2B0HA

Solution structure of vbs3 fragment of talin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
GIDPFTMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 50
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08913 VBS Vinculin Binding Site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2b0hA01
1RKEB 1U89A 2GWWA 1YDIA 2X0CA 4DJ9A 5L0CA 4ONSA 4P9TA 3T6GB 5L0JA 2LQGA 4PR9A 3H2UA 3TJ6A 1U6HA 4W8PA 3H2VA 1QKRA 2IBFA 4E18A 1RKEA 1SYQA 1ZW3A 5FZTA 1ZW2A 4EHPA 1H6GA 5L0IA 1XWJA 1RKCA 1ST6A 5L0GA 2L7AA 2GDCA 5L0DA 1DOWA 1ZVZA 4E17A 2HSQA 2B0HA 3S90A 3MYIA 1L7CA 3VF0A 4K1OA 1DOVA 1TR2A 5L0FA 4IGGA 5L0HA 3ZDLA 1T01A 3RF3A 3TJ5A
chains in the Genus database with same CATH superfamily
1RKEB 2R9RB 3VM6A 2IXMA 4CJOA 2Y3HA 4DJ9A 4BPMA 4MS2A 4JEBA 1H7IA 1OCCC 5JT4A 4YJWA 5F28E 2A0BA 5T1DB 3G4XA 2A0UA 1GM5A 2CDQA 1OKKA 3CEXA 1O5HA 256BA 4DRJB 1OW7A 4DRHB 1D0YA 2M4EA 3DD7A 3NMKA 4XEKA 4FESA 4XTKA 4BJ5C 3IQ5A 1ZW2A 4RBNA 3S84A 3X1OA 4JCZA 5K0IA 3POVA 3LNMB 3Q6MA 4U9DA 5TJ5E 4YN0B 3SYNA 3G4ZA 3LEOA 2Q00A 4HEAJ 2QTVA 3U2MA 3I5PA 4DBQA 2R7WA 1G5ZA 1Y6DA 1A0BA 4U5GA 2VH3A 1LKXA 1RJ9B 2EPKX 1JAFA 3LLIA 1OXKA 2R7SA 4Q7CA 1QSPA 1MNEA 2AWCA 4ULWA 5KYNA 3PHF2 2I8BA 3AG2C 4P9TA 2WVOA 4PJNA 1VLSA 1FFTC 1V55C 5L3QA 3FOOA 3M15A 4LDQA 5BUOA 5A6BD 2PX3A 4BJ6A 2WB7A 2XLMA 1MMNA 1QQ3A 1WATA 2YLIA 5E33A 2ICWG 1TWCA 3K1HA 1APCA 1HE9A 2KW3C 3N2ZB 4FAPB 1TWHA 3ZC4A 4XLPF 3FHDA 1EQ1A 1OR3A 3DJNB 3HNJA 4JKVA 1ZU5A 2P7VA 3JRMO 4YL0A 3T9OA 3M1CB 3GEIA 1BR2A 4CBEA 4MVUA 3B0VC 5BQGA 1EKYA 2XS8A 3CQZA 5DS4A 3Q6NA 1M2VB 3AQCA 2LP4A 3EH1A 3K66A 5B1AC 2Q9AA 3ATPA 1I4ZA 5COMA 3M79A 4U9EA 1ORYA 4XEFA 3FOPA 3SXKA 1ZU4A 3BRJA 3EGXA 4IARA 3AGUA 3VAYA 2YKZA 3C62A 4AL1A 3DM5A 3TOMA 2NUTA 3FVYA 2IXNA 1V4AA 1Q0GA 4K0DA 2YL3A 2QE9A 1AUEA 3ZSUA 1PD1A 3B71A 2XXAA 3N0TA 2IBFA 3IPMO 1RKEA 4EHPA 2L6GA 2QY9A 2A69F 2D4UA 2WZFA 1WOLA 3NMJA 3R2PA 4DBRA 1KTMA 1XWJA 1XZQA 2KJGA 3T6JA 2R7XA 1WTYA 4CS9C 1Q0DA 3IQCA 3ZTZA 4WGZA 2XL4A 2IOQA 5COGA 4WJ0A 5DS5A 3B0PA 3ABKC 1Z6AA 2GWWA 4KNVA 1YVIA 2G62A 5JSLA 1CGME 3N24A 2XM0A 2CNWA 4PJLA 3A11A 4JTDB 4CDVA 3ZWIA 1FAPB 5A6AA 1NU9C 3JYYA 4JW1A 3ZG1A 1RJ9A 1TQGA 4DVZA 1K04A 2J45A 5EGYA 4MVMA 1D1AA 1R5ID 2KK1A 1A41A 2J7PD 3R7CA 4EWCA 2YHSA 1F1MA 1M2OA 2XLOA 1BBHA 2J9WA 2P6VA 2HMZA 1LI7A 1LIHA 1ST6A 1ORJA 2Y3DA 4CSAA 3W4YA 1CGOA 1LS1A 4O6MA 1HW1A 1GGQA 5CI8A 3U9JA 5AGFA 4DRIB 4IGGA 4JURI 3KH2A 1A7EA 2YVKA 4N6CA 1T01A 2J46A 3DI5A 4I1OB 4LDRA 1CGNA 2Q4FA 2XM4A 3K6BA 3RIPA 5AC4A 4NQFA 4MTGA 1N1CA 4LERA 