2B0HA

Solution structure of vbs3 fragment of talin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
GIDPFTMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 50
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08913 VBS Vinculin Binding Site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2b0hA01
5L0IA 1YDIA 1XWJA 1ZW2A 3MYIA 5L0JA 1ZW3A 3RF3A 1QKRA 2B0HA 2L7AA 4DJ9A 1TR2A 3VF0A 5FZTA 5L0CA 1ST6A 2GDCA 1RKEB 1RKCA 2LQGA 3H2VA 5L0DA 2IBFA 4E18A 4ONSA 5L0FA 2X0CA 1U6HA 4EHPA 4P9TA 4PR9A 3TJ5A 3S90A 3TJ6A 3T6GB 1H6GA 1DOVA 1RKEA 1L7CA 1U89A 1ZVZA 1T01A 5L0GA 1DOWA 5L0HA 4K1OA 2HSQA 4W8PA 3H2UA 4E17A 4IGGA 1SYQA 2GWWA 3ZDLA
chains in the Genus database with same CATH superfamily
1YLMA 1ZHTA 3RW0A 3WHNA 2YL7A 2YHSA 3QZCA 2EINC 3R2PA 4KBLA 1KU2A 5AC4A 3NYLA 2D4UA 3G4XA 1APCA 1JRAA 2GDCA 1TWHA 2R25A 3S9OA 2GAQA 1M57C 4LDRA 4JJGA 2O9XA 4WABA 1NZEA 1RJ9B 3WAQA 5BQIA 4BJTA 5KYXA 3C63A 1M2VA 3LNMB 3E70C 1JOGA 3S90A 3T4RA 3RQFA 2XLOA 3TULA 4O6YA 2R7UA 2HKVA 3DI5A 1PD1A 4KNVA 3B29A 4GQHA 1BR4A 4U5CE 4G7HF 1N1CA 1NBBA 3PMRA 1KTMA 4EWCA 4DRHB 1R5ID 4U5HA 4BPMA 3GODA 3Q7LA 1YDIA 1ZW2A 5L0JA 1FTSA 3EHMA 2AVKA 2KW3C 1Z3IX 3QMKA 4FESA 4CIPA 3KL4A 3M15A 4CS9C 1GM5A 3EG9A 2P61A 5T3WA 2R05A 3C7JA 1IW7F 3ZTMA 3S29A 3MFNA 1JMWA 1MMNA 2YL0A 1SZIA 3FHDA 3WG7C 1A7DA 3AQBA 4M63A 4KC9A 5BQGA 4AE4B 4JE9A 3ECSA 3FVYA 3BRJA 2YLIA 2EIJC 2ZPAA 4DXWA 2HFIA 4DVZA 3X1OA 1OR2A 2CNWA 1JAFA 1LS1A 4BJ5A 2WVOA 3MLGA 4DRJB 2H8AA 3KMIA 4PJNA 4CDYA 3IPMO 1QVXA 5DQZA 2A6EF 2H7BA 1VTMP 4NC3A 3B0UX 4MTOA 2A68F 2BE5F 3M4BA 4HEAJ 1WGWA 3AGTA 2EPMX 2NUTB 1LI5A 3HNKA 2Q9BA 4K0DA 4YWQA 2XS8A 4DRIB 2NG1A 2VCCA 2VB6A 2LFDA 5E33A 2TMVP 1GS9A 5COMA 3V5XA 4O6MA 1YA9A 4CSAC 2KNHA 1NSGB 3G50A 3UNGC 1H9GA 3SXKA 3KYJA 1HE1A 2CGEA 2HV7A 3C8ZA 4AK9A 1B68A 1ZYRF 2MWQA 3QW1A 4NTAA 1ZU5A 4UDVA 2XL8A 1WATA 3ZVRA 2IM8A 3DE8A 1FMWA 2XL6A 3M4CA 5A6BA 1CGME 5CI8A 1D1BA 3A11A 3ITFA 4AE4A 1C02A 1CPRA 2P6VA 2HS5A 3OWTA 4QI2A 4P6IC 3U3FA 4BG0A 2RSEB 2FGYA 1XWJA 4NCQA 3K33A 2KSFA 4PACA 4C3BA 4EUKB 2L6GA 2ETSA 1YYXA 3O6XA 2YLDA 4BEMJ 3ASNC 3KYIA 5A6AA 3K1IC 2HMQA 1F1MA 2PP4A 2XSEA 1E84A 3MBGA 4MVUA 2R7TA 5IY5C 1RCPA 1BZ4A 2NUPB 2XLMA 4P9TA 2NUTA 3ZIBA 3SEOA 3DAFA 2LSEA 3T6GB 1RXQA 3ATPA 3UGOA 3F46A 4E0HA 4DBRA 5JSLA 1ZHYA 5HV9A 4IWBA 4BJ1A 2DYRC 1VYKA 2EPNA 4OIOF 4NQFA 5FCLA 3JSZA 2A0UA 3O55A 1PCXA 3DAGA 1T6UA 3I5PA 3PCVA 5EK0A 5F28E 3U8PA 5BQHA 2HUJA 1NG1A 3S84A 4AL0A 1XZPA 3Q6NA 4N6HA 5DVWA 2YRFA 4MTFA 4JCZA 4CS7A 2Q3TA 2XL4A 1HE9A 2OEVA 3OEOA 