2B0HA

Solution structure of vbs3 fragment of talin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
GIDPFTMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Talin-1
total genus 50
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08913 VBS Vinculin Binding Site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2b0hA01
3TJ6A 5L0IA 3RF3A 2GDCA 5FZTA 3MYIA 1ZW2A 1DOWA 1SYQA 4PR9A 5L0CA 2L7AA 2X0CA 5L0FA 1RKEB 1YDIA 1ZW3A 1TR2A 3TJ5A 4ONSA 3H2UA 4W8PA 1DOVA 1U89A 4K1OA 1QKRA 3ZDLA 5L0GA 2B0HA 5L0JA 4E17A 1L7CA 1ZVZA 4DJ9A 1RKEA 1ST6A 1XWJA 3T6GB 4E18A 2GWWA 5L0HA 5L0DA 1H6GA 2HSQA 1T01A 3VF0A 2LQGA 4IGGA 4EHPA 1U6HA 3S90A 1RKCA 4P9TA 2IBFA 3H2VA
chains in the Genus database with same CATH superfamily
2CNWD 1ORSC 2IXMA 2HJ3A 3Q6MA 4U5FE 1FFTC 1LI5A 2PP4A 4XWJA 4IARA 4BEJA 3DE8A 2J7PA 1CPQA 4CDAA 1IZMA 3FOPA 4DRIB 4CDVA 4P9FA 3O10A 4WGYA 2XS8A 1A41A 3AOUA 1D0XA 2YQYA 3EH2A 4JEBA 4YT2A 2W45A 5T3TA 2XXAB 3K66A 2A6HF 2Y3HA 1LKXA 4CIHA 5DLJA 5GPGB 3EGDB 4FAPB 4E7ZA 1L3PA 1M2VA 2M4EA 1S05A 3IQCA 4PJJA 4IJJA 1HY5A 3VM6A 1AUEA 4BG0A 4DOZA 2R7XA 4XPWA 4H54A 3W8HA 5CIVA 4Z9IA 4XEFA 2Y69C 3B0UX 2NUPB 3KKBA 3E70C 1OQCA 2P0NA 1HMDA 1NSGB 2QE9A 2BC5A 1Q0FA 3NMIA 2IXPA 3V7OA 4K1OA 1JPNA 1JAFA 2YEVA 5F28E 2LFFA 3ZG1A 4EWCA 4JKVA 1D1CA 4EBJA 3NRHA 1I5NA 3DD7A 2QLAA 1LI7A 5BQGA 4W8KA 3Q7GA 5BQHA 2ZPAA 1G4US 4NTFA 1RKEB 1W2WA 2J7PD 3G4XA 3NYMA 3DAFA 3RVZA 1U89A 2OKUA 1UG7A 1WOLA 3ZC4A 4OIPF 2R02A 3GORA 2FGYA 1FNTc 1T9KA 1Q0GA 4C3BA 1TWHA 3AGUA 4PJLA 1EA8A 5HV9A 4OINF 1D1AA 2Q9AA 3DM5A 3LESA 1T01A 5A6KA 4QDLA 2LQGA 4Q7CA 5T3WA 4EHPA 4FX5A 1LIHA 3S90A 2HUJA 5EK0A 2EPLX 2W9YA 5EGYA 2J0WA 2YHSA 3O39A 3EHMA 5AGFA 2L9JA 3H65A 5KYYA 5CI8A 4WABA 4Z9HA 5E3AA 1D0YA 1JPJA 2E87A 4CS9C 5DS4A 4C3EA 1OCOC 4MVSA 3BRJA 4O6NA 5TJ5E 3TD7A 5A6BA 4QI2A 3SEOA 2D4UA 4MW3A 3EQLF 2OJQA 2YLGA 3GM1A 3TJ5A 2FFHA 5KYYB 1K04A 4O6MA 4CS7A 3R2PA 1TQGA 3I5QA 3JRMO 4XQ1A 4AK9A 4G7HF 1HE1A 1KTMA 4RD9A 4AE4A 1RCPA 4LLEA 1A0BA 2XLMA 1PD0A 4J32B 4JRZA 1OW6A 2HKVA 5COMA 3GM3A 4YT5A 1VLTA 3B0PA 2NSGA 2YWAA 3C8ZA 2A1DD 3EG9B 3JYYA 3FDQA 3S29A 1S7ZA 2WZGA 4H4KC 2R05A 1U6HA 2HV6A 2OG2A 2OEVA 1YA9A 5DQTA 3C18A 1OXKA 2YZSA 3N24A 3F46A 1A7VA 4X0RA 1OKKA 4BJ6C 3U3FA 1OR2A 3KMIA 4EKWA 3QVZA 1M56C 4YL0A 5JRAA 1Q0KA 3UGPA 1CGNA 1H7IA 2JPUA 3B71A 1O5HA 3G4ZA 3HNLA 1M2VB 4HFFB 3AG4C 3T6BA 4ULWA 1Q0DA 4IRUA 5L0FA 2NSFA 2RD9A 3W2WA 1QKRA 2YL1A 4I1OB 3GODA 3JRTA 2YLIA 4E17A 1M2OA 5FCLA 1FFHA 2L6HA 2LD6A 3A11A 4NY3A 2NUPA 2HFIA 2CDQA 3JYHA 2GWWA 4Q5SF 2L81A 