QM9A 1NCLA 1VI7A 2MQ8A 1HKAA 3KK3A 1V3SA 4ILMA 2C2OB 2C1EB 2OELA 2CQCA 4P73A 1VJQA 3LP2B 3C46A 2E9ZA 4Y34A 5KFVA 1UETA 3SCIE 3SIPB 4CH1A 1DJ0A 3PXGa 3UCGA 1RT4A 4F67A 3R1LA 1RHJB 4O23A 1UFKA 2YNIB 1QSLA 2ZC3A 4ZN3A 4KGXB 3TA2A 2CQGA 3QMQA 4AXJA 4TQRA 1FK9A 1FKPA 2VKRA 5LMUJ 4J9OA 2YNGB 4I4BA 1WOPA 4WE1B 3W2VB 4GVBA 1GMWD 3H25A 2DVIA 4UY8T 3FJ2A 3G87A 4ZP6A 3G8SA 1GTHA 1WDTA 1OO0B 2W24A 2OTLS 3QRRA 2RJZA 1M5KC 3ETMA 5LM7E 4Q2LA 3NCQA 4CRJA 2VHGA 3FBFA 4WK3A 2V8PA 4PAAA 3NNAA 1FXRA 2RSQA 5K14B 5AJ3F 3MOZA 5DG7A 4MKYA 1AROP 2XM3A 4AFFA 1RT5A 3FEXB 4TLRA 5LXYA 3CDWA 4XPEA 3G4SS 1NK4A 2HHXA 3M1VA 3I0SB 3QJLA 2HHHF 1KTQA 1CVJA 4TNOA 3OFEA 1WHYA 3QATA 4CO3A 2G0JA 2U2FA 1VC0A 3ZTPA 1R0AA 2KXFA 2YWHA 3DLKB 2MKCA 3BKUA 3ET6B 1HD1A 2RDDA 3GE9A 3UNGC 2BKPA 3EVOA 2UV8G 3R3TA 2M9KA 2AMCB 2V63A 3MD3A 4KFBB 3HPOA 4N8NA 3KHGA 2L3MA 4WXOA 3I87A 1ZM3A 2MZJA 5EX0A 7FD1A 1XMOF 2QL7B 3KNAA 4PXBA 3W3SA 1REVB 4MIBA 2RQCA 2D7SA 2L08A 3QGGA 4KHPF 1JLAA 1L3SA 1FJ7A 2BRKA 4ZITA 1HLWA 2DRDA 3CJQA 3ZZOA 4DZDA 3E01A 4XPCA 2IBKA 3GIJA 3LTOA 4MH8A 1U6FA 3M30A 3KG4A 1P1LA 2CNKB 1ZA1B 4IFYB 4RWXA 3HT0A 5DDRC 2RS2A 4NI2A 3L7UA 4F02A 1BWEA 2KKHA 3OUYA 2OFHX 1T03A 1Y4ZB 3PZPA 1SKWA 4LFCF 1F5AA 5KG7A 1DLOB 3KJVA 4QU7A 1JLBA 3UR0A 1U48A 4DN0A 2QSFA 2VG6A 2YNFB 5T7LA 5AXKA 4CIOA 3J7YI 4ZJOA 5DQHA 4L6V3 5E3PA 3VALA 3M2VA 1YITS 2LXIA 3QGIA 2FLNA 4H54A 4KGMA 1C1BA 1P9YA 1XQIA 2EW9A 5J2NB 2AGPA 4RBTA 2AYBA 2R8KA 1S1UA 2MKSA 2QT7A 1PCAA 3OSNA 3GR0A 3ZTSA 2HFVA 3D67A 2MKKA 4RZRA 2YNFA 4B3MF 2HZVA 2JH3A 4B02A 4RW9B 1N56A 3DGPB 1Y9OA 3MI7X 3V4IB 1IKWA 2M8DB 2XY6A 5J2PA 3I0RB 5DLGA 5F0UA 4PPZA 3J81U 3GFHA 2PI4A 2ZHOA 2KU7A 4USHA 2HZAA 3NP5A 3KHHA 3T1YF 3BEGB 1NK9A 2JVOA 1LXNA 3ILJA 2EEYA 5E3CA 4DL7A 3D1QA 1EX8A 4P74A 3H0PA 3TWZA 2RF2B 1R8HA 3E3XA 1YI2S 4PG4A 2VC1A 1NPPA 4ZJLA 4ERDA 1UW4A 1FFGB 1VLOA 2DGUA 1TV6A 3KUEA 1NH7A 3O8WA 4IG0B 2HNYB 2MQNA 2E1RA 5THWA 4O4GA 2ATLA 1HIYA 4QWAA 3EZUA 5D4LA 5F8JA 4Z37A 2ZH9A 2ZVSA 2UUAF 5DQIA 3K0JA 4F8RA 2YX4A 4TY8A 2NYHA 3W5YA 5KT3A 2HBZB 3N6NA 4GKJJ 3MM6A 5JUMA 4NLQA 3HVWA 3BKFA 5KFSA 3W8GA 5KFJA 4OI0A 5KFYA 3ET6A 3HFVA 5HLFA 3RRGA 3M8PA 4ZKAA 3HVTB 3N5FA 3JSMB 2LXFA 2XZTB 1BQMA 2BOPA 4LF7J 4X4OA 1JJCB 1PILA 3LGNA 4LSZB 4Q44A 2R8JA 1SQFA 1NNDA 3DHWC 3ZO7A 4WFNQ 3CCZA 5LMUF 1DHMA 2WAQD 3BBBA 3IC1A 2G1HA 2CWKA 3IBCB 2EFNA 2GMHA 3R5DA 5KFRA 4GC6A 3M4XA 3VGTA 2C3UA 4GRSA 2B6AA 5DG8A 4PUOB 5EX3A 3OV7A 4K4UA 3SFUA 1N54B 3PJ9A 4JUZA 4BC7A 4CI0B 6FD1A 2ADCA 1ELOA 2ZH4A 2CDQA 2DNKA 1AXQA 1LWFA 1JB0C 5KT6A 5AJ3J 2XQCA 1S7IA 2F4VJ 1I51B 1Y3KA 2VICA 4G1QA 4IOAQ 2E5IA 5B0EA 3JAMU 4AL7A 3I32A 2RKIB 4TQSA 4YHHF 4WTOB 3BF4A 2IVYA 3HCXA 4DPOA 4NCGA 4FPRA 2GVZA 2GJIA 2YWEA 2DXDA 3FEZA 3ICLA 1SV5A 4QJVA 1RT2B 1GXLA 3MM5B 3Q86A 5F9NA 2YWFA 2QMXA 2ZBPA 2DR6A 4OX9F 1UVJA 4C3KA 3LANA 1VQ9S 2VPZB 2KM8B 4RR5A 2BQUA 3KLFB 1I5OB 2RMLA 4Y2MA 4IQMA 4J9NA 3I96A 3CO9A 4OYIA 4BS2A 1SL0A 4F26A 2MGZB 2H3EB 4MK9A 5C42A 3TZZA 1T11A 4LF1A 1OY9A 4XDCA 3DRSA 3OR2B 2UU9J 4NYOA 2YQ1A 5IOLA 5L9XA 4UZBA 4DSIA 4X62J 3FSXA 1M5HA 3KLFA 2ZH5A 5HMYA 3RBXA 1FKOB 1HWLA 1CJUA 1KRPA 4UQGA 1RT2A 2VJUA 2YWWA 2BYCA 5AE1A 1SKSA 4QYZK 1RSCA 4FDFA 4CLUA 3G8TA 2FD2A 3PJXA 1RAHB 1SV5B 1IBLJ 3LPYA 4GKKF 4KIAA 3LP1A 3W64A 5EWEA 4JV1A 1TL7B 