2B0HA

Solution structure of vbs3 fragment of talin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
b'GIDPFTMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
molecule tags Structural protein
source organism Mus musculus
publication title Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod
pubmed doi rcsb
total genus 50
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08913 VBS Vinculin Binding Site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2b0hA01
4K1OA 1DOVA 1U6HA 1TR2A 1H6GA 3TJ6A 1ZVZA 1RKCA 5L0JA 2X0CA 4EHPA 3H2VA 5L0CA 2IBFA 4PR9A 1YDIA 3RF3A 1T01A 4E17A 5L0DA 2HSQA 3T6GB 4P9TA 5L0IA 3TJ5A 1RKEA 1ZW3A 2LQGA 2L7AA 3MYIA 1SYQA 3S90A 4IGGA 1QKRA 1L7CA 1DOWA 1ZW2A 4ONSA 4W8PA 3VF0A 5L0HA 1U89A 1ST6A 2GDCA 5L0GA 5L0FA 2B0HA 3ZDLA 1XWJA 5FZTA 2GWWA 3H2UA 4E18A 1RKEB 4DJ9A
chains in the Genus database with same CATH superfamily
1A41A 2VASA 3K7DA 3SXMA 4JURI 4C3DA 4CS7A 4UDVA 1U6HA 4ER9A 2DYRC 5B3IA 3MBGA 3LEOA 1WN0A 5AGFA 2GA0A 2J9WA 3WAQA 1LS1A 5L3VA 2C04A 3QMKA 4JJGA 1NU7D 4U9EA 2ZXWC 2ZXRA 1GQAA 1TFOB 4MW8A 4Z9HA 3F46A 3B29A 4KBLA 4MVZA 1V4AA 4JC7A 3LJBA 5CI9A 2IOQA 3U3FA 4ONSA 3A9CA 1I5NA 3DZAA 1YYJA 3LEVA 4I44A 4L6RA 1H9TA 3EZHA 3TK0A 3F47A 4K0DA 5CI8A 5DS5A 2P6VA 2CNWA 3M4CA 4F4BA 2J7PA 2ICWG 3QVYA 4I3MA 3QZCA 4U5CE 3SYNA 1RXQA 2XXAB 2LIGA 3FDQA 2DGJA 3GM2A 3KL4A 1BR2A 2XSEA 1VOMA 2QNLA 4HFKB 2EIKC 4YN0B 1VYIA 3US6A 3RKOF 4EBBA 3HLZA 4EHPA 4JEBA 1JPNA 2LFDA 2PP4A 1YDIA 2R05A 1BR4A 4AX2A 4AE4B 5KYNA 1EQ1A 3HNKA 3KKBA 1QVXA 3K1IA 4J7TA 1G5ZA 2YL7A 2YVKA 4O6NA 4YL0A 5L0IA 4CSAA 3DMDA 1SYQA 3HJCA 3L8JA 5KYYB 1BDJB 3JCUQ 1CGME 1EA8A 1Q0KA 3AQBA 2YLDA 3LNMB 4PFOA 1NLXA 5EGYA 5JUAA 3MX3A 1O3UA 2A0BA 4XQ1A 3RQGA 3HNLA 3C8ZA 4YT2A 4JZAA 4I1MA 5HV9A 5JRAA 5KYXA 4IAOA 3EGDB 2F22A 3GORA 1OXBA 4IWBA 1Q0FA 3SZRA 4OIQF 1TWCA 1VTMP 3JT1A 2E87A 1BBHA 1M2VA 4CBEA 1M56C 1FAPB 2IYLD 3DJNB 1ZHXA 3M79A 1ZHWA 2A6EF 2PFDA 3ABKC 3L1MA 1LE2A 3W2WA 2XLVA 5JVEA 1OCZC 2IXOA 1KTMA 1PD1A 2A6HF 1T01A 1E83A 3T6GB 1Q0MA 3EQLF 4DRJB 5A6JA 4XPYA 4BJ5A 3TJ5A 3GODA 3ZG1A 4J32B 1HMDA 2ZPAA 2KGOA 4XPWA 1RCPA 3DM9B 1K40A 2LSEA 2ZXOA 3LNRA 4W8PA 1ZW2A 3WG7C 1E84A 3EH2A 1JMWA 1CGOA 4NY3A 4GYTA 1Z23A 2DYSC 2JPUA 2DI3A 2R7TA 4C7OA 1NBBA 1CPQA 1D0XA 2WVOA 3PCVA 1GS9A 2WB7A 3R2PA 1ZHYA 1FR0A 3M1CB 3E9VA 3I5QA 4JRZA 4HFFB 1IW7F 2XM0A 3PHF2 4G7OF 1G8XA 3ECSA 1LI5A 3BRJA 4R32A 3TJ6A 2WZLA 3Q7LA 2VB6A 3SXZA 1A0BA 1E85A 1ZYRF 3EGXA 3DI5A 3EPVA 3EFOB 1M6TA 5L0CA 4JTCB 3LUTB 5BQIA 3W8IA 4DOZA 4BPMA 1PV3A 3UNGC 1O5HA 4MVMA 3S27A 