2LQGA 3GM3A 3HNLA 1ZHZA 3NMJA 4ER9A 2OQMA 2R7XA 1MNDA 3I5QA 4EBBA 2EIMC 5EGYA 2BC5A 3H65A 1UG7A 3U3BA 1WWPA 2Y3DA 1OXKA 1S7ZA 4JIOA 1TFKB 2D5RB 2RD9A 3N24A 4U5FE 2OOCA 4WGYA 2AU5A 3V7OA 3IQCA 4O6NA 4E7ZA 3UGPA 4J32B 5A6BD 2HSQA 2NUPA 4BJ6A 3QW0A 4IAOA 1VK5A 3HTKC 2J0XA 3EHNA 1EA8A 3LLKA 1YYJA 1K40A 3SZRA 2EPKX 3GEHA 1HMOA 2Z15A 1NU9C 2WB7A 4J30B 1FAPB 2AP3A 2P0NA 2Y3BA 2P7VA 2W45A 3IQTA 5K0IA 1ST6A 2YL3A 1TKNA 2J46A 3AG2C 2G3KA 2CYDA 3H2VA 3K1HA 4G78A 3TK0A 5B3IA 2L9JA 2EILC 2QUPA 2GFHA 3LEOA 4MVSA 1ZHXA 4MQ9F 2LIGA 5JUAA 4LERA 5KYUB 4MNDA 1Q0MA 1H6GA 5E3CA 3TD7A 4K7BA 2B0JA 3V5YA 1U89A 1LPEA 3S0XA 3E9VA 3KPHA 5B1BC 3CAXA 3NYMA 3S28A 3IEEA 1MNEA 2ICWG 4JEBA 1TWGA 1K04A 4K1OA 1LE4A 1VOMA 4YJWA 1JR8A 5AC5A 3NRHA 3N2ZB 4O7GA 1YAUO 4H4KC 4DOZA 4Z9JA 2V3CC 2H7OA 2J9VA 2IXMA 2J9WA 4U9EA 4I44A 5TJ5E 4XLNF 4C3EA 2ZXOA 1Z63A 5A6KA 4IAQA 1NFOA 3K7DA 1TQGA 1SF8A 5FZTA 4Q7CA 1Z7Qc 2J7PA 2DB4A 3KH2A 4MS2A 2IXNA 2VC9A 3K6BA 4MVQA 2OCCC 4PFPA 3U2MA 3AGUA 2NPUA 2XLDA 1YZCA 3AQCA 4G0HA 1TFOB 4PJLA 2HZ8A 3EFOB 4DBQA 1A7EA 1EKYA 5E3AA 3HLZA 2EPLX 3QVYA 5JP7A 1FNTc 3DWWA 4QI0A 2I8BA 3SXYA 3VAYA 1FMVA 1QSPA 3NKDA 3Q6MA 4Q5SF 1G8XA 1ORJA 3W8IA 1D1CA 2CCYA 4C3DA 4OD5A 2I15A 1RJ9A 2MYSA 4W8PA 3DD7A 5KYUA 3DM9B 3HNIA 4JW1A 4NY3A 4RD9A 2Q9CA 1MMDA 1W2WA 2CDQA 4JCHA 2M4EA 1A7VA 1BDJB 2J45A 3FOOA 1CGOA 2A1DD 2IXPA 3EH1A 4N6CA 5CI9A 3SXMA 3UMIA 2J9UA 4MVZA 4XPWA 1CPQA 4YK5A 3LEVA 4WJ0A 2W4MA 4MVOA 4A2NB 2YLGA 4U5BE 1LKXA 3X2QC 4CS8A 4NTFA 2AWCA 1U6HA 2XLWA 4MW3A 1FFHA 1C03A 1IZMA 1MMAA 3PDMP 1RMVA 3O10A 4YL0A 1HY5A 3B0PA 3GWNA 3JT1A 1DOVA 4BJ5C 1T9KA 2R7OA 4MVMA 4U9DA 1QQ3A 4IJJA 2J0WA 5D92A 3RIPA 5L0HA 3CSKA 3EFOA 1OCCC 3KKBA 4XEKA 1V4AA 1ORYA 4E17A 2FFHA 2KK1A 2NSFA 4EBJA 1SMYF 2YL1A 4L6RA 1QLEC 4XEVA 1AVOB 2AWYA 2IXOA 3DMDA 2A0BA 1M2OA 3L34A 3M1CB 4IRUA 5JS5A 3GWLA 1AUEA 1WASA 3DZAA 3FMSA 4XQ1A 5L3VA 2YKZA 3IHUA 2DGJA 2KYHA 1RKEB 4JJFA 4MW8A 3SNHA 2J7PD 2KC3A 4O79A 4YN0B 2QTVA 4KNWA 2YQYA 4ONSA 4D4XA 4IB4A 4XPXA 2X0CA 3C62A 3K1IA 3EQLF 1Q0DA 2XLVA 2GA0A 2IYLD 3GM2A 3CQZA 3TJ6A 4CIHA 1GQAA 2ZXPA 1WTYA 2IOQA 3RH3A 1LE2A 3DXJF 3LJBA 4WGZA 4LDKA 4I1OB 3EGXB 2LK4A 1Q0GA 4Z9IA 2R9RB 1DOWA 3HNJA 3H2UA 3FAJA 5F5HA 4DVYP 2VASA 2VCBA 3S27A 1CGNA 5DS4A 3MYIA 1OW8A 4R32A 2NSGA 3L8JA 1QKRA 4EIYA 5KYYB 5BUOA 3EZIA 2EIKC 4GEHA 1T6IA 4E7SA 5AGFA 3ABKC 2A6HF 1OW6A 3IQ5A 4ULVA 2M64A 3DJNB 3LLIA 2KGOA 4YT5A 3RFYA 3MX3A 1BR2A 2Q00A 3QTHA 4I1MA 4JVSA 3AG1C 5T1DB 3UMHA 3UR3C 4CX9A 4ULWA 2PNOA 4JURI 5DS6A 1D1AA 4KI2A 1RKEA 1ZVZA 3TOLA 