1PIEA 2QLJB 2D3O1 4CLTA 4A8QA 1AT1B 4KHRA 3T5LA 1QAXA 1IKVB 1KTVA 1FFWB 1RLCL 1SC3B 5I42A 1TK8A 2PE8A 3K8VA 1VK8A 2ZBRA 5B0GA 4DCJB 2VD3A 3W9HA 5KT4A 3SZ2A 2DCUB 1N6QB 3QO9B 1U0HB 4L74A 1NZAA 1R0AB 1DZ5A 1WJ9A 1K73T 2J6TA 2DISA 4P75A 4CLSA 4M94A 2G4BA 3LWLA 1NHVA 4R25A 2YPYA 5KFIA 3DU6A 1OQ6A 1OS5A 1RWPB 1S57A 2NXNA 2RQ4A 4P2XA 4DL4A 2OD6A 2CQ1A 1XC9A 3P4UB 1FXLA 2DEIA 1FWKA 1GMVA 3W2WB 2H54B 1WSVA 4WIIA 3TARA 4DR7J 5L46A 2DR9A 2B4UA 3QIDA 3GB0A 3GPAA 2XGPA 4ECRA 2XEXA 4ZVRB 3MM6B 3QGPA 1T9WA 1D09B 3TEGA 4X4SA 1WSRA 1LW2B 5LL6d 2MY8A 3AODA 3FRZA 2KHCA 2M88A 3HDSA 2G0CA 3OTBA 4QR0A 3ILLA 1FTCA 3OTCA 4RNHA 4YQWA 3S7RA 2X1FA 3EGNA 3QRPA 4IO9Q 3TP2A 2D1CA 3RU0A 3C66A 3IAS9 4NOHA 2AJ4A 3KKFA 1N4LA 2GQCA 3PEHA 5K8OA 2YX7A 1NB2A 1W25A 3W9JA 1HNVB 3FCHA 5EDWA 2RILA 3K57A 1U4BA 2DIUA 2CQIA 3BBFA 1I94F 4C7QA 1XNRJ 1D8ZA 3M2UA 4IOCQ 2XYGB 1D9AA 3UR3C 3M05A 4DPWA 2N3LA 5J2PB 4LQ9A 2J0QD 3VAFA 2ZD1A 4X4QA 3GZ7A 5FJ4A 3EVMA 3LF0A 3QT7A 7AT1B 3M2UB 4CLWA 4Q45A 2A0FB 4ES2A 2F4VF 4KH0B 4ZHRB 3LP0A 2G1DA 3AA8A 4FKYA 3CCUS 1RT7B 2EKYA 4OI1A 2K7JA 5J2QB 3NS7B 3PFEA 3OTOF 2OTJS 1OIAA 1IKXB 3M7VA 4YHHJ 1L3KA 2BANA 2FJBB 2PT0A 1FRMA 2QFIA 3I31A 3MECA 3PV8A 3RAXA 3A8JA 2ZEJA 2HS0A 3TUZC 1N34J 2CG4A 2FIUA 4ZP9A 1RWOB 3EDQB 3VGVA 2QSWA 3M8ZA 3M8QB 1MROB 1WUUA 3MPYA 2W2NP 5E3RA 2EG2A 4C97A 2IAJA 4QBUA 4EEYA 2NQPA 4RUHA 3MR2A 4NMLA 3FFIA 1TMJA 1DLOA 3H42A 3CJRA 4WYWA 1U1NA 1RT6A 4LQ3A 5KOWA 4Y0FA 4CO5A 3HI9A 1WF2A 2R4FA 4XTTA 2PN6A 4Y28C 1PJ7A 1T3NA 1N5VA 3NNCA 1QUVA 3EYZA 1LWCA 2WVBA 3I6PA 5IT4A 2XO6A 3BO3A 4ED0A 2AX0A 2PD1A 4OZLA 4TKTA 2UU9F 5M2UA 2CPDA 4KFBA 1H6KX 2N7CA 4NX9A 2NUHA 4O4RA 3HKZD 2BBEA 3L7PA 2WBMA 1NDCA 3VQTA 3R97A 1FNOA 4EGLA 3Q22A 2C3PA 1KN6A 1UPPA 3H98A 2JOQA 3N01A 1UEUA 1SL1A 5I4MA 1IBLF 4ZCLA 3OVSA 2K3KA 4DV3F 3FBBA 4F0MA 2M5YA 3M1VB 2A1BA 5F3ZA 4C8LA 2EFVA 1K44A 3D7SB 5H9FJ 4ELVA 1RBAA 3SQGB 2J5AA 4M5HA 9ATCB 3L3CA 3N6MA 5DDQC 1CJKA 2DJWA 4QIVA 2FQQB 2AYMA 4DFJA 2A18A 2HK2A 3HSZA 2QYCA 1C1CA 1GXTA 4ZVPB 4FYDA 3F44A 4F3OA 1LWEA 1HA1A 3K5OA 1JJHA 3OQ2A 4OFZA 4ZPWR 3T6JA 3GIRA 5GAGU 5EHHA 2D69A 2IC3A 1IR0A 2JL9A 1S10A 4HHJA 4QQBA 3GSDA 1N8RT 1KFSA 4LUBA 3PHTA 1C0TA 1RAIB 1SKUB 4KBIA 4WWSA 5A8WB 1QVFR 1HR0F 1RWNB 3GP9A 1FDDA 1AB8A 1HW8A 2DGQA 1EARA 3WIVA 1V5VA 3Q8SB 2XSJB 2VFSA 1IBKJ 4DV6F 4LFBJ 3W5ZA 2A2DA 4FVCA 1LW0A 4HEA9 4KY3A 3BQ2A 1FD8A 1FERA 2DGOA 2X7IA 5C42B 2FJEB 3N4WA 2OMOA 3LP1B 3MR7A 1WKLA 2KVQE 2V2KA 3PRDA 4ZPTR 3NAIA 2MGZA 4DUYJ 1RYRA 3NCPA 4AXIA 2ZJPQ 1YSJA 2GX8A 1YTYA 2HGNA 4MK8A 2UVRA 3PO4A 4TN2A 5HAOA 4WTYA 5GMKa 1FRLA 2AT1B 2NCKL 4JV5F 2R3VA 1C0UB 2KT3A 2D9OA 1FRJA 5KFQA 1MMLA 4B9UA 3MCNA 3QRQA 4DPUA 4FBTA 2VQEJ 1NDKA 4MKVA 2IYGA 4MFBA 4OZ2A 2P9CA 4U7UK 3R6GB 2XSJA 3M9NB 3EPGA 4QCLA 3ILOA 2VOPA 2FY1A 2HHUA 3PYDA 3NAHA 4NXMJ 4JV0A 4TYAA 1WC5A 4ID5B 4LRBA 1KVJA 1SXLA 4KO0B 2J9DA 2GHPA 1F1BB 2RU3A 3GV7B 2AKWB 2ZKTA 2XZWA 1RTJA 3CJ3A 3VHQA 1NO8A 2IMWP 1A0OB 1OPIA 2X51A 2R7SA 1VHFA 2OPQA 2D9PA 3OL6A 1V5IB 3DCAA 3UDEA 1HI1A 1WC1A 2F9JA 3B54A 4HHHA 1V6HA 4QZVB 2ZVIA 1FDBA 1WACA 4JOUA 3IR6B 1VRTB 4OX6A 5D4NA 4R8UB 1FHTA 2L9WA 5BR8F 1FEEA 1VC5A 1JXLA 5A8KB 1IKYA 1DTQB 3UPFA 5GVQA 1FKAF 4B3RJ 1KFDA 5HMZA 4IR9A 4CLKA 4X65J 4H4KC 3NG8A 4I2QB 1P9QC 2B9EA 2H51B 1PBUA 2M7SA 