5CIVA 4KC9A 4DVYP 3QTHA 4Z9JA 4AX2A 1Z63A 2C04A 1M2VA 3NRHA 1OKKD 3JTLO 4YT2A 3NYJA 5L3VA 4R32A 2XLWA 2WZLA 1M6TA 3AQBA 4IAQA 4XPYA 4NY3A 5F5FA 3SP1A 5A6JA 1M57C 1LPEA 1YZCA 1ZHYA 2J0WA 4FWVA 3AJMA 3EGXB 3OWTA 4PFOA 4GEHA 4XPWA 2B0HA 5CI9A 2Q7RA 3RFYA 2XLHA 1ZYRF 3LS1A 4CDAA 4YT8A 5COFA 3HJCA 1D0XA 3KKBA 2EPLX 2AP3A 3TOLA 1RMVA 4MNDA 1IW7F 2XXAB 2QLAA 3UMKA 4BJ6C 3L0IA 3BEHA 4RDAA 4J32B 5JVEA 1OW8A 2EIJC 2UUHA 1R4TA 2L81A 2JX0A 1WGWA 2P1AA 2EINC 2H8AA 3NYLA 4BG0A 3E70C 1C17M 2LSEA 2WVNA 3LNRA 4I3MA 4W8PA 4JE9A 2GAQA 4EKWA 5B3IA 2D5RB 1U0BB 5HV9A 3C8ZA 4AE4B 1FR0A 2EIKC 2LD6A 1D1BA 1I5NA 4WGYA 2ZXPA 3IQTA 4PJMA 2CW0F 2GFHA 4NC3A 3ZTMA 3PMRA 1YA9A 4EBKA 1WN0A 3VRCA 4ER9A 4CS8A 1OQCA 5E3AA 3UMHA 3MLGA 3SZRA 1TKNA 3U2LA 4JTCB 4NTFA 3W2WA 4J7TA 3ZDLA 4O6NA 5BQIA 2EIMC 2J9BA 3EJNA 2OU6A 3EGDA 1FMVA 3GWNA 4CJGA 4EIYA 1UFBA 1BZ4A 3ASOC 2J8WA 1VK5A 3EH2A 3MFNA 1VTMP 2YRFA 4C3DA 2H7BA 4WABA 4AL0A 1H9GA 2MWQA 1BR1A 3QW0A 2HS5A 3EZIA 2HJMA 3GWLA 4OINF 3DXJF 3S27A 5HSWA 4B6IA 1PD0A 1SYQA 1SZIA 5FZTA 2HV6A 3Q7LA 2WL8A 4H4KC 1ZHXA 1YYXA 2XL6A 3DKAA 4OIRF 3QMKA 3W8IA 3WHNA 2WZGA 2R03A 4JIOA 3KMIA 1NFOA 4C7OB 1HE1A 3T6BA 3VF0A 3UNGC 4K7BA 3W8HA 2YL7A 2E87A 5IY5C 3DAFA 4FX5A 2CYDA 2J9UA 3K7DA 3SNHA 5DQTA 1J8YF 3TK0A 2BE5F 3ABMC 5JS5A 1WWPA 1E84A 3GANA 3ZVRA 1FNTc 1NU7D 1E86A 3M4BA 1EI7A 4DXWA 3DE8A 4PACA 1SF8A 3DE9A 2XS1A 2R7VA 2Y69C 2Y39A 1T6UA 2CNWD 3T4RA 1U6HA 4JCHA 2HSBA 3V7OA 3QZCA 2C03A 3IQ6A 1VYKA 3JCUQ 4E18A 2O9XA 4XLNF 1E83A 2ZXWC 3S28A 4IRUA 5L0IA 4BJ5A 2KGOA 3HLZA 2DB4A 3O55A 4XQ1A 2YLDA 3C63A 3EG9B 3FAPB 4ULVA 2OG2A 3C7JA 3MBGA 1JOGA 1G8XA 2NPUA 2YL0A 3RQGA 4AE4A 3RW0A 4YT4A 1I4YA 2Y3GA 2ZD9A 5T3TA 4KNWA 4MW3A 4A4AA 4BEJA 1HY5A 2MHRA 1VB5A 3JYHA 2LQGA 4J7YA 1LM3B 1KNYA 2G3VA 2IXOA 2EPMX 3W2VA 4CIPA 2MYSA 4G7OF 5JP7A 3FMSA 3SXMA 4CIHA 4U5EE 1K05A 4HE8D 4OD5A 4O6YA 2CCYA 1OCOC 1MMDA 2DYSC 4PK4A 4KI2A 3FXHA 3GEHA 3NYMA 3MYFA 5DS6A 1OCZC 1SR2A 1Z7Qc 3ZQYA 3EGDB 1NBBA 2OEVA 3O10A 3QVYA 3WAQA 2HJ3A 4C3EA 3ITFA 5KYXB 4MVQA 3NKEA 2HV7A 5L0FA 2V3CC 3RF3A 3TJ5A 4Q5SF 3KL4A 4MTFA 1ZZPA 4O79A 4YT5A 1U89A 3GODA 4MTOA 1T5OA 1FFHA 1TFOB 3C8GB 3RH3A 1PV3A 1Q0MA 3U9MA 1H9TA 1OR2A 3O6XA 2R7RA 4Z9HA 2TMVP 1O3UA 2R25A 4C7OA 1LS4A 1KU2A 2R7OA 3EHNA 4IB4A 3SEOA 4H54A 1BR4A 2FGYA 1YA7O 2AU5A 3H2VA 4GYTA 2HFIA 4I1MA 4E7ZA 5D92A 1NFNA 1G4US 1ZW3A 4UDVA 3FDQA 4JJGA 1ZHZA 1V74B 4JJFA 4CS8C 1HW2A 2JPUA 1C03A 2BC5A 1OXBA 3B29A 3I5QA 3IHUA 3S9OA 2X51A 3X2QC 2KQ9A 3AOUA 1JPJA 4LLEA 2J0XA 4JVSA 3LAYA 1NSGB 3MYIA 1BDJB 4MVOA 