2X51A 3B71A 4PK4A 4MVRA 4YL3A 1WN0A 1M56C 1JPNA 3SP1A 4E0IA 2LCHA 5A6JA 1V55C 3C8GD 3ZQVA 3EGDB 4N06A 1J8YF 1LIHA 1YVIA 3LNRA 5COFA 3ZTZA 2F22A 3ABMC 4IARA 3DM5A 3EGXA 1OW7A 3QVZA 3RQEA 1BR1A 3L1MA 1VMAA 3SXZA 3TQOA 1J8MF 4XEFA 4CDVA 1D0YA 1FFTC 1YARO 4LLCA 4PJJA 4PFOA 1RKCA 2HV6A 1E2XA 3L0IA 5L0DA 3NDBB 5F5FA 1Q0FA 2OEXA 3EPVA 1JPJA 3U0CA 2JPUA 2J9BA 3LUTB 3T9OA 5KYNA 4J7YA 3W8HA 2PFDA 2LFFA 2XM4A 3ABLC 1ORSC 5KYYA 1EI7A 2PX3A 2HJMA 3EH2A 4AX2A 4BJ6C 1TWAA 2DYSC 4YL1A 3FDQA 3JTLO 4W8KA 4OIPF 2XXAB 2L81A 1OQCA 2R7WA 1T01A 3JSEO 2ASRA 4JEAA 1NFNA 1L3PA 4XLPF 3DE9A 2HJ3A 4FWVA 1PV3A 4FAPB 2R7QA 5JRAA 2R03A 1SYQA 3A9CA 3RKOF 1BBHA 3UMKA 5DLJA 2YWAA 3AG4C 3ZDLA 1Z23A 4YT4A 4H54A 1R4TA 4EBKA 2WVQA 3RF3A 3VYWA 2L7AA 3B9QA 1ZHWA 3BEHA 1G5ZA 1GGQA 3T6BA 3G4ZA 1YJGA 2Q4FA 3EGDA 4ZLCA 3W2WA 1T5OA 1OCRC 4CBEA 1A41A 5A69A 1SR2A 2XLHA 3JYYA 3DJUB 4CS9A 5HSWA 3C8GB 3JYHA 4GYTA 4CJGA 2XS1A 3SYNA 5JLIA 1ZU4A 2UUHA 1HW2A 5DS5A 1OKKD 3RVZA 256BA 4HFFB 2YZSA 3K66A 2Q7RA 4I3MA 1VLTA 2XRHA 4U5EE 5L0GA 4NTBA 3MYFA 2QNLA 2LD6A 3GANA 1H7IA 4ZLDA 1TWCA 2C04A 1Z6AA 3NMKA 1LM3B 4XWJA 2CW0F 3FAPB 3NYJA 1ZZPA 2XXAA 1MQVA 1O5HA 1FR0A 1QPUA 3U8VA 1TR2A 4JTCB 2PX0A 1I4ZA 1NLXA 3NKEA 3N0TA 3Q7GA 1O87A 1Y6DA 3U9MA 1I5NA 5JVEA 2IBFA 1E85A 5L0FA 4X0RA 4HFKB 1HMDA 4G7ZF 3OA1A 2A69F 4PR9A 2YEVA 2EPOA 3M79A 1OR3A 3ZQYA 1QZXA 4ANJA 2VH3A 2Y69C 4LACB 4N4WA 2LP4A 5T3TA 4B6IA 1XZQA 4CSAA 3HKKA 3EJNA 1OCOC 2Y39A 3CEXA 1A0BA 3JRTA 2L6HA 4JC7A 3RQGA 3C8GA 4IGGA 1VB5A 2OJQA 3W4YA 4CDAA 1H9TA 3J06A 3LS0A 4F4BA 4G7OF 5L3QA 2GWWA 5EHHA 5B3SC 3FOPA 5L0IA 1C17M 1K05A 2HMZA 2OU6A 5JT4A 2QY9A 3AOUA 3LESA 2Y3GA 4C7OB 4CS8C 1EQ1A 3GEIA 3VF0A 3EZHA 3I4UA 3NG1A 4OINF 2XLEA 1I4YA 2E87A 1LI7A 1VYIA 3F47A 3U9JA 4E18A 2HSBA 1UFBA 2L6FA 4LLEA 3HJCA 3WODF 1U0BB 1T6QA 3NMIA 3LAYA 4EKWA 3GORA 2G62A 2V26A 5CIVA 1G4US 2ZXRA 1D0ZA 2WZFA 2J8WA 2KQ9A 3U2LA 3ZC4A 4RDAA 4AL1A 3W2VA 4D4NA 2JX0A 3L8IA 4HE8D 4JTDB 1O3UA 4LDQA 2W9YA 5B1AC 4BEJA 2Q9AA 1V74B 3U5SA 2FAPB 3VRCA 1OXBA 3AG3C 2ZD9A 4Q4ZF 2PBEA 3FXHA 1LS4A 3DKAA 3JCUQ 3RVYA 4QDLA 5COGA 3ZWIA 1WOLA 2KJGA 5KYWB 4OIQF 1KNYA 3LS1A 5L0CA 2OG2A 2DI3A 2WZLA 2XM0A 4U5GA 3VM6A 4YT8A 3POVA 1NU7D 5D91A 4J7TA 4P9FA 1E83A 1YA7O 4EHPA 3C18A 3TJ5A 2OJED 4C7OA 2QE9A 3ZG1A 1E86A 1OKKA 1PD0A 4CJOA 4FX5A 2ZXWC 4YT2A 2MHRA 4Z9HA 1MMGA 1Z5ZA 3ASOC 3B0VC 4MTGA 4PJMA 2CNWD 4U5DE 1G4WR 2WZGA 4JRZA 3R7CA 3GEEA 4JKVA 1Q0KA 3PHF2 5KYXB 1OCZC 1ZW3A 1M2VB 2B0HA 4XTKA 5GPGB 5DQTA 4XPYA 4DJ9A 2OKUA 1HW1A 4RBNA 2WVNA 1LVKA 3O39A 2P1AA 1S05A 3T6JA 3JRMO 2QLAA 1D0XA 3GM1A 3V5ZA 3TOMA 2G3VA 5KYWA 2Y3HA 3CZ6A 4OIRF 2R7SA 2PF4E 1VLSA 1M6TA 1AEPA 2W4BA 3ZSUA 2H7VC 1L7CA 1YZAA 4JZAA 4A4AA 2VCAA 2WL8A 2R7RA 2YVKA 1V54C 3AJMA 2C03A 3IQ6A 3RYLA 4JTAB 2UUIA 3EG9B 2R7VA 2R02A 4OD4A 1Y4CA 3JZ0A 2BL2A 5E2QA 3US6A 2JD3A