3LGHA 4I2PB 4UUWA 4CM2A 4DI6A 1IJFB 1TL1B 5G0RB 5J1NA 4DV2F 4DR4F 1EQ0A 2Z56B 1IM6A 4ECQA 1T02A 2CPFA 3I5BA 2RE1A 1R8BA 4FS2A 4RU9A 4ZOSA 3WHIA 3K59A 3D6TB 2HKEA 4DSEA 2FGCA 2WVDA 4OLPA 1VQKS 1EP4A 4OI6A 3PKMA 1BLUA 2E5GA 5K9FA 3RJMB 3RZAA 1XMBA 2VKZG 3ZTOA 1RCOB 3BB5A 3KUGA 4FXDA 4OIXA 4IRDA 4LFBF 4DQQA 3AB4B 1F5CA 1VRTA 2BOAA 2QE5A 2YY3A 5KFMA 1LWCB 2J0XA 1F2GA 2LECA 3B6BA 2QC3A 1QAIA 3LH2S 5EUHA 2DNNA 2AF6A 3DRPB 1QLNA 2HHWA 4FYWB 4XIUA 2OMLA 1MWYA 1NMEB 2Y9HA 2E5LJ 1RAAB 2M2BA 2W2OP 2HMIA 5ETPA 1SIZA 2ZKUA 2F63A 5GAEI 3PW7A 4I69A 5D15A 4O0NA 1R31A 1TUWA 2FLPA 1A6LA 2YKQA 4EO6A 5CCLA 4JI2F 4PRFA 1RT7A 3RUBL 2M0GB 4BWMA 1N5TA 5ETRA 4LIWA 3SYZA 1GAOA 2HGLA 3DLHA 2OO4A 2CJQA 4YEAA 4L73A 4JI7F 1X0FA 1JLGA 1U6BA 2GW8A 3C6UA 3CDEA 3D5MA 5C2GA 2LP4A 3ZZTA 4DJBA 1ZZFA 1L3TA 4USWA 4MIAA 4AD6A 1NSQA 3HD1A 3AH6A 1GMUA 3QQCD 2DY9A 3HHLB 5E33A 2EK6A 5A2QY 1IWGA 1HI8A 3OXGA 4H4KA 3R5CA 4KPCA 2FZCB 2CQBA 2W2PP 4KRWA 4LIRA 4K2JA 3T1AA 4USJC 2FTRA 4I6AA 2UXBF 4AYBD 1NDPA 2P9EA 2MQLA 3G86A 4I6WA 3TAPA 1FD2A 1NU4A 1R43A 3EMTA 3PX0A 1U1KA 2YPZA 2NR0A 4RL1A 3CCMS 3CCRS 1U25A 1X8DA 2R8HA 2UXDF 2MZ1A 4ZPDA 2BE9B 1QJHA 1UWBA 2AJ0A 4NPOA 1I3OB 1Z4UA 3K17A 1RT3B 4DCOB 4JI3F 3Q8QB 2EC2A 2EG1A 3GCWP 2UVWA 4QWCA 3PW5A 2I8EA 5DDPC 3V6KA 1H7XA 2ZJQQ 2O66A 1X4GA 3QIPB 2MEWA 2DNZA 3K5PA 4NLDA 2FHMA 3TZWA 4OYAA 4DUTA 1M1GA 3RR7A 2Q1LA 2HS4A 2MLXA 2JC1A 3ZTQA 4DU8A 3I55S 2VQEF 3F0NA 1S4FA 2V8DA 3VWSA 4PWUA 4MT1A 3K8WA 4CNZA 5LSOA 4F36A 2RRAA 4X4VA 1REVA 2KT2A 4J9UE 1VQLS 3CJ0A 2IJNA 2V2ZA 1XIQA 3BR8A 3CEDA 3I5CA 3HP6A 4GC7A 1N6QA 3MR5A 2DRBA 4RKUC 3N28A 1Q0NA 2RDIA 3D6FB 2GHVC 4JI8F 3UDLA 3V2UC 1R7IA 1G2EA 3AOAA 1DBDA 3RRKA 3BDPA 1C4CA 4HL9A 3DM2B 3KG0A 4ANDA 3CF5Q 1FK9B 1FKPB 1GEHA 2CZ4A 1EQMA 2G2YA 2QMUB 4L75A 5IC4B 3HHDA 4ZIWA 4A8YA 3IGVA 4UOFA 4NMXA 5LMNJ 2HQ3A 3IR7B 4FF4A 5KFEA 2QLXA 3J7Z5 4X65F 2MZRA 3X3UA 2KHDA 4CYUB 3AOCA 4CP5A 2GZOA 4PQAA 1K9MT 5C25B 4B3TF 3FBCA 2CWXA 3QO9A 4DV2J 2LMIA 3UD4P 3POTB 3SCLE 3F56A 2MSTA 2CPIA 4A8WA 4J91A 2DPJA 1YBUA 4WE1A 3NWGA 4DL5A 1RKIA 3I56S 4TU8A 1RDRA 3EGZA 5D3GA 1UTAA 3K2YA 5I42B 4G65A 2VFTA 3GSIA 3J81j 2ZZNA 2BM1A 2KFZA 1YRTA 3NCRA 1ZM4A 1UJ4A 4ZVSB 1OY6A 2AZ3A 2Q6CA 3IBWA 3CCES 1J5OA 5RUBA 5T41A 4C2MA 4C0OC 1F5BA 4CLYA 1AW0A 5HL7Q 4C0HA 1MU2A 4N77A 3NGDA 3CJKA 4C8NA 3WQPA 4ZLPA 2NLWA 4LF6J 1JJ4A 3HVAA 1Q79A 3C16A 1WG5A 5DG9A 3EXYA 5KFCA 1FEHA 3GYGA 3CMQA 3H90A 2HNZA 1RLDA 4RU2A 3OSPA 3CDBA 1LFPA 1LW0B 5L39A 2MQQA 2DD8S 5KFAA 1YVFA 5K8NA 4DV7F 5KFTA 3A3PB 3MUMP 1OJ4A 4LBPA 4YB1P 3M9OB 1VC6A 2HNDA 2PGCA 2VH7A 3Q89A 5LSRA 2QO3A 3DM2A 3GR1A 3PKYA 2PI5A 4TVAB 4ED4A 1XR7A 1PGZA 4ELUA 3DYAA 5D3GB 3FMBA 4JI0J 2HZCA 3W63A 3D2WA 2HHVA 3BDEA 2UUCF 2IVFB 4ZVTB 2HK3A 1BUXA 3JQJA 4PEOA 2VF3A 2WW4A 3TZXA 5F9LA 4DR5J 4AQYF 2Y1RI 5HQLA 1BQNB 2QZ8A 2XS7A 2W7OA 2NSBA 3QAUA 2HWHA 1YJUA 4OYWA 2KZMA 2KZZA 1U8SA 5HSPA 2JZ5A 4QPXA 3HVTA 5I3QA 2J6SA 3GV5B 2DNOA 1K8AT 2XNQA 1IBMJ 1Y11A 1BQMB 2ZWOA 2JEGA 1KLMB 3CC2S 2XWXA 1FRXA 3M8PB 1V9OA 5C7PA 1YDLA 2CJBA 4NYZA 1Y5LB 1XJWB 2CJXB 1GQEA 2K3IA 4MYTA 4TYBA 3T6BA 5KT7A 3G6YA 3VGUA 3RB3A 4JI3J 1PJ6A 4CM0A 2RDJA 3GCXP 2GGPA 3OJUA 3VAHA 3ELHA 3DRRB 4LJMA 3BBCA 3MAQA 3F73A 1WKKA 3EUNA 4C8KA 4J90A 3N79A 1TUVA 3EJMA 2DNYA 4K4YA 1RP5A 2BJ3A 