2GA0A 4CS9A 1G4WR 1VYIA 2WVQA 4ANJA 2PF4E 3GM3A 3EFOB 1TFKB 2LK4A 4JRZA 3V5ZA 2Q3TA 2JD3A 2A6HF 1QVXA 1ZHTA 2J9VA 3NKDA 1K40A 1LVKA 4G0HA 1YDIA 2NG1A 3L8IA 4OD4A 4P9FA 3LS0A 4ONSA 4C3BA 1ZHWA 2KNHA 2XLVA 3EG9A 1HMOA 5B1BC 4OIOF 3JSEO 1Y4CA 3UR3C 2J7PA 2VCAA 2VC9A 3K1IA 4N6HA 3O39A 1QZXA 2AVKA 4L6RA 2QUPA 4BEMJ 1T9KA 5KYUB 2R02A 4O7GA 4EUKB 3RVYA 3DZAA 3U3FA 1MMGA 4JEAA 4G7ZF 3EQLF 2H7VC 1C02A 2ETSA 2H7OA 4AK9A 4E0IA 3HNIA 2HSQA 1B68A 1DOVA 1LE2A 3U8PA 3UMIA 5KYYB 1WASA 4D4NA 4EBBA 1CPRA 3ASNC 3M4CA 4F4BA 2YEVA 3DMDA 2EILC 3GM2A 3HKKA 1AEPA 3J06A 3LESA 3FAJA 1O87A 3G50A 3U3BA 3TQOA 3T6GB 2DI3A 1A7DA 3ECSA 3H2UA 4IWBA 5KYXA 2PP4A 3NDBB 3LJBA 1QLEC 3V5YA 3QVZA 1T6IA 2HZ8A 2M64A 2IYLD 1LE4A 1QPUA 2NUPB 4GQHA 4HFKB 3JZ0A 4BJTA 5A69A 2PX0A 3GEEA 3Q7GA 1VOMA 4NTAA 3C8GA 3US6A 4E7SA 3RVZA 4YL1A 2VASA 5L0GA 5EHHA 1AVOB 1J8MF 1S7ZA 3PDMP 3GM1A 1YZAA 3S90A 1HMDA 4NCQA 3WODF 4LACB 2IM8A 1D0ZA 1SMYF 4HFFB 4J30B 4XEVA 2IXPA 3WG7C 1MQVA 3ZQVA 4CDYA 2RD9A 5AC5A 1M56C 4EBJA 2R7QA 4NTBA 2BL2A 4LDKA 2QNLA 3C18A 2ZXRA 2LFDA 2V26A 3AG1C 1OCRC 2EPNA 2FFHA 3EHMA 4PR9A 5B3SC 5F5HA 5L0JA 3EPVA 1FMWA 2XL8A 3UGPA 3TULA 2ZXOA 1Q0KA 3EFOA 3RQFA 1E85A 1JPNA 2YWAA 1GQAA 2W4BA 2VCBA 4D4XA 4CSAC 2NSFA 3KYIA 3JT1A 2HUJA 4JC7A 3DJUB 3S29A 2LIGA 1L3PA 3QW1A 4I44A 3V5XA 2XRHA 3LLKA 5JUAA 1ZVZA 4QI0A 3I4UA 4X0RA 5KYWB 2DYRC 2G3KA 3F47A 1YLMA 5DVWA 3KPHA 3DAGA 2A1DD 1E2XA 4P6IC 2FAPB 5KYUA 1A7VA 2HMQA 3CAXA 1XZPA 2YLGA 1OW6A 2OEXA 4RD9A 2RSEB 3H65A 3CSKA 2X0CA 4A2NB 1CPQA 5A6BA 2DGJA 1YJGA 1NZEA 4QI2A 3HNKA 3JSZA 1T6QA 2CGEA 2L6FA 5GPGB 2VCCA 1RXQA 4N06A 5KYYA 2Q9CA 1QKRA 3U8VA 2I15A 2YL1A 4YWQA 2PFDA 4E0HA 1MMAA 2KYHA 3KYJA 5JLIA 4IAOA 2PBEA 2L7AA 1TWGA 5BQHA 1UG7A 3NG1A 4XPXA 4U5HA 4YK5A 4G7HF 3B9QA 2NUPA 4U5CE 3RYLA 3SXYA 3U5SA 4E17A 3OEOA 3NMIA 1L7CA 2L9JA 4JTAB 4DOZA 2YQYA 1JMWA 2OKUA 3LUTB 5DLJA 2LCHA 5DQZA 2VB6A 1YAUO 1VLTA 2A6EF 3ABLC 1JR8A 3DWWA 4YL3A 2R7UA 1FTSA 1YARO 5L0CA 5T3WA 3K1IC 5D91A 4MVZA 1YYJA 3TJ6A 4U5DE 5JRAA 3L34A 2P61A 2XLDA 3PCVA 2XLEA 4Q4ZF 2ZPAA 1Z23A 3JRTA 1NLXA 3U0CA 4IJJA 5FCLA 1EA8A 3AGTA 3CZ6A 3L1MA 4CS7A 2Q9BA 3A9CA 2Z15A 2AWYA 1Z3IX 4MW8A 3B0UX 4U5FE 5L0DA 2OJQA 2B0JA 3GORA 4N4WA 1DOWA 2OJED 4MVSA 5E3CA 4G78A 4ZLCA 1VMAA 1IZMA 1JRAA 1ORSC 2KSFA 3AG4C 2ASRA 4K1OA 4KBLA 4U5BE 3AG3C 4XWJA 3TD7A 3ZIBA 5L0HA 1TWAA 2UUIA 4BJ1A 3SXZA 2F22A 5E2QA 2R05A 4CX9A 4QDLA 1S05A 2W4MA 3UGOA 4JZAA 1LI5A 4MVRA 1D1CA 2A68F 2Y3BA 4Z9IA 5A6KA 2PNOA 3MX3A 5KYWA 2NSGA 3L8JA 3LEVA 4MQ9F 4PFPA 4OIPF 3HNLA 4PJJA 4W8KA 4LLCA 1GS9A 2OQMA 1NG1A 1RCPA 2P0NA 2LFFA 3HTKC 3K33A 3RKOF 2W9YA 5EK0A 1H6GA 2HKVA 3S0XA 4OIQF 3F46A 1Q0FA 2OOCA 3C8GD 1RKCA 2EPOA 3IEEA 3OA1A 2R7TA 2YZSA 2GDCA 1PCXA 1Z5ZA 2L6HA 3VYWA 2KC3A 3EZHA 2NUTB 1MNDA 1TR2A 2OCCC 1V54C 3E9VA 1W2WA 3DM9B 4M63A 3RQEA 2W45A 4ZLDA 2XSEA
