2B0LA

C-terminal dna binding domain of transcriptional pleiotropic repressor cody.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
HHHHHHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVLNNKFLIELENLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
total genus 29
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08222 HTH_CodY CodY helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2b0lA00
2HDCA 3F8NA 3T5XA 1BC8C 3I5UA 3GFMA 3T1BA 4KIFA 3C7JA 4G6DA 3ECHA 2CYYA 3JAMK 1KU2A 2Z99A 1MJBA 1SFEA 2BEOA 2K86A 4KYWA 2ZMEB 4YFXF 3V7CA 3RPUA 1XCVA 3ZP5A 1ZHFA 2XAJA 4WX9A 3F22A 2XKPA 3EETA 3R0JA 4AD9A 2HOEA 3KETA 1XGNA 2M8EA 1J59A 4P55A 1LDKB 5L3FA 5DYMA 3MAJA 5CYVA 4GYIA 3WU1B 3W6KB 4PCQA 1OMIA 3V7SA 2QYOA 2DK8A 1IAWA 4IRIA 3GEZA 2O6GE 4EJOA 4FHTA 4EGZA 1P6RA 1MJAA 2F5FA 3ULQB 3TDUC 5ERIA 1UHWA 1KU9A 3R6SA 3MFKA 1HW1A 1YS7A 2M30A 4L5IA 2H94A 2HR3A 4EQQA 3E5XA 2EV6A 2YU3A 4CICA 3WTYC 3NRVA 1S6LA 1J5YA 3E6BA 4KIGA 2DQLA 4NHJA 4UV9A 1FP2A 3L7WA 2GQQA 1OPCA 4EM0B 1BJAA 3BROA 1O7FA 3B73A 1I5ZA 4KFCA 5ILVA 2K02A 3COAC 3F3XA 1D8KA 1HW2A 3P9IA 4M6XA 3FMSA 4HYEA 4EGYA 1Z1DA 3TO6A 5DEQA 3TKYA 3WTZA 5AONA 5D5UB 3TQNA 2PBIA 4CDGA 2DBBA 1L0OC 4MTDA 5HLIA 4HOBA 1C0WA 1AWCA 3HOSA 5BS6A 3JAMZ 4L9TA 4M74A 2HYFA 2EFNA 3N97A 3IKVA 2CFXA 2UXNA 4I0BA 2XAGA 1KQ8A 3P9CA 3MZYA 3KZYA 5LEKA 2ZCWA 1JE8A 1BBYA 1ZGAA 1YLFA 1RZ4A 2QZ8A 1O3TA 3ZPLA 5FD5A 3F6VA 2P8TA 3WGHA 3BZ6A 2EB7A 3RTRA 4RGUA 2DI3A 4RS8A 1BIAA 4AVPA 1FSEA 3DV8A 4WXDA 4NQWA 2VC1A 3SZPA 3I53A 1SFUA 3KP7A 5IT9Z 2A3SA 4KT5C 2CW0F 2GWRA 2WC2A 1LJ9A 3F8FA 3U2RA 3V4GA 1Z6RA 4WXCA 3I0TA 4MEXF 2HTJA 2WTEA 3P7NA 3ISPA 5E1WA 4LFUA 3HRMA 2EA2A 4YIIA 2M5WA 3R4KA 3M8EA 4LG0B 3F8MA 3K1PA 3LQQA 3I58A 4BHBA 2HWVA 1FSHA 1ZREA 3E6CC 3K0LA 4H0EA 3L9FA 2LF8A 3J80K 3DXJF 1E2XA 4E70A 4HF2A 4OIQF 2YPRA 4LD5A 2DQRA 2E7WA 2HKOA 1ZLJA 5DD4A 3EDPA 1JGSA 3JTGA 3F8CA 2UXXA 4MQVA 3JW4A 3RYRA 4L9NA 2Z9OA 3MCZA 2FBIA 2Q2EA 3V8LA 2PN6A 2GXBA 3U1DA 2NNYA 2HQRA 2OAZA 3L09A 3WTSC 3QU6A 2DAOA 1H9GA 2FU4A 3CJNA 3PQKA 4CZZA 5FD6A 1TW2A 2DLLA 2MD5A 3C18A 5KK1A 5L3CA 3OOPA 1FOKA 4B09A 1R22A 4ZZDA 2F2EA 2GA1A 4KMFA 5ILUA 1XD7A 1IXSB 1R1TA 2Y48A 4I2OA 2RDPA 1ODDA 4OIRF 3K1MA 2OU2A 2Q8KA 4LG0A 2XROA 2OZUA 4BAYA 1B6AA 1T2KA 1BC7C 2VBWA 1CF7A 1W7PB 2G9WA 3J81Z 1GXPA 1FPQA 2DO7A 3OV8A 1K7AA 3KP6A 4QLCU 1P2FA 2F5CA 4HLXA 2OD5A 1U2WA 1HW5A 2KJCA 2P4WA 5FFZA 4IPAA 3QAHA 4IJAA 3ZMZA 1DPRA 3HTSB 5BOXA 4KA4A 3E3VA 5HDKA 1B4AA 3WODF 2HKXA 3ZMSA 2V1DA 3RKYA 1WKMA 3DKWA 2LF7A 1T39A 4EMSA 1U3EM 4XLNF 4L9VA 5DUIA 3CDHA 4EM1A 1G3SA 4KICA 2V9VA 3V7RA 2A6HF 3I4PA 3V8KA 3M9AA 3DPTA 1K79A 3RJPA 3KP5A 3GZ5A 5D4SA 4U7BA 4M9XA 1Z9CA 3CUOA 2O61A 3IC7A 1SMTA 2PG4A 1GHCA 1RIOH 1KYZA 3IRQA 2W84A 2XRNA 2P5LC 2D1VA 4LGWA 2ZO4A 4IRGA 3HHHA 3S2WA 1FNNA 2PI0A 1FYLA 1OYYA 3GYHX 3ZN1A 2LSOA 1O3RA 1FYKA 2OZ6A 2VOPA 5L3BA 3BDDA 3BY6A 5D8LB 2HS5A 3BPXA 2FNPA 5DD8A 1SD5A 3DF8A 4I02A 3H92A 5F6FA 4LK1F 3GFIA 4ENKA 2FRHA 1IUYA 3KZZA 3L00A 4Y13A 1ZRDA 4F7ZA 1TNSA 4UXNA 4BQAA 3HSFA 1UB9A 5HLHA 2MC3A 3WE3A 1ZRFA 5KVRA 2ADUA 4JQFA 4WWCA 2A07F 4RGRA 2IP2A 2ACJA 4U88A 4A5NA 4XLPF 1PDNC 2OBPA 4UUVA 2EA4A 3LSTA 3EUHA 2JPCA 2ZXJA 3GZ6A 3KEQA 5EEGA 4IRHA 2PFBA 5D4RA 1LNWA 1J2XA 4R8HA 4A2UA 3HHGA 1EH8A 4EJWA 1I6XA 1FC3A 2MBFA 2OQGA 2QQBA 3E97A 2W24A 2DW4A 4NB5A 5DCMB 3ROUA 2IJLA 3QP6A 1I27A 2JT1A 1HKTA 2F5DA 3M1EA 1R5HA 4CYDA 1BN5A 3LAJA 5E1XA 1YTYA 3EYIA 3H3ZA 1XSDA 2P6TA 2K4JA 2F5EA 5BPIA 1BM9A 5E1ZB 3TOAA 3MZHA 4L0ZB 2A68F 3RYPA 3MQ0A 1B9MA 3SXYA 4OMYA 1BI0A 2X4HA 1KYWA 2CQKA 3K9TA 4R1HA 1ZGJA 5L3EA 3LA2A 3ABTA 1H9TA 4P9UA 4I09A 5A2QK 5CLSA 4OOIA 1JHHA 4FX4A 1STZA 2EFWA 2O8XA 3GF2A 4HX8A 4M6YA 2PJPA 2RN7A 3HOTA 1T98A 1KQ9A 1KU3A 1VTNC 2PMUA 4LLGF 2MLKA 4HZFA 3H3UA 2Z33A 1K78A 4U0YA 2UWMA 1XDSA 3HIFA 3ERED 3HUGA 4TV7A 1YQAA 3CO6C 1P4AA 1SD4A 4HQEA 1KU7A 2XGXA 4N9HA 2VE8A 2ZJ2A 2STTA 4Q48A 3I71A 1W7PA 1FYMA 2VODA 5DDGA 5LRRA 1R36A 5E18F 1P92A 1IXCA 4CHUA 3R60A 3FHZA 2DTRA 1RNLA 4OU0A 2D45A 2G7UA 2GA2A 1XN7A 1S3JA 2R7FA 1YIOA 1Y0UA 2LNBA 1W7PD 2BE5F 4O3MA 2P6SA 1FP1D 3LAPA 3O2PE 2K7LA 1WWXA 4KN7X 2EFOA 2ZMEA 1IN4A 1B1BA 4A0XA 3SHFA 1PP7U 3GVAA 1DUXC 3C1DA 5TJJA 5K1YA 4I7HA 1ULYA 3E5UA 4UVAA 3G73A 2FBHA 2PEXA 3RKWA 4EJUA 5K5QA 5CVUA 2DT5A 2Q0OA 3LA7A 3KLNA 4ZYGA 1SFXA 4ZYDA 4MGRA 1R23A 2QENA 4PGGA 1GVJA 1FY7A 3WTUC 4L5JA 1F9NA 2O03A 3LQRA 2HFHA 2EV5A 3BOQA 2VE9A 4HX7A 1ZG1A 4FT8A 2CWEA 2IT0A 1RUNA 2ZNYA 4A12A 4P5OA 3I64A 3DFGA 4L0YB 2ETHA 2IA1A 1TW3A 2AXLA 3F6OA 5D5VB 1XCBA 1ZRCA 3PFIA 1OYIA 4FX0A 3KFWX 2RC4A 2ESNA 2XHKA 2KIUA 3K1NA 4ENMA 1KQ0A 3G3ZA 4I98B 5DUKA 3LA3A 2RGVA 3IL2A 3JTHA 5D8KB 4DQ2A 2VT2A 4BNCA 3BJ6A 1D5VA 3PQJA 5ED4A 2CGPA 3BJOA 3E5QA 2CSOA 3IWFA 1A04A 5FGMA 4LB6B 2LDUA 4OMZA 2VT3A 1WSUA 1RI7A 3ZN0A 2DPDA 4U7DA 1G3TA 1IN8A 1S7OA 1UHMA 4KIBA 3ZMDA 5E8GA 3SQNA 4GYGA 4XBFA 2HYGD 3QPTA 5JHUA 5BMZA 2FNAA 2ESHA 3JSOA 4OIPF 1W5TA 1P4WA 1F4KA 2GZWA 4WF2A 5J8FA 3J81K 2JSCA 2Y75A 1LEBA 3HRUA 1U5TC 4RAZA 1IN7A 1HBXG 3R61A 2W25A 3W6JB 4N9IA 1IRFA 4A0ZA 4YG2F 4EVIA 3FXQA 3Q9SA 4G6QA 3GFLA 5CVRA 3WTTC 3HRTA 2BYVE 2ELHA 2Z3YA 1EH7A 2KJBA 3HRSA 5JR3A 2XKOA 3IHUA 4I0AA 2Z5UA 3HSRA 3SFZA 1S7AA 2QBYB 4R79A 3QPHA 1J75A 5E8IA 1P4XA 4LLLA 3RIRA 3GX4X 5E17F 2FA5A 3KP4A 4HX4A 1YS6A 1TQMA 3CUQA 2L01A 4MTEA 1JXSA 1FT9A 2V1XA 1IZ1A 3DEUA 3GW2A 1IF1A 5F1RA 1KGSA 3M8FA 1MGTA 1MKMA 2DPUA 2FE3A 5CVJA 3FZVA 1HXDA 3E6MA 2RQPA 3TGNA 2HTSA 4ON0A 2VN2A 3O3KA 5HS8A 2AS5F 4MNUA 2L3DA 2XIGA 4DNCA 2DFIA 4XSXF 2QLZA 5FLXK 4EM2A 3J80Z 5EEHA 2KKOA 1IW7F 2PMHA 1FBQA 5JI6A 1XSXA 2VC0A 5LGUA 4HDUA 2EFQA 1EV7A 4IHSA 2HQNA 3KEOA 3GUDA 2P7VB 1YG2A 1QO0D 3QP5A 4CXFA 2YX4A 3VFZA 2OQRA 4RGXA 1O57A 3Q5FA 2JTVA 2DU9A 2NS0A 4KDPA 3FM3A 5IT9K 4S04A 1J7KA 4UV8A 5AIQA 5LBQA 4KN4X 2NNNA 1D3YA 5HS9A 2DK5A 4UVCA 4I01A 1X3UA 4RGSA 3WGIA 5E20A 4HQMA 1ZG5A 2YSRA 4Z2YA 2HGCA 1T6SA 3N4MA 4G7HF 4Y15A 1WI9A 2IVMA 5D5XB 2V79A 4GCVA 4BXUA 3DQVC 2E1NA 4XRFA 3VOEA 2KRFA 3WTVC 1LDJA 5JFRA 3QOPA 4BHCA 2GXGA 2MA3A 1MDMA 1FWZA 2EJRA 2WWYA 1MD0A 4G8XA 4EJTA 1ZG3A 1G6NA 3ZMUA 1JHFA 2PLYA 3WTXC 1HQCA 5L3DA 2J5PA 4HBLA 2FMYA 4GGGA 2BBYA 3L2CA 2P5VA 1QQIA 3IWZA 4ZYHA 3WTWC 4GO1A 3DPLC 4RB3C 2CO5A 1HKQA 4YFKF 1R5GA 2JRTA 3WGGA 5FLXZ 1TNTA 2VBZA 5FFXA 2MLGA 4O5VA 2UZKA 2XUBA 5F64A 1QBJA 1H0MA 4RB0A 2MH9A 2G7HA 3ZMVA 3LFKA 4M73A 2FSWA 5H6QA 1TLHB 1Z6TA 3I59B 5FB2A 1TQIA 2W57A 1ZLKA 3LWFA 1W5SA 2V6CA 4XSZF 1G4DA 3FXUA 1IN5A 3MEXA 4PDKA 4P96A 4AIJA 1Z7UA 5CVVA 3KE2A 3TO9A 4AIKA 4IHTA 1O3QA 3J7AO 3WU0A 1OKRA 4ZYEA 1R00A 3I59A 1QPMA 1XGSA 4GXOA 1D8JA 3CLOA 1Z91A 1IXRC 1YW8A 1F5TA 4U0VA 1J9IA 5ICFA 5D5WB 3BPVA 3V8JA 4LK0F 5JVTA 5FO5A 2RKHA 3U9GA 2W85A 5H20A 1XGOA 5K5RA 2ZNZA 3CO7C 4B8XA 4M71A 5D6FA 4HA8A 1OR7A 3IKTA 2XV4S 1SAXA 3FWEA 4KUMA 1LDDA 4M9SA 3GLXA 1K6OA 5ICCA 1S8NA 1DPUA 4P9FA 3ELKA 4HDVA 1Z05A 2NAZA 5K5OA 3FMRA 4AWXB 3I54A 4ENNA 4HF0A 3B02A 1R1VA 2D2WA 5BPDA 1AOYA 4CO8A 3FF5A 3M7GA 1S29A 5HLGA 3QRFF 2FF4A 3GXOA 2NYXA 2XAFA 2IRFG 3D5LA 4Q47A 2A69F 3FX3A 1XMAA 2XASA 2ZFWA 3NQOA 1USSA 3K2ZA 2XVCA 5CJ9A 3ZQ7A 4LB5A 1SD7A 2H6BA 5HDNA 4QWQA 4CGZA 1QZZA 3EYYA 3F21A 5LHIA 2H09A 5A2QZ 4L18B 1U78A 4S05A 4ASNA 3JSPA 2TDXA 1KA8A 2IPQX 5AIPA 3ECOA 3VB2A 1UCRA 4YFNF 2VOOA 3O6BB 1E17A 4Q4ZF 1RUOA 4PGHA 1G3YA 4JBAA 2R7DA 1CF7B 3HYIA 4IXAA 2EV0A 1SD6A 1DDNA 4O6JA 1PUEE 4HAMA 1Q1HA 2L4AA 2ISYA 5J8CA 3KP2A 4IF4A 4EV0A 4HF1A 4AIHA 5HDGA 3SZTA 2XAHA 4IVNA 2IA0A 2M45A 2H27A 3C3WA 5HOOA 3EQLF 1B59A 3FM5A 1PP8F 2KIMA 5J6XA 4MHGA 4BHPA 2JZYA 4YIFA 3FXRA 2XAQA 