chains in the Genus database with same CATH topology
5L0IA 1YDIA 1XWJA 1ZW2A 3MYIA 5L0JA 1ZW3A 3RF3A 1QKRA 2B0HA 2L7AA 4DJ9A 1TR2A 3VF0A 5FZTA 5L0CA 1ST6A 2GDCA 1RKEB 1RKCA 2LQGA 3H2VA 5L0DA 2IBFA 4E18A 4ONSA 5L0FA 2X0CA 1U6HA 4EHPA 4P9TA 4PR9A 3TJ5A 3S90A 3TJ6A 3T6GB 1H6GA 1DOVA 1RKEA 1L7CA 1U89A 1ZVZA 1T01A 5L0GA 1DOWA 5L0HA 4K1OA 2HSQA 4W8PA 3H2UA 4E17A 4IGGA 1SYQA 2GWWA 3ZDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0I A;  1YDI A;  1XWJ A;  1ZW2 A;  3MYI A;  5L0J A;  1ZW3 A;  3RF3 A;  1QKR A;  2B0H A;  2L7A A;  4DJ9 A;  1TR2 A;  3VF0 A;  5FZT A;  5L0C A;  1ST6 A;  2GDC A;  1RKE B;  1RKC A;  2LQG A;  3H2V A;  5L0D A;  2IBF A;  4E18 A;  4ONS A;  5L0F A;  2X0C A;  1U6H A;  4EHP A;  4P9T A;  4PR9 A;  3TJ5 A;  3S90 A;  3TJ6 A;  3T6G B;  1H6G A;  1DOV A;  1RKE A;  1L7C A;  1U89 A;  1ZVZ A;  1T01 A;  5L0G A;  1DOW A;  5L0H A;  4K1O A;  2HSQ A;  4W8P A;  3H2U A;  4E17 A;  4IGG A;  1SYQ A;  2GWW A;  3ZDL A; 
#chains in the Genus database with same CATH topology
 1YLM A;  1ZHT A;  3RW0 A;  3WHN A;  2YL7 A;  2YHS A;  3QZC A;  2EIN C;  3R2P A;  4KBL A;  1KU2 A;  5AC4 A;  3NYL A;  2D4U A;  3G4X A;  1APC A;  1JRA A;  2GDC A;  1TWH A;  2R25 A;  3S9O A;  2GAQ A;  1M57 C;  4LDR A;  4JJG A;  2O9X A;  4WAB A;  1NZE A;  1RJ9 B;  3WAQ A;  5BQI A;  4BJT A;  5KYX A;  3C63 A;  1M2V A;  3LNM B;  3E70 C;  1JOG A;  3S90 A;  3T4R A;  3RQF A;  2XLO A;  3TUL A;  4O6Y A;  2R7U A;  2HKV A;  3DI5 A;  1PD1 A;  4KNV A;  3B29 A;  4GQH A;  1BR4 A;  4U5C E;  4G7H F;  1N1C A;  1NBB A;  3PMR A;  1KTM A;  4EWC A;  4DRH B;  1R5I D;  4U5H A;  4BPM A;  3GOD A;  3Q7L A;  1YDI A;  1ZW2 A;  5L0J A;  1FTS A;  3EHM A;  2AVK A;  2KW3 C;  1Z3I X;  3QMK A;  4FES A;  4CIP A;  3KL4 A;  3M15 A;  4CS9 C;  1GM5 A;  3EG9 A;  2P61 A;  5T3W A;  2R05 A;  3C7J A;  1IW7 F;  3ZTM A;  3S29 A;  3MFN A;  1JMW A;  1MMN A;  2YL0 A;  1SZI A;  3FHD A;  3WG7 C;  1A7D A;  3AQB A;  4M63 A;  4KC9 A;  5BQG A;  4AE4 B;  4JE9 A;  3ECS A;  3FVY A;  3BRJ A;  2YLI A;  2EIJ C;  2ZPA A;  4DXW A;  2HFI A;  4DVZ A;  3X1O A;  1OR2 A;  2CNW A;  1JAF A;  1LS1 A;  4BJ5 A;  2WVO A;  3MLG A;  4DRJ B;  2H8A A;  3KMI A;  4PJN A;  4CDY A;  3IPM O;  1QVX A;  5DQZ A;  2A6E F;  2H7B A;  1VTM P;  4NC3 