3GYXB 1RT4B 5D0EA 2W2QP 2ZWPA 5KG3A 1Q7YT 2CG8A 1WC3A 2UV8A 4O3SA 4IFVB 1N33F 2MXYA 3IP0A 3IS9A 3KDNA 3P96A 4IG0A 2GVDA 4CLFA 3CC4S 1S0VA 1RU1A 2E66A 2WBRA 2RF2A 4OHWA 4ZVEA 5KFFA 5HBMA 4DS4A 2R8IA 3W60A 1SB6A 5CQGA 1H2VZ 1FE4A 4HACB 4HT5A 1PKUA 1ZM2A 1VIXA 1MU2B 4I1TA 4S0MA 1HNIB 4CO4A 2G13A 4NLSA 4OJ1A 1SH3A 2WSCC 4B3OA 1QSSA 1HBNA 4PWDB 5F8LA 2O67A 1N5YA 3OR2A 3IG1A 1JQGA 4NEZA 2V4RA 2IFXA 1VHIA 3JSYA 2YWGA 3OL8A 1JIHA 3GYNA 4J9SA 2AGOA 2VFVA 1R6YA 4GMKA 3MFIA 3NGSA 2R2SA 3T9ZA 1FJGF 1FE0A 3Q24A 1HPZB 1NPRA 4Y2IA 5A8RA 1HMVB 4ELTA 3H4DA 2D3ZA 1ACMB 2LCWA 2PMHA 1LFWA 2ZZTA 3NOCA 4HTJA 4M5KA 2XMKA 4WZQA 2MSSA 1M0SA 3C14A 4X64F 4DX7A 1U49A 3LW5C 1U0SA 3CIMA 4HTIA 4DX8H 4DOZA 1TK0A 2DKOB 4N8OA 4NI2B 2EFOA 2GVZB 2C3OA 1OQ3A 4DHVA 1T03B 4KHPJ 1CJKB 4ER8A 5HP1B 4HH0A 2DRAA 1VQYA 1TMMA 1FWLA 4USUA 1ZAVA 3WBZA 1H2UX 2CQ0A 1UKUA 1CSJA 2B8QA 3KHRA 4WZMA 1KQFB 2GV1A 4G1QB 4J9LA 1IXKA 3V4MA 4KR0B 3BQ0A 3H5XA 4I67A 2MYFA 3T5KA 1AUDA 5KFWA 3HM9A 3HT3A 4NLPA 2ZOGA 3R5BA 4LFCJ 2PMZD 2LEBA 2RVJA 2QX0A 4HDHA 1TKTA 4I7FA 4OYPA 3SV3A 3W62A 1R8PA 1RWMB 2L48A 3ULHA 4ITSA 4IH7A 2OPPB 1IWAA 1P6TA 1HQEB 5F41A 1AA1B 1IR2A 1S6UA 2C3MA 2FB0A 2FHOB 4KH1B 2OEJA 4DQRA 2QN6B 1HBMB 3K58A 3E2EA 1E6YB 4M5IA 1PYOB 2K1RB 2E7WA 2C2RA 5HP1A 2ERRA 2CNNB 4F4XA 3QT8A 1FVSA 4F3MA 2I0XA 2XMJA 5AE3A 4DR3F 1Q7LB 1VR6A 1BQXA 1NSAA 2YTCA 1CC7A 3CNQP 2ZDPA 1Y5IB 3JQMA 3FFIB 3RGIA 5LSLA 1J5EJ 1D8YA 2B3TB 2AHOB 4URQU 2BE2B 2DNMA 4U8YA 5JJBA 1VQ7S 4U7UD 2N4DA 2WSFC 2OLWA 2J7KA 3M6UA 1R3NA 2MKHA 2NPIA 1MG7A 3CJ4A 4ZVQB 3RAMA 4ECSA 2UUCJ 3T1YJ 2ASYA 2A2CA 1Q8KA 2VBYA 3SV4A 4DR5F 3FGVA 4WP8A 1S6PA 4FNHA 4CTAA 1YWXA 2ROEA 4Q2MA 4K7QA 1FRHA 4KHMA 1X4HA 1HL6A 2YNHB 3UVJB 4FKXA 4CO0A 2FLLA 2AJQA 1TL7A 1RT5B 1VYAA 3IG1B 3B82A 5G4DA 2JFDA 3UN5A 3D0GE 3GV8B 1IBMF 4DF4A 1URRA 2W9BB 1X7VA 2OPRA 3V81B 2AD9A 4DG1A 4DL0C 3DRYA 1C2PA 2C3YA 2OPQB 3VCDA 1S9FA 3E8OA 3ZZ0A 2XULA 4F04B 3IWLA 4ZLLA 3MTKA 2V8GA 3PRBA 3W9IA 3TYTA 2NREA 4ZP7A 3DGPA 1W7WA 3MECB 3ZTRA 5CYQA 3KLEB 5H9FK 3SSQA 1HBUB 2CQ4A 2G2OA 4NE9C 3PR5B 5ETOA 3DLEB 4RBUA 1KSPA 3B8HA 4MFBB 5D77A 3UD5A 2Y1IA 2UUBJ 1X5SA 5B0CA 1HBNB 1YKWA 3M2VB 2WONA 4PWDA 2R7XA 1X4BA 4OV1A 2XWYA 1OYDA 3TO8A 1WNEA 1LW2A 3A3NB 2B51A 3TJ9A 2HMIB 1JLCA 2KH9A 1NJZA 3P6YC 1FA0A 1VOMA 3M6XA 4NLGA 2I38A 2RD5C 3G82A 5A6WA 5A8WA 2HHSA 3CVKA 3S6EA 1RT1B 1S0NA 1URNA 2IRYA 4UTGA 4CLZA 2XCAA 1NJYA 4YS2A 3M2RB 1S76D 2HQFA 1N5SA 2CQDA 2RQMA 3MEDA 3TAQA 2AGQA 1S1TA 4N7TA 3VTIA 3OLBA 4W92B 2OJ3A 3CCWA 1MLAA 2F8EX 2EC0A 3E01B 5ETMA 6FDRA 4F4YA 1L3UA 2AYGA 2BACA 4IRKA 2I1RA 1FJGJ 4LMZA 1H2TZ 2H4WB 4UOCA 5A0YA 2F65A 2ZNZA 3EZOA 4B3SJ 4YR0A 3LOUA 3ISZA 2H4YB 3JSRA 2DH9A 2W9CB 1QTNB 1RXOB 3KXDA 3GIMA 1MSWD 1I6JA 2LFVA 5B0AA 3TJAA 4EBEA 5G0RA 2XLJA 4NA3A 4OX9J 1NK7A 1RQ0A 3MFHA 3MMAB 4ZVFA 3H20A 2B6AB 4A48A 2AX1A 4DV5J 2WW8A 3BH7B 1JNRB 3CWJA 2ZM6J 1C1CB 5KFUA 4BDPA 2G9OA 2V6AA 3OVAA 2OI2A 3TQEA 2LA6A 5H9EJ 2IM2A 4OV6A 4O44A 2CAJA 2VJVA 4X4PA 3R7BB 1O6XA 1S1VA 3NRBA 2HSEB 1XWLA 3Q8YA 5HMXA 3VAIA 1G1XA 4X62F 2PA3A 3L9ZA 2F8MA 3IAM9 4DR1F 2EFQA 4OYBA 3KLVA 1RA6A 3LUYA 1G3OA 4GKKJ 3KMSA 2M4MA 1KOHA 3MTJA 2V68A 2D3UA 3V6HA 2AW0A 2XLIA 2HNYA 3DOLB 2HFUA 3QPIA 4OZ5A 1JWWA 4OJGA 4QR2A 4DX5A 3CTRA 4OYMA 4DR3J 1HBUA 2XSFA 2XHCA 