chains in the Genus database with same CATH topology
1RKEB 1U89A 2GWWA 1YDIA 2X0CA 4DJ9A 5L0CA 4ONSA 4P9TA 3T6GB 5L0JA 2LQGA 4PR9A 3H2UA 3TJ6A 1U6HA 4W8PA 3H2VA 1QKRA 2IBFA 4E18A 1RKEA 1SYQA 1ZW3A 5FZTA 1ZW2A 4EHPA 1H6GA 5L0IA 1XWJA 1RKCA 1ST6A 5L0GA 2L7AA 2GDCA 5L0DA 1DOWA 1ZVZA 4E17A 2HSQA 2B0HA 3S90A 3MYIA 1L7CA 3VF0A 4K1OA 1DOVA 1TR2A 5L0FA 4IGGA 5L0HA 3ZDLA 1T01A 3RF3A 3TJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKE B;  1U89 A;  2GWW A;  1YDI A;  2X0C A;  4DJ9 A;  5L0C A;  4ONS A;  4P9T A;  3T6G B;  5L0J A;  2LQG A;  4PR9 A;  3H2U A;  3TJ6 A;  1U6H A;  4W8P A;  3H2V A;  1QKR A;  2IBF A;  4E18 A;  1RKE A;  1SYQ A;  1ZW3 A;  5FZT A;  1ZW2 A;  4EHP A;  1H6G A;  5L0I A;  1XWJ A;  1RKC A;  1ST6 A;  5L0G A;  2L7A A;  2GDC A;  5L0D A;  1DOW A;  1ZVZ A;  4E17 A;  2HSQ A;  2B0H A;  3S90 A;  3MYI A;  1L7C A;  3VF0 A;  4K1O A;  1DOV A;  1TR2 A;  5L0F A;  4IGG A;  5L0H A;  3ZDL A;  1T01 A;  3RF3 A;  3TJ5 A; 
#chains in the Genus database with same CATH topology
 1RKE B;  2R9R B;  3VM6 A;  2IXM A;  4CJO A;  2Y3H A;  4DJ9 A;  4BPM A;  4MS2 A;  4JEB A;  1H7I A;  1OCC C;  5JT4 A;  4YJW A;  5F28 E;  2A0B A;  5T1D B;  3G4X A;  2A0U A;  1GM5 A;  2CDQ A;  1OKK A;  3CEX A;  1O5H A;  256B A;  4DRJ B;  1OW7 A;  4DRH B;  1D0Y A;  2M4E A;  3DD7 A;  3NMK A;  4XEK A;  4FES A;  4XTK A;  4BJ5 C;  3IQ5 A;  1ZW2 A;  4RBN A;  3S84 A;  3X1O A;  4JCZ A;  5K0I A;  3POV A;  3LNM B;  3Q6M A;  4U9D A;  5TJ5 E;  4YN0 B;  3SYN A;  3G4Z A;  3LEO A;  2Q00 A;  4HEA J;  2QTV A;  3U2M A;  3I5P A;  4DBQ A;  2R7W A;  1G5Z A;  1Y6D A;  1A0B A;  4U5G A;  2VH3 A;  1LKX A;  1RJ9 B;  2EPK X;  1JAF A;  3LLI A;  1OXK A;  2R7S A;  4Q7C A;  1QSP A;  1MNE A;  2AWC A;  4ULW A;  5KYN A;  3PHF 2;  2I8B A;  3AG2 C;  4P9T A;  2WVO A;  4PJN A;  1VLS A;  1FFT C;  1V55 C;  5L3Q A;  3FOO A;  3M15 A;  4LDQ A;  5BUO A;  5A6B D;  2PX3 A;  4BJ6 A;  2WB7 A;  2XLM A;  1MMN A;  1QQ3 A;  1WAT A;  2YLI A;  5E33 A;  2ICW G;  1TWC A;  3K1H A;  1APC A;  1HE9 A;  2KW3 C;  3N2Z B;  4FAP B;  1TWH A;  3ZC4 A;  4XLP F;  3FHD A;  1EQ1 A;  1OR3 A;  3DJN B;  3HNJ A;  4JKV A;  1ZU5 A;  2P7V A;  3JRM O;  4YL0 A;  3T9O A;  3M1C B;  3GEI A;  1BR2 A;  4CBE A;  4MVU A;  3B0V C;  5BQG A;  1EKY