3KLOA 1U6GA 1ZN2A 3TOBA 4Y17A 1QGPA 1TQPA 4G7OF 2E1CA 2FOKA 1G3WA 4G9YA 3Q9VA 1BI3A 2D1HA 1W4MA 3TDZC 1YO5C 1MDMB 4OINF 4ENJA 1YW7A 2C6YA 2O3FA 4WXHA 2M87A 2OA4A 1CGPA 1MZBA 2A6EF 5HVQC 1R58A 2FQ3A 4HW0A 4A6DA 1V4RA 2WV0A 5ICEA 3HSEA 1K78B 1LVAA 4HV6A 1HSTA 5DV5A 4ESBA 3REOA 2ZKZA 1LEAA 2L02A 5LEJA 5DCFA 2B0LA 1MJ9A 4BYYA 1U5TA 1FZPB 5TRDA 1UFMA 2L4MA 2QWWA 1SMYF 2RV8A 4G94A 2LKPA 3ZMTA 3CUQB 2QVOA 3D0SA 3K69A 4ZZLA 1O7LA 5D6EA 3CTAA 5CVIA 1T0FA 3IRRA 4KMUX 1XB4A 1GXQA 1B9NA 2ISZA 4M72A 2RNJA 3RKXA 4WK8F 3T8TA 1WRJA 3ABUA 3HTUA 3QU3A 3P9KA 1TTYA 4WCGA 1BI1A 1XGMA 1BIBA 2VBYA 4MEYF 5DCMA 3RDIA 4M9ZA 4A6EA 3GO5A 2NRAC 1NHAA 2K27A 2QBYA 3GWZA 1YFHA 3NEUA 4HV5A 2P5KA 2BV6A 2FXAA 1XMKA 1ZH5A 5ICGA 2V1UA 2JPBA 1FBSA 2X0LA 5LGNA 4RB2C 2O0YA 4EJVA 1HSJA 1FLIA 2VONA 2VBXA 5LHHA 2QUFA 2ZBKA 2R3SA 4Q5SF 4LMYA 1DP7P 3F23A 2M1BA 3FMQA 3GFJA 1ZYRF 3TO7A 1BI2A 2PQ8A 3CUQC 4UVBA 2A5YB 1R1UA 1R7JA 4RB1A 1LB2A 2QQAA 2A61A 1F1ZA 5LHGA 3F8BA 1IN6A 6PAXA 1HKSA 1IRGA 2EK5A 4ETSA 3ML6A 2RVCA 1QNTA 1I1SA 2IW5A 3WG9A 1YYVA 4LLNA 2E7XA 1TBXA 1BOAA 3KCCA 2VXZA 1I1GA 4A5MA 1QZYA 1J0RA 3KP3A 2K4BA 1ZARA 2Y0MA 2BGCA 4D0PA 4OIOF 2COMA 5HS7A 1V3FA 4KNYA 3RPQA 1ON2A 3T8RA 3E6DA 4UHTA 2EFPA 1XSVA 5L3GA 3RI4A 1WQ2A 4L9JA 5IT3A 1T38A 1YW9A 5H6RA 4ESFA 1U8RA 2FEZA 2L54A 1FX7A 3BP8A 4MQ9F 1L3LA 2STWA 2EWNA 4JK1X 2P7CB 5LLQA 2MH2A 4A0YA 3MWMA 1U5TB 4U0WA 4LJZF 5BQTA 1FBUA 1OYWA 3VEPA 4HLYA 2FBKA 2YR2A 4UNOA 1LQ1A 3F72A 4PZJA 2QQ9A 4ESJA 4ZH4F 1ONVA 1ON1A 3T0YA 4RAYA 5LGTA 5ILSA 4N0BA 2KIFA 1USTA 2J5OA 4BH9A 2GIVA 1REPC 2IA2A 4G7ZF 2HEOA 2HZTA 2FMLA 4K2EA 3BJAA 3R0AA 5LRSA 1EH6A 1XDUA 2H6CA 3DP7A 3AAFA 2CG4A 3BWGA 1O3SA 2QM3A 2GAUA 2YX7A 3WE2A 1ZAOA 3VODA
chains in the Genus database with same CATH superfamily
2HDCA 2QGUA 3JRHA 3I55I 3F8NA 3T5XA 3GTKJ 1O4XA 1BC8C 1BW6A 3PSIA 3I5UA 2CFOA 4W1UA 3GFMA 3T1BA 4KIFA 3C7JA 2KDOA 4G6DA 1QHHD 3ECHA 2CYYA 4A3MJ 1WH5A 2CW7A 5DM6F 3JAMK 1KU2A 2Z99A 1MJBA 3CF2A 1SFEA 5FKMA 1AKHA 4AM3A 3K4MA 5EG0B 2BEOA 2K86A 4KYWA 2ZMEB 2A5WA 1DQUA 3UR3C 4YFXF 3G2BA 3QYBA 3S8PA 3V7CA 2E36A 3K4CA 3RPUA 1XCVA 3ZP5A 1ZHFA 2XAJA 4WX9A 3F22A 2XKPA 1NTCA 3EETA 3X2QH 1X4PA 1MBEA 3R0JA 4AD9A 4HRIA 2HOEA 4A3EJ 3KETA 1XGNA 2M8EA 1MBKA 2DOAA 1J59A 4P55A 1LDKB 5L3FA 2A05A 3BCBA 5DYMA 3MAJA 2L7KA 5CYVA 2NS7A 4GYIA 4QSHA 2X85A 3WU1B 3W6KB 2R7XA 3Q3SA 3DU5A 1QVTA 4PCQA 1OMIA 3V7SA 2QYOA 2DK8A 2K9NA 1IAWA 3GEZA 4IRIA 1FOWA 2O6GE 4EJOA 2E1OA 1N77A 1HCRA 4I99C 5F04A 4FHTA 4EGZA 2EH3A 3ESWB 3ZQFA 3KEYA 1P6RA 1MJAA 2F5FA 3ULQB 4BU2A 3TDUC 5ERIA 5HNFA 1W0UA 3DKYA 1UHWA 4G6TB 1KU9A 3R6SA 4XKVA 2GLOA 3FHNA 4XL9A 3MFKA 1H88C 2DA5A 3MD2A 3QQAA 1HW1A 3EUHC 1YS7A 3U21A 2DMTA 2M30A 4L5IA 3CESA 4ZDPA 4XLCA 2H94A 4XLFA 2HR3A 2IEKA 4BEHB 4EQQA 2DA4A 4ZDLA 3E5XA 2EV6A 2YU3A 4CICA 5HLTA 3WTYC 2W48A 3CCYA 3NRVA 1IRXA 1S6LA 3VSKA 2PJRB 2CUFA 1J5YA 4XLHA 3E6BA 3IH4A 4KIGA 2JRMA 3IV5A 5J1UA 2DQLA 2D5VA 4NHJA 4UV9A 4YRVA 1FP2A 3L7WA 2GQQA 3DBLB 5KAIC 2FJ1A 4NUBA 1X3ZB 3OL4A 2WY8Q 1OPCA 4EM0B 1BJAA 3BROA 3H0GJ 1ZELA 1Y56A 3I56I 1O7FA 5FKLA 2X6XA 3UKGA 2YUSA 3B73A 3OYMA 3LL7A 1I5ZA 3IAS2 2GOMA 4CH7A 4KFCA 5ILVA 1ETVA 2K02A 3COAC 3F3XA 1D8KA 2R93J 1OLTA 3BTIA 1HW2A 1GV5A 4C3JJ 2OV7A 3P9IA 3PJRA 1U8BA 4M6XA 3BQZA 1JJ8C 3FMSA 3UNGC 4B3AA 1Y1VJ 4HYEA 2M4GA 4EGYA 2LFBA 3F9KA 1Z1DA 3TO6A 3VYTB 4ABZA 5DEQA 1TWHJ 3TKYA 3WTZA 3MZ8A 4D5CA 5AONA 5D5UB 4BDZA 3TQNA 2PBIA 2Y2ZA 4CDGA 1J09A 5K7FA 4JX6A 4BGDA 4J19A 3RQ4A 3FXJA 5IYCJ 4PJJA 2HI3A 2QA4I 2ZXWH 3DEWA 2B9SA 2DBBA 1L0OC 4MTDA 5HLIA 4HOBA 1ETKA 4UB6C 2L9VA 3MN2A 2H8RA 1C0WA 2VL8A 1AWCA 3HOSA 5BS6A 3IUOA 3JAMZ 2M34A 5J1RA 1HLVA 4RAFA 4L9TA 4M74A 2HYFA 2EFNA 3J7ZI 3N97A 2LKSA 5EDNA 3IKVA 3VYUB 2CV1A 2CFXA 4DOZA 2IXSA 2CQ7A 1E3OC 3H35A 4GFBA 3ZQLA 2UXNA 4I0BA 4BQQA 4NQWB 2XAGA 1KQ8A 3S1MJ 3P9CA 3MZYA 3KZYA 2VIXA 5LEKA 1YRNA 2OCCH 4PSXA 2PMZN 2ZCWA 3SFIA 1F43A 4ZTJA 1JE8A 1BBYA 1ZGAA 3RCOA 1YLFA 2Y31A 1RZ4A 2KFDA 1WJFA 2QZ8A 4AYBA 1O3TA 3ZPLA 5FD5A 4XIDA 3F6VA 2P8TA 3WGHA 1MNDA 3BZ6A 5CPRB 2EB7A 3RTRA 3LSJA 3IH3A 4RGUA 2DI3A 4NC8A 4RS8A 3BR3A 1BIAA 4AVPA 4ANJA 1SC7A 4A3BJ 9ANTA 1FSEA 2I5UA 2LG4A 3DV8A 4WXDA 4NQWA 2VC1A 4C3IJ 3N05A 3SZPA 3I53A 1SFUA 3KP7A 3K6GA 5IT9Z 2F48A 1X19A 2A3SA 2DOEA 4KT5C 2CW0F 1JKPC 2GWRA 2WC2A 1LJ9A 3F8FA 5EZHA 3U2RA 3V4GA 1Z6RA 5EJCA 2TCTA 4WXCA 3I0TA 4MEXF 2HTJA 4Y3OA 2WTEA 2NVTJ 3P7NA 1X1DA 3ISPA 5E1WA 4LFUA 1M1EB 3HRMA 2CUZA 2EA2A 4YIIA 2ZJRF 2M5WA 3DTEA 3M8EA 2MABA 3R4KA 2OTLI 4LG0B 3F8MA 1PJRA 3K1PA 5KAFC 4PJLA 3LQQA 3I58A 4BHBA 2HWVA 1FSHA 3BTJA 1UJ8A 2Y9ZA 5FRNA 1ZREA 2VQLA 2DOFA 1WJ5A 3E6CC 2WADA 3K0LA 4H0EA 1LVKA 4GRIA 3L9FA 2XSDC 2LF8A 4W97A 3J80K 3DXJF 1E2XA 2GXAA 4E7KA 2R0QC 4RLFA 4E70A 2XGCA 4HF2A 1IV6A 3OYAA 3MKZA 4OIQF 2X1DA 2YPRA 2IS1A 4LD5A 2DQRA 2E7WA 2EIKH 2HKOA 1WHUA 3QODA 2O9LA 1ZLJA 4II2A 5DD4A 3H3VK 3CDLA 3SEZA 5C4JJ 3EDPA 4QPQA 4E4HA 1JGSA 3JTGA 3HXLA 3F8CA 2UXXA 4MQVA 1JUMA 2DTZA 3JW4A 3PUBA 2V1NA 3ZR8X 2QSHX 3RYRA 3BG5A 4L9NA 2Z9OA 3MCZA 2FBIA 2Q2EA 1BR4A 3TP0A 3V8LA 3CD6I 2PN6A 2GXBA 1F36A 1B8IB 4NDLA 4IHXA 3U1DA 2NNYA 2HQRA 2OAZA 3L09A 4BQNA 3WTSC 1GDTA 1MSFC 4PK4A 4LIUA 3K4LA 3QU6A 2DAOA 1H9GA 2FU4A 3CJNA 3PQKA 3H0DA 1W36C 4X6AJ 1BR2A 4CZZA 2DFFA 3G1LA 3OYHA 2LTPA 1U9NA 5FD6A 3BLYA 1TW2A 2DLLA 2QKMB 4M6VA 2MD5A 4ZTFA 3C18A 5KK1A 5L3CA 2JUGA 3OOPA 1FOKA 4B09A 1R22A 4G12A 4ZZDA 2F2EA 2GA1A 1KZHA 4KMFA 2VKHA 2QKLB 2WB1N 5ILUA 1B8IA 3OYDA 3BCAA 1XD7A 1IXSB 1R1TA 3OR2C 2Y48A 3GBGA 2VJ5A 5GTIC 5EG0A 4I2OA 2RDPA 1MMDA 1ODDA 2R5ZB 1JTYA 2KRHA 4OIRF 3AG4H 3K1MA 2OU2A 3K4KA 2Q8KA 4LG0A 3L2QA 2XROA 2QEXI 2OZUA 2O5RA 4BAYA 1B6AA 2VKEA 1OCRH 1T2KA 1BC7C 4A3FJ 3GCMA 1N25A 2VBWA 1CF7A 1W7PB 2G9WA 1IJWC 3S1NJ 2B63J 3NARA 3JREA 2CV0A 3J81Z 1GXPA 4A3DJ 1FOXA 1FPQA 2DO7A 3OV8A 2BZTA 1K7AA 3KP6A 3CMEI 1LKXA 2DMPA 4QLCU 4XMYA 1P2FA 2F5CA 4HLXA 3MMYB 2ZMEC 2G0EA 2OD5A 1U2WA 2K3FA 3OYGA 1HW5A 2KJCA 4M3BA 4XICA 2P4WA 5FFZA 1Y8QB 3HPHA 4IPAA 1K83J 4Y4RA 3CP8A 3QAHA 4IJAA 1GVDA 3S1RJ 3ZMZA 2DA7A 1DPRA 3HTSB 2ZFUA 5BOXA 4KA4A 3E3VA 5HDKA 3JRFA 1TL8A 1B4AA 4F3QA 4HNVA 3GMEA 1MBFA 3DTIA 3WODF 2HKXA 2HXOA 4E7JA 1IC8A 3ZMSA 3ZQQA 2V1DA 4C30A 4RM2A 4B3XA 5FLMJ 3MVPA 4B4CA 2EILH 3RKYA 1WKMA 3DKWA 2LF7A 1T39A 3ZOBA 4EMSA 4XNFA 3PFYA 1U3EM 4XLNF 3RZDJ 4L9VA 5DUIA 3RKQA 3FKIJ 3CDHA 4EM1A 4A69C 1G3SA 4KICA 2CJJA 2V9VA 3HZJA 3V7RA 2A6HF 3I4PA 3V8KA 5GADJ 4D9JA 3MKYB 3A2KA 3M9AA 3DPTA 1ZKGA 1K79A 5EEAA 5KCMA 3RJPA 3KP5A 3GZ5A 5D4SA 4U7BA 4YIRX 2YU9J 4M9XA 4F93B 1Z9CA 3CUOA 2O61A 4UUSA 4CA0A 5LFAA 3HOWJ 1V5GA 5GP9A 1RPWA 3IC7A 1SMTA 2PG4A 2PJRA 1GHCA 1RIOH 1KYZA 3IRQA 2W84A 2XRNA 2P5LC 2D1VA 3QOEA 2IGMA 1VQLI 4LGWA 2ZO4A 5EGOA 1ETWA 3A02A 4IRGA 3HHHA 3S2WA 1FNNA 2Y69H 2PI0A 1FYLA 1ITYA 2XF7A 4J01A 1OYYA 3GYHX 3ZN1A 2LSOA 3ZQGA 2DJIA 3OR1C 1R9TJ 1OCCH 4CYCB 1O3RA 2BVMA 1JTXA 1FYKA 2OZ6A 2VKDA 2VOPA 5L3BA 1R49A 3FIWA 1ZTRA 3BDDA 3BY6A 4RBOA 2VQHA 4AVZA 2UV1A 2Y0SA 2BOLA 5D8LB 1AU7A 4MFDA 2Z1DA 3D5SC 2HS5A 3BPXA 2FNPA 2NVXJ 2EZKA 5DD8A 3PO3J 3VSLA 3DLLF 1SD5A 4PJMA 4E7IA 3DF8A 1V55H 2DN0A 1N78A 4I02A 3H92A 2QQ8A 5F6FA 3HOXJ 4F55A 4BBSJ 4LK1F 3GFIA 1Q1VA 3CCSI 4ENKA 1B72A 4C9YA 1UELB 3S15J 1A36A 2FRHA 3K4BA 1RC9A 3FBNB 3KZZA 1IUYA 3L00A 4Y13A 1ZRDA 3KYDB 4F7ZA 1TNSA 4UXNA 4BQAA 3HSFA 1P9QC 1UB9A 5HLHA 2MC3A 2NVYJ 2ICWG 3WE3A 2CRGA 2V6EA 1ZRFA 1MH4A 5KVRA 2ADUA 4JQFA 4WWCA 3CDIA 3AL0B 2A07F 2XF5A 2F4MB 4RGRA 1FEXA 2IP2A 2ACJA 2VB6A 4E6KG 4U88A 1HDDC 4CCOA 2BVLA 2HPIA 5CKTA 4A5NA 4XLPF 3GTJJ 1PDNC 2OBPA 4UUVA 4DBQA 5M5YJ 2EA4A 2TRTA 3LSTA 