1HD0A 1VFJA 1YJ7A 1J5EF 1UZDA 2KN4A 2DNPA 1N5QA 3HK2A 4FPIA 3AD9C 1RAGB 2QLFB 3IRWP 2J6UA 3CMAS 1HHTP 4A8FA 1UJ5A 3VF0B 2QA2A 3CJKB 4ATNA 2VU5A 1LNQA 3NS6A 3O1LA 2OPRB 4P10A 3UN2A 1DQ9A 4Q5VA 4DLGA 2BMBA 1S99A 3EX7B 1FVQA 2RUGA 1S4EA 2DYAA 2F40A 3A13A 3MWBA 4OQJA 3R6LB 5IQQA 5KFGA 4BHQA 4DV1J 3TZYA 4ECTA 3HFZB 2Y3YA 5J2NA 4CWBA 2Q3PA 4RNFA 3FSIA 3GJTB 1NK0A 2YWKA 2DK2A 5DLFA 2VBXA 3HLUA 1NK6A 2XLKA 1RWWB 2H48B 5AXLA 2NSCA 4DR7F 3FQKA 1Q82T 1UAWA 2V2VA 1HQ2A 3RR8A 1T7PA 1NEEA 1WWHA 3BYPA 3RW7A 1SH2A 1HBOA 3ZZUA 4YY3F 1Y00A 2ROPA 4K59A 4ZPBA 3C6TB 4ZN1A 1VRUA 2MKYA 3UW1A 2R7RA 1N36J 3OL9A 2Y1LB 3W7BA 3J80U 3QT6A 1F0XA 2AV5A 4JYAJ 2UUBF 3UO0A 1M5SA 2X3GA 3PYFA 2ZH7A 2XS2A 2PEHA 4BWJA 2ALYB 1I94J 1K0VA 4QYZJ 4EBCA 1YGYA 2W2MP 3C2PA 2MLZA 3R5JB 1KKHA 1SBRA 2PC6A 2Y8WA 1ROFA 2BJ7A 4NCAA 5I3PA 3HSGA 4NRTA 2AQ4A 2WOMB 5ETVA 3CB4A 2FGOA 3R7SB 4B9LA 3HX9A 2CUYA 2MKJA 2HVEA 3DOMA 3P5TL 4OHXA 3U27A 3CC7S 2CRLA 5BXIA 3HO1A 3OVBA 2HHTA 2DITA 1HW9A 2YX1A 3I0SA 2CVEA 4A8XA 4P2MA 3P3DA 3FC9A 5KFDA 5CAAA 1M90T 3ZFVA 4PG6A 1VQ4S 2DNQA 3D1OA 3B4DA 1LKZA 2CIMA 2RAQA 3NGKA 4OZ0A 1SC4B 4P7TA 1FF2A 5KFLA 4RNOA 4B3SF 1N34F 1VRUB 3H5YA 3U1LA 4M63A 1EHWA 2AEJA 5H1SV 4C11A 1RB0A 4C8MA 5ETTA 2KFYA 1G4CA 3C15A 1GT8A 1I1GA 3W1YC 2W1BA 1JJ2R 1X4CA 3P45B 2Z30B 2R7QA 1Z2LA 4DV5F 2HQDA 1FT8A 5AT1B 4LF4F 5L9NA 2QJ3A 4XAKA 3M9MB 2XNRA 4GVLA 4OHVA 1RWKB 1U1MA 1TV6B 1HPZA 2BUNA 2XMWA 5KFBA 1D0EA 4W90B 2CA9A 3OXLA 1YX2A 1S6OA 2CQPA 3HHNB 3QLHB 3UNYA 1CULA 4YB5A 3O2IA 5KT2A 3ENQA 4M95A 3CCJS 1TFYA 5JVGQ 3CULA 2KM8C 3AQOA 2EFPA 1TVRB 2RNEA 4MTPA 2MQOA 3Q8UA 1S5ZA 5B09A 1JXEA 4RW8A 1YZ7A 2H5EA 2XMTA 1BGXT 4WCEQ 4DR1J 2VDIA 3NXZA 4RUCA 2G2ZA 2Z8QA 4ZVGA 2A6OA 1TL3B 3C6UB 1RUSA 4Q8EA 4KGKA 2QYGA 4NLRA 4ETXA 2PO4A 1M1HA 3CXCR 4B9TA 3QFWA 1CS4B 2IRXA 2W4CA 3FEYB 4UF4A 3MUVP 3TVZA 1FWPA 1BHNA 2IRUA 4L3KA 3IRXB 4IYQA 4OI4A 5CH7B 2M70A 3HHLD 2BR0A 1EP4B 4DBQA 1XN9A 4KC5A 4X66J 4C8ZA 1VBKA 4OJ3A 1UL3A 2XG8A 5A6PA 7FDRA 3M6WA 1S49A 3LQVA 2OGUA 1J2VA 1H98A 1U7LA 3KWMA 4MAKA 1LWFB 3FCWA 3I4HX 3NOGA 2YKAA 4E8UA 3T3FA 1L5UA 3POTA 2JEJA 2UVVA 5CYJA 2FJXA 4EYIB 1GH8A 4F25A 2ZBIA 2DB1A 4F0HA 4RPFA 3W65A 4ZCIA 1U09A 5J1EB 4K5SA 4X4TA 1HR0J 1TL5A 3B4MA 1B0PA 4P2FA 4CYUA 2VA2A 1TKXB 3MAAA 3DOKB 3TUPA 2VFRA 4DV6J 1IBKF 3RRHA 5K5MA 2LQBA 2RKIA 4R8UA 1WTBA 8ATCB 5SUHA 2R2UA 2V4JB 3T5HA 3H7HB 2DHAA 1ZOTA 2HGMA 4IR1A 1NH8A 1CQNA 2Z2LA 4OL8A 2GO8A 4C4WA 5HROA 2FZKB 1FX2A 4OYZA 3R2CJ 4K4VA 2WHOA 3Q8VA 1DY3A 3W2VA 4YY3J 1PC5A 1UVLA 4I2PA 1SJRA 2KVIA 2CQ2A 3EXCX 3FZ2A 3MPVA 4KGZB 2ZH8A 1GX6A 1D9FA 3W8PA 2OFGX 2UVUA 1WC0A 1N36F 2CQHA 3JS9A 3W66A 4JYAF 2E1PA 2DGTA 3MAAB 2FJVA 2XI3A 3TI0A 3Q83A 1VJWA 2XMVA 3AQPA 2GIRA 1KONA 1HNZF 1SC6A 1XERA 2EVZA 1X9SA 4JV2A 1NJWA 2AZ1A 3MURP 4N41A 4Q0BB 2HVIA 4NZ0A 3AT1B 4FVMA 4X4NA 2PFDA 1X4FA 2JLGA 3UDVA 4MYUA 1CJVB 1U1LA 1JLFA 4CCHA 2IAJB 1SVDA 2H5IB 4ECXA 3J81Y 1NPKA 1LEOA 2OPSB 1Q78A 3M8QA 3CD6S 3M6VA 1UVKA 4U67Q 4ECVA 4FNIA 3PW4A 3JQKA 3QFHA 4K4ZA 2ALZA 1TKZB 2DXFA 3DLEA 2X1BA 2AP6A 3CD5A 1Z2ZA 4O4GB 4URGA 5BR8J 1CEZA 3LP2A 1JLQA 4AUKA 5GAGI 1MW7A 4B3RF 1A7GE 1DRZA 2GS8A 5DETA 1S0OA 5ETKA 2DPIA 3D3CJ 1KDNA 4NLOA 4WF9Q 3CJTA 1RHKB 3NBPB 2GNKA 3A4TA 3TAMA 4EU0A 2OH2A 2NZ4A 2KL8A 1FRIA 1Z1ZA 1ZA2B 4E0DA 