1HMOA 5F5HA 5IY5C 3B9QA 4E7ZA 2XL6A 1QKRA 1L7CA 1DOWA 2AP3A 4IAQA 3RQFA 3IQ6A 2I8BA 2HV6A 2XS8A 3ABLC 5L0HA 4XEKA 1E86A 5GPGB 3AGUA 4PJMA 1VYKA 1NZEA 3LAYA 3NMKA 4JCZA 1YVIA 4DRIB 4H54A 1YYXA 4C3EA 3C8GA 4NTFA 3MLGA 3EG9A 3AQCA 1RKEB 3AG2C 2YHSA 3C8GD 3ITFA 3JRTA 4NQFA 4O6MA 3CSKA 4MVQA 1H6GA 1OR2A 2ETSA 3K66A 4WGZA 1UFBA 4U5FE 2YEVA 4K7BA 3QW1A 2IBFA 1QPUA 1GM5A 2P0NA 4LDRA 5E2QA 4EWCA 5L0DA 3AG3C 1QZXA 4N4WA 3UGPA 2AU5A 3HKKA 3S90A 3C8GB 4ZLDA 3ZWIA 3UGOA 1Y6DA 4AL0A 1LM3B 1C03A 2J8WA 3NYJA 4BJ6C 3K33A 1MMGA 1KNYA 4Q4ZF 1WASA 2YZSA 1T6UA 2NUPB 2J7PD 1E2XA 2MWQA 1SF8A 3CZ6A 5EK0A 1YARO 1RJ9B 2GWWA 3NKEA 4E18A 2KC3A 2YLIA 3FHDA 4MVRA 4Q7CA 1O87A 4DJ9A 2G3KA 4PK4A 1HE9A 3C63A 4XEFA 3EZIA 3IEEA 4MNDA 3IHUA 1SR2A 1RKCA 1ZVZA 4XLNF 3NMJA 1M2VB 3RF3A 5DS4A 1EKYA 3L34A 3K6BA 2BL2A 3EH1A 4RBNA 1QQ3A 2HSQA 4BG0A 2R7OA 1R5ID 2HS5A 1JPJA 3AGTA 4C3BA 1YLMA 2WVNA 3JTLO 3NKDA 2OU6A 1D0ZA 3HTKC 3RIPA 3LLKA 5T3TA 5A69A 1W2WA 2KNHA 1V54C 4A2NB 1GGQA 2CNWD 4JE9A 1ST6A 2XLDA 5L0GA 2HFIA 5DLJA 2R7UA 2WL8A 4OD4A 4U5BE 1VMAA 4WGYA 2EPLX 4LLEA 3EHMA 1H7IA 2OKUA 1M57C 1T6QA 3FVYA 3JYYA 2FAPB 4JKVA 1OCOC 1TWHA 2QY9A 2HJ3A 4C7OB 3RW0A 3U9MA 5AC4A 1ORSC 2NUPA 2HV7A 3DJUB 4DXWA 2X0CA 1I4YA 2FFHA 1OQCA 1Q0DA 2H7BA 3X2QC 3S0XA 3FOPA 3IQCA 4G0HA 4PR9A 4LDKA 4HE8D 3J06A 1SMYF 4JCHA 4P6IC 3UR3C 1V55C 3POVA 1NFOA 2D5RB 3LS0A 5JS5A 2EIJC 1TWAA 2XLMA 2R9RB 4U9DA 2R7VA 3TULA 1JR8A 2MHRA 4NTAA 3NG1A 4U5EE 1WTYA 3U8PA 3H65A 1TFKB 4QDLA 2Q9AA 2LK4A 3RH3A 2Y69C 3EJNA 5DVWA 4CS8C 2HMZA 2J9BA 2NSFA 4U5HA 1F1MA 3IQTA 4G78A 3A11A 4I1OB 1TR2A 4XEVA 1N1CA 2OJED 3L8IA 5A6BD 3U0CA 2EILC 5E3CA 2I15A 2J45A 3M15A 2GFHA 4CDVA 4MVOA 4P9TA 2EINC 2P61A 2V3CC 2CW0F 2YL1A 1RMVA 4CS9A 1HW1A 1HE1A 2L7AA 2H7VC 1JOGA 1NG1A 1PCXA 1OXKA 1ZHZA 2NG1A 2QE9A 1OW7A 2B0JA 3MFNA 3OWTA 4GQHA 3TOMA 4EUKB 2KQ9A 5K0IA 3B0VC 3JSEO 1K05A 1LI7A 1Z5ZA 4MTOA 5COGA 4CSAC 2H7OA 1FFTC 2OG2A 2HZ8A 3GWNA 1OKKA 3HNIA 2AWYA 2NPUA 1OW6A 2VCAA 2Y3BA 1OKKD 3RVYA 5BQHA 3WHNA 2M4EA 1K04A 3ABMC 4H4KC 4LACB 4NCQA 3ZQVA 5L0JA 2XLEA 4N6HA 3NYLA 4YJWA 2UUIA 1TQGA 5COMA 3SXKA 2PBEA 3S9OA 3G4XA 3G50A 3DXJF 1RKEA 1ZW3A 2LQGA 3FMSA 4U5GA 2JX0A 3EHNA 3IPMO 5F28E 2WZGA 2W45A 1ZHTA 1D1AA 2OEXA 1ZU5A 4IGGA 1IZMA 3N2ZB 1YA7O 1FFHA 4MVUA 4EBJA 3FXHA 3OA1A 4BJ5C 2WZFA 3NDBB 3FOOA 2XS1A 4EKWA 4QI2A 2IXMA 2PF4E 2D4UA 1G4US 2VCBA 2Y3HA 5JT4A 2G62A 3B0UX 1MNDA 5F5FA 4K1OA 2TMVP 4CS9C 3AOUA 1RJ9A 2NUTA 1MNEA 2O9XA 2J9UA 4LERA 1I4ZA 4IJJA 3SP1A 4CIHA 4MS2A 3B0PA 3UMKA 4E0HA 3G4ZA 2Y3GA 1ORYA 1T9KA 4O79A 5A6AA 3NRHA 1HW2A 