2JA8J 3EUHA 1EJ9A 2JPCA 4AYBN 2ZXJA 3A0BC 2DT6A 3GZ6A 3RPUD 3KEQA 5EEGA 3JRAA 4PSWA 1V5EA 4IRHA 4DZPA 2PFBA 2IGNA 5D4RA 1JT6A 2P81A 2IS6A 4BJ5C 1ZQ3P 1X1CA 1LNWA 2R7TA 3CP2A 5B1AH 1J2XA 4R8HA 4A2UA 3HHGA 3SJMA 1EH8A 4EJWA 1VFCA 1I6XA 1FC3A 2MBFA 2OQGA 2QQBA 3CCEI 1LE8A 1ACIA 3JRGA 2K9QA 3E97A 4N4OB 2W24A 2DW4A 3M07A 4NB5A 5C44J 3JR9A 3L2WA 3NWSA 5DCMB 4JX5A 3ROUA 2IJLA 3LSIA 3QP6A 2OCEA 2RAEA 1I27A 2JT1A 1RRJA 1HKTA 2HU9A 1MIJA 2F5DA 1V5FA 3M1EA 1R5HA 4CYDA 1BN5A 3LAJA 5E1XA 3L1PA 1YTYA 2JN6A 3EYIA 2CUJA 2VQGA 3H3ZA 2P6TA 1XSDA 4HNTA 4XRSA 2R7OA 2K4JA 2LYCA 1NG7A 1Z77A 2F5EA 5BPIA 3LSMA 1BM9A 2K85A 5E1ZB 3SEQA 1KONA 3H5NA 4IOCF 2ZSIB 3LNQA 3TOAA 2ELJA 3MZHA 4L0ZB 2A68F 3RYPA 3MQ0A 3FK6A 2XRLA 1B9MA 1OFCX 1SVOA 3SXYA 4OMYA 1UMQA 4MFEA 1BI0A 2X4HA 1FOYA 5IOZA 1KYWA 2CQKA 2JWTA 4XLAA 3K9TA 1ENHA 4R1HA 1ZGJA 5L3EA 2LD5A 3AL0C 5E3NA 3K4NA 3LA2A 3ABTA 2JSPA 2IAIA 1H9TA 4P9UA 4I09A 5A2QK 5CLSA 4V2GA 1UHSA 4OOIA 1JHHA 3JRBA 4FX4A 1STZA 3E7LA 1XX5A 3F0CA 3CCUI 2O8XA 3GF2A 2EFWA 3CC2I 3A03A 1XS9A 3CCMI 4HX8A 4NC6A 4M6YA 2PJPA 2RN7A 3HOTA 1T98A 1KQ9A 1KU3A 1VTNC 5E3MA 2FUG2 2PMUA 4LLGF 2V9KA 4BE2A 2MLKA 4HZFA 3H3UA 2Z33A 1D5YA 1K78A 1D0ZA 4U0YA 2UWMA 3OYKA 1XDSA 1ETQA 4YEJA 1RR7A 5JLWA 1IDZA 3W2WA 3HIFA 3ERED 3HUGA 4S0HB 2KHMA 4TV7A 1YQAA 1QHGA 2ZXHA 3QPLA 3CO6C 2E5NA 1P4AA 1SD4A 4Y33A 4HQEA 2M7BA 1WJDA 2DMUA 3W6VA 2KLOA 1KU7A 4E7HA 1ZK8A 2XGXA 3QPSA 2EQRA 4N9HA 1T33A 2VE8A 2E19A 2ZJ2A 3D5RC 3JRDA 2STTA 1DP3A 4Q48A 4CSWA 4CZCA 3IAM2 2F4OB 2VASA 3I71A 1AHDP 1W7PA 1FYMA 2VODA 2EBIA 2R5ZA 5DDGA 1APLC 4NNJA 5LRRA 1Y39A 1R36A 5E18F 1SVMA 5B66C 2RQQA 1P92A 1IXCA 3EUKL 4CHUA 1G2HA 3R60A 3FHZA 5J1YA 2DTRA 1RNLA 4OU0A 2D45A 2G7UA 2GA2A 1XN7A 2R7FA 1S3JA 2L9NA 1YIOA 1Y0UA 2LNBA 2XPVA 4XRSG 4XQFA 1W7PD 2BE5F 4O3MA 2P6SA 4A3CJ 3H9GA 1FP1D 3LAPA 1T95A 2DA3A 3O2PE 3CF5F 2K7LA 1WWXA 4KN7X 2EFOA 2ZMEA 1IN4A 1B1BA 3HC7A 4A0XA 1XG1A 2RREA 3AG1H 3SHFA 5DM7F 2DDBA 5IP9J 5E3OA 1PP7U 3GVAA 3A01A 1I3AA 4IX7A 1XPXA 1DUXC 4HNUA 1Z3YA 1TT5B 3C2HA 3C1DA 5TISC 2JJ7A 3EUAA 2IS4A 5TJJA 5K1YA 4I7HA 1ULYA 3OYCA 2X6WA 3E5UA 1JT0A 4UVAA 3FDYA 3G73A 4B48A 2FBHA 2PEXA 3RKWA 2L9SA 3RQIA 3L2VA 4ZC3A 4EJUA 5C4XJ 1VQOI 2MYSA 5K5QA 1IG7A 2HYJA 5CVUA 1LUJB 1QZEA 3LOCA 2DT5A 2Q0OA 3HKZA 3LA7A 1MSEC 3KLNA 4ZYGA 1K61A 4DZJA 3WHCA 1SFXA 4ZYDA 2EPFA 1BA5A 4MGRA 4UB8C 1R23A 4HG2A 1S9HA 2QENA 4PGGA 1QA6A 1GVJA 4P1WA 1FY7A 2Q2EB 1VQ8I 3WTUC 4L5JA 1YJNI 4QPOA 1F9NA 3OS1A 1YJ9I 2O03A 4XORA 2E34A 2L9RA 3LQRA 1VNDA 2WAQN 2HFHA 3KIOA 2DA1A 3S93A 2EV5A 4IKFA 3I4MJ 1W5CC 3BOQA 4HX7A 2VE9A 2VPRA 4U87A 1ZG1A 4FT8A 2CWEA 2JA2A 2IT0A 1E3HA 1SVLA 2F5VA 1RUNA 2ZNYA 2KDZA 2DODA 4A12A 4P5OA 3I64A 3DFGA 4L0YB 3NAUA 2ETHA 2VKVA 4XONA 4D7MA 1BOBA 3A0HC 2IA1A 2XPWA 3FXKA 1X2NA 5B1BH 2JA7J 1TW3A 3FBIB 2AXLA 1T56A 3B6AA 3ONQA 1OISA 3DWLE 3F6OA 4M3GA 1LFPA 2XAUA 3BG7A 5D5VB 1XCBA 1ZRCA 3PFIA 4M3FA 2CS3A 4IHWA 1OYIA 2A6TA 4FX0A 3CJQB 3KFWX 2RC4A 2ESNA 2XHKA 2KIUA 3K1NA 2XGDA 4ENMA 1YRNB 1KQ0A 2LP0A 3G3ZA 3PIOF 3CMAI 4I98B 5DUKA 3LA3A 3S3NA 3L2UA 2R7QA 2KL4A 2XDVA 5M5WJ 1FIPA 2M0CA 2RGVA 3IL2A 2Z2SB 1VQPI 2ZC2A 3JTHA 3OY9A 5D8KB 4DQ2A 2EINH 3VPRA 3PSFA 1BJZA 3HOVJ 2VT2A 1YITI 4BNCA 3BJ6A 5GAGJ 4OAZA 1D5VA 4BL0B 3PQJA 5ED4A 2CGPA 2ECBA 2ZB9A 3RZOJ 3BJOA 2CU7A 3E5QA 2CSOA 4C2UA 3B6CA 1HDPA 3IWFA 1VQKI 1A04A 3C2BA 5CQEA 2X1EA 5FGMA 4LB6B 2LDUA 3L2RA 4FE7A 2VT3A 4OMZA 1R6RA 1WSUA 1RI7A 4XOPA 3ZQIA 3IP4B 3ZN0A 4AC0A 2DPDA 4U7DA 2E2HJ 2WB1A 5B5EC 1G3TA 4IHYA 1IN8A 1S7OA 1CQTA 1UHMA 1ETXA 2GIZA 2XSJC 4KIBA 3ZMDA 3M1CA 5E8GA 3SQNA 3G4SI 1WJAA 4GYGA 4XBFA 2HPMA 1RKTA 2HYGD 3QPTA 5JHUA 5BMZA 5J40A 4KITB 2FNAA 2ESHA 3I4NJ 2JVHA 3JSOA 1W5TA 1P4WA 4BACA 1F4KA 4OIPF 2GZWA 3OYIA 2IGOA 4WF2A 5J8FA 2XB0X 5JHFA 2JSCA 2K9SA 3BZKA 3J81K 2R7RA 2Y75A 1LEBA 3HRUA 1T08B 3K10A 1U5TC 4RAZA 3CMYA 3HBLA 1IN7A 1SAUA 3R61A 3TBIA 1HBXG 3H5RA 2W25A 3W6JB 4AUXA 1OR7C 4HPQA 4N9IA 4IZZA 1GUUA 1IRFA 4XOTA 4AIDA 1LFBA 4A0ZA 2HOAA 4D7NA 4YG2F 4EVIA 1S7EA 3FXQA 3H9JA 3Q9SA 4G6QA 3GFLA 1Y1WJ 4I76A 5CVRA 1OQYA 2R7UA 3WTTC 5FJ8J 1V54H 3HRTA 4BUPA 3VWBA 2BY0A 2BYVE 2ELHA 2Z3YA 1EH7A 2MFZA 2LBFA 1MMNA 4FE4A 2NOGA 5KNLA 2KJBA 3HRSA 2BY2A 3S17J 1I39A 4A93J 5JR3A 4XLEA 1DGRM 4LITA 2XKOA 5FROA 4BY1J 3IHUA 3J7YJ 4I0AA 2Z5UA 4BQOA 3HSRA 3SFZA 1JUPA 2KQRA 1S7AA 2L7MP 3OYBA 2JA5J 1WZ2A 2QBYB 1RR8C 3LSRA 1ERDA 1YJWI 4R79A 3QPHA 1X1PA 1J75A 2EZHA 5E8IA 1P4XA 4LLLA 3RIRA 3GX4X 5K7HA 3S1QJ 5TGTA 5E17F 2FA5A 3KP4A 4HX4A 4XK4A 1YS6A 3CLQA 1TQMA 2KISA 2R7ZJ 1MMAA 3CUQA 3OYLA 2VPLA 1S72I 2L01A 1OJLA 4MTEA 4IQJA 1YX5A 1JXSA 1FT9A 2V1XA 4LOCA 1JUSA 4FQGA 1IZ1A 3DEUA 3GW2A 2DT7B 3WU2C 3BTCA 1IF1A 5F1RA 1KGSA 3M8FA 2WY7Q 2EIJH 1MGTA 1MKMA 4LG3A 1IGNA 2DPUA 2FE3A 3BG3A 3OWTA 2LY1A 1YI2I 3CJRB 4RDUA 5CVJA 3FZVA 1HXDA 3E6MA 4BKXA 2RQPA 3TGNA 2HTSA 1WJCA 4ON0A 2VN2A 3O3KA 5HS8A 2AS5F 4BJ6C 4MNUA 2L3DA 2XIGA 2YS9A 4DNCA 2DFIA 4XSXF 3JCUC 2QLZA 5FLXK 4EM2A 3J80Z 3MKLA 5EEHA 2KKOA 1IW7F 4BDYA 2LC2A 1D1CA 2PMHA 1FBQA 3AG2H 3VDXA 3RSNA 5JI6A 1XSXA 2AQEA 2VC0A 3FKJA 5LGUA 5IY5H 4HDUA 3AG3H 2EFQA 3HJEA 3PL8A 2OTJI 3SDGA 1MNEA 1EV7A 4IHSA 2HQNA 3W3CA 3KEOA 1TWFJ 1X3WB 2OJED 3GUDA 2P7VB 1YG2A 1QO0D 2I10A 2HDWA 2PMZA 3QP5A 1YOVB 2GBYA 1D0YA 5KHDA 2YX4A 3GZNB 5GTHC 4CXFA 3VFZA 3FXOA 4Z6YA 2OQRA 4RGXA 1LPQA 2COBA 1O57A 1BR1A 2B7EA 3Q5FA 2OPTA 1TZLA 2JTVA 2DU9A 2NS0A 3CC7I 3FM3A 3OSFA 4KDPA 3GTMJ 4S04A 5IT9K 1J7KA 2LRDA 4UV8A 4N4NB 3EPZA 3H1CA 5AIQA 5LBQA 2XC7A 4KN4X 2NNNA 1A6IA 2HVQA 1D3YA 3HDDA 2BHYA 2V7FA 1X58A 5K7ZA 2W82A 5E79C 2DK5A 5HS9A 4UVCA 1JJ6C 3FXLA 4I01A 1X3UA 3ZQCA 1MW7A 1JGGA 4RGSA 3WGIA 4KISA 3TEDA 2ELKA 5E20A 4HQMA 1ZG5A 4XN3A 2YSRA 1HF0A 5IOYA 4Z2YA 3G6EI 2BHZA 2O8KA 1WCMJ 2F4IA 2HGCA 2CMPA 1T6SA 3WHBA 1WH7A 3N4MA 2HDDA 4CCMA 3GTQJ 3KYLA 4G7HF 2W1OA 4Y15A 4XKBA 2VUMJ 1WI9A 4PJ0C 2IVMA 1A5JA 5D5XB 5DS9A 3M3YJ 1R71A 2V79A 3P5JA 4GCVA 1Y0NA 4BEHA 2LVSA 3DQVC 1IV8A 4BXUA 3H36A 2E1NA 2W4SA 2W7NA 3DU6A 2ZJPF 4XRFA 3VOEA 1TT0A 2KRFA 3G71I 3WTVC 4BXXJ 4C3HJ 4I6ZA 1UG0A 2NVUB 4RA2A 2WA0A 2L5QA 1VI0A 4RMNA 4CCNA 1BW5A 2JA6J 2Y9YA 1LDJA 4X0GA 4JX4A 3TW6A 2IBDA 5JFRA 4UY8I 3QOPA 4BHCA 2GXGA 2CQNA 3CC4I 2MA3A 1MDMA 2R7VA 1FWZA 2EJRA 2WWYA 2Q1ZB 5GPCA 2ZJQF 1MD0A 4G8XA 4EJTA 1ZG3A 1G6NA 3ZMUA 1JHFA 1FIAA 1VQ9I 2PLYA 3WTXC 2VJ4A 2E60A 3HUGB 3J7AY 1HQCA 5L3DA 2J5PA 4HBLA 2FMYA 4GGGA 2BBYA 3L2CA 1LFUP 2P5VA 1QQIA 3NWTA 5F27A 3S3OA 3IWZA 4E7ZA 4ZYHA 3WTWC 2ME6A 4GO1A 5J4YA 3DPLC 2K40A 2XF6A 3OOUA 2CO5A 4RB3C 4A3LJ 1IUFA 1HKQA 1I50J 4YFKF 3HM5A 3H9QA 1R5GA 3CCLI 1D0XA 3QWLA 2JRTA 2LMDA 4CCJA 1TP4A 3WGGA 5FLXZ 1TNTA 4M3DA 1X4OA 2VBZA 3S2HJ 1OCPA 5FFXA 2MLGA 2X9DA 4O5VA 2UZKA 1X1AA 2XUBA 5F64A 1QBJA 5M5XJ 1H0MA 4RB0A 2X1CA 2MH9A 2G7HA 3ZMVA 3LFKA 1W0TA 4M73A 3HKZN 4B44A 2FSWA 4CUGA 2H1KA 5H6QA 2WAEA 1TLHB 3VYRB 3ZRGA 1Z6TA 3I59B 5FB2A 2HNHA 1TQIA 2W57A 1ZLKA 3E0JB 1IRZA 3LWFA 1W5SA 2V6CA 4XSZF 1Z7LA 1G4DA 2PX9A 3FXUA 3CCQI 1IN5A 1YHQI 2K9LA 1VQ4I 1HA8A 3MEXA 2DA6A 4PDKA 4P96A 5F1JA 4AIJA 3G1OA 2R7WA 3W2AA 2L7ZA 1NH3A 5F0CA 1Z7UA 5CVVA 5JLXA 3KE2A 3TO9A 3K4JA 3H5AA 4AIKA 3PM1A 3HOYJ 4XR6A 1MNMC 1U0JA 1FJLA 5JVGF 4IHTA 3HB9A 4XM3A 3TP3A 2AXTC 1IDYA 3SZGA 1O3QA 3J7AO 3WU0A 1OKRA 3BQYA 1R00A 3I59A 4ZYEA 3S3MA 2MG4A 1TWGJ 2EZIA 3ZXSA 4FISA 1QPMA 1XGSA 4GXOA 4PFPA 3LFUA 4A3GJ 4DBRA 4DYQA 1D8JA 3CLOA 3GTPJ 5FKNA 1Z91A 1IXRC 3PNYA 4RM3A 1YW8A 1VQ5I 1F5TA 4U0VA 1J9IA 5ICFA 5D5WB 3PNTA 3BPVA 3ZGKA 3HEFA 3V8JA 3KYCB 4LK0F 4RLQA 1U9OA 4F91B 5JVTA 4BE0A 5FO5A 4IQ4A 2RKHA 3U9GA 2W85A 5H20A 1XGOA 5K5RA 2ZNZA 3E1SA 