3RH3A 1K40A 1YYXA 3SZRA 5D92A 3O6XA 1G8XA 3HTKC 4BPMA 1O87A 3I4UA 1T6UA 1YYJA 2QUPA 2YL7A 3S9OA 4A4AA 4LDQA 2RSEB 3TQOA 4XLPF 3TOLA 4XTKA 4Z9JA 3U9JA 1H9TA 1QPUA 4CJGA 1GGQA 3ABLC 4U9DA 2KGOA 3KL4A 3AQBA 3T4RA 3EPVA 1JMWA 1YARO 1ZZPA 2DGJA 1MNDA 2VH3A 3S27A 2A68F 3EHNA 3OWTA 2Y3GA 4BJ5C 4EBKA 1R5ID 1CPRA 3QZCA 3RFYA 2QTVA 3AG2C 1I4YA 3IHUA 5K0IA 4XPYA 2TMVP 2HZ8A 1XZPA 4JCZA 3CEXA 3JSZA 3MLGA 3PCVA 3QTHA 4IGGA 5JVEA 4JVSA 5HSWA 2GAQA 3L8JA 4PJNA 3ATPA 1ZHYA 3EH1A 3LEVA 2JD3A 2IYLD 3NMKA 4OD5A 3TULA 3MFNA 4JZAA 3JT1A 2GDCA 1RJ9B 3OEOA 4YL3A 4CDYA 1MMGA 1WWPA 4CBEA 4G0HA 3AGTA 3FAPB 3LLIA 4PR9A 3SXYA 1ZHZA 4JW1A 4D4XA 1N1CA 3J06A 3QVYA 2VC9A 2YKZA 4UDVA 3DI5A 2Y39A 4FESA 3FOOA 2NUTA 1LE4A 2LSEA 2R7TA 2WVOA 1NU7D 2KSFA 3NKEA 3TOMA 5COGA 1XWJA 2YLDA 3S84A 3LUTB 2UUIA 5T1DB 4KNWA 3SNHA 3C8GD 4MTOA 1GS9A 1WATA 4P6IC 2Q00A 3O55A 2YL0A 3NKDA 5AC4A 1Z6AA 5DVWA 2Z15A 1E85A 2CW0F 4CS9A 4G78A 2HMQA 2R7QA 3ASNC 2ZXWC 3FVYA 4AL0A 4B6IA 1FMVA 5B3SC 1ORYA 1E2XA 2A69F 1SF8A 3IQ5A 4J30B 4JTDB 5JLIA 2OU6A 2Y3BA 1MMDA 1PD1A 5KYWB 3JTLO 3M1CB 1OKKD 3RQGA 2ZD9A 1OW7A 1WASA 3LLKA 2J45A 1CGOA 1T6IA 1IW7F 2VCCA 3M79A 4MTFA 1YAUO 3IPMO 3ZTZA 1GM5A 3WAQA 1BZ4A 1ZYRF 1VB5A 2PNOA 4HE8D 4GQHA 5B3IA 3V5ZA 1H9GA 1ZHXA 4ZLDA 2W4BA 2YVKA 4NCQA 3DAGA 2CGEA 4DXWA 2AP3A 2EIJC 2MYSA 2CNWA 1TFKB 3FXHA 4RDAA 4U5HA 2J9BA 3K33A 3AG3C 3POVA 2P6VA 2WZLA 5EHHA 1FR0A 3SXZA 3CZ6A 1LM3B 1WGWA 3K1IC 4PACA 1LS4A 4NTBA 2FAPB 2J9VA 1D1BA 5E2QA 2AWYA 3UR3C 4ONSA 2EINC 4NQFA 3ZTMA 1AEPA 4DRHB 4QI0A 2R7RA 2AU5A 1V74B 2H8AA 3Q6NA 5CI9A 4MVRA 3V5YA 3N2ZB 4L6RA 1JRAA 3IQTA 4PJMA 5KYUA 1LS1A 1EI7A 4HEAJ 4DJ9A 3AQCA 1QZXA 1VK5A 1VYIA 5B1AC 3DZAA 5BUOA 3FHDA 1V54C 2J46A 2XLEA 4N6CA 5DS6A 3SP1A 2W4MA 3CQZA 3L0IA 5JT4A 3KH2A 4E0IA 2QNLA 3T6JA 4Q4ZF 3ASOC 1EQ1A 3LS0A 1YA7O 1NZEA 4DVZA 3RYLA 1VMAA 2J0XA 1BDJB 3DWWA 3QMKA 4N6HA 3TJ6A 1QVXA 1TWCA 2GA0A 4WJ0A 2XXAA 2XLWA 1YZAA 3HJCA 4G7ZF 3EZHA 4CSAA 2J9WA 2OEXA 3C62A 2ZXPA 3DJNB 3KPHA 3W2VA 1KNYA 2F22A 3GEEA 3LAYA 1BBHA 2AVKA 3LNRA 2B0JA 4RBNA 1O3UA 3RW0A 2H7BA 4G7OF 1ST6A 4E18A 3JZ0A 1NLXA 3VAYA 3C8GB 2EPMX 1VOMA 5F5FA 2XLHA 3EFOB 4DBQA 5JUAA 1NBBA 5F5HA 3AG1C 4IAQA 1I4ZA 3X1OA 4AX2A 5A6JA 1R4TA 2P7VA 3GWLA 4K7BA 4EIYA 2P1AA 4BJTA 2XLOA 3HLZA 3W8IA 1V4AA 3FMSA 2WL8A 4BJ6A 3U8PA 4ZLCA 2R7SA 3EGXA 2KK1A 2ZXRA 2A6EF 2HMZA 3U2LA 2PX0A 5L0CA 1E86A 4JIOA 1TWGA 4A2NB 5COFA 3OA1A 2G3VA 3U0CA 3EGDA 2R9RB 1DOVA 2J8WA 4OD4A 2XLVA 2VB6A 2XM4A 3ABKC 4MQ9F 4MVOA 3U9MA 4KNVA 1FTSA 2X51A 1J8YF 3K6BA 4JTCB 3DKAA 5A6BD 