2XMMA 2MQMA 2FVSA 1WD6A 2E7XA 3TNVA 3RTVA 2Q79A 4LF4J 4NCGB 2BRLA 3OLAA 2YKNB 4HVZA 4DF8A 3ENVA 4F4AA 1F3VA 1PBAA 1KHWA 2DHGA 2Z4PA 1JX4A 4QWDA 2ASDA 5KOXA 3CMES 2ZITA 1O8BA 2XMUA 1ZS6A 5IXUA 4CO1A 4HKQA 1Q81T 3HZGA 1JLAB 1RCXB 3N9UC 3PEJA 2LQ9A 3PIPQ 5CHCB 1HQUA 2J9DE 2IC3B 5E0OA 4UOHA 4CLPA 1S1WA 3CD0A 1TZ0A 3WC0A 2AU0A 1LWEB 1NKEA 2ZNYA 3I9ZA 1JK9B 2E5LF 4JI6J 4NXNJ 3KK1B 3BJYA 4K4TA 3PFOA 1VMBA 1NJXA 3DLKA 4EBDA 2BA9A 2K1RA 3HSJA 1LXJA 1Q1KA 3ONQA 2LDYA 2WSEC 2YH0A 3CD7A 4M5GA 2Y0SD 4TY9A 1WF0A 3R8YA 4KV8B 4Y6IA 2HBQB 1T05B 2YQ3A 1T9XA 1SC1B 3BPSP 3QIPA 2IY5B 4C0BA 4OYOA 3PVXA 1QVGR 2B7CB 2NYIA 5HLFB 4ED3A 4JI7J 1SH0A 1R0BG 2BJ1A 3NWRA 3QZ8A 1QSYA 1AFJA 1B7YB 2AEFA 2CQ3A 1APSA 2VBWA 2CZVC 5KFZA 2Z2YB 3QWPA 2AJFE 4QW8A 3TJ8A 4DSFA 1IQZA 2CPXA 3H8YA 2IA6A 1H74A 1N32J 3T1HF 8RUCA 5F8HA 2NXUA 3MM9A 4LRDA 4FXWA 4KT0C 5KG5A 4Y2CA 1NB7A 1ZM9A 2OP5A 1S12A 3HSDA 5E3QA 2V2QA 2BANB 2PA8D 1RHRB 5D4PA 2J76E 3PJWA 4CQ1A 9RUBA 3KYLA 3GJQB 1CC8A 4HDGA 3K5MA 3J7ZT 5DO2A 3IGNA 3MM7B 3SDEA 2C2NA 4NLVA 1UWAA 5BJRA 5KG2A 2FJDB 1FI4A 4FF1A 1PC4A 2ZD1B 2WVCA 4WKRA 2FHKA 2ACMA 3I9V9 3SFGA 3DU5A 3ITHA 3T41A 3BN7A 3VAGA 2E7VA 1IKWB 3J7A1 1KR4A 1U26A 4F0KA 1VQ8S 3HD2A 1HFEL 2POKA 4DR2F 2C22A 1IKXA 1U47A 4LF9F 2ILYA 1HHSA 2O5DA 4YB6A 5L38A 5FDLB 4NLXA 5JMNA 2UUTA 4ES3A 2R42A 3Q23A 2CJYB 3WZ0A 5IS2A 2GQQA 3SCJE 1X4AA 2LDIA 1EAYC 2JX2A 4OJHA 4QYRA 2FVPA 3MM8B 2W7AA 1N5YB 1RU2A 1Q5VA 4K0KF 2ACYA 2KXHA 1DARA 2MJUA 4AL6A 1YJNS 1JLFB 3NL0A 3TUIC 3BR9A 2HHHJ 3KDOA 5M2PA 3A8EA 3FCVA 1F9FA 1X0PA 3FRYA 1CJVA 2JEIA 4Y2AA 3OUYB 2QFJA 3PTWA 2R7OA 1WEXA 3IXQA 3UQSA 4DN9A 4IFVA 4TU7A 2CJAA 4F7VA 1M5VC 2LA4A 4ZVOB 2GVDB 4V19J 4J37A 1HNWF 3D54A 1S77D 2PSZA 4PKDB 3GILA 1U2CA 4A8KA 2DT9A 3NKYA 4U96A 2E1AA 3DNCA 3TRGA 6AT1B 5D6GA 2XYPB 1VQOS 3M8YA 5AE2A 2MZSA 2R7UA 1QE1B 4RNNA 2DXEA 1Q5YA 1JNZB 1HWJA 1SQEA 2V9KA 4NASA 4DL2A 4LF8J 3NMRA 4OMFG 3VVUA 1AZSA 4B3TJ 3GU0A 4XDDA 2DY1A 1F6TA 1YLXA 1RK8A 3GG1A 5K20B 4WFAQ 5GAEU 2HEKA 4EZ9A 4L72B 4DQPA 4P9SA 4WFBQ 3DDKA 1KLMA 3BSCA 4ED5A 2APOA 4OZNA 4A47A 2OEKA 4F50A 3VR1A 1ICEB 2HFOA 2Q66A 2JHEA 5ETLA 4LRFA 3HHEA 2AWZA 4KKOB 3K7RA 1NM2A 1WF1A 4B9VA 3I4PA 2XS5A 3PW0A 1K1QA 4RW6B 3CSKA 1X5OA 2V8VA 3IO1A 3OFGA 1VIOA 2HBYB 2MMYA 4I56A 1T9YA 3TR5A 4CNYA 5C24A 1JMTA 2P6SA 4LF6F 4KGVB 4JI6F 4EYHB 4DQSA 2C2EA 1UCNA 2V94A 3FUYA 3EM1A 1T94A 1TTHB 3H59A 5DZ7A 2KG0A 2DBBA 2MY7A 1IKYB 2EBGA 4Q7AA 4EMDA 2VODA 1QDUB 2PMWA 1Y3JA 3HHKA 5A0YB 2YH1A 4DEZA 2UZAA 3DOKA 3R5GA 3ZC4A 1TR0A 4J9KA 5C2CA 2DO4A 2ZDOA 1UPMB 5CZVA 2VC0A 4DPXA 3Q2TC 5HANA 2PFFB 1ZAWA 2EFGA 3MXHP 4ECZA 3CCVS 2E1CA 1VQ6S 4ECWA 2BDPA 2PIIA 2B43A 1PYSB 2AJ1A 1N32F 2GJFA 1NHUA 2ZOMA 4D3HA 3QGHA 1B3TA 1XTZA 1BMQB 2CNLB 1O51A 5LOQA 5E41A 3ZNJ1 3P8BB 1J27A 5HVFA 5F8IA 4TXSA 1HMVA 3K5NA 4DR6J 2HURA 1X5PA 4N47A 2BKOA 3BREA 3QLHA 2JNJA 2WONB 2QL5B 1LV5A 2JRSA 1RTDA 2CKWA 2LEAA 3CGIA 4K50A 2UUWA 4LRAA 1DQ8A 2MJNA 3BO2A 4P7VA 4P71A 3CIZA 2WCXA 3G71S 2BJEA 3KLEA 1KHVA 2YBVA 5IM0A 1SJFA 1K47A 2FDNA 2FVQA 4F4ZA 2IJFA 4YR2A 2V0NA 5GADU 1ZETA 4FN5A 4Z7YA 4X4RA 2BE2A 2JLFA 2QL9B 2YKMB 3MDFA 4WKYA 3M8RA 2QRRA 3GQCA 1YJTA 1KLNA 1H7WA 2W25A 2KDOA 5D4OA 4IRCA 2W4DA 5HI7A 3BO4A 1EZZB 4DR2J 4LF9J 1CULB 4NZ7A 4BBYA 1OSDA 3GFYA 4KTQA 3OW2R 3PX6A 