3S29A 1LKXA 1M2OA 4DBRA 4XLPF 3RVZA 1NFNA 2XLWA 2EPKX 4DBQA 2EPMX 5EHHA 1XZPA 3VYWA 3CQZA 4JEAA 4XTKA 3NMIA 2DB4A 2R7WA 1MMNA 1B68A 4JIOA 1ZZPA 1CPRA 1EI7A 2YL3A 1HY5A 3DE8A 4PJLA 2Y3DA 2A1DD 2HJMA 2YWAA 3O39A 3RYLA 3ZC4A 4Z9IA 4RDAA 2R02A 2AWCA 3V5YA 4AE4A 2IXPA 2CGEA 1DOVA 3CAXA 3HNJA 2PNOA 3FAPB 2Y39A 1SZIA 4PJJA 2M64A 2VCCA 4CX9A 3PMRA 4Q5SF 3KPHA 3UMHA 1VLTA 4G7ZF 4JTAB 4YK5A 2UUHA 2XLOA 1R4TA 4MQ9F 2YL0A 3EGDA 3MYIA 5KYXB 1NU9C 1UG7A 2CDQA 3ASNC 3QW0A 4FESA 3VF0A 1U89A 2YRFA 1JRAA 1Q0GA 4CIPA 1YZCA 5JLIA 3EFOA 1MMDA 3O10A 3WODF 2KJGA 1U0BB 2B0HA 3TQOA 2YKZA 1XWJA 2XL4A 3V5ZA 1T5OA 2WVQA 5KYYA 2BC5A 2MYSA 5B1BC 2Q4FA 3ZQYA 2KSFA 3M4BA 2L6FA 2Q9BA 2QLAA 2R25A 2Z15A 3GM3A 4OIRF 1D1BA 1V74B 1OW8A 4JJFA 1A7VA 3DD7A 4WJ0A 4OINF 3JRMO 4KC9A 1AUEA 3C18A 5BQGA 1ZU4A 3ZTZA 5B3SC 4KNWA 1A7EA 1H9GA 1L3PA 3LESA 4CDYA 1C02A 5JSLA 2XLHA 4XWJA 1A7DA 1Y4CA 2VH3A 3SXYA 4MW3A 2W9YA 3DE9A 3U2MA 4MTGA 5T1DB 4FAPB 2XXAA 3Q7GA 3DM5A 3T6JA 1NSGB 4E0IA 1OCCC 4EBKA 4PJNA 3AG1C 4X0RA 1LE4A 4CJGA 4J30B 4YL3A 1VLSA 2QTVA 5AC5A 3O55A 3W8HA 1LPEA 2ZD9A 3EGXB 3T9OA 5DS6A 1VB5A 3V7OA 2P7VA 1ORJA 1BR1A 3ZDLA 2Q7RA 4KI2A 1J8MF 3Q6NA 2J0XA 5A6BA 2YLGA 3T6BA 3VRCA 3JSZA 2EPNA 1J8YF 4O6YA 4LDQA 1JAFA 1WWPA 4YT4A 3MYFA 3KYIA 4MTFA 4A4AA 3DAFA 2LCHA 2XM4A 5COFA 3E70C 1WATA 1MQVA 2L6HA 4E17A 2A0UA 4YL1A 4N06A 4OIPF 3EG9B 5DQTA 2RSEB 3R7CA 3C62A 2CCYA 2A68F 4LLCA 1YAUO 4AK9A 4BJ1A 4KNVA 1D0YA 4RD9A 3B71A 1YJGA 5KYWA 2AVKA 2KYHA 2J0WA 2R7QA 2LP4A 1TKNA 3U9JA 3ZVRA 3L0IA 3W2VA 2OCCC 3KH2A 1QLEC 2QUPA 2OQMA 2W4BA 2XL8A 3H2UA 3W4YA 3QTHA 3N0TA 1LIHA 1FTSA 2L9JA 5L3QA 5KYUB 2HMQA 2EPOA 3DKAA 4P9FA 4U5DE 4D4NA 3SEOA 4PACA 1YZAA 1TWGA 4FX5A 4PFPA 5E33A 3H2VA 4QI0A 4XPXA 3SNHA 3PDMP 2LD6A 5B1AC 3JZ0A 1Z6AA 256BA 5KYWB 2L81A 1MMAA 2CYDA 5D92A 1LS4A 2FGYA 1KU2A 2IM8A 4JW1A 1VK5A 4ULWA 2G3VA 2PX0A 3QVZA 1XZQA 2HSBA 2OOCA 4IB4A 5D91A 4BJ6A 3U2LA 4YWQA 5FCLA 4J7YA 2HUJA 2LFFA 3GWLA 3K1HA 2V26A 4E7SA 3DAGA 4DRHB 3LLIA 4ZLCA 4IRUA 1T6IA 1FMWA 4G7HF 4NTBA 2RD9A 5HSWA 3ZTMA 5BUOA 3FAJA 2Q00A 3GM1A 3TD7A 4BJTA 1AEPA 1S05A 1OCRC 2IXNA 3OEOA 2YQYA 4OD5A 1Z63A 2OEVA 3KMIA 3KYJA 3GEIA 2JD3A 1PD0A 2R03A 2L6GA 3BEHA 3TOLA 2PX3A 3N24A 3ZSUA 3VAYA 3Q6MA 5KYUA 3GEHA 5T3WA 3GANA 4HEAJ 4Z9JA 3S28A 3T4RA 3U5SA 3S84A 2HKVA 4W8KA 5A6KA 1FMVA 2R7RA 3NYMA 1CGNA 3GEEA 1G4WR 4WABA 3RFYA 3CEXA 3I4UA 4O7GA 3I5PA 4ANJA 4EIYA 4DVZA 4MVSA 3U3BA 4BEMJ 4BEJA 5CIVA 3DWWA 1C17M 2ASRA 4JVSA 4DVYP 2J9VA 1OR3A 2GDCA 2KW3C 3ATPA 3LS1A 1Z7Qc 2XRHA 4OIOF 5TJ5E 3AJMA 1BZ4A 1APCA 5FZTA 4FWVA 