A;  2XS8 A;  3CQZ A;  5DS4 A;  3Q6N A;  1M2V B;  3AQC A;  2LP4 A;  3EH1 A;  3K66 A;  5B1A C;  2Q9A A;  3ATP A;  1I4Z A;  5COM A;  3M79 A;  4U9E A;  1ORY A;  4XEF A;  3FOP A;  3SXK A;  1ZU4 A;  3BRJ A;  3EGX A;  4IAR A;  3AGU A;  3VAY A;  2YKZ A;  3C62 A;  4AL1 A;  3DM5 A;  3TOM A;  2NUT A;  3FVY A;  2IXN A;  1V4A A;  1Q0G A;  4K0D A;  2YL3 A;  2QE9 A;  1AUE A;  3ZSU A;  1PD1 A;  3B71 A;  2XXA A;  3N0T A;  2IBF A;  3IPM O;  1RKE A;  4EHP A;  2L6G A;  2QY9 A;  2A69 F;  2D4U A;  2WZF A;  1WOL A;  3NMJ A;  3R2P A;  4DBR A;  1KTM A;  1XWJ A;  1XZQ A;  2KJG A;  3T6J A;  2R7X A;  1WTY A;  4CS9 C;  1Q0D A;  3IQC A;  3ZTZ A;  4WGZ A;  2XL4 A;  2IOQ A;  5COG A;  4WJ0 A;  5DS5 A;  3B0P A;  3ABK C;  1Z6A A;  2GWW A;  4KNV A;  1YVI A;  2G62 A;  5JSL A;  1CGM E;  3N24 A;  2XM0 A;  2CNW A;  4PJL A;  3A11 A;  4JTD B;  4CDV A;  3ZWI A;  1FAP B;  5A6A A;  1NU9 C;  3JYY A;  4JW1 A;  3ZG1 A;  1RJ9 A;  1TQG A;  4DVZ A;  1K04 A;  2J45 A;  5EGY A;  4MVM A;  1D1A A;  1R5I D;  2KK1 A;  1A41 A;  2J7P D;  3R7C A;  4EWC A;  2YHS A;  1F1M A;  1M2O A;  2XLO A;  1BBH A;  2J9W A;  2P6V A;  2HMZ A;  1LI7 A;  1LIH A;  1ST6 A;  1ORJ A;  2Y3D A;  4CSA A;  3W4Y A;  1CGO A;  1LS1 A;  4O6M A;  1HW1 A;  1GGQ A;  5CI8 A;  3U9J A;  5AGF A;  4DRI B;  4IGG A;  4JUR I;  3KH2 A;  1A7E A;  2YVK A;  4N6C A;  1T01 A;  2J46 A;  3DI5 A;  4I1O B;  4LDR A;  1CGN A;  2Q4F A;  2XM4 A;  3K6B A;  3RIP A;  5AC4 A;  4NQF A;  4MTG A;  1N1C A;  4LER A;  5CIV A;  4KC9 A;  4DVY P;  3QTH A;  4Z9J A;  4AX2 A;  1Z63 A;  2C04 A;  1M2V A;  3NRH A;  1OKK D;  3JTL O;  4YT2 A;  3NYJ A;  5L3V A;  4R32 A;  2XLW A;  2WZL A;  1M6T A;  3AQB A;  4IAQ A;  4XPY A;  4NY3 A;  5F5F A;  3SP1 A;  5A6J A;  1M57 C;  1LPE A;  1YZC A;  1ZHY A;  2J0W A;  4FWV A;  3AJM A;  3EGX B;  3OWT A;  4PFO A;  4GEH A;  4XPW A;  2B0H A;  5CI9 A;  2Q7R A;  3RFY A;  2XLH A;  1ZYR F;  3LS1 A;  4CDA A;  4YT8 A;  5COF A;  3HJC A;  1D0X A;  3KKB A;  2EPL X;  2AP3 A;  3TOL A;  1RMV A;  4MND A;  1IW7 F;  2XXA B;  2QLA A;  3UMK A;  4BJ6 C;  3L0I A;  3BEH A;  4RDA A;  4J32 B;  5JVE A;  1OW8 A;  2EIJ C;  2UUH A;  1R4T A;  2L81 A;  2JX0 A;  1WGW A;  2P1A A;  2EIN C;  2H8A A;  3NYL A;  4BG0 A;  3E70 C;  1C17 M;  2LSE A;  2WVN A;  3LNR A;  4I3M A;  4W8P A;  4JE9 A;  2GAQ A;  4EKW A;  5B3I A;  2D5R B;  1U0B B;  5HV9 A;  3C8Z A;  4AE4 B;  1FR0 A;  2EIK C;  2LD6 A;  1D1B A;  1I5N A;  4WGY A;  2ZXP A;  3IQT A;  4PJM A;  2CW0 F;  2GFH A;  4NC3 A;  3ZTM A;  3PMR A;  1YA9 A;  4EBK A;  1WN0 A;  3VRC A;  4ER9 