3CO7C 1AKHB 5EYRA 4B8XA 1G8XA 4M71A 2ECCA 1K4TA 2HQAA 5J4VA 5D6FA 4J00A 2FQ4A 4HA8A 3Q0WA 2EZLA 1OR7A 3HL2A 3IKTA 3FXMA 2L0KA 2IGKA 2LLKA 3QYFA 4IHVA 2XV4S 2BXYA 1SAXA 2VJIA 3FWEA 2WAFA 1SFOJ 4KUMA 2KMUA 2OUMA 3TL4X 1LDDA 2F6CA 4M9SA 1DGWY 3GLXA 3KPHA 1K6OA 2AHQA 2MD0A 1S8NA 2NS8A 5ICCA 4XRMA 4P9FA 1DPUA 3DKXA 3ELKA 4HDVA 1Z05A 1RETA 2NAZA 5K5OA 2K3PA 3FMRA 5C3EJ 4AWXB 3I54A 2LKXA 4ENNA 4HF0A 3BG6A 3PNVA 4BY7J 3D1NI 3B02A 1R1VA 2K5CA 2WAQA 2K9MA 4FASD 3ABLH 1W1WE 2BXZA 3TW7A 2D2WA 4UUSB 5FKKA 5BPDA 2V26A 1AOYA 3G1MA 4BS9A 2P0WA 4LIVA 4CO8A 3CQZJ 3FF5A 1OCOH 3M7GA 1TWCJ 1YX3A 1S29A 5DTDA 5HLGA 4C2TA 3QRFF 1WI3A 3PUFA 2FF4A 2JMWA 3GXOA 4XKWA 2NYXA 1XC5A 2XAFA 2IRFG 2E35A 3D5LA 3FK7A 4CCKA 4MO7A 3DCFA 2A69F 3FX3A 4Q47A 3ZCOA 1XMAA 2XASA 3Q0VA 1QRYA 4IEJA 2ZFWA 5EZGA 4CYCA 3NQOA 1R5ID 1USSA 3K2ZA 1G59A 2XVCA 2XB5A 5CJ9A 3ZQ7A 4LB5A 1SD7A 2H6BA 4OAYA 5HDNA 3I3LA 4QWQA 4CGZA 1QZZA 3EYYA 3F21A 4V2FA 2WV1A 5LHIA 2H09A 5A2QZ 5LD2C 4OWRB 1EKEA 2HQ5A 4L18B 3DLAA 1U78A 2QF7A 3BTLA 4S05A 1H8AC 4ASNA 3SDBA 3S14J 2ID6A 1X1BA 3SYTA 4EATA 1SEUA 3JSPA 1QU3A 2CQXA 4E7LA 2TDXA 1KA8A 2DA2A 2IPQX 5AIPA 5IYBJ 3DBHB 2LK2A 5HNHA 3ECOA 3VB2A 5EF6A 2HOSA 1UCRA 3GTOJ 3S16J 4YFNF 2M8GX 2VOOA 5IP7J 3OYEA 3O6BB 1E17A 4Q4ZF 1RUOA 2QSGX 4DW6A 4MLOA 4PGHA 4PUSA 1G3YA 4DIQA 4H4KC 4JBAA 3ABMH 2R7DA 1NG6A 1VQMI 1CF7B 3HYIA 4IXAA 5H2FC 1GV2A 4NC7A 2EV0A 1SD6A 1DDNA 2DYSH 1ZR4A 2FX0A 1EA3A 4O6JA 2KRCA 2O7OA 1PUEE 5F0FA 1YIJI 2DXIA 4A3IJ 2CW8A 4HAMA 1Q1HA 1T8IA 2L4AA 4B1RA 1MBJA 2ISYA 2UUZA 1GLNA 5J8CA 4YELA 2CUEA 3KP2A 1RKWA 3Q0UA 4IF4A 2ID3A 5FRMA 2KZVA 4D1QA 1K4SA 2NOJB 2R5YB 4EV0A 4HF1A 5BNGA 1WJBA 4AIHA 3BC8A 5F08A 5HDGA 3SZTA 2X6YA 2CH0A 2VI6A 3ZQHA 2XAHA 4AU7A 3A4CA 4IVNA 5GPAA 2IA0A 2M45A 2ME0A 2LY2A 2H27A 3C3WA 4JP0A 2WBMA 5HOOA 2Y0SN 1MH3A 1R4MB 4A3KJ 3EQLF 5FLVA 4GDFA 1B59A 1MMGA 3FM5A 1PP8F 2KIMA 4KJZA 5J6XA 4DGWB 4MHGA 2R5YA 4BHPA 2JZYA 4YIFA 1EF4A 4DYRA 2M9HA 2R4GA 5J47A 3FXRA 1NK2P 5FKOA 2XAQA 3I9V2 3KLOA 1U6GA 1ZN2A 3TOBA 1X2MA 4BXFA 4Y17A 4CCLA 2LREA 2HOTA 1XTAA 1QGPA 3OS2A 1TQPA 4G7OF 2E1CA 2FOKA 1G3WA 4G9YA 3Q9VA 1BI3A 2D1HA 2X48A 2E2JJ 1WVRA 2R7SA 1W4MA 4ZYAA 3TDZC 1YO5C 5EGOB 1TC3C 2KP6A 2HVRA 1MDMB 1H89C 4XN0A 4OINF 4ENJA 1YW7A 3K70D 2C6YA 2O3FA 4WXHA 2M87A 2OA4A 3PO2J 1CGPA 4RAGA 1SANA 1MZBA 4QTRA 2MW8A 2KPMA 4IO9F 4JYKA 1VQNI 2A6EF 1WPKA 4ZJZA 2W00A 1ETOA 4DJAA 1YE9A 2LH9A 5HVQC 1S5LC 4KT6A 1AA7A 1A35A 1R58A 2LR8A 3DEEA 2FQ3A 2LY9A 3AKZA 1FMVA 1I3QJ 3OIQA 4HW0A 3GLLA 4A6DA 1V4RA 2WV0A 1UZCA 5ICEA 2MC4A 2DFEA 1B72B 1DU6A 3K7AJ 5M3FJ 3S2DJ 2VJJA 3HSEA 1K78B 1LVAA 4NBQA 2DCEA 4HV6A 1HSTA 3O8GA 1ZR2A 3CCVI 1JKRC 2LOOA 3OYJA 5DV5A 4ESBA 3REOA 2FD5A 4BJTA 3IH2A 2E1MC 5HODA 1VQ7I 2ZKZA 3LSPA 1LEAA 2L02A 5LEJA 2KZGA 2CQQA 5DCFA 2B0LA 1UAAA 3LSHA 1MJ9A 2N8GA 4BYYA 2OC6A 1U5TA 1FZPB 5TRDA 1UFMA 2OF7A 2L4MA 1VF9A 2QWWA 1SMYF 2RV8A 4G94A 2LKPA 3ZMTA 3DPUA 3CUQB 2JK3A 2QVOA 1XMXA 2HXIA 3D0SA 3K69A 1P7IA 4ZZLA 1O7LA 2VLAA 2VXDA 5D6EA 5IPAA 1VQ6I 3CTAA 5CVIA 1T0FA 3BT9A 3IRRA 2V9PA 1XB4A 4KMUX 1GXQA 3K70C 1B9NA 2ISZA 4M72A 4UUTA 2RNJA 3BZCA 3QYEA 2R92J 4MIMA 3CCJI 2HVSA 1MBGA 2DMQA 3RKXA 4WK8F 2DJNA 3T8TA 1Y6IA 1GT0C 1P7JA 2H8WA 1WRJA 3ABUA 4HSTA 3HTUA 5IP6A 2IS2A 1Z21A 4FCYA 3QU3A 2QSFX 1Y8RB 1RESA 3P9KA 3M8JA 1MBHA 1TTYA 3HPGA 4WCGA 1BI1A 1W36D 4DYCA 1XGMA 2NVQJ 1BIBA 4E7SA 2BW3B 2VBYA 3S32A 4MEYF 2BY1A 5DCMA 3RDIA 1JKQC 5IYDJ 3JRIA 4M9ZA 4A6EA 4F52A 3GO5A 1ZGWA 1LE8B 1NHAA 2K27A 1R4NB 3BG9A 2NRAC 3U1KA 3JRCA 4IL6C 2QBYA 1I6HJ 3GWZA 4D5FA 3DBRB 3NEUA 1YFHA 3KX2A 4HV5A 2P5KA 2BV6A 3CMMA 2L2OA 4X1EA 1Z0XA 2FXAA 1XMKA 1ZH5A 1T0FC 5ICGA 1Z3XA 2V1UA 1FTZA 2M7AA 2JPBA 5B3SH 1FBSA 1N75A 2X0LA 5LGNA 4RB2C 2O0YA 2M2EA 1A31A 2KT0A 4FETA 3MKWB 4EJVA 1HSJA 3C2GA 3CJTB 1TWAJ 1VZ0A 3OIPA 1FLIA 1NK3P 2JQ7A 2VONA 2VBXA 2E1MB 5LHHA 3M4OJ 2QUFA 2ZBKA 2R3SA 4Q5SF 3GTLJ 1UG2A 2X51A 4LMYA 4BBRJ 1DP7P 1FTTA 3F23A 2M1BA 3FMQA 3GFJA 1ZYRF 3LSKA 3OL3A 3TO7A 2BY3A 1BI2A 2PQ8A 2AQFA 3CUQC 4UVBA 5E3LA 2A5YB 1R1UA 1R7JA 4Y7NJ 2X6OA 4RB1A 4B47A 4V19K 1OCZH 4ITVA 5J3LA 3HOUJ 1LB2A 2DDAA 3BR6A 4PFOA 2QQAA 3BR5A 2KIQA 5M3MJ 2A61A 1F1ZA 2LBFB 5LHGA 3BR2A 3F8BA 1IN6A 3HG9A 6PAXA 1HKSA 3ASOH 3W2VA 1SFKA 2EK5A 1IRGA 1E0EA 4ETSA 3ML6A 1PYVA 3OYNA 4HSRA 2E2IJ 4ZDOA 2RVCA 4PJNA 1QNTA 3BR0A 1I1SA 2IW5A 3WG9A 2JUCA 1YYVA 3OS0A 1JI8A 3HGGA 4LLNA 3OMYA 1PUFB 1FMWA 2E7XA 1DU0A 1WJEA 1TBXA 1BOAA 3KCCA 5GAEJ 2FOWA 2VXZA 1I1GA 4EEFG 1JKOC 5CQGA 1Z67A 3CCRI 4A5MA 1QZYA 1J0RA 3KP3A 2K4BA 3KZIC 1ZARA 2H1LA 2Y0MA 4BE1A 2BGCA 4D0PA 4OIOF 2COMA 5HS7A 4FTHA 1V3FA 1POGA 4KNYA 3RPQA 1ON2A 3WG7H 3T8RA 4B43A 3FISA 3E6DA 2XGEA 4UHTA 2EFPA 4Y52J 1IO2A 1QVUA 1XSVA 3K2AA 5L3GA 3RI4A 3O8HA 1WQ2A 3ASNH 2V4JC 3ERMA 4L9JA 5IT3A 1YW9A 1T38A 5H6RA 2M3AA 2XPUA 4ESFA 2E71A 1U8RA 3TMOA 2FEZA 2JVGA 3AFHA 4A3JJ 3OYFA 2L54A 1FX7A 3BP8A 4MQ9F 1L3LA 2RNGA 3ABKH 2STWA 3DTKA 2GOXB 2EWNA 2VQCA 4JK1X 4F92B 3PIPF 2P7CB 5LLQA 4IOAF 1HC8A 4QIWN 2MH2A 1WGXA 3HOZJ 4A0YA 3MWMA 2Z16A 1U5TB 4U0WA 2Y30A 4LJZF 2DMNA 2L7FP 1E3PA 2AO9A 2M0MA 3HGYA 5GAHJ 5BQTA 1BL0A 3V42A 3OSGA 1FBUA 1OYWA 2DYRH 4L5EA 2I8DA 3VEPA 4HLYA 2ZSHB 2GM4A 2FBKA 2YR2A 3A01B 4II3A 3LMMA 4UNOA 3LSGA 1LQ1A 3F72A 4PZJA 2QQ9A 2ZXIA 1QPIA 2QCOA 3BR1A 5F0HA 4ESJA 4ZH4F 1ONVA 1ON1A 4JOMA 1ORKA 3T0YA 2E5ZA 3CZ6A 4RAYA 5LGTA 2MGQA 5ILSA 4N0BA 1D1BA 2KIFA 4XKCA 1MMSA 2CV2A 1D1AA 1USTA 1OCTC 1WFXA 2J5OA 4BH9A 2MSYA 2GIVA 2NXNB 1REPC 1A6QA 2IA2A 4G7ZF 3VYSB 2HEOA 2HZTA 4M3EA 2BW3A 2FMLA 2DFHA 4K2EA 1PUFA 3OIOA 3BJAA 4C2MJ 3R0AA 2HZDA 5LRSA 1HOMA 1EH6A 1XDUA 2H6CA 3DP7A 3AAFA 2CG4A 3BWGA 1O3SA 4HEA2 1ETYA 2QM3A 1PVEA 2GAUA 2M4KA 2EIMH 2YX7A 3WE2A 1K6YA 1ZAOA 3A1YA 3GTGJ 3VODA
chains in the Genus database with same CATH topology
2HDCA 3F8NA 3T5XA 1BC8C 3I5UA 3GFMA 3T1BA 4KIFA 3C7JA 4G6DA 3ECHA 2CYYA 3JAMK 1KU2A 2Z99A 1MJBA 1SFEA 2BEOA 2K86A 4KYWA 2ZMEB 4YFXF 3V7CA 3RPUA 1XCVA 3ZP5A 1ZHFA 2XAJA 4WX9A 3F22A 2XKPA 3EETA 3R0JA 4AD9A 2HOEA 3KETA 1XGNA 2M8EA 1J59A 4P55A 1LDKB 5L3FA 5DYMA 3MAJA 5CYVA 4GYIA 3WU1B 3W6KB 4PCQA 1OMIA 3V7SA 2QYOA 2DK8A 1IAWA 4IRIA 3GEZA 2O6GE 4EJOA 4FHTA 4EGZA 1P6RA 1MJAA 2F5FA 3ULQB 3TDUC 5ERIA 1UHWA 1KU9A 3R6SA 3MFKA 1HW1A 1YS7A 2M30A 4L5IA 2H94A 2HR3A 4EQQA 3E5XA 2EV6A 2YU3A 4CICA 3WTYC 3NRVA 1S6LA 1J5YA 3E6BA 4KIGA 2DQLA 4NHJA 4UV9A 1FP2A 3L7WA 2GQQA 1OPCA 4EM0B 1BJAA 3BROA 1O7FA 3B73A 1I5ZA 4KFCA 5ILVA 2K02A 3COAC 3F3XA 1D8KA 1HW2A 3P9IA 4M6XA 3FMSA 4HYEA 4EGYA 1Z1DA 3TO6A 5DEQA 3TKYA 3WTZA 5AONA 5D5UB 3TQNA 2PBIA 4CDGA 2DBBA 1L0OC 4MTDA 5HLIA 4HOBA 1C0WA 1AWCA 3HOSA 5BS6A 3JAMZ 4L9TA 4M74A 2HYFA 2EFNA 3N97A 3IKVA 2CFXA 2UXNA 4I0BA 2XAGA 1KQ8A 3P9CA 3MZYA 3KZYA 5LEKA 2ZCWA 1JE8A 1BBYA 1ZGAA 1YLFA 1RZ4A 2QZ8A 1O3TA 3ZPLA 5FD5A 3F6VA 2P8TA 3WGHA 3BZ6A 2EB7A 3RTRA 4RGUA 2DI3A 4RS8A 1BIAA 4AVPA 1FSEA 3DV8A 4WXDA 4NQWA 2VC1A 3SZPA 3I53A 1SFUA 3KP7A 5IT9Z 2A3SA 4KT5C 2CW0F 2GWRA 2WC2A 1LJ9A 3F8FA 3U2RA 3V4GA 1Z6RA 4WXCA 3I0TA 4MEXF 2HTJA 2WTEA 3P7NA 3ISPA 5E1WA 4LFUA 3HRMA 2EA2A 4YIIA 2M5WA 3R4KA 3M8EA 4LG0B 3F8MA 3K1PA 3LQQA 3I58A 4BHBA 2HWVA 1FSHA 1ZREA 3E6CC 3K0LA 4H0EA 3L9FA 2LF8A 3J80K 3DXJF 1E2XA 4E70A 4HF2A 4OIQF 2YPRA 4LD5A 2DQRA 2E7WA 2HKOA 1ZLJA 5DD4A 3EDPA 1JGSA 3JTGA 3F8CA 2UXXA 4MQVA 3JW4A 3RYRA 4L9NA 2Z9OA 3MCZA 2FBIA 2Q2EA 3V8LA 2PN6A 2GXBA 3U1DA 2NNYA 2HQRA 2OAZA 3L09A 3WTSC 3QU6A 2DAOA 1H9GA 2FU4A 3CJNA 3PQKA 4CZZA 5FD6A 1TW2A 2DLLA 2MD5A 3C18A 5KK1A 5L3CA 3OOPA 1FOKA 4B09A 1R22A 4ZZDA 2F2EA 2GA1A 4KMFA 5ILUA 1XD7A 1IXSB 1R1TA 2Y48A 4I2OA 2RDPA 1ODDA 