4YT5A 1FNTc 1QSPA 1LVKA 2H8AA 2R7XA 4NC3A 4JTDB 1WOLA 3RQEA 3JYHA 3C7JA 4N6CA 5E3AA 4M63A 2OJQA 3X1OA 4CJOA 4CDAA 5JP7A 2W4MA 4B6IA 3IQ5A 1D1CA 2EIMC 2GAQA 3UMIA 4ULVA 3ZIBA 1Z3IX 3U8VA 3VM6A 2R7SA 2C03A 1WGWA 4AL1A 2ZXPA 1S7ZA 3AG4C 2KK1A 2J46A 1YA9A 2Q3TA 4YT8A 3O6XA 3ASOC 2NUTB 2X51A 5DQZA 4CS8A 3V5XA 2VC9A 2NSGA 1AVOB 3K1IC 4D4XA 5L0FA 2A69F 2Q9CA 4IARA 2BE5F 4GEHA 2P1AA
chains in the Genus database with same CATH topology
4K1OA 1DOVA 1U6HA 1TR2A 1H6GA 3TJ6A 1ZVZA 1RKCA 5L0JA 2X0CA 4EHPA 3H2VA 5L0CA 2IBFA 4PR9A 1YDIA 3RF3A 1T01A 4E17A 5L0DA 2HSQA 3T6GB 4P9TA 5L0IA 3TJ5A 1RKEA 1ZW3A 2LQGA 2L7AA 3MYIA 1SYQA 3S90A 4IGGA 1QKRA 1L7CA 1DOWA 1ZW2A 4ONSA 4W8PA 3VF0A 5L0HA 1U89A 1ST6A 2GDCA 5L0GA 5L0FA 2B0HA 3ZDLA 1XWJA 5FZTA 2GWWA 3H2UA 4E18A 1RKEB 4DJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1O A;  1DOV A;  1U6H A;  1TR2 A;  1H6G A;  3TJ6 A;  1ZVZ A;  1RKC A;  5L0J A;  2X0C A;  4EHP A;  3H2V A;  5L0C A;  2IBF A;  4PR9 A;  1YDI A;  3RF3 A;  1T01 A;  4E17 A;  5L0D A;  2HSQ A;  3T6G B;  4P9T A;  5L0I A;  3TJ5 A;  1RKE A;  1ZW3 A;  2LQG A;  2L7A A;  3MYI A;  1SYQ A;  3S90 A;  4IGG A;  1QKR A;  1L7C A;  1DOW A;  1ZW2 A;  4ONS A;  4W8P A;  3VF0 A;  5L0H A;  1U89 A;  1ST6 A;  2GDC A;  5L0G A;  5L0F A;  2B0H A;  3ZDL A;  1XWJ A;  5FZT A;  2GWW A;  3H2U A;  4E18 A;  1RKE B;  4DJ9 A; 
#chains in the Genus database with same CATH topology
 1A41 A;  2VAS A;  3K7D A;  3SXM A;  4JUR I;  4C3D A;  4CS7 A;  4UDV A;  1U6H A;  4ER9 A;  2DYR C;  5B3I A;  3MBG A;  3LEO A;  1WN0 A;  5AGF A;  2GA0 A;  2J9W A;  3WAQ A;  1LS1 A;  5L3V A;  2C04 A;  3QMK A;  4JJG A;  1NU7 D;  4U9E A;  2ZXW C;  2ZXR A;  1GQA A;  1TFO B;  4MW8 A;  4Z9H A;  3F46 A;  3B29 A;  4KBL A;  4MVZ A;  1V4A A;  4JC7 A;  3LJB A;  5CI9 A;  2IOQ A;  3U3F A;  4ONS A;  3A9C A;  1I5N A;  3DZA A;  1YYJ A;  3LEV A;  4I44 A;  4L6R A;  1H9T A;  3EZH A;  3TK0 A;  3F47 A;  4K0D A;  5CI8 A;  5DS5 A;  2P6V A;  2CNW A;  3M4C A;  4F4B A;  2J7P A;  2ICW G;  3QVY A;  4I3M A;  3QZC A;  4U5C E;  3SYN A;  1RXQ A;  2XXA B;  2LIG A;  3FDQ A;  2DGJ A;  3GM2 A;  3KL4 A;  1BR2 A;  2XSE A;  1VOM A;  2QNL A;  4HFK B;  2EIK C;  4YN0 B;  1VYI A;  3US6 A;  3RKO F;  4EBB A;  3HLZ A;  4EHP A;  4JEB A;  1JPN A;  2LFD A;  2PP4 A;  1YDI A;  2R05 A;  1BR4 A;  4AX2 A;  4AE4 B;  5KYN A;  1EQ1 A;  3HNK A;  3KKB A;  1QVX A;  3K1I A;  4J7T A;  1G5Z A;  2YL7 A;  2YVK A;  4O6N A;  4YL0 A;  5L0I A;  4CSA A;  3DMD A;  1SYQ A;  3HJC A;  3L8J A;  5KYY B;  1BDJ B;  3JCU Q;  1CGM E;  1EA8 A;  1Q0K A;  3AQB