3SQGA 4IG3A 3V5RA 3G6ES 2VZ9A 4GO7X 4ICLA 3KLHB 5LJ5Y 1N33J 2VPYB 3GIIA 2IM1A 3O5TB 4RW7B 5IV3A 2GAGC 3CUNA 1Q86T 4AL5A 2OPPA 2E1MC 4WK1A 3WX4A 2IBOA 3FVYA 1B0TA 2FY8A 5DRKA 4Z7CA 2WOMA 3MF5A 3KLGB 4DV4J 1U1QA 1S9GA 2IJRA 3CDAA 4DUZJ 2EBEA 3N6LA 5IZHA 4FF3A 2DHHA 3DI6B 2CADA 4BLGA 2BM0A 1SI9A 1ZH5A 3MEGB 3DFEA 3PRVA 4ZLJA 2KFNA 4HHUA 1MWZA 1TELA 1WELA 2B7BB 4NLTA 4LSNA 3AA9A 5IWAJ 1XMQJ 1WKJA 5HQMA 1RBOB 1HNWJ 2DHXA 4B17A 2LQ8A 4J9PA 1TAUA 3JYTA 1HBMA 5GADI 3Q8RB 2IM0A 1S0MA 5EGYA 4ED8A 1BQNA 4LSNB 4PWWA 1RT6B 5J1EA 1Y5NB 5D0GA 1YJ9S 4PG8A 1U1PA 2J9CA 3S01A 1HWIA 2WB4A 3C14B 4X64J 3V4IA 1HQUB 2HRTA 3FMWA 3QT5A 1S1WB 4PCQA 3OFHA 4J9QA 4AT1B 4BCAA 4F4WA 2OSRA 1CLFA 1GK8A 4A8SA 3HF5A 3TVYA 3DRXA 4R5PB 1JKHB 1RYSA 1R0CB 4A4JA 3P5BP 1B7FA 1YJRA 5EWFA 1H3DA 3QWUA 5HO4A 3CT9A 4CT9A 2VV5A 4ED7A 1U45A 1RE1B 2C28A 5I3UB 5T14A 5A2QU 4CH7A 1BXNA 4YDDB 2FUG9 1O5JA 1XNQJ 1EETB 1OPZA 1IVZA 4JBCA 2DNRA 2V67A 2C2KB 3ETOA 4IDKA 4M5DB 3DLGB 2BW7A 3BSOA 3NBPA 3E51A 2F8HA 3L4BC 4OLOA 4Y2KA 4DWIA 4FXVA 2DNLA 3LPEA 3I0RA 4NA1A 4WU3A 5HBMB 4ED1A 3UCZP 1RABB 3AJ1A 4R0EA 3I5AA 4LT6A 5HJXA 3AD8C 3AJ2A 3D9BA 3PM9A 1NUEA 1VLYA 5HQ8A 1NBEB 1VBYA 2HIYA 1JLQB 3NNHA 4B9SA 4Q8FA 3EPIA 3DLJA 4WXWA 3PW2A 4R5PA 3CJSA 3TA0A 3GLJA 3IR5B 3PDNA 1OWXA 4V1Ak 3ZZZA 2Y8YA 3RG6A 4USVA 3K89A 1EKRA 3QBCA 5D0HA 1SJ4P 1WDDA 4KQZA 4Q0BA 2HFNA 3C15B 3KFWX 3D66A 3MCSA 4KYZA 1F9HA 2COLA 3KJVB 2YVSA 5K8PA 4CT8A 3VQSA 1S1VB 2QLWA 3VV2B 4U95A 2LU2A 1CPZA 4FYYB 3OPKA 2VG5B 4DR6F 2J0SD 4P2SA 4DZ6A 2XCPA 4DPTA 1ZTWA 4CDIA 5E2QA 2FVRA 2BXJA 3TVKA 5BYRA 1Q8BA 4ILRA 1N0VC 2DH7A 4FYVB 1LOUA 4E98A 1TQLA 2VQFF 2JSXA 1IM4A 1CJTB 5L1IA 3QJPA 2Z2MA 4C6AA 3IWXA 2XY5A 1EIYB 1CQMA 2B4PA 2B4OA 3BH6B 5FD1A 3AOBA 4O3NA 4DX6A 1WG1A 3EE3A 5HROB 1H73A 3TQ1A 3K5LA 3IBFB 4WFXA
chains in the Genus database with same CATH topology
1VQPS 2M3DA 4GO5X 4RW6A 2MHNA 3FZBA 4OZ1A 1BC6A 4MIWA 3RB4A 1UA0A 1IUJA 4F3QA 5A8KA 5KG4A 3BGUA 2ZUGA 2E5HA 2KJWA 2QA4S 1U2FA 2XGQA 1TFWA 3ZZYA 1U2RA 2F1FA 3LAKA 2GCFA 1CG2A 3MEKA 3KK3B 1V3RA 2QMWA 5LT5A 3OHBA 2HHPA 3D1HA 2KJVA 3U1MA 3V81A 3MEEA 5CXTA 4TY8B 2XC9A 5KFKA 4QIGA 4ID5A 2Z0GA 3SXLA 5SZTA 2YKPA 2CYYA 5GAHI 1FNXH 4QWEA 2NUUG 1S6QB 1X9WA 1S1XB 1WEYA 2KO1A 1DTTA 3J80Y 4HYKA 2R8GA 1VQNS 3GFZA 2XHWA 2UXDF 2GA7A 2ZOFA 2ZHBA 3VZIA 1QTMA 3BSAA 2GQ2A 1VS3A 4K5RA 5DGAA 3SMZA 4UY85 1XR5A 1TL3A 3JSBA 4HT7A 2I9SA 2MHEA 5DM7Q 2K7KA 4DS5A 4NLWA 4DFMA 3TOQA 1W2BR 2L41A 5DQGA 1JLCB 4MJKA 5BYSA 4ECYA 2N7YA 3M32B 2NS1B 2ZM6F 4FP9A 4O3PA 5CD4H 3H5SA 3ZZPA 3BSNA 2HRUA 1SUQB 5I3UA 1JKHA 1SJQA 1S1XA 1XNQF 2ROGA 3X1LB 4CZCA 4C3MA 1TAQA 1KVIA 3UWTA 4LF5F 2R7TA 4OX8A 3G96A 3N0VA 5T7LB 3MM5A 2W7PA 2ZH3A 1FTRA 4C11B 1S97A 1OSCA 2HAIA 4Z2XA 1KQGB 1P1TA 2HFZA 4IH6A 2FHJD 3R27A 1X9MA 2ABYA 2DGWA 3S1TA 4KV8A 2EWHA 4H4MA 5ADZA 4YP3A 4NCBA 4G3IA 4QWBA 5BYQA 1S9EB 3OHAA 4LSLA 3V6JA 2E5JA 1T3OA 4UQTA 1P8GA 1RT3A 2CPZA 4IH5A 1UVIA 1JLEB 3THTA 4DDFA 1UVMA 3KLGA 2V5HG 2FLOA 5EN1A 3HFKA 1S9GB 2J9EA 5AXMA 3BN4A 3DLLQ 3F41A 3CPWR 2FPHX 4DV1F 4IG3B 2DHSA 2QIFA 3TX8A 2ASLA 3MOJB 3KLHA 1D3WA 2R7VA 2I2YA 1RTHB 3MAHA 2IYIA 1RAJA 3C6TA 1QAJA 2VBZA 3R1HA 2P5VA 4IKAA 4MMOA 1KQKA 3KK1A 3HVRA 2QA4G 5KTQA 1HARA 1PSDA 4GKJF 2B4VA 2WTFA 3NLCA 5E7OB 3B78A 1MROA 2CJKA 2KRRA 