4OIRF 3K1MA 2OU2A 2Q8KA 4LG0A 2XROA 2OZUA 4BAYA 1B6AA 1T2KA 1BC7C 2VBWA 1CF7A 1W7PB 2G9WA 3J81Z 1GXPA 1FPQA 2DO7A 3OV8A 1K7AA 3KP6A 4QLCU 1P2FA 2F5CA 4HLXA 2OD5A 1U2WA 1HW5A 2KJCA 2P4WA 5FFZA 4IPAA 3QAHA 4IJAA 3ZMZA 1DPRA 3HTSB 5BOXA 4KA4A 3E3VA 5HDKA 1B4AA 3WODF 2HKXA 3ZMSA 2V1DA 3RKYA 1WKMA 3DKWA 2LF7A 1T39A 4EMSA 1U3EM 4XLNF 4L9VA 5DUIA 3CDHA 4EM1A 1G3SA 4KICA 2V9VA 3V7RA 2A6HF 3I4PA 3V8KA 3M9AA 3DPTA 1K79A 3RJPA 3KP5A 3GZ5A 5D4SA 4U7BA 4M9XA 1Z9CA 3CUOA 2O61A 3IC7A 1SMTA 2PG4A 1GHCA 1RIOH 1KYZA 3IRQA 2W84A 2XRNA 2P5LC 2D1VA 4LGWA 2ZO4A 4IRGA 3HHHA 3S2WA 1FNNA 2PI0A 1FYLA 1OYYA 3GYHX 3ZN1A 2LSOA 1O3RA 1FYKA 2OZ6A 2VOPA 5L3BA 3BDDA 3BY6A 5D8LB 2HS5A 3BPXA 2FNPA 5DD8A 1SD5A 3DF8A 4I02A 3H92A 5F6FA 4LK1F 3GFIA 4ENKA 2FRHA 1IUYA 3KZZA 3L00A 4Y13A 1ZRDA 4F7ZA 1TNSA 4UXNA 4BQAA 3HSFA 1UB9A 5HLHA 2MC3A 3WE3A 1ZRFA 5KVRA 2ADUA 4JQFA 4WWCA 2A07F 4RGRA 2IP2A 2ACJA 4U88A 4A5NA 4XLPF 1PDNC 2OBPA 4UUVA 2EA4A 3LSTA 3EUHA 2JPCA 2ZXJA 3GZ6A 3KEQA 5EEGA 4IRHA 2PFBA 5D4RA 1LNWA 1J2XA 4R8HA 4A2UA 3HHGA 1EH8A 4EJWA 1I6XA 1FC3A 2MBFA 2OQGA 2QQBA 3E97A 2W24A 2DW4A 4NB5A 5DCMB 3ROUA 2IJLA 3QP6A 1I27A 2JT1A 1HKTA 2F5DA 3M1EA 1R5HA 4CYDA 1BN5A 3LAJA 5E1XA 1YTYA 3EYIA 3H3ZA 1XSDA 2P6TA 2K4JA 2F5EA 5BPIA 1BM9A 5E1ZB 3TOAA 3MZHA 4L0ZB 2A68F 3RYPA 3MQ0A 1B9MA 3SXYA 4OMYA 1BI0A 2X4HA 1KYWA 2CQKA 3K9TA 4R1HA 1ZGJA 5L3EA 3LA2A 3ABTA 1H9TA 4P9UA 4I09A 5A2QK 5CLSA 4OOIA 1JHHA 4FX4A 1STZA 2EFWA 2O8XA 3GF2A 4HX8A 4M6YA 2PJPA 2RN7A 3HOTA 1T98A 1KQ9A 1KU3A 1VTNC 2PMUA 4LLGF 2MLKA 4HZFA 3H3UA 2Z33A 1K78A 4U0YA 2UWMA 1XDSA 3HIFA 3ERED 3HUGA 4TV7A 1YQAA 3CO6C 1P4AA 1SD4A 4HQEA 1KU7A 2XGXA 4N9HA 2VE8A 2ZJ2A 2STTA 4Q48A 3I71A 1W7PA 1FYMA 2VODA 5DDGA 5LRRA 1R36A 5E18F 1P92A 1IXCA 4CHUA 3R60A 3FHZA 2DTRA 1RNLA 4OU0A 2D45A 2G7UA 2GA2A 1XN7A 1S3JA 2R7FA 1YIOA 1Y0UA 2LNBA 1W7PD 2BE5F 4O3MA 2P6SA 1FP1D 3LAPA 3O2PE 2K7LA 1WWXA 4KN7X 2EFOA 2ZMEA 1IN4A 1B1BA 4A0XA 3SHFA 1PP7U 3GVAA 1DUXC 3C1DA 5TJJA 5K1YA 4I7HA 1ULYA 3E5UA 4UVAA 3G73A 2FBHA 2PEXA 3RKWA 4EJUA 5K5QA 5CVUA 2DT5A 2Q0OA 3LA7A 3KLNA 4ZYGA 1SFXA 4ZYDA 4MGRA 1R23A 2QENA 4PGGA 1GVJA 1FY7A 3WTUC 4L5JA 1F9NA 2O03A 3LQRA 2HFHA 2EV5A 3BOQA 2VE9A 4HX7A 1ZG1A 4FT8A 2CWEA 2IT0A 1RUNA 2ZNYA 4A12A 4P5OA 3I64A 3DFGA 4L0YB 2ETHA 2IA1A 1TW3A 2AXLA 3F6OA 5D5VB 1XCBA 1ZRCA 3PFIA 1OYIA 4FX0A 3KFWX 2RC4A 2ESNA 2XHKA 2KIUA 3K1NA 4ENMA 1KQ0A 3G3ZA 4I98B 5DUKA 3LA3A 2RGVA 3IL2A 3JTHA 5D8KB 4DQ2A 2VT2A 4BNCA 3BJ6A 1D5VA 3PQJA 5ED4A 2CGPA 3BJOA 3E5QA 2CSOA 3IWFA 1A04A 5FGMA 4LB6B 2LDUA 4OMZA 2VT3A 1WSUA 1RI7A 3ZN0A 2DPDA 4U7DA 1G3TA 1IN8A 1S7OA 1UHMA 4KIBA 3ZMDA 5E8GA 3SQNA 4GYGA 4XBFA 2HYGD 3QPTA 5JHUA 5BMZA 2FNAA 2ESHA 3JSOA 4OIPF 1W5TA 1P4WA 1F4KA 2GZWA 4WF2A 5J8FA 3J81K 2JSCA 2Y75A 1LEBA 3HRUA 1U5TC 4RAZA 1IN7A 1HBXG 3R61A 2W25A 3W6JB 4N9IA 1IRFA 4A0ZA 4YG2F 4EVIA 3FXQA 3Q9SA 4G6QA 3GFLA 5CVRA 3WTTC 3HRTA 2BYVE 2ELHA 2Z3YA 1EH7A 2KJBA 3HRSA 5JR3A 2XKOA 3IHUA 4I0AA 2Z5UA 3HSRA 3SFZA 1S7AA 2QBYB 4R79A 3QPHA 1J75A 5E8IA 1P4XA 4LLLA 3RIRA 3GX4X 5E17F 2FA5A 3KP4A 4HX4A 1YS6A 1TQMA 3CUQA 2L01A 4MTEA 1JXSA 1FT9A 2V1XA 1IZ1A 3DEUA 3GW2A 1IF1A 5F1RA 1KGSA 3M8FA 1MGTA 1MKMA 2DPUA 2FE3A 5CVJA 3FZVA 1HXDA 3E6MA 2RQPA 3TGNA 2HTSA 4ON0A 2VN2A 3O3KA 5HS8A 2AS5F 4MNUA 2L3DA 2XIGA 4DNCA 2DFIA 4XSXF 2QLZA 5FLXK 4EM2A 3J80Z 5EEHA 2KKOA 1IW7F 2PMHA 1FBQA 5JI6A 1XSXA 2VC0A 5LGUA 4HDUA 2EFQA 1EV7A 4IHSA 2HQNA 3KEOA 3GUDA 2P7VB 1YG2A 1QO0D 3QP5A 4CXFA 2YX4A 3VFZA 2OQRA 4RGXA 1O57A 3Q5FA 2JTVA 2DU9A 2NS0A 4KDPA 3FM3A 5IT9K 4S04A 1J7KA 4UV8A 5AIQA 5LBQA 4KN4X 2NNNA 1D3YA 5HS9A 2DK5A 4UVCA 4I01A 1X3UA 4RGSA 3WGIA 5E20A 4HQMA 1ZG5A 2YSRA 4Z2YA 2HGCA 1T6SA 3N4MA 4G7HF 4Y15A 1WI9A 2IVMA 5D5XB 2V79A 4GCVA 4BXUA 3DQVC 2E1NA 4XRFA 3VOEA 2KRFA 3WTVC 1LDJA 5JFRA 3QOPA 4BHCA 2GXGA 2MA3A 1MDMA 1FWZA 2EJRA 2WWYA 1MD0A 4G8XA 4EJTA 1ZG3A 1G6NA 3ZMUA 1JHFA 2PLYA 3WTXC 1HQCA 5L3DA 2J5PA 4HBLA 2FMYA 4GGGA 2BBYA 3L2CA 2P5VA 1QQIA 3IWZA 4ZYHA 3WTWC 4GO1A 3DPLC 4RB3C 2CO5A 1HKQA 4YFKF 1R5GA 2JRTA 3WGGA 5FLXZ 1TNTA 2VBZA 5FFXA 2MLGA 4O5VA 2UZKA 2XUBA 5F64A 1QBJA 1H0MA 4RB0A 2MH9A 2G7HA 3ZMVA 3LFKA 4M73A 2FSWA 5H6QA 1TLHB 1Z6TA 3I59B 5FB2A 1TQIA 2W57A 1ZLKA 3LWFA 1W5SA 2V6CA 4XSZF 1G4DA 3FXUA 1IN5A 3MEXA 4PDKA 4P96A 4AIJA 1Z7UA 5CVVA 3KE2A 3TO9A 4AIKA 4IHTA 1O3QA 3J7AO 3WU0A 1OKRA 4ZYEA 1R00A 3I59A 1QPMA 1XGSA 4GXOA 1D8JA 3CLOA 1Z91A 1IXRC 1YW8A 1F5TA 4U0VA 1J9IA 5ICFA 5D5WB 3BPVA 3V8JA 4LK0F 5JVTA 5FO5A 2RKHA 3U9GA 2W85A 5H20A 1XGOA 5K5RA 2ZNZA 3CO7C 4B8XA 4M71A 5D6FA 4HA8A 1OR7A 3IKTA 2XV4S 1SAXA 3FWEA 4KUMA 1LDDA 4M9SA 3GLXA 1K6OA 5ICCA 1S8NA 1DPUA 4P9FA 3ELKA 4HDVA 1Z05A 2NAZA 5K5OA 3FMRA 4AWXB 3I54A 4ENNA 4HF0A 3B02A 1R1VA 2D2WA 5BPDA 1AOYA 4CO8A 3FF5A 3M7GA 1S29A 5HLGA 3QRFF 2FF4A 3GXOA 2NYXA 2XAFA 2IRFG 3D5LA 4Q47A 2A69F 3FX3A 1XMAA 2XASA 2ZFWA 3NQOA 1USSA 3K2ZA 2XVCA 5CJ9A 3ZQ7A 4LB5A 1SD7A 2H6BA 5HDNA 4QWQA 4CGZA 1QZZA 3EYYA 3F21A 5LHIA 2H09A 5A2QZ 4L18B 1U78A 4S05A 4ASNA 3JSPA 2TDXA 1KA8A 2IPQX 5AIPA 3ECOA 3VB2A 1UCRA 4YFNF 2VOOA 3O6BB 1E17A 4Q4ZF 1RUOA 4PGHA 1G3YA 4JBAA 2R7DA 1CF7B 3HYIA 4IXAA 2EV0A 1SD6A 1DDNA 4O6JA 1PUEE 4HAMA 1Q1HA 2L4AA 2ISYA 5J8CA 3KP2A 4IF4A 4EV0A 4HF1A 4AIHA 5HDGA 3SZTA 2XAHA 4IVNA 2IA0A 2M45A 2H27A 3C3WA 5HOOA 3EQLF 1B59A 3FM5A 1PP8F 2KIMA 5J6XA 4MHGA 4BHPA 2JZYA 4YIFA 3FXRA 2XAQA 3KLOA 1U6GA 1ZN2A 3TOBA 4Y17A 1QGPA 1TQPA 4G7OF 2E1CA 2FOKA 1G3WA 4G9YA 3Q9VA 1BI3A 2D1HA 1W4MA 3TDZC 1YO5C 1MDMB 4OINF 4ENJA 1YW7A 2C6YA 2O3FA 4WXHA 2M87A 2OA4A 1CGPA 1MZBA 2A6EF 5HVQC 1R58A 2FQ3A 4HW0A 4A6DA 1V4RA 2WV0A 5ICEA 3HSEA 1K78B 1LVAA 4HV6A 1HSTA 5DV5A 4ESBA 3REOA 2ZKZA 1LEAA 2L02A 5LEJA 5DCFA 2B0LA 1MJ9A 4BYYA 1U5TA 1FZPB 5TRDA 1UFMA 2L4MA 2QWWA 1SMYF 2RV8A 4G94A 2LKPA 3ZMTA 3CUQB 2QVOA 3D0SA 3K69A 4ZZLA 1O7LA 5D6EA 3CTAA 5CVIA 1T0FA 3IRRA 4KMUX 1XB4A 1GXQA 1B9NA 2ISZA 4M72A 2RNJA 3RKXA 4WK8F 3T8TA 1WRJA 3ABUA 3HTUA 3QU3A 3P9KA 1TTYA 4WCGA 1BI1A 1XGMA 1BIBA 2VBYA 4MEYF 5DCMA 3RDIA 4M9ZA 4A6EA 3GO5A 2NRAC 1NHAA 2K27A 2QBYA 3GWZA 1YFHA 3NEUA 4HV5A 2P5KA 2BV6A 2FXAA 1XMKA 1ZH5A 5ICGA 2V1UA 2JPBA 1FBSA 2X0LA 5LGNA 4RB2C 2O0YA 4EJVA 1HSJA 1FLIA 2VONA 2VBXA 5LHHA 2QUFA 2ZBKA 2R3SA 4Q5SF 4LMYA 1DP7P 3F23A 2M1BA 3FMQA 3GFJA 1ZYRF 3TO7A 1BI2A 2PQ8A 3CUQC 4UVBA 2A5YB 1R1UA 1R7JA 4RB1A 1LB2A 2QQAA 2A61A 1F1ZA 5LHGA 3F8BA 1IN6A 6PAXA 1HKSA 1IRGA 2EK5A 4ETSA 3ML6A 2RVCA 1QNTA 1I1SA 2IW5A 3WG9A 1YYVA 4LLNA 2E7XA 1TBXA 1BOAA 3KCCA 2VXZA 1I1GA 4A5MA 1QZYA 1J0RA 3KP3A 2K4BA 1ZARA 2Y0MA 2BGCA 4D0PA 4OIOF 2COMA 5HS7A 1V3FA 4KNYA 3RPQA 1ON2A 3T8RA 3E6DA 4UHTA 2EFPA 1XSVA 5L3GA 3RI4A 1WQ2A 4L9JA 5IT3A 1T38A 1YW9A 5H6RA 4ESFA 1U8RA 2FEZA 2L54A 1FX7A 3BP8A 4MQ9F 1L3LA 2STWA 2EWNA 4JK1X 2P7CB 5LLQA 2MH2A 4A0YA 3MWMA 1U5TB 4U0WA 4LJZF 5BQTA 1FBUA 1OYWA 3VEPA 4HLYA 2FBKA 2YR2A 4UNOA 1LQ1A 3F72A 4PZJA 2QQ9A 4ESJA 4ZH4F 1ONVA 1ON1A 3T0YA 4RAYA 5LGTA 5ILSA 4N0BA 2KIFA 1USTA 2J5OA 4BH9A 2GIVA 1REPC 2IA2A 4G7ZF 2HEOA 2HZTA 2FMLA 4K2EA 3BJAA 3R0AA 5LRSA 1EH6A 1XDUA 2H6CA 3DP7A 3AAFA 2CG4A 3BWGA 1O3SA 2QM3A 2GAUA 2YX7A 3WE2A 1ZAOA 3VODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDC A;  3F8N A;  3T5X A;  1BC8 C;  3I5U A;  3GFM A;  3T1B A;  4KIF A;  3C7J A;  4G6D A;  3ECH A;  2CYY A;  3JAM K;  1KU2 A;  2Z99 A;  1MJB A;  1SFE A;  2BEO A;  2K86 A;  4KYW A;  2ZME B;  4YFX F;  3V7C A;  3RPU A;  1XCV A;  3ZP5 A;  1ZHF A;  2XAJ A;  4WX9 A;  3F22 A;  2XKP A;  3EET A;  3R0J A;  4AD9 A;  2HOE A;  3KET A;  1XGN A;  2M8E A;  1J59 A;  4P55 A;  1LDK B;  5L3F A;  5DYM A;  3MAJ A;  5CYV A;  4GYI A;  3WU1 