A;  2YLD A;  3LNM B;  4PFO A;  1NLX A;  5EGY A;  5JUA A;  3MX3 A;  1O3U A;  2A0B A;  4XQ1 A;  3RQG A;  3HNL A;  3C8Z A;  4YT2 A;  4JZA A;  4I1M A;  5HV9 A;  5JRA A;  5KYX A;  4IAO A;  3EGD B;  2F22 A;  3GOR A;  1OXB A;  4IWB A;  1Q0F A;  3SZR A;  4OIQ F;  1TWC A;  1VTM P;  3JT1 A;  2E87 A;  1BBH A;  1M2V A;  4CBE A;  1M56 C;  1FAP B;  2IYL D;  3DJN B;  1ZHX A;  3M79 A;  1ZHW A;  2A6E F;  2PFD A;  3ABK C;  3L1M A;  1LE2 A;  3W2W A;  2XLV A;  5JVE A;  1OCZ C;  2IXO A;  1KTM A;  1PD1 A;  2A6H F;  1T01 A;  1E83 A;  3T6G B;  1Q0M A;  3EQL F;  4DRJ B;  5A6J A;  4XPY A;  4BJ5 A;  3TJ5 A;  3GOD A;  3ZG1 A;  4J32 B;  1HMD A;  2ZPA A;  2KGO A;  4XPW A;  1RCP A;  3DM9 B;  1K40 A;  2LSE A;  2ZXO A;  3LNR A;  4W8P A;  1ZW2 A;  3WG7 C;  1E84 A;  3EH2 A;  1JMW A;  1CGO A;  4NY3 A;  4GYT A;  1Z23 A;  2DYS C;  2JPU A;  2DI3 A;  2R7T A;  4C7O A;  1NBB A;  1CPQ A;  1D0X A;  2WVO A;  3PCV A;  1GS9 A;  2WB7 A;  3R2P A;  1ZHY A;  1FR0 A;  3M1C B;  3E9V A;  3I5Q A;  4JRZ A;  4HFF B;  1IW7 F;  2XM0 A;  3PHF 2;  4G7O F;  1G8X A;  3ECS A;  1LI5 A;  3BRJ A;  4R32 A;  3TJ6 A;  2WZL A;  3Q7L A;  2VB6 A;  3SXZ A;  1A0B A;  1E85 A;  1ZYR F;  3EGX A;  3DI5 A;  3EPV A;  3EFO B;  1M6T A;  5L0C A;  4JTC B;  3LUT B;  5BQI A;  3W8I A;  4DOZ A;  4BPM A;  1PV3 A;  3UNG C;  1O5H A;  4MVM A;  3S27 A;  1HMO A;  5F5H A;  5IY5 C;  3B9Q A;  4E7Z A;  2XL6 A;  1QKR A;  1L7C A;  1DOW A;  2AP3 A;  4IAQ A;  3RQF A;  3IQ6 A;  2I8B A;  2HV6 A;  2XS8 A;  3ABL C;  5L0H A;  4XEK A;  1E86 A;  5GPG B;  3AGU A;  4PJM A;  1VYK A;  1NZE A;  3LAY A;  3NMK A;  4JCZ A;  1YVI A;  4DRI B;  4H54 A;  1YYX A;  4C3E A;  3C8G A;  4NTF A;  3MLG A;  3EG9 A;  3AQC A;  1RKE B;  3AG2 C;  2YHS A;  3C8G D;  3ITF A;  3JRT A;  4NQF A;  4O6M A;  3CSK A;  4MVQ A;  1H6G A;  1OR2 A;  2ETS A;  3K66 A;  4WGZ A;  1UFB A;  4U5F E;  2YEV A;  4K7B A;  3QW1 A;  2IBF A;  1QPU A;  1GM5 A;  2P0N A;  4LDR A;  5E2Q A;  4EWC A;  5L0D A;  3AG3 C;  1QZX A;  4N4W A;  3UGP A;  2AU5 A;  3HKK A;  3S90 A;  3C8G B;  4ZLD A;  3ZWI A;  3UGO A;  1Y6D A;  4AL0 A;  1LM3 B;  1C03 A;  2J8W A;  3NYJ A;  4BJ6 C;  3K33 A;  1MMG A;  1KNY A;  4Q4Z F;  1WAS A;  2YZS A;  1T6U A;  2NUP B;  2J7P D;  1E2X A;  2MWQ A;  1SF8 A;  3CZ6 A;  5EK0 A;  1YAR O;  1RJ9 B;  2GWW A;  3NKE A;  4E18 A;  2KC3 A;  2YLI A;  3FHD A;  4MVR A;  4Q7C A;  1O87 A;  4DJ9 A;  2G3K A;  4PK4 A;  1HE9 A;  3C63 A;  4XEF A;  3EZI A;  3IEE A;  4MND A;  3IHU A;  1SR2 A;  1RKC A;  1ZVZ A;  4XLN F;  3NMJ A;  1M2V B;  3RF3 A;  5DS4 A;  1EKY A;  3L34 A;  3K6B