5KYWA 1E84A 4OIQF 1GQAA 3NG1A 2HSQA 4I3MA 4LLCA 4I44A 2LK4A 2G3KA 4BJ1A 1APCA 3KYJA 5L3VA 1M6TA 3NYLA 1SMYF 2I15A 2WB7A 3QW1A 5JSLA 4I1MA 1OCZC 4PK4A 3US6A 4XPXA 2LP4A 2XLDA 2XRHA 3MYIA 2VASA 4O79A 2PBEA 4YN0B 1VLSA 3MYFA 3UMKA 1YVIA 4F4BA 1KU2A 1YZCA 1Z3IX 1RJ9A 2ASRA 4MTGA 1SR2A 5IY5C 1C02A 1TKNA 2C04A 1TWAA 1WTYA 3QW0A 1A7DA 5B1BC 1CGME 3FAJA 3KYIA 3ZDLA 1NFNA 2B0HA 5DS5A 2G62A 5KYXB 3N0TA 3T6GB 4YWQA 3SYNA 1C03A 1OCCC 1BR4A 2KNHA 4N4WA 4JURI 4JCHA 1Z7Qc 2J9UA 4O7GA 4YT8A 3ITFA 4JJFA 1QQ3A 2KQ9A 1MMAA 2KJGA 3AJMA 2HS5A 2XL6A 2ICWG 3ABMC 5KYUB 3IQ6A 4P9TA 3C7JA 4WGZA 1ZU5A 5A6AA 2M64A 3R7CA 3VF0A 3T9OA 3RF3A 1XZQA 1BR1A 256BA 3EJNA 2KYHA 3G50A 5A69A 3ZSUA 3HNIA 4MW8A 4BJ5A 4BEMJ 2YRFA 1SYQA 3ZVRA 1ZU4A 3ZQVA 3E9VA 3SXKA 1T6QA 3HNJA 3LJBA 4YL1A 4R32A 4CSAC 2BL2A 2NUTB 2A0UA 1A7EA 3GEHA 2H7OA 4O6YA 1PCXA 2DI3A 2LCHA 3HNKA 2ETSA 2IXNA 3GANA 4EBBA 4K0DA 5DQZA 3EFOA 2Q7RA 1RKEA 2LFDA 4YK5A 4PFPA 3DJUB 3C8GA 1HW2A 2O9XA 4J7TA 2UUHA 4MVUA 3VRCA 2XL4A 3Q7LA 4DVYP 5L3QA 2IBFA 4HFKB 4YJWA 3U5SA 1F1MA 3H2VA 3RIPA 3PMRA 2GFHA 4JTAB 5L0IA 2C03A 2V26A 4OIRF 1ZHTA 4U5DE 2BE5F 2OOCA 1YJGA 3LNMB 3K7DA 4JE9A 4E0HA 2XSEA 3B29A 3GWNA 2WZFA 1DOWA 3UMHA 2ZXOA 3K1HA 4AL1A 2L7AA 3IEEA 2X0CA 1YDIA 1ZW3A 2PX3A 2PFDA 1OW8A 2EILC 2KW3C 4GYTA 3VYWA 2EIMC 1NG1A 1OXBA 3L34A 1MMNA 4U5BE 1M57C 1ZVZA 4XEVA 3GM2A 2QY9A 3S28A 2Q3TA 2HJMA 4J7YA 1RMVA 3NMJA 3TK0A 5L0HA 1H6GA 3DE9A 4LDRA 2VCBA 3M4BA 5AC5A 1OCRC 3MX3A 3I5PA 1ORJA 1J8MF 4MNDA 3LEOA 4LERA 4CJOA 2LIGA 1HMOA 4NTAA 4MVQA 2Q9BA 2NG1A 2XS1A 4LACB 3WODF 4XLNF 4U5GA 1PV3A 1Y6DA 3SXMA 4KC9A 1TFOB 1ZW2A 3DM9B 2AWCA 3PDMP 2CCYA 1JOGA 2MHRA 2Y3DA 5KYNA 3K1IA 2PF4E 5BQIA 2DYSC 2NPUA 4GEHA 4W8PA 4AE4B 1VYKA 2R7VA 2XL8A 3B0VC 5JP7A 2Q9CA 2OJED 2JX0A 1WN0A 2KC3A 3GEIA 4MVZA 1HE9A 3UMIA 3ZQYA 2EPKX 1B68A 3HKKA 4NC3A 3DXJF 1E83A 3DMDA 1Z23A 2OQMA 4C3DA 1SZIA 4LDKA 2L6FA 4CIPA 2HSBA 1RKCA 5KYXA 1RXQA 4CS8C 5D91A 1FAPB 5E3CA 1BR2A 4JEAA 1D0ZA 1FMWA 2Q4FA 5JS5A 3UGOA 2R25A 1T5OA 2VCAA 2A0BA 4IAOA 3U3BA 1QSPA 1G5ZA 2YL3A 4JC7A 1Z63A 1Q0MA 4MVMA 4CX9A 1JR8A 1U0BB 1LE2A 3RVYA 3U8VA 4N06A 3U2MA 4D4NA 2R7WA 3JSEO 3MBGA 1TR2A 1MQVA 2R7OA 3LS1A 3X2QC 2WVQA 3H2UA 3NYJA 2CYDA 4ANJA 3B9QA 2R03A 1AVOB 3L1MA 3JCUQ 2WVNA 3V5XA 3EG9A 5L0DA 4E7SA 2L6GA 3A9CA 3S0XA 4U5CE 4U9EA 1C17M 2MWQA 3BEHA 2OCCC 4KBLA 3WHNA 2V3CC 2XM0A 4FWVA 1Y4CA 3UNGC 4CS8A 3WG7C 4DRJB 4C7OA 2DB4A 5FZTA 1UFBA 4M63A 1LPEA 3ZWIA 4KI2A 3M4CA 4XEKA 4IWBA 3RQEA 3EGXB 2I8BA 2IXOA 1NU9C 3CSKA 3W4YA 4PFOA 3L8IA 1MNEA 4DBRA 2HV7A 4C7OB 1VTMP 1LVKA 4EUKB 3M15A 5L0GA 2R7UA 5L0JA 1Z5ZA 4OIOF 5E33A 1L7CA 1G4WR 3CAXA 3EZIA 4ULVA 3PHF2 2D5RB 1K05A 2DYRC 1QLEC 3F47A 2EIKC 4YT4A 4IB4A 4ER9A 1NFOA 3RKOF 4JJGA 1YLMA 2H7VC 1OR3A 2EPOA 3ECSA 4MS2A 4U5EE 2EPNA 3RQFA 3ZIBA 1ZHWA 1HW1A 3NDBB 1EKYA 1V55C 3C63A 2IOQA 2P61A 2IM8A