A;  3B0U X;  4MTO A;  2A68 F;  2BE5 F;  3M4B A;  4HEA J;  1WGW A;  3AGT A;  2EPM X;  2NUT B;  1LI5 A;  3HNK A;  2Q9B A;  4K0D A;  4YWQ A;  2XS8 A;  4DRI B;  2NG1 A;  2VCC A;  2VB6 A;  2LFD A;  5E33 A;  2TMV P;  1GS9 A;  5COM A;  3V5X A;  4O6M A;  1YA9 A;  4CSA C;  2KNH A;  1NSG B;  3G50 A;  3UNG C;  1H9G A;  3SXK A;  3KYJ A;  1HE1 A;  2CGE A;  2HV7 A;  3C8Z A;  4AK9 A;  1B68 A;  1ZYR F;  2MWQ A;  3QW1 A;  4NTA A;  1ZU5 A;  4UDV A;  2XL8 A;  1WAT A;  3ZVR A;  2IM8 A;  3DE8 A;  1FMW A;  2XL6 A;  3M4C A;  5A6B A;  1CGM E;  5CI8 A;  1D1B A;  3A11 A;  3ITF A;  4AE4 A;  1C02 A;  1CPR A;  2P6V A;  2HS5 A;  3OWT A;  4QI2 A;  4P6I C;  3U3F A;  4BG0 A;  2RSE B;  2FGY A;  1XWJ A;  4NCQ A;  3K33 A;  2KSF A;  4PAC A;  4C3B A;  4EUK B;  2L6G A;  2ETS A;  1YYX A;  3O6X A;  2YLD A;  4BEM J;  3ASN C;  3KYI A;  5A6A A;  3K1I C;  2HMQ A;  1F1M A;  2PP4 A;  2XSE A;  1E84 A;  3MBG A;  4MVU A;  2R7T A;  5IY5 C;  1RCP A;  1BZ4 A;  2NUP B;  2XLM A;  4P9T A;  2NUT A;  3ZIB A;  3SEO A;  3DAF A;  2LSE A;  3T6G B;  1RXQ A;  3ATP A;  3UGO A;  3F46 A;  4E0H A;  4DBR A;  5JSL A;  1ZHY A;  5HV9 A;  4IWB A;  4BJ1 A;  2DYR C;  1VYK A;  2EPN A;  4OIO F;  4NQF A;  5FCL A;  3JSZ A;  2A0U A;  3O55 A;  1PCX A;  3DAG A;  1T6U A;  3I5P A;  3PCV A;  5EK0 A;  5F28 E;  3U8P A;  5BQH A;  2HUJ A;  1NG1 A;  3S84 A;  4AL0 A;  1XZP A;  3Q6N A;  4N6H A;  5DVW A;  2YRF A;  4MTF A;  4JCZ A;  4CS7 A;  2Q3T A;  2XL4 A;  1HE9 A;  2OEV A;  3OEO A;  2LQG A;  3GM3 A;  3HNL A;  1ZHZ A;  3NMJ A;  4ER9 A;  2OQM A;  2R7X A;  1MND A;  3I5Q A;  4EBB A;  2EIM C;  5EGY A;  2BC5 A;  3H65 A;  1UG7 A;  3U3B A;  1WWP A;  2Y3D A;  1OXK A;  1S7Z A;  4JIO A;  1TFK B;  2D5R B;  2RD9 A;  3N24 A;  4U5F E;  2OOC A;  4WGY A;  2AU5 A;  3V7O A;  3IQC A;  4O6N A;  4E7Z A;  3UGP A;  4J32 B;  5A6B D;  2HSQ A;  2NUP A;  4BJ6 A;  3QW0 A;  4IAO A;  1VK5 A;  3HTK C;  2J0X A;  3EHN A;  1EA8 A;  3LLK A;  1YYJ A;  1K40 A;  3SZR A;  2EPK X;  3GEH A;  1HMO A;  2Z15 A;  1NU9 C;  2WB7 A;  4J30 B;  1FAP B;  2AP3 A;  2P0N A;  2Y3B A;  2P7V A;  2W45 A;  3IQT A;  5K0I A;  1ST6 A;  2YL3 A;  1TKN A;  2J46 A;  3AG2 C;  2G3K A;  2CYD A;  3H2V A;  3K1H A;  4G78 A;  3TK0 A;  5B3I A;  2L9J A;  2EIL C;  2QUP A;  2GFH A;  3LEO A;  4MVS A;  1ZHX A;  4MQ9 F;  2LIG A;  5JUA A;  4LER A;  5KYU B;  4MND A;  1Q0M A;  1H6G A;  5E3C A;  3TD7 A;  4K7B A;  2B0J A;  3V5Y A;  1U89 A;  1LPE A;  3S0X A;  3E9V A;  3KPH A;  5B1B C;  3CAX A;  3NYM A;  3S28 A;  3IEE A;  1MNE A;  2ICW G;  4JEB A;  1TWG A;  1K04 