A;  2BL2 A;  3EH1 A;  4RBN A;  1QQ3 A;  2HSQ A;  4BG0 A;  2R7O A;  1R5I D;  2HS5 A;  1JPJ A;  3AGT A;  4C3B A;  1YLM A;  2WVN A;  3JTL O;  3NKD A;  2OU6 A;  1D0Z A;  3HTK C;  3RIP A;  3LLK A;  5T3T A;  5A69 A;  1W2W A;  2KNH A;  1V54 C;  4A2N B;  1GGQ A;  2CNW D;  4JE9 A;  1ST6 A;  2XLD A;  5L0G A;  2HFI A;  5DLJ A;  2R7U A;  2WL8 A;  4OD4 A;  4U5B E;  1VMA A;  4WGY A;  2EPL X;  4LLE A;  3EHM A;  1H7I A;  2OKU A;  1M57 C;  1T6Q A;  3FVY A;  3JYY A;  2FAP B;  4JKV A;  1OCO C;  1TWH A;  2QY9 A;  2HJ3 A;  4C7O B;  3RW0 A;  3U9M A;  5AC4 A;  1ORS C;  2NUP A;  2HV7 A;  3DJU B;  4DXW A;  2X0C A;  1I4Y A;  2FFH A;  1OQC A;  1Q0D A;  2H7B A;  3X2Q C;  3S0X A;  3FOP A;  3IQC A;  4G0H A;  4PR9 A;  4LDK A;  4HE8 D;  3J06 A;  1SMY F;  4JCH A;  4P6I C;  3UR3 C;  1V55 C;  3POV A;  1NFO A;  2D5R B;  3LS0 A;  5JS5 A;  2EIJ C;  1TWA A;  2XLM A;  2R9R B;  4U9D A;  2R7V A;  3TUL A;  1JR8 A;  2MHR A;  4NTA A;  3NG1 A;  4U5E E;  1WTY A;  3U8P A;  3H65 A;  1TFK B;  4QDL A;  2Q9A A;  2LK4 A;  3RH3 A;  2Y69 C;  3EJN A;  5DVW A;  4CS8 C;  2HMZ A;  2J9B A;  2NSF A;  4U5H A;  1F1M A;  3IQT A;  4G78 A;  3A11 A;  4I1O B;  1TR2 A;  4XEV A;  1N1C A;  2OJE D;  3L8I A;  5A6B D;  3U0C A;  2EIL C;  5E3C A;  2I15 A;  2J45 A;  3M15 A;  2GFH A;  4CDV A;  4MVO A;  4P9T A;  2EIN C;  2P61 A;  2V3C C;  2CW0 F;  2YL1 A;  1RMV A;  4CS9 A;  1HW1 A;  1HE1 A;  2L7A A;  2H7V C;  1JOG A;  1NG1 A;  1PCX A;  1OXK A;  1ZHZ A;  2NG1 A;  2QE9 A;  1OW7 A;  2B0J A;  3MFN A;  3OWT A;  4GQH A;  3TOM A;  4EUK B;  2KQ9 A;  5K0I A;  3B0V C;  3JSE O;  1K05 A;  1LI7 A;  1Z5Z A;  4MTO A;  5COG A;  4CSA C;  2H7O A;  1FFT C;  2OG2 A;  2HZ8 A;  3GWN A;  1OKK A;  3HNI A;  2AWY A;  2NPU A;  1OW6 A;  2VCA A;  2Y3B A;  1OKK D;  3RVY A;  5BQH A;  3WHN A;  2M4E A;  1K04 A;  3ABM C;  4H4K C;  4LAC B;  4NCQ A;  3ZQV A;  5L0J A;  2XLE A;  4N6H A;  3NYL A;  4YJW A;  2UUI A;  1TQG A;  5COM A;  3SXK A;  2PBE A;  3S9O A;  3G4X A;  3G50 A;  3DXJ F;  1RKE A;  1ZW3 A;  2LQG A;  3FMS A;  4U5G A;  2JX0 A;  3EHN A;  3IPM O;  5F28 E;  2WZG A;  2W45 A;  1ZHT A;  1D1A A;  2OEX A;  1ZU5 A;  4IGG A;  1IZM A;  3N2Z B;  1YA7 O;  1FFH A;  4MVU A;  4EBJ A;  3FXH A;  3OA1 A;  4BJ5 C;  2WZF A;  3NDB B;  3FOO A;  2XS1 A;  4EKW A;  4QI2 A;  2IXM A;  2PF4 E;  2D4U A;  1G4U S;  2VCB A;  2Y3H A;  5JT4 A;  2G62 A;  3B0U X;  1MND A;  5F5F A;  4K1O A;  2TMV P;  4CS9 C;  3AOU A;  1RJ9 A;  2NUT A;  1MNE A;  2O9X A;  2J9U A;  4LER A;  1I4Z A;  4IJJ A;  3SP1 A;  4CIH A;  4MS2 A;  3B0P A;  3UMK A;  4E0H A;  3G4Z A;  