A;  4CS8 A;  1OQC A;  5E3A A;  3UMH A;  3MLG A;  3SZR A;  1TKN A;  3U2L A;  4JTC B;  4NTF A;  3W2W A;  4J7T A;  3ZDL A;  4O6N A;  5BQI A;  2EIM C;  2J9B A;  3EJN A;  2OU6 A;  3EGD A;  1FMV A;  3GWN A;  4CJG A;  4EIY A;  1UFB A;  1BZ4 A;  3ASO C;  2J8W A;  1VK5 A;  3EH2 A;  3MFN A;  1VTM P;  2YRF A;  4C3D A;  2H7B A;  4WAB A;  4AL0 A;  1H9G A;  2MWQ A;  1BR1 A;  3QW0 A;  2HS5 A;  3EZI A;  2HJM A;  3GWL A;  4OIN F;  3DXJ F;  3S27 A;  5HSW A;  4B6I A;  1PD0 A;  1SYQ A;  1SZI A;  5FZT A;  2HV6 A;  3Q7L A;  2WL8 A;  4H4K C;  1ZHX A;  1YYX A;  2XL6 A;  3DKA A;  4OIR F;  3QMK A;  3W8I A;  3WHN A;  2WZG A;  2R03 A;  4JIO A;  3KMI A;  1NFO A;  4C7O B;  1HE1 A;  3T6B A;  3VF0 A;  3UNG C;  4K7B A;  3W8H A;  2YL7 A;  2E87 A;  5IY5 C;  3DAF A;  4FX5 A;  2CYD A;  2J9U A;  3K7D A;  3SNH A;  5DQT A;  1J8Y F;  3TK0 A;  2BE5 F;  3ABM C;  5JS5 A;  1WWP A;  1E84 A;  3GAN A;  3ZVR A;  1FNT c;  1NU7 D;  1E86 A;  3M4B A;  1EI7 A;  4DXW A;  3DE8 A;  4PAC A;  1SF8 A;  3DE9 A;  2XS1 A;  2R7V A;  2Y69 C;  2Y39 A;  1T6U A;  2CNW D;  3T4R A;  1U6H A;  4JCH A;  2HSB A;  3V7O A;  3QZC A;  2C03 A;  3IQ6 A;  1VYK A;  3JCU Q;  4E18 A;  2O9X A;  4XLN F;  1E83 A;  2ZXW C;  3S28 A;  4IRU A;  5L0I A;  4BJ5 A;  2KGO A;  3HLZ A;  2DB4 A;  3O55 A;  4XQ1 A;  2YLD A;  3C63 A;  3EG9 B;  3FAP B;  4ULV A;  2OG2 A;  3C7J A;  3MBG A;  1JOG A;  1G8X A;  2NPU A;  2YL0 A;  3RQG A;  4AE4 A;  3RW0 A;  4YT4 A;  1I4Y A;  2Y3G A;  2ZD9 A;  5T3T A;  4KNW A;  4MW3 A;  4A4A A;  4BEJ A;  1HY5 A;  2MHR A;  1VB5 A;  3JYH A;  2LQG A;  4J7Y A;  1LM3 B;  1KNY A;  2G3V A;  2IXO A;  2EPM X;  3W2V A;  4CIP A;  2MYS A;  4G7O F;  5JP7 A;  3FMS A;  3SXM A;  4CIH A;  4U5E E;  1K05 A;  4HE8 D;  4OD5 A;  4O6Y A;  2CCY A;  1OCO C;  1MMD A;  2DYS C;  4PK4 A;  4KI2 A;  3FXH A;  3GEH A;  3NYM A;  3MYF A;  5DS6 A;  1OCZ C;  1SR2 A;  1Z7Q c;  3ZQY A;  3EGD B;  1NBB A;  2OEV A;  3O10 A;  3QVY A;  3WAQ A;  2HJ3 A;  4C3E A;  3ITF A;  5KYX B;  4MVQ A;  3NKE A;  2HV7 A;  5L0F A;  2V3C C;  3RF3 A;  3TJ5 A;  4Q5S F;  3KL4 A;  4MTF A;  1ZZP A;  4O79 A;  4YT5 A;  1U89 A;  3GOD A;  4MTO A;  1T5O A;  1FFH A;  1TFO B;  3C8G B;  3RH3 A;  1PV3 A;  1Q0M A;  3U9M A;  1H9T A;  1OR2 A;  3O6X A;  2R7R A;  4Z9H A;  2TMV P;  1O3U A;  2R25 A;  4C7O A;  1LS4 A;  1KU2 A;  2R7O A;  3EHN A;  4IB4 A;  3SEO A;  4H54 A;  1BR4 A;  2FGY A;  1YA7 O;  2AU5 A;  3H2V A;  4GYT A;  2HFI A;  4I1M A;  4E7Z A;  5D92 A;  1NFN A;  1G4U S;  1ZW3 A;  4UDV A;  3FDQ A;  4JJG A;  1ZHZ A;  1V74 B;  4JJF A;  4CS8 