A;  4K1O A;  1LE4 A;  1VOM A;  4YJW A;  1JR8 A;  5AC5 A;  3NRH A;  3N2Z B;  4O7G A;  1YAU O;  4H4K C;  4DOZ A;  4Z9J A;  2V3C C;  2H7O A;  2J9V A;  2IXM A;  2J9W A;  4U9E A;  4I44 A;  5TJ5 E;  4XLN F;  4C3E A;  2ZXO A;  1Z63 A;  5A6K A;  4IAQ A;  1NFO A;  3K7D A;  1TQG A;  1SF8 A;  5FZT A;  4Q7C A;  1Z7Q c;  2J7P A;  2DB4 A;  3KH2 A;  4MS2 A;  2IXN A;  2VC9 A;  3K6B A;  4MVQ A;  2OCC C;  4PFP A;  3U2M A;  3AGU A;  2NPU A;  2XLD A;  1YZC A;  3AQC A;  4G0H A;  1TFO B;  4PJL A;  2HZ8 A;  3EFO B;  4DBQ A;  1A7E A;  1EKY A;  5E3A A;  3HLZ A;  2EPL X;  3QVY A;  5JP7 A;  1FNT c;  3DWW A;  4QI0 A;  2I8B A;  3SXY A;  3VAY A;  1FMV A;  1QSP A;  3NKD A;  3Q6M A;  4Q5S F;  1G8X A;  1ORJ A;  3W8I A;  1D1C A;  2CCY A;  4C3D A;  4OD5 A;  2I15 A;  1RJ9 A;  2MYS A;  4W8P A;  3DD7 A;  5KYU A;  3DM9 B;  3HNI A;  4JW1 A;  4NY3 A;  4RD9 A;  2Q9C A;  1MMD A;  1W2W A;  2CDQ A;  4JCH A;  2M4E A;  1A7V A;  1BDJ B;  2J45 A;  3FOO A;  1CGO A;  2A1D D;  2IXP A;  3EH1 A;  4N6C A;  5CI9 A;  3SXM A;  3UMI A;  2J9U A;  4MVZ A;  4XPW A;  1CPQ A;  4YK5 A;  3LEV A;  4WJ0 A;  2W4M A;  4MVO A;  4A2N B;  2YLG A;  4U5B E;  1LKX A;  3X2Q C;  4CS8 A;  4NTF A;  2AWC A;  1U6H A;  2XLW A;  4MW3 A;  1FFH A;  1C03 A;  1IZM A;  1MMA A;  3PDM P;  1RMV A;  3O10 A;  4YL0 A;  1HY5 A;  3B0P A;  3GWN A;  3JT1 A;  1DOV A;  4BJ5 C;  1T9K A;  2R7O A;  4MVM A;  4U9D A;  1QQ3 A;  4IJJ A;  2J0W A;  5D92 A;  3RIP A;  5L0H A;  3CSK A;  3EFO A;  1OCC C;  3KKB A;  4XEK A;  1V4A A;  1ORY A;  4E17 A;  2FFH A;  2KK1 A;  2NSF A;  4EBJ A;  1SMY F;  2YL1 A;  4L6R A;  1QLE C;  4XEV A;  1AVO B;  2AWY A;  2IXO A;  3DMD A;  2A0B A;  1M2O A;  3L34 A;  3M1C B;  4IRU A;  5JS5 A;  3GWL A;  1AUE A;  1WAS A;  3DZA A;  3FMS A;  4XQ1 A;  5L3V A;  2YKZ A;  3IHU A;  2DGJ A;  2KYH A;  1RKE B;  4JJF A;  4MW8 A;  3SNH A;  2J7P D;  2KC3 A;  4O79 A;  4YN0 B;  2QTV A;  4KNW A;  2YQY A;  4ONS A;  4D4X A;  4IB4 A;  4XPX A;  2X0C A;  3C62 A;  3K1I A;  3EQL F;  1Q0D A;  2XLV A;  2GA0 A;  2IYL D;  3GM2 A;  3CQZ A;  3TJ6 A;  4CIH A;  1GQA A;  2ZXP A;  1WTY A;  2IOQ A;  3RH3 A;  1LE2 A;  3DXJ F;  3LJB A;  4WGZ A;  4LDK A;  4I1O B;  3EGX B;  2LK4 A;  1Q0G A;  4Z9I A;  2R9R B;  1DOW A;  3HNJ A;  3H2U A;  3FAJ A;  5F5H A;  4DVY P;  2VAS A;  2VCB A;  3S27 A;  1CGN A;  5DS4 A;  3MYI A;  1OW8 A;  4R32 A;  2NSG A;  3L8J A;  1QKR A;  4EIY A;  5KYY B;  5BUO A;  3EZI A;  2EIK C;  4GEH A;  1T6I A;  4E7S A;  5AGF A;  3ABK C;  2A6H F;  1OW6 A;  3IQ5 A;  4ULV A;  2M64 A;  3DJN B;  3LLI A;  2KGO