chains in the Genus database with same CATH topology
3TJ6A 5L0IA 3RF3A 2GDCA 5FZTA 3MYIA 1ZW2A 1DOWA 1SYQA 4PR9A 5L0CA 2L7AA 2X0CA 5L0FA 1RKEB 1YDIA 1ZW3A 1TR2A 3TJ5A 4ONSA 3H2UA 4W8PA 1DOVA 1U89A 4K1OA 1QKRA 3ZDLA 5L0GA 2B0HA 5L0JA 4E17A 1L7CA 1ZVZA 4DJ9A 1RKEA 1ST6A 1XWJA 3T6GB 4E18A 2GWWA 5L0HA 5L0DA 1H6GA 2HSQA 1T01A 3VF0A 2LQGA 4IGGA 4EHPA 1U6HA 3S90A 1RKCA 4P9TA 2IBFA 3H2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ6 A;  5L0I A;  3RF3 A;  2GDC A;  5FZT A;  3MYI A;  1ZW2 A;  1DOW A;  1SYQ A;  4PR9 A;  5L0C A;  2L7A A;  2X0C A;  5L0F A;  1RKE B;  1YDI A;  1ZW3 A;  1TR2 A;  3TJ5 A;  4ONS A;  3H2U A;  4W8P A;  1DOV A;  1U89 A;  4K1O A;  1QKR A;  3ZDL A;  5L0G A;  2B0H A;  5L0J A;  4E17 A;  1L7C A;  1ZVZ A;  4DJ9 A;  1RKE A;  1ST6 A;  1XWJ A;  3T6G B;  4E18 A;  2GWW A;  5L0H A;  5L0D A;  1H6G A;  2HSQ A;  1T01 A;  3VF0 A;  2LQG A;  4IGG A;  4EHP A;  1U6H A;  3S90 A;  1RKC A;  4P9T A;  2IBF A;  3H2V A; 
#chains in the Genus database with same CATH topology
 2CNW D;  1ORS C;  2IXM A;  2HJ3 A;  3Q6M A;  4U5F E;  1FFT C;  1LI5 A;  2PP4 A;  4XWJ A;  4IAR A;  4BEJ A;  3DE8 A;  2J7P A;  1CPQ A;  4CDA A;  1IZM A;  3FOP A;  4DRI B;  4CDV A;  4P9F A;  3O10 A;  4WGY A;  2XS8 A;  1A41 A;  3AOU A;  1D0X A;  2YQY A;  3EH2 A;  4JEB A;  4YT2 A;  2W45 A;  5T3T A;  2XXA B;  3K66 A;  2A6H F;  2Y3H A;  1LKX A;  4CIH A;  5DLJ A;  5GPG B;  3EGD B;  4FAP B;  4E7Z A;  1L3P A;  1M2V A;  2M4E A;  1S05 A;  3IQC A;  4PJJ A;  4IJJ A;  1HY5 A;  3VM6 A;  1AUE A;  4BG0 A;  4DOZ A;  2R7X A;  4XPW A;  4H54 A;  3W8H A;  5CIV A;  4Z9I A;  4XEF A;  2Y69 C;  3B0U X;  2NUP B;  3KKB A;  3E70 C;  1OQC A;  2P0N A;  1HMD A;  1NSG B;  2QE9 A;  2BC5 A;  1Q0F A;  3NMI A;  2IXP A;  3V7O A;  4K1O A;  1JPN A;  1JAF A;  2YEV A;  5F28 E;  2LFF A;  3ZG1 A;  4EWC A;  4JKV A;  1D1C A;  4EBJ A;  3NRH A;  1I5N A;  3DD7 A;  2QLA A;  1LI7 A;  5BQG A;  4W8K A;  3Q7G A;  5BQH A;  2ZPA A;  1G4U S;  4NTF A;  1RKE B;  1W2W A;  2J7P D;  3G4X A;  3NYM A;  3DAF A;  3RVZ A;  1U89 A;  2OKU A;  1UG7 A;  1WOL A;  3ZC4 A;  4OIP F;  2R02 A;  3GOR A;  2FGY A;  1FNT c;  1T9K A;  1Q0G A;  4C3B A;  1TWH A;  3AGU A;  4PJL A;  1EA8 A;  5HV9 A;  4OIN F;  1D1A A;  2Q9A A;  3DM5 