B;  3W6K B;  4PCQ A;  1OMI A;  3V7S A;  2QYO A;  2DK8 A;  1IAW A;  4IRI A;  3GEZ A;  2O6G E;  4EJO A;  4FHT A;  4EGZ A;  1P6R A;  1MJA A;  2F5F A;  3ULQ B;  3TDU C;  5ERI A;  1UHW A;  1KU9 A;  3R6S A;  3MFK A;  1HW1 A;  1YS7 A;  2M30 A;  4L5I A;  2H94 A;  2HR3 A;  4EQQ A;  3E5X A;  2EV6 A;  2YU3 A;  4CIC A;  3WTY C;  3NRV A;  1S6L A;  1J5Y A;  3E6B A;  4KIG A;  2DQL A;  4NHJ A;  4UV9 A;  1FP2 A;  3L7W A;  2GQQ A;  1OPC A;  4EM0 B;  1BJA A;  3BRO A;  1O7F A;  3B73 A;  1I5Z A;  4KFC A;  5ILV A;  2K02 A;  3COA C;  3F3X A;  1D8K A;  1HW2 A;  3P9I A;  4M6X A;  3FMS A;  4HYE A;  4EGY A;  1Z1D A;  3TO6 A;  5DEQ A;  3TKY A;  3WTZ A;  5AON A;  5D5U B;  3TQN A;  2PBI A;  4CDG A;  2DBB A;  1L0O C;  4MTD A;  5HLI A;  4HOB A;  1C0W A;  1AWC A;  3HOS A;  5BS6 A;  3JAM Z;  4L9T A;  4M74 A;  2HYF A;  2EFN A;  3N97 A;  3IKV A;  2CFX A;  2UXN A;  4I0B A;  2XAG A;  1KQ8 A;  3P9C A;  3MZY A;  3KZY A;  5LEK A;  2ZCW A;  1JE8 A;  1BBY A;  1ZGA A;  1YLF A;  1RZ4 A;  2QZ8 A;  1O3T A;  3ZPL A;  5FD5 A;  3F6V A;  2P8T A;  3WGH A;  3BZ6 A;  2EB7 A;  3RTR A;  4RGU A;  2DI3 A;  4RS8 A;  1BIA A;  4AVP A;  1FSE A;  3DV8 A;  4WXD A;  4NQW A;  2VC1 A;  3SZP A;  3I53 A;  1SFU A;  3KP7 A;  5IT9 Z;  2A3S A;  4KT5 C;  2CW0 F;  2GWR A;  2WC2 A;  1LJ9 A;  3F8F A;  3U2R A;  3V4G A;  1Z6R A;  4WXC A;  3I0T A;  4MEX F;  2HTJ A;  2WTE A;  3P7N A;  3ISP A;  5E1W A;  4LFU A;  3HRM A;  2EA2 A;  4YII A;  2M5W A;  3R4K A;  3M8E A;  4LG0 B;  3F8M A;  3K1P A;  3LQQ A;  3I58 A;  4BHB A;  2HWV A;  1FSH A;  1ZRE A;  3E6C C;  3K0L A;  4H0E A;  3L9F A;  2LF8 A;  3J80 K;  3DXJ F;  1E2X A;  4E70 A;  4HF2 A;  4OIQ F;  2YPR A;  4LD5 A;  2DQR A;  2E7W A;  2HKO A;  1ZLJ A;  5DD4 A;  3EDP A;  1JGS A;  3JTG A;  3F8C A;  2UXX A;  4MQV A;  3JW4 A;  3RYR A;  4L9N A;  2Z9O A;  3MCZ A;  2FBI A;  2Q2E A;  3V8L A;  2PN6 A;  2GXB A;  3U1D A;  2NNY A;  2HQR A;  2OAZ A;  3L09 A;  3WTS C;  3QU6 A;  2DAO A;  1H9G A;  2FU4 A;  3CJN A;  3PQK A;  4CZZ A;  5FD6 A;  1TW2 A;  2DLL A;  2MD5 A;  3C18 A;  5KK1 A;  5L3C A;  3OOP A;  1FOK A;  4B09 A;  1R22 A;  4ZZD A;  2F2E A;  2GA1 A;  4KMF A;  5ILU A;  1XD7 A;  1IXS B;  1R1T A;  2Y48 A;  4I2O A;  2RDP A;  1ODD A;  4OIR F;  3K1M A;  2OU2 A;  2Q8K A;  4LG0 A;  2XRO A;  2OZU A;  4BAY A;  1B6A A;  1T2K A;  1BC7 C;  2VBW A;  1CF7 A;  1W7P B;  2G9W A;  3J81 Z;  1GXP A;  1FPQ A;  2DO7 A;  3OV8 A;  1K7A A;  3KP6 A;  4QLC U;  1P2F A;  2F5C A;  4HLX A;  2OD5 A;  1U2W A;  1HW5 A;  2KJC A;  2P4W A;  5FFZ A;  4IPA A;  3QAH A;  4IJA A;  3ZMZ A;  1DPR A;  3HTS B;  5BOX A;  4KA4 A;  3E3V A;  5HDK A;  1B4A A;  3WOD F;  2HKX A;  3ZMS A;  2V1D A;  3RKY A;  1WKM A;  3DKW A;  2LF7 A;  1T39 A;  4EMS A;  1U3E M;  4XLN F;  4L9V A;  5DUI A;  3CDH A;  4EM1 A;  1G3S A;  4KIC A;  2V9V A;  3V7R A;  2A6H F;  3I4P A;  3V8K A;  3M9A A;  3DPT A;  1K79 A;  3RJP A;  3KP5 A;  3GZ5 A;  5D4S A;  4U7B A;  4M9X A;  1Z9C A;  3CUO A;  2O61 A;  3IC7 A;  1SMT A;  2PG4 A;  1GHC A;  1RIO H;  1KYZ A;  3IRQ A;  2W84 A;  2XRN A;  2P5L C;  2D1V A;  4LGW A;  2ZO4 A;  4IRG A;  3HHH A;  3S2W A;  1FNN A;  2PI0 A;  1FYL A;  1OYY A;  3GYH X;  3ZN1 A;  2LSO A;  1O3R A;  1FYK A;  2OZ6 A;  2VOP A;  5L3B A;  3BDD A;  3BY6 A;  5D8L B;  2HS5 A;  3BPX A;  2FNP A;  5DD8 A;  1SD5 A;  3DF8 A;  4I02 A;  3H92 A;  5F6F A;  4LK1 F;  3GFI A;  4ENK A;  2FRH A;  1IUY A;  3KZZ A;  3L00 A;  4Y13 A;  1ZRD A;  4F7Z A;  1TNS A;  4UXN A;  4BQA A;  3HSF A;  1UB9 A;  5HLH A;  2MC3 A;  3WE3 A;  1ZRF A;  5KVR A;  2ADU A;  4JQF A;  4WWC A;  2A07 F;  4RGR A;  2IP2 A;  2ACJ A;  4U88 A;  4A5N A;  4XLP F;  1PDN C;  2OBP A;  4UUV A;  2EA4 A;  3LST A;  3EUH A;  2JPC A;  2ZXJ A;  3GZ6 A;  3KEQ A;  5EEG A;  4IRH A;  2PFB A;  5D4R A;  1LNW A;  1J2X A;  4R8H A;  4A2U A;  3HHG A;  1EH8 A;  4EJW A;  1I6X A;  1FC3 A;  2MBF A;  2OQG A;  2QQB A;  3E97 A;  2W24 A;  2DW4 A;  4NB5 A;  5DCM B;  3ROU A;  2IJL A;  3QP6 A;  1I27 A;  2JT1 A;  1HKT A;  2F5D A;  3M1E A;  1R5H A;  4CYD A;  1BN5 A;  3LAJ A;  5E1X A;  1YTY A;  3EYI A;  3H3Z A;  1XSD A;  2P6T A;  2K4J A;  2F5E A;  5BPI A;  1BM9 A;  5E1Z B;  3TOA A;  3MZH A;  4L0Z B;  2A68 F;  3RYP A;  3MQ0 A;  1B9M A;  3SXY A;  4OMY A;  1BI0 A;  2X4H A;  1KYW A;  2CQK A;  3K9T A;  4R1H A;  1ZGJ A;  5L3E A;  3LA2 A;  3ABT A;  1H9T A;  4P9U A;  4I09 A;  5A2Q K;  5CLS A;  4OOI A;  1JHH A;  4FX4 A;  1STZ A;  2EFW A;  2O8X A;  3GF2 A;  4HX8 A;  4M6Y A;  2PJP A;  2RN7 A;  3HOT A;  1T98 A;  1KQ9 A;  1KU3 A;  1VTN C;  2PMU A;  4LLG F;  2MLK A;  4HZF A;  3H3U A;  2Z33 A;  1K78 A;  4U0Y A;  2UWM A;  1XDS A;  3HIF A;  3ERE D;  3HUG A;  4TV7 A;  1YQA A;  3CO6 C;  1P4A A;  1SD4 A;  4HQE A;  1KU7 A;  2XGX A;  4N9H A;  2VE8 A;  2ZJ2 A;  2STT A;  4Q48 A;  3I71 A;  1W7P A;  1FYM A;  2VOD A;  5DDG A;  5LRR A;  1R36 A;  5E18 F;  1P92 A;  1IXC A;  4CHU A;  3R60 A;  3FHZ A;  2DTR A;  1RNL A;  4OU0 A;  2D45 A;  2G7U A;  2GA2 A;  1XN7 A;  1S3J A;  2R7F A;  1YIO A;  1Y0U A;  2LNB A;  1W7P D;  2BE5 F;  4O3M A;  2P6S A;  1FP1 D;  3LAP A;  3O2P E;  2K7L A;  1WWX A;  4KN7 X;  2EFO A;  2ZME A;  1IN4 A;  1B1B A;  4A0X A;  3SHF A;  1PP7 U;  3GVA A;  1DUX C;  3C1D A;  5TJJ A;  5K1Y A;  4I7H A;  1ULY A;  3E5U A;  4UVA A;  3G73 A;  2FBH A;  2PEX A;  3RKW A;  4EJU A;  5K5Q A;  5CVU A;  2DT5 A;  2Q0O A;  3LA7 A;  3KLN A;  4ZYG A;  1SFX A;  4ZYD A;  4MGR A;  1R23 A;  2QEN A;  4PGG A;  1GVJ A;  1FY7 A;  3WTU C;  4L5J A;  1F9N A;  2O03 A;  3LQR A;  2HFH A;  2EV5 A;  3BOQ A;  2VE9 A;  4HX7 A;  1ZG1 A;  4FT8 A;  2CWE A;  2IT0 A;  1RUN A;  2ZNY A;  4A12 A;  4P5O A;  3I64 A;  3DFG A;  4L0Y B;  2ETH A;  2IA1 A;  1TW3 A;  2AXL A;  3F6O A;  5D5V B;  1XCB A;  1ZRC A;  3PFI A;  1OYI A;  4FX0 A;  3KFW X;  2RC4 A;  2ESN A;  2XHK A;  2KIU A;  3K1N A;  4ENM A;  1KQ0 A;  3G3Z A;  4I98 B;  5DUK A;  3LA3 A;  2RGV A;  3IL2 A;  3JTH A;  5D8K B;  4DQ2 A;  2VT2 A;  4BNC A;  3BJ6 A;  1D5V A;  3PQJ A;  5ED4 A;  2CGP A;  3BJO A;  3E5Q A;  2CSO A;  3IWF A;  1A04 A;  5FGM A;  4LB6 B;  2LDU A;  4OMZ A;  2VT3 A;  1WSU A;  1RI7 A;  3ZN0 A;  2DPD A;  4U7D A;  1G3T A;  1IN8 A;  1S7O A;  1UHM A;  4KIB A;  3ZMD A;  5E8G A;  3SQN A;  4GYG A;  4XBF A;  2HYG D;  3QPT A;  5JHU A;  5BMZ A;  2FNA A;  2ESH A;  3JSO A;  4OIP F;  1W5T A;  1P4W A;  1F4K A;  2GZW A;  4WF2 A;  5J8F A;  3J81 K;  2JSC A;  2Y75 A;  1LEB A;  3HRU A;  1U5T C;  4RAZ A;  1IN7 A;  1HBX G;  3R61 A;  2W25 A;  3W6J B;  4N9I A;  1IRF A;  4A0Z A;  4YG2 F;  4EVI A;  3FXQ A;  3Q9S A;  4G6Q A;  3GFL A;  5CVR A;  3WTT C;  3HRT A;  2BYV E;  2ELH A;  2Z3Y A;  1EH7 A;  2KJB A;  3HRS A;  5JR3 A;  2XKO A;  3IHU A;  4I0A A;  2Z5U A;  3HSR A;  3SFZ A;  1S7A A;  2QBY B;  4R79 A;  3QPH A;  1J75 A;  5E8I A;  1P4X A;  4LLL A;  3RIR A;  3GX4 X;  5E17 F;  2FA5 A;  3KP4 A;  4HX4 A;  1YS6 A;  1TQM A;  3CUQ A;  2L01 A;  4MTE A;  1JXS A;  1FT9 A;  2V1X A;  1IZ1 A;  3DEU A;  3GW2 A;  1IF1 A;  5F1R A;  1KGS A;  3M8F A;  1MGT A;  1MKM A;  2DPU A;  2FE3 A;  5CVJ A;  3FZV A;  1HXD A;  3E6M A;  2RQP A;  3TGN A;  2HTS A;  4ON0 A;  2VN2 A;  3O3K A;  5HS8 A;  2AS5 F;  4MNU A;  2L3D A;  2XIG A;  4DNC A;  2DFI A;  4XSX F;  2QLZ A;  5FLX K;  4EM2 A;  3J80 Z;  5EEH A;  2KKO A;  1IW7 F;  2PMH A;  1FBQ A;  5JI6 A;  1XSX A;  2VC0 A;  5LGU A;  4HDU A;  2EFQ A;  1EV7 A;  4IHS A;  2HQN A;  3KEO A;  3GUD A;  2P7V B;  1YG2 A;  1QO0 D;  3QP5 A;  4CXF A;  2YX4 A;  3VFZ A;  2OQR A;  4RGX A;  1O57 A;  3Q5F A;  2JTV A;  2DU9 A;  2NS0 A;  4KDP A;  3FM3 A;  5IT9 K;  4S04 A;  1J7K A;  