C;  1HW2 A;  2JPU A;  1C03 A;  2BC5 A;  1OXB A;  3B29 A;  3I5Q A;  3IHU A;  3S9O A;  2X51 A;  3X2Q C;  2KQ9 A;  3AOU A;  1JPJ A;  4LLE A;  2J0X A;  4JVS A;  3LAY A;  1NSG B;  3MYI A;  1BDJ B;  4MVO A;  2GA0 A;  4CS9 A;  1G4W R;  1VYI A;  2WVQ A;  4ANJ A;  2PF4 E;  3GM3 A;  3EFO B;  1TFK B;  2LK4 A;  4JRZ A;  3V5Z A;  2Q3T A;  2JD3 A;  2A6H F;  1QVX A;  1ZHT A;  2J9V A;  3NKD A;  1K40 A;  1LVK A;  4G0H A;  1YDI A;  2NG1 A;  3L8I A;  4OD4 A;  4P9F A;  3LS0 A;  4ONS A;  4C3B A;  1ZHW A;  2KNH A;  2XLV A;  3EG9 A;  1HMO A;  5B1B C;  4OIO F;  3JSE O;  1Y4C A;  3UR3 C;  2J7P A;  2VCA A;  2VC9 A;  3K1I A;  4N6H A;  3O39 A;  1QZX A;  2AVK A;  4L6R A;  2QUP A;  4BEM J;  1T9K A;  5KYU B;  2R02 A;  4O7G A;  4EUK B;  3RVY A;  3DZA A;  3U3F A;  1MMG A;  4JEA A;  4G7Z F;  3EQL F;  2H7V C;  1C02 A;  2ETS A;  2H7O A;  4AK9 A;  4E0I A;  3HNI A;  2HSQ A;  1B68 A;  1DOV A;  1LE2 A;  3U8P A;  3UMI A;  5KYY B;  1WAS A;  4D4N A;  4EBB A;  1CPR A;  3ASN C;  3M4C A;  4F4B A;  2YEV A;  3DMD A;  2EIL C;  3GM2 A;  3HKK A;  1AEP A;  3J06 A;  3LES A;  3FAJ A;  1O87 A;  3G50 A;  3U3B A;  3TQO A;  3T6G B;  2DI3 A;  1A7D A;  3ECS A;  3H2U A;  4IWB A;  5KYX A;  2PP4 A;  3NDB B;  3LJB A;  1QLE C;  3V5Y A;  3QVZ A;  1T6I A;  2HZ8 A;  2M64 A;  2IYL D;  1LE4 A;  1QPU A;  2NUP B;  4GQH A;  4HFK B;  3JZ0 A;  4BJT A;  5A69 A;  2PX0 A;  3GEE A;  3Q7G A;  1VOM A;  4NTA A;  3C8G A;  3US6 A;  4E7S A;  3RVZ A;  4YL1 A;  2VAS A;  5L0G A;  5EHH A;  1AVO B;  1J8M F;  1S7Z A;  3PDM P;  3GM1 A;  1YZA A;  3S90 A;  1HMD A;  4NCQ A;  3WOD F;  4LAC B;  2IM8 A;  1D0Z A;  1SMY F;  4HFF B;  4J30 B;  4XEV A;  2IXP A;  3WG7 C;  1MQV A;  3ZQV A;  4CDY A;  2RD9 A;  5AC5 A;  1M56 C;  4EBJ A;  2R7Q A;  4NTB A;  2BL2 A;  4LDK A;  2QNL A;  3C18 A;  2ZXR A;  2LFD A;  2V26 A;  3AG1 C;  1OCR C;  2EPN A;  2FFH A;  3EHM A;  4PR9 A;  5B3S C;  5F5H A;  5L0J A;  3EPV A;  1FMW A;  2XL8 A;  3UGP A;  3TUL A;  2ZXO A;  1Q0K A;  3EFO A;  3RQF A;  1E85 A;  1JPN A;  2YWA A;  1GQA A;  2W4B A;  2VCB A;  4D4X A;  4CSA C;  2NSF A;  3KYI A;  3JT1 A;  2HUJ A;  4JC7 A;  3DJU B;  3S29 A;  2LIG A;  1L3P A;  3QW1 A;  4I44 A;  3V5X A;  2XRH A;  3LLK A;  5JUA A;  1ZVZ A;  4QI0 A;  3I4U A;  4X0R A;  5KYW B;  2DYR C;  2G3K A;  3F47 A;  1YLM A;  5DVW A;  3KPH A;  3DAG A;  2A1D D;  1E2X A;  4P6I C;  2FAP B;  5KYU A;  1A7V A;  2HMQ A;  3CAX A;  1XZP A;  2YLG A;  1OW6 A;  2OEX A;  4RD9 A;  2RSE B;  3H65 A;  3CSK A;  2X0C A;  4A2N B;  1CPQ A;  5A6B A;  2DGJ A;  1YJG A;  1NZE A;  4QI2 