A;  3LES A;  1T01 A;  5A6K A;  4QDL A;  2LQG A;  4Q7C A;  5T3W A;  4EHP A;  4FX5 A;  1LIH A;  3S90 A;  2HUJ A;  5EK0 A;  2EPL X;  2W9Y A;  5EGY A;  2J0W A;  2YHS A;  3O39 A;  3EHM A;  5AGF A;  2L9J A;  3H65 A;  5KYY A;  5CI8 A;  4WAB A;  4Z9H A;  5E3A A;  1D0Y A;  1JPJ A;  2E87 A;  4CS9 C;  5DS4 A;  4C3E A;  1OCO C;  4MVS A;  3BRJ A;  4O6N A;  5TJ5 E;  3TD7 A;  5A6B A;  4QI2 A;  3SEO A;  2D4U A;  4MW3 A;  3EQL F;  2OJQ A;  2YLG A;  3GM1 A;  3TJ5 A;  2FFH A;  5KYY B;  1K04 A;  4O6M A;  4CS7 A;  3R2P A;  1TQG A;  3I5Q A;  3JRM O;  4XQ1 A;  4AK9 A;  4G7H F;  1HE1 A;  1KTM A;  4RD9 A;  4AE4 A;  1RCP A;  4LLE A;  1A0B A;  2XLM A;  1PD0 A;  4J32 B;  4JRZ A;  1OW6 A;  2HKV A;  5COM A;  3GM3 A;  4YT5 A;  1VLT A;  3B0P A;  2NSG A;  2YWA A;  3C8Z A;  2A1D D;  3EG9 B;  3JYY A;  3FDQ A;  3S29 A;  1S7Z A;  2WZG A;  4H4K C;  2R05 A;  1U6H A;  2HV6 A;  2OG2 A;  2OEV A;  1YA9 A;  5DQT A;  3C18 A;  1OXK A;  2YZS A;  3N24 A;  3F46 A;  1A7V A;  4X0R A;  1OKK A;  4BJ6 C;  3U3F A;  1OR2 A;  3KMI A;  4EKW A;  3QVZ A;  1M56 C;  4YL0 A;  5JRA A;  1Q0K A;  3UGP A;  1CGN A;  1H7I A;  2JPU A;  3B71 A;  1O5H A;  3G4Z A;  3HNL A;  1M2V B;  4HFF B;  3AG4 C;  3T6B A;  4ULW A;  1Q0D A;  4IRU A;  5L0F A;  2NSF A;  2RD9 A;  3W2W A;  1QKR A;  2YL1 A;  4I1O B;  3GOD A;  3JRT A;  2YLI A;  4E17 A;  1M2O A;  5FCL A;  1FFH A;  2L6H A;  2LD6 A;  3A11 A;  4NY3 A;  2NUP A;  2HFI A;  2CDQ A;  3JYH A;  2GWW A;  4Q5S F;  2L81 A;  3RH3 A;  1K40 A;  1YYX A;  3SZR A;  5D92 A;  3O6X A;  1G8X A;  3HTK C;  4BPM A;  1O87 A;  3I4U A;  1T6U A;  1YYJ A;  2QUP A;  2YL7 A;  3S9O A;  4A4A A;  4LDQ A;  2RSE B;  3TQO A;  4XLP F;  3TOL A;  4XTK A;  4Z9J A;  3U9J A;  1H9T A;  1QPU A;  4CJG A;  1GGQ A;  3ABL C;  4U9D A;  2KGO A;  3KL4 A;  3AQB A;  3T4R A;  3EPV A;  1JMW A;  1YAR O;  1ZZP A;  2DGJ A;  1MND A;  2VH3 A;  3S27 A;  2A68 F;  3EHN A;  3OWT A;  2Y3G A;  4BJ5 C;  4EBK A;  1R5I D;  1CPR A;  3QZC A;  3RFY A;  2QTV A;  3AG2 C;  1I4Y A;  3IHU A;  5K0I A;  4XPY A;  2TMV P;  2HZ8 A;  1XZP A;  4JCZ A;  3CEX A;  3JSZ A;  3MLG A;  3PCV A;  3QTH A;  4IGG A;  5JVE A;  4JVS A;  5HSW A;  2GAQ A;  3L8J A;  4PJN A;  3ATP A;  1ZHY A;  3EH1 A;  3LEV A;  2JD3 A;  2IYL D;  3NMK A;  4OD5 A;  3TUL A;  3MFN A;  4JZA A;  3JT1 A;  2GDC A;  1RJ9 B;  3OEO A;  4YL3 A;  4CDY A;  1MMG A;  1WWP A;  4CBE A;  4G0H A;  3AGT A;  3FAP B;  3LLI A;  4PR9 A;  3SXY A;  1ZHZ A;  4JW1 A;  4D4X A;  1N1C A;  3J06 A;  3QVY A;  2VC9 A;  2YKZ A;  4UDV A;  3DI5 A;  2Y39 A;  4FES A;  3FOO A;  