2Y3G A;  1ORY A;  1T9K A;  4O79 A;  5A6A A;  3NRH A;  1HW2 A;  3S29 A;  1LKX A;  1M2O A;  4DBR A;  4XLP F;  3RVZ A;  1NFN A;  2XLW A;  2EPK X;  4DBQ A;  2EPM X;  5EHH A;  1XZP A;  3VYW A;  3CQZ A;  4JEA A;  4XTK A;  3NMI A;  2DB4 A;  2R7W A;  1MMN A;  1B68 A;  4JIO A;  1ZZP A;  1CPR A;  1EI7 A;  2YL3 A;  1HY5 A;  3DE8 A;  4PJL A;  2Y3D A;  2A1D D;  2HJM A;  2YWA A;  3O39 A;  3RYL A;  3ZC4 A;  4Z9I A;  4RDA A;  2R02 A;  2AWC A;  3V5Y A;  4AE4 A;  2IXP A;  2CGE A;  1DOV A;  3CAX A;  3HNJ A;  2PNO A;  3FAP B;  2Y39 A;  1SZI A;  4PJJ A;  2M64 A;  2VCC A;  4CX9 A;  3PMR A;  4Q5S F;  3KPH A;  3UMH A;  1VLT A;  4G7Z F;  4JTA B;  4YK5 A;  2UUH A;  2XLO A;  1R4T A;  4MQ9 F;  2YL0 A;  3EGD A;  3MYI A;  5KYX B;  1NU9 C;  1UG7 A;  2CDQ A;  3ASN C;  3QW0 A;  4FES A;  3VF0 A;  1U89 A;  2YRF A;  1JRA A;  1Q0G A;  4CIP A;  1YZC A;  5JLI A;  3EFO A;  1MMD A;  3O10 A;  3WOD F;  2KJG A;  1U0B B;  2B0H A;  3TQO A;  2YKZ A;  1XWJ A;  2XL4 A;  3V5Z A;  1T5O A;  2WVQ A;  5KYY A;  2BC5 A;  2MYS A;  5B1B C;  2Q4F A;  3ZQY A;  2KSF A;  3M4B A;  2L6F A;  2Q9B A;  2QLA A;  2R25 A;  2Z15 A;  3GM3 A;  4OIR F;  1D1B A;  1V74 B;  1OW8 A;  4JJF A;  1A7V A;  3DD7 A;  4WJ0 A;  4OIN F;  3JRM O;  4KC9 A;  1AUE A;  3C18 A;  5BQG A;  1ZU4 A;  3ZTZ A;  5B3S C;  4KNW A;  1A7E A;  1H9G A;  1L3P A;  3LES A;  4CDY A;  1C02 A;  5JSL A;  2XLH A;  4XWJ A;  1A7D A;  1Y4C A;  2VH3 A;  3SXY A;  4MW3 A;  2W9Y A;  3DE9 A;  3U2M A;  4MTG A;  5T1D B;  4FAP B;  2XXA A;  3Q7G A;  3DM5 A;  3T6J A;  1NSG B;  4E0I A;  1OCC C;  4EBK A;  4PJN A;  3AG1 C;  4X0R A;  1LE4 A;  4CJG A;  4J30 B;  4YL3 A;  1VLS A;  2QTV A;  5AC5 A;  3O55 A;  3W8H A;  1LPE A;  2ZD9 A;  3EGX B;  3T9O A;  5DS6 A;  1VB5 A;  3V7O A;  2P7V A;  1ORJ A;  1BR1 A;  3ZDL A;  2Q7R A;  4KI2 A;  1J8M F;  3Q6N A;  2J0X A;  5A6B A;  2YLG A;  3T6B A;  3VRC A;  3JSZ A;  2EPN A;  1J8Y F;  4O6Y A;  4LDQ A;  1JAF A;  1WWP A;  4YT4 A;  3MYF A;  3KYI A;  4MTF A;  4A4A A;  3DAF A;  2LCH A;  2XM4 A;  5COF A;  3E70 C;  1WAT A;  1MQV A;  2L6H A;  4E17 A;  2A0U A;  4YL1 A;  4N06 A;  4OIP F;  3EG9 B;  5DQT A;  2RSE B;  3R7C A;  3C62 A;  2CCY A;  2A68 F;  4LLC A;  1YAU O;  4AK9 A;  4BJ1 A;  4KNV A;  1D0Y A;  4RD9 A;  3B71 A;  1YJG A;  5KYW A;  2AVK A;  2KYH A;  2J0W A;  2R7Q A;  2LP4 A;  1TKN A;  3U9J A;  3ZVR A;  3L0I A;  3W2V A;  2OCC C;  3KH2 A;  1QLE C;  2QUP A;  2OQM A;  2W4B A;  2XL8 A;  3H2U A;  3W4Y A;  3QTH A;  3N0T A;  1LIH A;  1FTS A;  2L9J A;  5L3Q A;  5KYU B;  2HMQ A;  2EPO A;  3DKA A;  4P9F A;  4U5D E;  4D4N