A;  4YT5 A;  3RFY A;  3MX3 A;  1BR2 A;  2Q00 A;  3QTH A;  4I1M A;  4JVS A;  3AG1 C;  5T1D B;  3UMH A;  3UR3 C;  4CX9 A;  4ULW A;  2PNO A;  4JUR I;  5DS6 A;  1D1A A;  4KI2 A;  1RKE A;  1ZVZ A;  3TOL A;  2X51 A;  3B71 A;  4PK4 A;  4MVR A;  4YL3 A;  1WN0 A;  1M56 C;  1JPN A;  3SP1 A;  4E0I A;  2LCH A;  5A6J A;  1V55 C;  3C8G D;  3ZQV A;  3EGD B;  4N06 A;  1J8Y F;  1LIH A;  1YVI A;  3LNR A;  5COF A;  3ZTZ A;  2F22 A;  3ABM C;  4IAR A;  3DM5 A;  3EGX A;  1OW7 A;  3QVZ A;  3RQE A;  1BR1 A;  3L1M A;  1VMA A;  3SXZ A;  3TQO A;  1J8M F;  4XEF A;  4CDV A;  1D0Y A;  1FFT C;  1YAR O;  4LLC A;  4PJJ A;  4PFO A;  1RKC A;  2HV6 A;  1E2X A;  3L0I A;  5L0D A;  3NDB B;  5F5F A;  1Q0F A;  2OEX A;  3EPV A;  1JPJ A;  3U0C A;  2JPU A;  2J9B A;  3LUT B;  3T9O A;  5KYN A;  4J7Y A;  3W8H A;  2PFD A;  2LFF A;  2XM4 A;  3ABL C;  1ORS C;  5KYY A;  1EI7 A;  2PX3 A;  2HJM A;  3EH2 A;  4AX2 A;  4BJ6 C;  1TWA A;  2DYS C;  4YL1 A;  3FDQ A;  3JTL O;  4W8K A;  4OIP F;  2XXA B;  2L81 A;  1OQC A;  2R7W A;  1T01 A;  3JSE O;  2ASR A;  4JEA A;  1NFN A;  1L3P A;  4XLP F;  3DE9 A;  2HJ3 A;  4FWV A;  1PV3 A;  4FAP B;  2R7Q A;  5JRA A;  2R03 A;  1SYQ A;  3A9C A;  3RKO F;  1BBH A;  3UMK A;  5DLJ A;  2YWA A;  3AG4 C;  3ZDL A;  1Z23 A;  4YT4 A;  4H54 A;  1R4T A;  4EBK A;  2WVQ A;  3RF3 A;  3VYW A;  2L7A A;  3B9Q A;  1ZHW A;  3BEH A;  1G5Z A;  1GGQ A;  3T6B A;  3G4Z A;  1YJG A;  2Q4F A;  3EGD A;  4ZLC A;  3W2W A;  1T5O A;  1OCR C;  4CBE A;  1A41 A;  5A69 A;  1SR2 A;  2XLH A;  3JYY A;  3DJU B;  4CS9 A;  5HSW A;  3C8G B;  3JYH A;  4GYT A;  4CJG A;  2XS1 A;  3SYN A;  5JLI A;  1ZU4 A;  2UUH A;  1HW2 A;  5DS5 A;  1OKK D;  3RVZ A;  256B A;  4HFF B;  2YZS A;  3K66 A;  2Q7R A;  4I3M A;  1VLT A;  2XRH A;  4U5E E;  5L0G A;  4NTB A;  3MYF A;  2QNL A;  2LD6 A;  3GAN A;  1H7I A;  4ZLD A;  1TWC A;  2C04 A;  1Z6A A;  3NMK A;  1LM3 B;  4XWJ A;  2CW0 F;  3FAP B;  3NYJ A;  1ZZP A;  2XXA A;  1MQV A;  1O5H A;  1FR0 A;  1QPU A;  3U8V A;  1TR2 A;  4JTC B;  2PX0 A;  1I4Z A;  1NLX A;  3NKE A;  3N0T A;  3Q7G A;  1O87 A;  1Y6D A;  3U9M A;  1I5N A;  5JVE A;  2IBF A;  1E85 A;  5L0F A;  4X0R A;  4HFK B;  1HMD A;  4G7Z F;  3OA1 A;  2A69 F;  4PR9 A;  2YEV A;  2EPO A;  3M79 A;  1OR3 A;  3ZQY A;  1QZX A;  4ANJ A;  2VH3 A;  2Y69 C;  4LAC B;  4N4W A;  2LP4 A;  5T3T A;  4B6I A;  1XZQ A;  4CSA A;  3HKK A;  3EJN A;  1OCO C;  2Y39 A;  3CEX A;  1A0B A;  3JRT A;  2L6H A;  4JC7 A;  3RQG A;  3C8G A;  4IGG A;  1VB5 A;  2OJQ A;  3W4Y A;  4CDA A;  1H9T A;  3J06 A;  3LS0 A;  4F4B