2NUT A;  1LE4 A;  2LSE A;  2R7T A;  2WVO A;  1NU7 D;  2KSF A;  3NKE A;  3TOM A;  5COG A;  1XWJ A;  2YLD A;  3S84 A;  3LUT B;  2UUI A;  5T1D B;  4KNW A;  3SNH A;  3C8G D;  4MTO A;  1GS9 A;  1WAT A;  4P6I C;  2Q00 A;  3O55 A;  2YL0 A;  3NKD A;  5AC4 A;  1Z6A A;  5DVW A;  2Z15 A;  1E85 A;  2CW0 F;  4CS9 A;  4G78 A;  2HMQ A;  2R7Q A;  3ASN C;  2ZXW C;  3FVY A;  4AL0 A;  4B6I A;  1FMV A;  5B3S C;  1ORY A;  1E2X A;  2A69 F;  1SF8 A;  3IQ5 A;  4J30 B;  4JTD B;  5JLI A;  2OU6 A;  2Y3B A;  1MMD A;  1PD1 A;  5KYW B;  3JTL O;  3M1C B;  1OKK D;  3RQG A;  2ZD9 A;  1OW7 A;  1WAS A;  3LLK A;  2J45 A;  1CGO A;  1T6I A;  1IW7 F;  2VCC A;  3M79 A;  4MTF A;  1YAU O;  3IPM O;  3ZTZ A;  1GM5 A;  3WAQ A;  1BZ4 A;  1ZYR F;  1VB5 A;  2PNO A;  4HE8 D;  4GQH A;  5B3I A;  3V5Z A;  1H9G A;  1ZHX A;  4ZLD A;  2W4B A;  2YVK A;  4NCQ A;  3DAG A;  2CGE A;  4DXW A;  2AP3 A;  2EIJ C;  2MYS A;  2CNW A;  1TFK B;  3FXH A;  4RDA A;  4U5H A;  2J9B A;  3K33 A;  3AG3 C;  3POV A;  2P6V A;  2WZL A;  5EHH A;  1FR0 A;  3SXZ A;  3CZ6 A;  1LM3 B;  1WGW A;  3K1I C;  4PAC A;  1LS4 A;  4NTB A;  2FAP B;  2J9V A;  1D1B A;  5E2Q A;  2AWY A;  3UR3 C;  4ONS A;  2EIN C;  4NQF A;  3ZTM A;  1AEP A;  4DRH B;  4QI0 A;  2R7R A;  2AU5 A;  1V74 B;  2H8A A;  3Q6N A;  5CI9 A;  4MVR A;  3V5Y A;  3N2Z B;  4L6R A;  1JRA A;  3IQT A;  4PJM A;  5KYU A;  1LS1 A;  1EI7 A;  4HEA J;  4DJ9 A;  3AQC A;  1QZX A;  1VK5 A;  1VYI A;  5B1A C;  3DZA A;  5BUO A;  3FHD A;  1V54 C;  2J46 A;  2XLE A;  4N6C A;  5DS6 A;  3SP1 A;  2W4M A;  3CQZ A;  3L0I A;  5JT4 A;  3KH2 A;  4E0I A;  2QNL A;  3T6J A;  4Q4Z F;  3ASO C;  1EQ1 A;  3LS0 A;  1YA7 O;  1NZE A;  4DVZ A;  3RYL A;  1VMA A;  2J0X A;  1BDJ B;  3DWW A;  3QMK A;  4N6H A;  3TJ6 A;  1QVX A;  1TWC A;  2GA0 A;  4WJ0 A;  2XXA A;  2XLW A;  1YZA A;  3HJC A;  4G7Z F;  3EZH A;  4CSA A;  2J9W A;  2OEX A;  3C62 A;  2ZXP A;  3DJN B;  3KPH A;  3W2V A;  1KNY A;  2F22 A;  3GEE A;  3LAY A;  1BBH A;  2AVK A;  3LNR A;  2B0J A;  4RBN A;  1O3U A;  3RW0 A;  2H7B A;  4G7O F;  1ST6 A;  4E18 A;  3JZ0 A;  1NLX A;  3VAY A;  3C8G B;  2EPM X;  1VOM A;  5F5F A;  2XLH A;  3EFO B;  4DBQ A;  5JUA A;  1NBB A;  5F5H A;  3AG1 C;  4IAQ A;  1I4Z A;  3X1O A;  4AX2 A;  5A6J A;  1R4T A;  2P7V A;  3GWL A;  4K7B A;  4EIY A;  2P1A A;  4BJT A;  2XLO A;  3HLZ A;  3W8I A;  1V4A A;  3FMS A;  2WL8 A;  4BJ6 A;  3U8P A;  4ZLC A;  2R7S A;  3EGX A;  2KK1 A;  2ZXR A;  2A6E F;  2HMZ A;  3U2L A;  2PX0 A;  5L0C A;  1E86 A;  4JIO A;  1TWG A;  4A2N B;  5COF A;  3OA1 A;  2G3V A;  