4UV8 A;  5AIQ A;  5LBQ A;  4KN4 X;  2NNN A;  1D3Y A;  5HS9 A;  2DK5 A;  4UVC A;  4I01 A;  1X3U A;  4RGS A;  3WGI A;  5E20 A;  4HQM A;  1ZG5 A;  2YSR A;  4Z2Y A;  2HGC A;  1T6S A;  3N4M A;  4G7H F;  4Y15 A;  1WI9 A;  2IVM A;  5D5X B;  2V79 A;  4GCV A;  4BXU A;  3DQV C;  2E1N A;  4XRF A;  3VOE A;  2KRF A;  3WTV C;  1LDJ A;  5JFR A;  3QOP A;  4BHC A;  2GXG A;  2MA3 A;  1MDM A;  1FWZ A;  2EJR A;  2WWY A;  1MD0 A;  4G8X A;  4EJT A;  1ZG3 A;  1G6N A;  3ZMU A;  1JHF A;  2PLY A;  3WTX C;  1HQC A;  5L3D A;  2J5P A;  4HBL A;  2FMY A;  4GGG A;  2BBY A;  3L2C A;  2P5V A;  1QQI A;  3IWZ A;  4ZYH A;  3WTW C;  4GO1 A;  3DPL C;  4RB3 C;  2CO5 A;  1HKQ A;  4YFK F;  1R5G A;  2JRT A;  3WGG A;  5FLX Z;  1TNT A;  2VBZ A;  5FFX A;  2MLG A;  4O5V A;  2UZK A;  2XUB A;  5F64 A;  1QBJ A;  1H0M A;  4RB0 A;  2MH9 A;  2G7H A;  3ZMV A;  3LFK A;  4M73 A;  2FSW A;  5H6Q A;  1TLH B;  1Z6T A;  3I59 B;  5FB2 A;  1TQI A;  2W57 A;  1ZLK A;  3LWF A;  1W5S A;  2V6C A;  4XSZ F;  1G4D A;  3FXU A;  1IN5 A;  3MEX A;  4PDK A;  4P96 A;  4AIJ A;  1Z7U A;  5CVV A;  3KE2 A;  3TO9 A;  4AIK A;  4IHT A;  1O3Q A;  3J7A O;  3WU0 A;  1OKR A;  4ZYE A;  1R00 A;  3I59 A;  1QPM A;  1XGS A;  4GXO A;  1D8J A;  3CLO A;  1Z91 A;  1IXR C;  1YW8 A;  1F5T A;  4U0V A;  1J9I A;  5ICF A;  5D5W B;  3BPV A;  3V8J A;  4LK0 F;  5JVT A;  5FO5 A;  2RKH A;  3U9G A;  2W85 A;  5H20 A;  1XGO A;  5K5R A;  2ZNZ A;  3CO7 C;  4B8X A;  4M71 A;  5D6F A;  4HA8 A;  1OR7 A;  3IKT A;  2XV4 S;  1SAX A;  3FWE A;  4KUM A;  1LDD A;  4M9S A;  3GLX A;  1K6O A;  5ICC A;  1S8N A;  1DPU A;  4P9F A;  3ELK A;  4HDV A;  1Z05 A;  2NAZ A;  5K5O A;  3FMR A;  4AWX B;  3I54 A;  4ENN A;  4HF0 A;  3B02 A;  1R1V A;  2D2W A;  5BPD A;  1AOY A;  4CO8 A;  3FF5 A;  3M7G A;  1S29 A;  5HLG A;  3QRF F;  2FF4 A;  3GXO A;  2NYX A;  2XAF A;  2IRF G;  3D5L A;  4Q47 A;  2A69 F;  3FX3 A;  1XMA A;  2XAS A;  2ZFW A;  3NQO A;  1USS A;  3K2Z A;  2XVC A;  5CJ9 A;  3ZQ7 A;  4LB5 A;  1SD7 A;  2H6B A;  5HDN A;  4QWQ A;  4CGZ A;  1QZZ A;  3EYY A;  3F21 A;  5LHI A;  2H09 A;  5A2Q Z;  4L18 B;  1U78 A;  4S05 A;  4ASN A;  3JSP A;  2TDX A;  1KA8 A;  2IPQ X;  5AIP A;  3ECO A;  3VB2 A;  1UCR A;  4YFN F;  2VOO A;  3O6B B;  1E17 A;  4Q4Z F;  1RUO A;  4PGH A;  1G3Y A;  4JBA A;  2R7D A;  1CF7 B;  3HYI A;  4IXA A;  2EV0 A;  1SD6 A;  1DDN A;  4O6J A;  1PUE E;  4HAM A;  1Q1H A;  2L4A A;  2ISY A;  5J8C A;  3KP2 A;  4IF4 A;  4EV0 A;  4HF1 A;  4AIH A;  5HDG A;  3SZT A;  2XAH A;  4IVN A;  2IA0 A;  2M45 A;  2H27 A;  3C3W A;  5HOO A;  3EQL F;  1B59 A;  3FM5 A;  1PP8 F;  2KIM A;  5J6X A;  4MHG A;  4BHP A;  2JZY A;  4YIF A;  3FXR A;  2XAQ A;  3KLO A;  1U6G A;  1ZN2 A;  3TOB A;  4Y17 A;  1QGP A;  1TQP A;  4G7O F;  2E1C A;  2FOK A;  1G3W A;  4G9Y A;  3Q9V A;  1BI3 A;  2D1H A;  1W4M A;  3TDZ C;  1YO5 C;  1MDM B;  4OIN F;  4ENJ A;  1YW7 A;  2C6Y A;  2O3F A;  4WXH A;  2M87 A;  2OA4 A;  1CGP A;  1MZB A;  2A6E F;  5HVQ C;  1R58 A;  2FQ3 A;  4HW0 A;  4A6D A;  1V4R A;  2WV0 A;  5ICE A;  3HSE A;  1K78 B;  1LVA A;  4HV6 A;  1HST A;  5DV5 A;  4ESB A;  3REO A;  2ZKZ A;  1LEA A;  2L02 A;  5LEJ A;  5DCF A;  2B0L A;  1MJ9 A;  4BYY A;  1U5T A;  1FZP B;  5TRD A;  1UFM A;  2L4M A;  2QWW A;  1SMY F;  2RV8 A;  4G94 A;  2LKP A;  3ZMT A;  3CUQ B;  2QVO A;  3D0S A;  3K69 A;  4ZZL A;  1O7L A;  5D6E A;  3CTA A;  5CVI A;  1T0F A;  3IRR A;  4KMU X;  1XB4 A;  1GXQ A;  1B9N A;  2ISZ A;  4M72 A;  2RNJ A;  3RKX A;  4WK8 F;  3T8T A;  1WRJ A;  3ABU A;  3HTU A;  3QU3 A;  3P9K A;  1TTY A;  4WCG A;  1BI1 A;  1XGM A;  1BIB A;  2VBY A;  4MEY F;  5DCM A;  3RDI A;  4M9Z A;  4A6E A;  3GO5 A;  2NRA C;  1NHA A;  2K27 A;  2QBY A;  3GWZ A;  1YFH A;  3NEU A;  4HV5 A;  2P5K A;  2BV6 A;  2FXA A;  1XMK A;  1ZH5 A;  5ICG A;  2V1U A;  2JPB A;  1FBS A;  2X0L A;  5LGN A;  4RB2 C;  2O0Y A;  4EJV A;  1HSJ A;  1FLI A;  2VON A;  2VBX A;  5LHH A;  2QUF A;  2ZBK A;  2R3S A;  4Q5S F;  4LMY A;  1DP7 P;  3F23 A;  2M1B A;  3FMQ A;  3GFJ A;  1ZYR F;  3TO7 A;  1BI2 A;  2PQ8 A;  3CUQ C;  4UVB A;  2A5Y B;  1R1U A;  1R7J A;  4RB1 A;  1LB2 A;  2QQA A;  2A61 A;  1F1Z A;  5LHG A;  3F8B A;  1IN6 A;  6PAX A;  1HKS A;  1IRG A;  2EK5 A;  4ETS A;  3ML6 A;  2RVC A;  1QNT A;  1I1S A;  2IW5 A;  3WG9 A;  1YYV A;  4LLN A;  2E7X A;  1TBX A;  1BOA A;  3KCC A;  2VXZ A;  1I1G A;  4A5M A;  1QZY A;  1J0R A;  3KP3 A;  2K4B A;  1ZAR A;  2Y0M A;  2BGC A;  4D0P A;  4OIO F;  2COM A;  5HS7 A;  1V3F A;  4KNY A;  3RPQ A;  1ON2 A;  3T8R A;  3E6D A;  4UHT A;  2EFP A;  1XSV A;  5L3G A;  3RI4 A;  1WQ2 A;  4L9J A;  5IT3 A;  1T38 A;  1YW9 A;  5H6R A;  4ESF A;  1U8R A;  2FEZ A;  2L54 A;  1FX7 A;  3BP8 A;  4MQ9 F;  1L3L A;  2STW A;  2EWN A;  4JK1 X;  2P7C B;  5LLQ A;  2MH2 A;  4A0Y A;  3MWM A;  1U5T B;  4U0W A;  4LJZ F;  5BQT A;  1FBU A;  1OYW A;  3VEP A;  4HLY A;  2FBK A;  2YR2 A;  4UNO A;  1LQ1 A;  3F72 A;  4PZJ A;  2QQ9 A;  4ESJ A;  4ZH4 F;  1ONV A;  1ON1 A;  3T0Y A;  4RAY A;  5LGT A;  5ILS A;  4N0B A;  2KIF A;  1UST A;  2J5O A;  4BH9 A;  2GIV A;  1REP C;  2IA2 A;  4G7Z F;  2HEO A;  2HZT A;  2FML A;  4K2E A;  3BJA A;  3R0A A;  5LRS A;  1EH6 A;  1XDU A;  2H6C A;  3DP7 A;  3AAF A;  2CG4 A;  3BWG A;  1O3S A;  2QM3 A;  2GAU A;  2YX7 A;  3WE2 A;  1ZAO A;  3VOD A; 
#chains in the Genus database with same CATH topology
 2HDC A;  2QGU A;  3JRH A;  3I55 I;  3F8N A;  3T5X A;  3GTK J;  1O4X A;  1BC8 C;  1BW6 A;  3PSI A;  3I5U A;  2CFO A;  4W1U A;  3GFM A;  3T1B A;  4KIF A;  3C7J A;  2KDO A;  4G6D A;  1QHH D;  3ECH A;  2CYY A;  4A3M J;  1WH5 A;  2CW7 A;  5DM6 F;  3JAM K;  1KU2 A;  2Z99 A;  1MJB A;  3CF2 A;  1SFE A;  5FKM A;  1AKH A;  4AM3 A;  3K4M A;  5EG0 B;  2BEO A;  2K86 A;  4KYW A;  2ZME B;  2A5W A;  1DQU A;  3UR3 C;  4YFX F;  3G2B A;  3QYB A;  3S8P A;  3V7C A;  2E36 A;  3K4C A;  3RPU A;  1XCV A;  3ZP5 A;  1ZHF A;  2XAJ A;  4WX9 A;  3F22 A;  2XKP A;  1NTC A;  3EET A;  3X2Q H;  1X4P A;  1MBE A;  3R0J A;  4AD9 A;  4HRI A;  2HOE A;  4A3E J;  3KET A;  1XGN A;  2M8E A;  1MBK A;  2DOA A;  1J59 A;  4P55 A;  1LDK B;  5L3F A;  2A05 A;  3BCB A;  5DYM A;  3MAJ A;  2L7K A;  5CYV A;  2NS7 A;  4GYI A;  4QSH A;  2X85 A;  3WU1 B;  3W6K B;  2R7X A;  3Q3S A;  3DU5 A;  1QVT A;  4PCQ A;  1OMI A;  3V7S A;  2QYO A;  2DK8 A;  2K9N A;  1IAW A;  3GEZ A;  4IRI A;  1FOW A;  2O6G E;  4EJO A;  2E1O A;  1N77 A;  1HCR A;  4I99 C;  5F04 A;  4FHT A;  4EGZ A;  2EH3 A;  3ESW B;  3ZQF A;  3KEY A;  1P6R A;  1MJA A;  2F5F A;  3ULQ B;  4BU2 A;  3TDU C;  5ERI A;  5HNF A;  1W0U A;  3DKY A;  1UHW A;  4G6T B;  1KU9 A;  3R6S A;  4XKV A;  2GLO A;  3FHN A;  4XL9 A;  3MFK A;  1H88 C;  2DA5 A;  3MD2 A;  3QQA A;  1HW1 A;  3EUH C;  1YS7 A;  3U21 A;  2DMT A;  2M30 A;  4L5I A;  3CES A;  4ZDP A;  4XLC A;  2H94 A;  4XLF A;  2HR3 A;  2IEK A;  4BEH B;  4EQQ A;  2DA4 A;  4ZDL A;  3E5X A;  2EV6 A;  2YU3 A;  4CIC A;  5HLT A;  3WTY C;  2W48 A;  3CCY A;  3NRV A;  1IRX A;  1S6L A;  3VSK A;  2PJR B;  2CUF A;  1J5Y A;  4XLH A;  3E6B A;  3IH4 A;  4KIG A;  2JRM A;  3IV5 A;  5J1U A;  2DQL A;  2D5V A;  4NHJ A;  4UV9 A;  4YRV A;  1FP2 A;  3L7W A;  2GQQ A;  3DBL B;  5KAI C;  2FJ1 A;  4NUB A;  1X3Z B;  3OL4 A;  2WY8 Q;  1OPC A;  4EM0 B;  1BJA A;  3BRO A;  3H0G J;  1ZEL A;  1Y56 A;  3I56 I;  1O7F A;  5FKL A;  2X6X A;  3UKG A;  2YUS A;  3B73 A;  3OYM A;  3LL7 A;  1I5Z A;  3IAS 2;  2GOM A;  4CH7 A;  4KFC A;  5ILV A;  1ETV A;  2K02 A;  3COA C;  3F3X A;  1D8K A;  2R93 J;  1OLT A;  3BTI A;  1HW2 A;  1GV5 A;  4C3J J;  2OV7 A;  3P9I A;  3PJR A;  1U8B A;  4M6X A;  