A;  4G7O F;  5L3Q A;  2GWW A;  5EHH A;  5B3S C;  3FOP A;  5L0I A;  1C17 M;  1K05 A;  2HMZ A;  2OU6 A;  5JT4 A;  2QY9 A;  3AOU A;  3LES A;  2Y3G A;  4C7O B;  4CS8 C;  1EQ1 A;  3GEI A;  3VF0 A;  3EZH A;  3I4U A;  3NG1 A;  4OIN F;  2XLE A;  1I4Y A;  2E87 A;  1LI7 A;  1VYI A;  3F47 A;  3U9J A;  4E18 A;  2HSB A;  1UFB A;  2L6F A;  4LLE A;  3HJC A;  3WOD F;  1U0B B;  1T6Q A;  3NMI A;  3LAY A;  4EKW A;  3GOR A;  2G62 A;  2V26 A;  5CIV A;  1G4U S;  2ZXR A;  1D0Z A;  2WZF A;  2J8W A;  2KQ9 A;  3U2L A;  3ZC4 A;  4RDA A;  4AL1 A;  3W2V A;  4D4N A;  2JX0 A;  3L8I A;  4HE8 D;  4JTD B;  1O3U A;  4LDQ A;  2W9Y A;  5B1A C;  4BEJ A;  2Q9A A;  1V74 B;  3U5S A;  2FAP B;  3VRC A;  1OXB A;  3AG3 C;  2ZD9 A;  4Q4Z F;  2PBE A;  3FXH A;  1LS4 A;  3DKA A;  3JCU Q;  3RVY A;  4QDL A;  5COG A;  3ZWI A;  1WOL A;  2KJG A;  5KYW B;  4OIQ F;  1KNY A;  3LS1 A;  5L0C A;  2OG2 A;  2DI3 A;  2WZL A;  2XM0 A;  4U5G A;  3VM6 A;  4YT8 A;  3POV A;  1NU7 D;  5D91 A;  4J7T A;  4P9F A;  1E83 A;  1YA7 O;  4EHP A;  3C18 A;  3TJ5 A;  2OJE D;  4C7O A;  2QE9 A;  3ZG1 A;  1E86 A;  1OKK A;  1PD0 A;  4CJO A;  4FX5 A;  2ZXW C;  4YT2 A;  2MHR A;  4Z9H A;  1MMG A;  1Z5Z A;  3ASO C;  3B0V C;  4MTG A;  4PJM A;  2CNW D;  4U5D E;  1G4W R;  2WZG A;  4JRZ A;  3R7C A;  3GEE A;  4JKV A;  1Q0K A;  3PHF 2;  5KYX B;  1OCZ C;  1ZW3 A;  1M2V B;  2B0H A;  4XTK A;  5GPG B;  5DQT A;  4XPY A;  4DJ9 A;  2OKU A;  1HW1 A;  4RBN A;  2WVN A;  1LVK A;  3O39 A;  2P1A A;  1S05 A;  3T6J A;  3JRM O;  2QLA A;  1D0X A;  3GM1 A;  3V5Z A;  3TOM A;  2G3V A;  5KYW A;  2Y3H A;  3CZ6 A;  4OIR F;  2R7S A;  2PF4 E;  1VLS A;  1M6T A;  1AEP A;  2W4B A;  3ZSU A;  2H7V C;  1L7C A;  1YZA A;  4JZA A;  4A4A A;  2VCA A;  2WL8 A;  2R7R A;  2YVK A;  1V54 C;  3AJM A;  2C03 A;  3IQ6 A;  3RYL A;  4JTA B;  2UUI A;  3EG9 B;  2R7V A;  2R02 A;  4OD4 A;  1Y4C A;  3JZ0 A;  2BL2 A;  5E2Q A;  3US6 A;  2JD3 A; 
#chains in the Genus database with same CATH homology
 5L0I A;  1YDI A;  1XWJ A;  1ZW2 A;  3MYI A;  5L0J A;  1ZW3 A;  3RF3 A;  1QKR A;  2B0H A;  2L7A A;  4DJ9 A;  1TR2 A;  3VF0 A;  5FZT A;  5L0C A;  1ST6 A;  2GDC A;  1RKE B;  1RKC A;  2LQG A;  3H2V A;  5L0D A;  2IBF A;  4E18 A;  4ONS A;  5L0F A;  2X0C A;  1U6H A;  4EHP A;  4P9T A;  4PR9 A;  3TJ5 A;  3S90 A;  3TJ6 A;  3T6G B;  1H6G A;  1DOV A;  1RKE A;  1L7C A;  1U89 A;  1ZVZ A;  1T01 A;  5L0G A;  1DOW A;  5L0H A;  4K1O A;  2HSQ A;  4W8P A;  3H2U A;  4E17 A;  4IGG A;  1SYQ A;  2GWW A;  3ZDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...