3U0C A;  3EGD A;  2R9R B;  1DOV A;  2J8W A;  4OD4 A;  2XLV A;  2VB6 A;  2XM4 A;  3ABK C;  4MQ9 F;  4MVO A;  3U9M A;  4KNV A;  1FTS A;  2X51 A;  1J8Y F;  3K6B A;  4JTC B;  3DKA A;  5A6B D;  5KYW A;  1E84 A;  4OIQ F;  1GQA A;  3NG1 A;  2HSQ A;  4I3M A;  4LLC A;  4I44 A;  2LK4 A;  2G3K A;  4BJ1 A;  1APC A;  3KYJ A;  5L3V A;  1M6T A;  3NYL A;  1SMY F;  2I15 A;  2WB7 A;  3QW1 A;  5JSL A;  4I1M A;  1OCZ C;  4PK4 A;  3US6 A;  4XPX A;  2LP4 A;  2XLD A;  2XRH A;  3MYI A;  2VAS A;  4O79 A;  2PBE A;  4YN0 B;  1VLS A;  3MYF A;  3UMK A;  1YVI A;  4F4B A;  1KU2 A;  1YZC A;  1Z3I X;  1RJ9 A;  2ASR A;  4MTG A;  1SR2 A;  5IY5 C;  1C02 A;  1TKN A;  2C04 A;  1TWA A;  1WTY A;  3QW0 A;  1A7D A;  5B1B C;  1CGM E;  3FAJ A;  3KYI A;  3ZDL A;  1NFN A;  2B0H A;  5DS5 A;  2G62 A;  5KYX B;  3N0T A;  3T6G B;  4YWQ A;  3SYN A;  1C03 A;  1OCC C;  1BR4 A;  2KNH A;  4N4W A;  4JUR I;  4JCH A;  1Z7Q c;  2J9U A;  4O7G A;  4YT8 A;  3ITF A;  4JJF A;  1QQ3 A;  2KQ9 A;  1MMA A;  2KJG A;  3AJM A;  2HS5 A;  2XL6 A;  2ICW G;  3ABM C;  5KYU B;  3IQ6 A;  4P9T A;  3C7J A;  4WGZ A;  1ZU5 A;  5A6A A;  2M64 A;  3R7C A;  3VF0 A;  3T9O A;  3RF3 A;  1XZQ A;  1BR1 A;  256B A;  3EJN A;  2KYH A;  3G50 A;  5A69 A;  3ZSU A;  3HNI A;  4MW8 A;  4BJ5 A;  4BEM J;  2YRF A;  1SYQ A;  3ZVR A;  1ZU4 A;  3ZQV A;  3E9V A;  3SXK A;  1T6Q A;  3HNJ A;  3LJB A;  4YL1 A;  4R32 A;  4CSA C;  2BL2 A;  2NUT B;  2A0U A;  1A7E A;  3GEH A;  2H7O A;  4O6Y A;  1PCX A;  2DI3 A;  2LCH A;  3HNK A;  2ETS A;  2IXN A;  3GAN A;  4EBB A;  4K0D A;  5DQZ A;  3EFO A;  2Q7R A;  1RKE A;  2LFD A;  4YK5 A;  4PFP A;  3DJU B;  3C8G A;  1HW2 A;  2O9X A;  4J7T A;  2UUH A;  4MVU A;  3VRC A;  2XL4 A;  3Q7L A;  4DVY P;  5L3Q A;  2IBF A;  4HFK B;  4YJW A;  3U5S A;  1F1M A;  3H2V A;  3RIP A;  3PMR A;  2GFH A;  4JTA B;  5L0I A;  2C03 A;  2V26 A;  4OIR F;  1ZHT A;  4U5D E;  2BE5 F;  2OOC A;  1YJG A;  3LNM B;  3K7D A;  4JE9 A;  4E0H A;  2XSE A;  3B29 A;  3GWN A;  2WZF A;  1DOW A;  3UMH A;  2ZXO A;  3K1H A;  4AL1 A;  2L7A A;  3IEE A;  2X0C A;  1YDI A;  1ZW3 A;  2PX3 A;  2PFD A;  1OW8 A;  2EIL C;  2KW3 C;  4GYT A;  3VYW A;  2EIM C;  1NG1 A;  1OXB A;  3L34 A;  1MMN A;  4U5B E;  1M57 C;  1ZVZ A;  4XEV A;  3GM2 A;  2QY9 A;  3S28 A;  2Q3T A;  2HJM A;  4J7Y A;  1RMV A;  3NMJ A;  3TK0 A;  5L0H A;  1H6G A;  3DE9 A;  4LDR A;  2VCB A;  3M4B A;  5AC5 A;  1OCR C;  3MX3 A;  3I5P A;  1ORJ A;  1J8M F;  4MND A;  3LEO A;  4LER A;  4CJO A;  2LIG A;  1HMO A;  4NTA A;  4MVQ A;  2Q9B A;  2NG1 A;  2XS1 A;  4LAC B;  3WOD