1M5OC 4RWWA 4G6VB 2YNGA 2GC8A 1T8EA 2DR8A 4LF7F 2LLZA 1FDAA 5FLXY 1FDNA 3LP0B 4LFAF 4HI2A 1RTIB 2HQIA 2YKOA 2N4CA 3HHLA 3OTDA 4ID8A 4A46A 4J5OA 1R8CA 2ZE2B 1YQHA 1HYSA 2JWNA 3THVA 3BGRB 4C98A 5JXSA 4YB7A 3DLGA 3DMJB 3HHLC 3LGMA 3G6XA 1DQAA 3AB2B 2LEPA 3CJ2A 5L1KA 1RTIA 2OAUA 3RBEA 3MM7A 1UP1A 1Y0HA 5HMWA 2YNHA 3LAMA 1HNVA 2M52A 1RISA 4PXCA 2HRYA 2O1PA 4ED2A 4NRUA 2HLUA 2JLEA 3DOLA 4ZVHA 4ZCKA 2HWTA 3BM7A 4IO1A 5B0BA 3HMJG 1H38A 1ZPWX 3PO5A 2F7VA 2QA1A 1NAQA 3AAWB 5L1LA 4C9DA 3QJJA 3T9NA 4PPDA 3HZEA 2DNGA 2U1AA 4ZPVR 4IFYA 4UW2A 2ASJA 3IS9B 1YRXA 1FCAA 3RB6A 3V6DA 2FHJA 4EUVA 1WEZA 1NKCA 3NS5A 3VAJA 5F3TA 4O0IA 2KYZA 4FS1A 5LJ3Y 4N5SA 4LVOP 5IT9Y 1W2IA 1T95A 4N76A 1VQ5S 1TKTB 4I7FB 2DR5A 3DI6A 1U6ZA 3IA0A 5KG1A 1NRKA 2CJ9A 2FC8A 3OR1A 1KD1T 2UP1A 4Y3CA 1XK8A 4KO0A 2ADBA 2LQJA 4OZJA 4PQUA 2VUGA 4EWTA 4DSJA 2HNDB 4O3RA 3CCSS 5JVHQ 4JI5F 3U1NA 5DDOC 3KHLA 3DXSX 4CO2A 4X66F 1U1RA 1KQSR 2XO7A 1TP7A 3C3LA 3T19A 4B9MA 3VAMA 1RT1A 1RWUA 2VFUA 3A1YG 1MMNA 3OTEA 2J0WA 2FC9A 2ZJRQ 1AFIA 3DHXA 2MZTA 5F8MA 1R27B 2B5JA 5U47A 3MR3A 3CCTA 1J5OB 1RI7A 5A8RB 2KI2A 3MMJA 1HWUA 1HNXF 3MM8A 5J2MB 4DFKA 3LALA 3AHPA 4TU9A 4O3QA 2RRNA 2D3OR 2C42A 2GJ2A 2GMLA 2HNZB 1TKZA 1QY7A 2UXCF 5FDLA 4F2RA 2LKZA 5B0FA 3OFFA 1FESA 1QAYA 4M1KA 4XO0A 2W8LA 2DO0A 2R9LA 1C0TB 4DSLA 2FJAB 2R7WA 3U02A 2J7UA 1H0HB 2VPXB 4RW8B 1G1XA 4EZ6A 2W9AA 4KAIA 3DLBA 1TVRA 3MZIA 1ZTTA 3C8YA 2IMOA 1IJEB 4LVNP 3SDEB 3TANA 2MDAA 4Q43A 4I64A 2W9BA 1FNMA 5KT5A 1DTTB 1YBAA 4DV0F 3JAMY 1R8AA 3RAQA 1S6QA 5MLCV 3CDUA 3BS9A 2B9XA 3FDSA 4J9RA 1YHQS 1TKDA 4NL5A 4RX6A 2XY7A 1L3VA 4PQUB 2GGPB 1XNRF 3KG1A 3CE8A 1UFLA 3MMBA 4ZPCA 2Y1JA 1NK5A 4PUOA 5KFOA 4D3GA 1B0VA 3MMCB 3OJSA 3MR6A 4K4SA 4RLEA 1K0TA 3TA1A 1TL4A 3RW6A 4DL3A 3Q8PB 2EI5A 4OHZA 3US5A 4USIA 4DFPA 3NMAA 2BQ3A 3KOAA 2BVZA 3SEOA 3JSMA 3GG0A 2WK4A 4URSA 3JTNA 1XEZA 1N0UA 2JJ4D 2BV3A 2MQPA 3WC2A 3ISND 1MMDA 2DIVA 2JFKA 2V8HA 4K4WA 2BW2A 2BZ2A 3GWCA 3ISNC 4G1IA 1HQEA 4U9RA 2VG7A 2HYIB 2HIQA 3DYAB 2HVHA 5KAKA 1JLEA 1SL2A 3PY8A 3PHEA 5F0WA 1Q16B 1Q53A 2DR7A 4ECUA 4RW7A 4G1PA 4NLUA 5B0DA 4ICLB 4X4UA 2Q6BA 2YKNA 2BJDA 2A10A 2X1AA 1D1UA 1KNZA 3UI3A 4WYLA 1HBOB 4NA2A 1S48A 4PXDA 4ZS6A 1DURA 1KS2A 5K8MA 4NXNF 2IHR1 2RB7A 1WI6A 2HPUA 2ZE2A 2VASA 1Q8LA 4OX7A 1DFDA 4RW9A 4QW9A 1HI0P 1WI8A 4QPTA 2L9DA 3J7YU 2QEXS 5B7WA 1U1OA 5J2QA 1VK3A 2HW3A 2OKQA 5L8RC 4UUXA 4O3OA 1SUQA 5D8HB 3PIOQ 5KFHA 1GX5A 2OD4A 2DH8A 3DN9A 4J9MA 4B3OB 4P6QA 1R89A 3QAEA 2RRBA 4Y65A 2BQRA 2JEFA 4NLYA 4PXEA 4R0JA 3BGFA 4JI0F 3KK2A 1XBWA 2FJWA 2CVIA 4X84A 5C25A 2CPHA 1WG4A 3JTOA 4IOBA 5LXRA 2SXLA 3AY0A 2PDAA 3U7JA 2M8HA 3S8SA 1SJ3P 4WFYA 2WRMA 3CCQS 1S72S 2JC0A 5D78A 1FO1A 5HN0A 3IN5A 4O44B 4DLEA 1P27B 1Q4RA 4KSEB 4YUDA 4HLBA 4K4XA 1VBZA 2X1FA 1ZBTA 2B9YA 2GMJA 4YDXA 3G6VA 3DRRA 4DUYF 1GTEA 2ZFHA 2VOOA 3D28A 1TL1A 2CPJA 3GFXA 4L3NA 1UJ6A 2RQKA 2C2DA 1KOOA 2ZBCA 1PO6A 4F4KA 4YOEA 2CFXA 1ZZNA 1M1KT 2VG7B 4M8LA 4RW4A 4PG7A 4YMEA 1DTQA 4PR6A 2N3OA 3W2WA 4XK8C 4BC9A 3L7OA 4KB7A 4C8OA 2GIQA 4QR1A 2KXNB 3V6DB 1FXDA 4NXMF 1S1TB 4RNMA 3MEGA 2EK1A 1MNEA 4OHYA 2RH3A 2YKMA 3M2RA 4RW4B 3MMAA 5KFXA 3MD1A 5KFNA 4JI1F 3MMCA 2GFFA 3QYYA 1LK5A 5IM0B 5F8GA 1X4DA 2D41A 2O3DA 3MMBB 4NYPA 1RJJA 4PUOB 1E6VB 2GHWA 2I5JA 1NKBA 2V9WA 5F8NA 1G7CB 3OXF