A;  3HNK A;  3JSZ A;  1T6Q A;  2CGE A;  2L6F A;  5GPG B;  2VCC A;  1RXQ A;  4N06 A;  5KYY A;  2Q9C A;  1QKR A;  3U8V A;  2I15 A;  2YL1 A;  4YWQ A;  2PFD A;  4E0H A;  1MMA A;  2KYH A;  3KYJ A;  5JLI A;  4IAO A;  2PBE A;  2L7A A;  1TWG A;  5BQH A;  1UG7 A;  3NG1 A;  4XPX A;  4U5H A;  4YK5 A;  4G7H F;  3B9Q A;  2NUP A;  4U5C E;  3RYL A;  3SXY A;  3U5S A;  4E17 A;  3OEO A;  3NMI A;  1L7C A;  2L9J A;  4JTA B;  4DOZ A;  2YQY A;  1JMW A;  2OKU A;  3LUT B;  5DLJ A;  2LCH A;  5DQZ A;  2VB6 A;  1YAU O;  1VLT A;  2A6E F;  3ABL C;  1JR8 A;  3DWW A;  4YL3 A;  2R7U A;  1FTS A;  1YAR O;  5L0C A;  5T3W A;  3K1I C;  5D91 A;  4MVZ A;  1YYJ A;  3TJ6 A;  4U5D E;  5JRA A;  3L34 A;  2P61 A;  2XLD A;  3PCV A;  2XLE A;  4Q4Z F;  2ZPA A;  1Z23 A;  3JRT A;  1NLX A;  3U0C A;  4IJJ A;  5FCL A;  1EA8 A;  3AGT A;  3CZ6 A;  3L1M A;  4CS7 A;  2Q9B A;  3A9C A;  2Z15 A;  2AWY A;  1Z3I X;  4MW8 A;  3B0U X;  4U5F E;  5L0D A;  2OJQ A;  2B0J A;  3GOR A;  4N4W A;  1DOW A;  2OJE D;  4MVS A;  5E3C A;  4G78 A;  4ZLC A;  1VMA A;  1IZM A;  1JRA A;  1ORS C;  2KSF A;  3AG4 C;  2ASR A;  4K1O A;  4KBL A;  4U5B E;  3AG3 C;  4XWJ A;  3TD7 A;  3ZIB A;  5L0H A;  1TWA A;  2UUI A;  4BJ1 A;  3SXZ A;  2F22 A;  5E2Q A;  2R05 A;  4CX9 A;  4QDL A;  1S05 A;  2W4M A;  3UGO A;  4JZA A;  1LI5 A;  4MVR A;  1D1C A;  2A68 F;  2Y3B A;  4Z9I A;  5A6K A;  2PNO A;  3MX3 A;  5KYW A;  2NSG A;  3L8J A;  3LEV A;  4MQ9 F;  4PFP A;  4OIP F;  3HNL A;  4PJJ A;  4W8K A;  4LLC A;  1GS9 A;  2OQM A;  1NG1 A;  1RCP A;  2P0N A;  2LFF A;  3HTK C;  3K33 A;  3RKO F;  2W9Y A;  5EK0 A;  1H6G A;  2HKV A;  3S0X A;  4OIQ F;  3F46 A;  1Q0F A;  2OOC A;  3C8G D;  1RKC A;  2EPO A;  3IEE A;  3OA1 A;  2R7T A;  2YZS A;  2GDC A;  1PCX A;  1Z5Z A;  2L6H A;  3VYW A;  2KC3 A;  3EZH A;  2NUT B;  1MND A;  1TR2 A;  2OCC C;  1V54 C;  3E9V A;  1W2W A;  3DM9 B;  4M63 A;  3RQE A;  2W45 A;  4ZLD A;  2XSE A; 
#chains in the Genus database with same CATH homology
 1RKE B;  1U89 A;  2GWW A;  1YDI A;  2X0C A;  4DJ9 A;  5L0C A;  4ONS A;  4P9T A;  3T6G B;  5L0J A;  2LQG A;  4PR9 A;  3H2U A;  3TJ6 A;  1U6H A;  4W8P A;  3H2V A;  1QKR A;  2IBF A;  4E18 A;  1RKE A;  1SYQ A;  1ZW3 A;  5FZT A;  1ZW2 A;  4EHP A;  1H6G A;  5L0I A;  1XWJ A;  1RKC A;  1ST6 A;  5L0G A;  2L7A A;  2GDC A;  5L0D A;  1DOW A;  1ZVZ A;  4E17 A;  2HSQ A;  2B0H A;  3S90 A;  3MYI A;  1L7C A;  3VF0 A;  4K1O A;  1DOV A;  1TR2 A;  5L0F A;  4IGG A;  5L0H A;  3ZDL A;  1T01 A;  3RF3 A;  3TJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...