F;  4XLN F;  4U5G A;  1PV3 A;  1Y6D A;  3SXM A;  4KC9 A;  1TFO B;  1ZW2 A;  3DM9 B;  2AWC A;  3PDM P;  2CCY A;  1JOG A;  2MHR A;  2Y3D A;  5KYN A;  3K1I A;  2PF4 E;  5BQI A;  2DYS C;  2NPU A;  4GEH A;  4W8P A;  4AE4 B;  1VYK A;  2R7V A;  2XL8 A;  3B0V C;  5JP7 A;  2Q9C A;  2OJE D;  2JX0 A;  1WN0 A;  2KC3 A;  3GEI A;  4MVZ A;  1HE9 A;  3UMI A;  3ZQY A;  2EPK X;  1B68 A;  3HKK A;  4NC3 A;  3DXJ F;  1E83 A;  3DMD A;  1Z23 A;  2OQM A;  4C3D A;  1SZI A;  4LDK A;  2L6F A;  4CIP A;  2HSB A;  1RKC A;  5KYX A;  1RXQ A;  4CS8 C;  5D91 A;  1FAP B;  5E3C A;  1BR2 A;  4JEA A;  1D0Z A;  1FMW A;  2Q4F A;  5JS5 A;  3UGO A;  2R25 A;  1T5O A;  2VCA A;  2A0B A;  4IAO A;  3U3B A;  1QSP A;  1G5Z A;  2YL3 A;  4JC7 A;  1Z63 A;  1Q0M A;  4MVM A;  4CX9 A;  1JR8 A;  1U0B B;  1LE2 A;  3RVY A;  3U8V A;  4N06 A;  3U2M A;  4D4N A;  2R7W A;  3JSE O;  3MBG A;  1TR2 A;  1MQV A;  2R7O A;  3LS1 A;  3X2Q C;  2WVQ A;  3H2U A;  3NYJ A;  2CYD A;  4ANJ A;  3B9Q A;  2R03 A;  1AVO B;  3L1M A;  3JCU Q;  2WVN A;  3V5X A;  3EG9 A;  5L0D A;  4E7S A;  2L6G A;  3A9C A;  3S0X A;  4U5C E;  4U9E A;  1C17 M;  2MWQ A;  3BEH A;  2OCC C;  4KBL A;  3WHN A;  2V3C C;  2XM0 A;  4FWV A;  1Y4C A;  3UNG C;  4CS8 A;  3WG7 C;  4DRJ B;  4C7O A;  2DB4 A;  5FZT A;  1UFB A;  4M63 A;  1LPE A;  3ZWI A;  4KI2 A;  3M4C A;  4XEK A;  4IWB A;  3RQE A;  3EGX B;  2I8B A;  2IXO A;  1NU9 C;  3CSK A;  3W4Y A;  4PFO A;  3L8I A;  1MNE A;  4DBR A;  2HV7 A;  4C7O B;  1VTM P;  1LVK A;  4EUK B;  3M15 A;  5L0G A;  2R7U A;  5L0J A;  1Z5Z A;  4OIO F;  5E33 A;  1L7C A;  1G4W R;  3CAX A;  3EZI A;  4ULV A;  3PHF 2;  2D5R B;  1K05 A;  2DYR C;  1QLE C;  3F47 A;  2EIK C;  4YT4 A;  4IB4 A;  4ER9 A;  1NFO A;  3RKO F;  4JJG A;  1YLM A;  2H7V C;  1OR3 A;  2EPO A;  3ECS A;  4MS2 A;  4U5E E;  2EPN A;  3RQF A;  3ZIB A;  1ZHW A;  1HW1 A;  3NDB B;  1EKY A;  1V55 C;  3C63 A;  2IOQ A;  2P61 A;  2IM8 A; 
#chains in the Genus database with same CATH homology
 3TJ6 A;  5L0I A;  3RF3 A;  2GDC A;  5FZT A;  3MYI A;  1ZW2 A;  1DOW A;  1SYQ A;  4PR9 A;  5L0C A;  2L7A A;  2X0C A;  5L0F A;  1RKE B;  1YDI A;  1ZW3 A;  1TR2 A;  3TJ5 A;  4ONS A;  3H2U A;  4W8P A;  1DOV A;  1U89 A;  4K1O A;  1QKR A;  3ZDL A;  5L0G A;  2B0H A;  5L0J A;  4E17 A;  1L7C A;  1ZVZ A;  4DJ9 A;  1RKE A;  1ST6 A;  1XWJ A;  3T6G B;  4E18 A;  2GWW A;  5L0H A;  5L0D A;  1H6G A;  2HSQ A;  1T01 A;  3VF0 A;  2LQG A;  4IGG A;  4EHP A;  1U6H A;  3S90 A;  1RKC A;  4P9T A;  2IBF A;  3H2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...