A;  3SEO A;  4PAC A;  1YZA A;  1TWG A;  4FX5 A;  4PFP A;  5E33 A;  3H2V A;  4QI0 A;  4XPX A;  3SNH A;  3PDM P;  2LD6 A;  5B1A C;  3JZ0 A;  1Z6A A;  256B A;  5KYW B;  2L81 A;  1MMA A;  2CYD A;  5D92 A;  1LS4 A;  2FGY A;  1KU2 A;  2IM8 A;  4JW1 A;  1VK5 A;  4ULW A;  2G3V A;  2PX0 A;  3QVZ A;  1XZQ A;  2HSB A;  2OOC A;  4IB4 A;  5D91 A;  4BJ6 A;  3U2L A;  4YWQ A;  5FCL A;  4J7Y A;  2HUJ A;  2LFF A;  3GWL A;  3K1H A;  2V26 A;  4E7S A;  3DAG A;  4DRH B;  3LLI A;  4ZLC A;  4IRU A;  1T6I A;  1FMW A;  4G7H F;  4NTB A;  2RD9 A;  5HSW A;  3ZTM A;  5BUO A;  3FAJ A;  2Q00 A;  3GM1 A;  3TD7 A;  4BJT A;  1AEP A;  1S05 A;  1OCR C;  2IXN A;  3OEO A;  2YQY A;  4OD5 A;  1Z63 A;  2OEV A;  3KMI A;  3KYJ A;  3GEI A;  2JD3 A;  1PD0 A;  2R03 A;  2L6G A;  3BEH A;  3TOL A;  2PX3 A;  3N24 A;  3ZSU A;  3VAY A;  3Q6M A;  5KYU A;  3GEH A;  5T3W A;  3GAN A;  4HEA J;  4Z9J A;  3S28 A;  3T4R A;  3U5S A;  3S84 A;  2HKV A;  4W8K A;  5A6K A;  1FMV A;  2R7R A;  3NYM A;  1CGN A;  3GEE A;  1G4W R;  4WAB A;  3RFY A;  3CEX A;  3I4U A;  4O7G A;  3I5P A;  4ANJ A;  4EIY A;  4DVZ A;  4MVS A;  3U3B A;  4BEM J;  4BEJ A;  5CIV A;  3DWW A;  1C17 M;  2ASR A;  4JVS A;  4DVY P;  2J9V A;  1OR3 A;  2GDC A;  2KW3 C;  3ATP A;  3LS1 A;  1Z7Q c;  2XRH A;  4OIO F;  5TJ5 E;  3AJM A;  1BZ4 A;  1APC A;  5FZT A;  4FWV A;  4YT5 A;  1FNT c;  1QSP A;  1LVK A;  2H8A A;  2R7X A;  4NC3 A;  4JTD B;  1WOL A;  3RQE A;  3JYH A;  3C7J A;  4N6C A;  5E3A A;  4M63 A;  2OJQ A;  3X1O A;  4CJO A;  4CDA A;  5JP7 A;  2W4M A;  4B6I A;  3IQ5 A;  1D1C A;  2EIM C;  2GAQ A;  3UMI A;  4ULV A;  3ZIB A;  1Z3I X;  3U8V A;  3VM6 A;  2R7S A;  2C03 A;  1WGW A;  4AL1 A;  2ZXP A;  1S7Z A;  3AG4 C;  2KK1 A;  2J46 A;  1YA9 A;  2Q3T A;  4YT8 A;  3O6X A;  3ASO C;  2NUT B;  2X51 A;  5DQZ A;  4CS8 A;  3V5X A;  2VC9 A;  2NSG A;  1AVO B;  3K1I C;  4D4X A;  5L0F A;  2A69 F;  2Q9C A;  4IAR A;  2BE5 F;  4GEH A;  2P1A A; 
#chains in the Genus database with same CATH homology
 4K1O A;  1DOV A;  1U6H A;  1TR2 A;  1H6G A;  3TJ6 A;  1ZVZ A;  1RKC A;  5L0J A;  2X0C A;  4EHP A;  3H2V A;  5L0C A;  2IBF A;  4PR9 A;  1YDI A;  3RF3 A;  1T01 A;  4E17 A;  5L0D A;  2HSQ A;  3T6G B;  4P9T A;  5L0I A;  3TJ5 A;  1RKE A;  1ZW3 A;  2LQG A;  2L7A A;  3MYI A;  1SYQ A;  3S90 A;  4IGG A;  1QKR A;  1L7C A;  1DOW A;  1ZW2 A;  4ONS A;  4W8P A;  3VF0 A;  5L0H A;  1U89 A;  1ST6 A;  2GDC A;  5L0G A;  5L0F A;  2B0H A;  3ZDL A;  1XWJ A;  5FZT A;  2GWW A;  3H2U A;  4E18 A;  1RKE B;  4DJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...