3BQZ A;  1JJ8 C;  3FMS A;  3UNG C;  4B3A A;  1Y1V J;  4HYE A;  2M4G A;  4EGY A;  2LFB A;  3F9K A;  1Z1D A;  3TO6 A;  3VYT B;  4ABZ A;  5DEQ A;  1TWH J;  3TKY A;  3WTZ A;  3MZ8 A;  4D5C A;  5AON A;  5D5U B;  4BDZ A;  3TQN A;  2PBI A;  2Y2Z A;  4CDG A;  1J09 A;  5K7F A;  4JX6 A;  4BGD A;  4J19 A;  3RQ4 A;  3FXJ A;  5IYC J;  4PJJ A;  2HI3 A;  2QA4 I;  2ZXW H;  3DEW A;  2B9S A;  2DBB A;  1L0O C;  4MTD A;  5HLI A;  4HOB A;  1ETK A;  4UB6 C;  2L9V A;  3MN2 A;  2H8R A;  1C0W A;  2VL8 A;  1AWC A;  3HOS A;  5BS6 A;  3IUO A;  3JAM Z;  2M34 A;  5J1R A;  1HLV A;  4RAF A;  4L9T A;  4M74 A;  2HYF A;  2EFN A;  3J7Z I;  3N97 A;  2LKS A;  5EDN A;  3IKV A;  3VYU B;  2CV1 A;  2CFX A;  4DOZ A;  2IXS A;  2CQ7 A;  1E3O C;  3H35 A;  4GFB A;  3ZQL A;  2UXN A;  4I0B A;  4BQQ A;  4NQW B;  2XAG A;  1KQ8 A;  3S1M J;  3P9C A;  3MZY A;  3KZY A;  2VIX A;  5LEK A;  1YRN A;  2OCC H;  4PSX A;  2PMZ N;  2ZCW A;  3SFI A;  1F43 A;  4ZTJ A;  1JE8 A;  1BBY A;  1ZGA A;  3RCO A;  1YLF A;  2Y31 A;  1RZ4 A;  2KFD A;  1WJF A;  2QZ8 A;  4AYB A;  1O3T A;  3ZPL A;  5FD5 A;  4XID A;  3F6V A;  2P8T A;  3WGH A;  1MND A;  3BZ6 A;  5CPR B;  2EB7 A;  3RTR A;  3LSJ A;  3IH3 A;  4RGU A;  2DI3 A;  4NC8 A;  4RS8 A;  3BR3 A;  1BIA A;  4AVP A;  4ANJ A;  1SC7 A;  4A3B J;  9ANT A;  1FSE A;  2I5U A;  2LG4 A;  3DV8 A;  4WXD A;  4NQW A;  2VC1 A;  4C3I J;  3N05 A;  3SZP A;  3I53 A;  1SFU A;  3KP7 A;  3K6G A;  5IT9 Z;  2F48 A;  1X19 A;  2A3S A;  2DOE A;  4KT5 C;  2CW0 F;  1JKP C;  2GWR A;  2WC2 A;  1LJ9 A;  3F8F A;  5EZH A;  3U2R A;  3V4G A;  1Z6R A;  5EJC A;  2TCT A;  4WXC A;  3I0T A;  4MEX F;  2HTJ A;  4Y3O A;  2WTE A;  2NVT J;  3P7N A;  1X1D A;  3ISP A;  5E1W A;  4LFU A;  1M1E B;  3HRM A;  2CUZ A;  2EA2 A;  4YII A;  2ZJR F;  2M5W A;  3DTE A;  3M8E A;  2MAB A;  3R4K A;  2OTL I;  4LG0 B;  3F8M A;  1PJR A;  3K1P A;  5KAF C;  4PJL A;  3LQQ A;  3I58 A;  4BHB A;  2HWV A;  1FSH A;  3BTJ A;  1UJ8 A;  2Y9Z A;  5FRN A;  1ZRE A;  2VQL A;  2DOF A;  1WJ5 A;  3E6C C;  2WAD A;  3K0L A;  4H0E A;  1LVK A;  4GRI A;  3L9F A;  2XSD C;  2LF8 A;  4W97 A;  3J80 K;  3DXJ F;  1E2X A;  2GXA A;  4E7K A;  2R0Q C;  4RLF A;  4E70 A;  2XGC A;  4HF2 A;  1IV6 A;  3OYA A;  3MKZ A;  4OIQ F;  2X1D A;  2YPR A;  2IS1 A;  4LD5 A;  2DQR A;  2E7W A;  2EIK H;  2HKO A;  1WHU A;  3QOD A;  2O9L A;  1ZLJ A;  4II2 A;  5DD4 A;  3H3V K;  3CDL A;  3SEZ A;  5C4J J;  3EDP A;  4QPQ A;  4E4H A;  1JGS A;  3JTG A;  3HXL A;  3F8C A;  2UXX A;  4MQV A;  1JUM A;  2DTZ A;  3JW4 A;  3PUB A;  2V1N A;  3ZR8 X;  2QSH X;  3RYR A;  3BG5 A;  4L9N A;  2Z9O A;  3MCZ A;  2FBI A;  2Q2E A;  1BR4 A;  3TP0 A;  3V8L A;  3CD6 I;  2PN6 A;  2GXB A;  1F36 A;  1B8I B;  4NDL A;  4IHX A;  3U1D A;  2NNY A;  2HQR A;  2OAZ A;  3L09 A;  4BQN A;  3WTS C;  1GDT A;  1MSF C;  4PK4 A;  4LIU A;  3K4L A;  3QU6 A;  2DAO A;  1H9G A;  2FU4 A;  3CJN A;  3PQK A;  3H0D A;  1W36 C;  4X6A J;  1BR2 A;  4CZZ A;  2DFF A;  3G1L A;  3OYH A;  2LTP A;  1U9N A;  5FD6 A;  3BLY A;  1TW2 A;  2DLL A;  2QKM B;  4M6V A;  2MD5 A;  4ZTF A;  3C18 A;  5KK1 A;  5L3C A;  2JUG A;  3OOP A;  1FOK A;  4B09 A;  1R22 A;  4G12 A;  4ZZD A;  2F2E A;  2GA1 A;  1KZH A;  4KMF A;  2VKH A;  2QKL B;  2WB1 N;  5ILU A;  1B8I A;  3OYD A;  3BCA A;  1XD7 A;  1IXS B;  1R1T A;  3OR2 C;  2Y48 A;  3GBG A;  2VJ5 A;  5GTI C;  5EG0 A;  4I2O A;  2RDP A;  1MMD A;  1ODD A;  2R5Z B;  1JTY A;  2KRH A;  4OIR F;  3AG4 H;  3K1M A;  2OU2 A;  3K4K A;  2Q8K A;  4LG0 A;  3L2Q A;  2XRO A;  2QEX I;  2OZU A;  2O5R A;  4BAY A;  1B6A A;  2VKE A;  1OCR H;  1T2K A;  1BC7 C;  4A3F J;  3GCM A;  1N25 A;  2VBW A;  1CF7 A;  1W7P B;  2G9W A;  1IJW C;  3S1N J;  2B63 J;  3NAR A;  3JRE A;  2CV0 A;  3J81 Z;  1GXP A;  4A3D J;  1FOX A;  1FPQ A;  2DO7 A;  3OV8 A;  2BZT A;  1K7A A;  3KP6 A;  3CME I;  1LKX A;  2DMP A;  4QLC U;  4XMY A;  1P2F A;  2F5C A;  4HLX A;  3MMY B;  2ZME C;  2G0E A;  2OD5 A;  1U2W A;  2K3F A;  3OYG A;  1HW5 A;  2KJC A;  4M3B A;  4XIC A;  2P4W A;  5FFZ A;  1Y8Q B;  3HPH A;  4IPA A;  1K83 J;  4Y4R A;  3CP8 A;  3QAH A;  4IJA A;  1GVD A;  3S1R J;  3ZMZ A;  2DA7 A;  1DPR A;  3HTS B;  2ZFU A;  5BOX A;  4KA4 A;  3E3V A;  5HDK A;  3JRF A;  1TL8 A;  1B4A A;  4F3Q A;  4HNV A;  3GME A;  1MBF A;  3DTI A;  3WOD F;  2HKX A;  2HXO A;  4E7J A;  1IC8 A;  3ZMS A;  3ZQQ A;  2V1D A;  4C30 A;  4RM2 A;  4B3X A;  5FLM J;  3MVP A;  4B4C A;  2EIL H;  3RKY A;  1WKM A;  3DKW A;  2LF7 A;  1T39 A;  3ZOB A;  4EMS A;  4XNF A;  3PFY A;  1U3E M;  4XLN F;  3RZD J;  4L9V A;  5DUI A;  3RKQ A;  3FKI J;  3CDH A;  4EM1 A;  4A69 C;  1G3S A;  4KIC A;  2CJJ A;  2V9V A;  3HZJ A;  3V7R A;  2A6H F;  3I4P A;  3V8K A;  5GAD J;  4D9J A;  3MKY B;  3A2K A;  3M9A A;  3DPT A;  1ZKG A;  1K79 A;  5EEA A;  5KCM A;  3RJP A;  3KP5 A;  3GZ5 A;  5D4S A;  4U7B A;  4YIR X;  2YU9 J;  4M9X A;  4F93 B;  1Z9C A;  3CUO A;  2O61 A;  4UUS A;  4CA0 A;  5LFA A;  3HOW J;  1V5G A;  5GP9 A;  1RPW A;  3IC7 A;  1SMT A;  2PG4 A;  2PJR A;  1GHC A;  1RIO H;  1KYZ A;  3IRQ A;  2W84 A;  2XRN A;  2P5L C;  2D1V A;  3QOE A;  2IGM A;  1VQL I;  4LGW A;  2ZO4 A;  5EGO A;  1ETW A;  3A02 A;  4IRG A;  3HHH A;  3S2W A;  1FNN A;  2Y69 H;  2PI0 A;  1FYL A;  1ITY A;  2XF7 A;  4J01 A;  1OYY A;  3GYH X;  3ZN1 A;  2LSO A;  3ZQG A;  2DJI A;  3OR1 C;  1R9T J;  1OCC H;  4CYC B;  1O3R A;  2BVM A;  1JTX A;  1FYK A;  2OZ6 A;  2VKD A;  2VOP A;  5L3B A;  1R49 A;  3FIW A;  1ZTR A;  3BDD A;  3BY6 A;  4RBO A;  2VQH A;  4AVZ A;  2UV1 A;  2Y0S A;  2BOL A;  5D8L B;  1AU7 A;  4MFD A;  2Z1D A;  3D5S C;  2HS5 A;  3BPX A;  2FNP A;  2NVX J;  2EZK A;  5DD8 A;  3PO3 J;  3VSL A;  3DLL F;  1SD5 A;  4PJM A;  4E7I A;  3DF8 A;  1V55 H;  2DN0 A;  1N78 A;  4I02 A;  3H92 A;  2QQ8 A;  5F6F A;  3HOX J;  4F55 A;  4BBS J;  4LK1 F;  3GFI A;  1Q1V A;  3CCS I;  4ENK A;  1B72 A;  4C9Y A;  1UEL B;  3S15 J;  1A36 A;  2FRH A;  3K4B A;  1RC9 A;  3FBN B;  3KZZ A;  1IUY A;  3L00 A;  4Y13 A;  1ZRD A;  3KYD B;  4F7Z A;  1TNS A;  4UXN A;  4BQA A;  3HSF A;  1P9Q C;  1UB9 A;  5HLH A;  2MC3 A;  2NVY J;  2ICW G;  3WE3 A;  2CRG A;  2V6E A;  1ZRF A;  1MH4 A;  5KVR A;  2ADU A;  4JQF A;  4WWC A;  3CDI A;  3AL0 B;  2A07 F;  2XF5 A;  2F4M B;  4RGR A;  1FEX A;  2IP2 A;  2ACJ A;  2VB6 A;  4E6K G;  4U88 A;  1HDD C;  4CCO A;  2BVL A;  2HPI A;  5CKT A;  4A5N A;  4XLP F;  3GTJ J;  1PDN C;  2OBP A;  4UUV A;  4DBQ A;  5M5Y J;  2EA4 A;  2TRT A;  3LST A;  2JA8 J;  3EUH A;  1EJ9 A;  2JPC A;  4AYB N;  2ZXJ A;  3A0B C;  2DT6 A;  3GZ6 A;  3RPU D;  3KEQ A;  5EEG A;  3JRA A;  4PSW A;  1V5E A;  4IRH A;  4DZP A;  2PFB A;  2IGN A;  5D4R A;  1JT6 A;  2P81 A;  2IS6 A;  4BJ5 C;  1ZQ3 P;  1X1C A;  1LNW A;  2R7T A;  3CP2 A;  5B1A H;  1J2X A;  4R8H A;  4A2U A;  3HHG A;  3SJM A;  1EH8 A;  4EJW A;  1VFC A;  1I6X A;  1FC3 A;  2MBF A;  2OQG A;  2QQB A;  3CCE I;  1LE8 A;  1ACI A;  3JRG A;  2K9Q A;  3E97 A;  4N4O B;  2W24 A;  2DW4 A;  3M07 A;  4NB5 A;  5C44 J;  3JR9 A;  3L2W A;  3NWS A;  5DCM B;  4JX5 A;  3ROU A;  2IJL A;  3LSI A;  3QP6 A;  2OCE A;  2RAE A;  1I27 A;  2JT1 A;  1RRJ A;  1HKT A;  2HU9 A;  1MIJ A;  2F5D A;  1V5F A;  3M1E A;  1R5H A;  4CYD A;  1BN5 A;  3LAJ A;  5E1X A;  3L1P A;  1YTY A;  2JN6 A;  3EYI A;  2CUJ A;  2VQG A;  3H3Z A;  2P6T A;  1XSD A;  4HNT A;  4XRS A;  2R7O A;  2K4J A;  2LYC A;  1NG7 A;  1Z77 A;  2F5E A;  5BPI A;  3LSM A;  1BM9 A;  2K85 A;  5E1Z B;  3SEQ A;  1KON A;  3H5N A;  4IOC F;  2ZSI B;  3LNQ A;  3TOA A;  2ELJ A;  3MZH A;  4L0Z B;  2A68 F;  3RYP A;  3MQ0 A;  3FK6 A;  2XRL A;  1B9M A;  1OFC X;  1SVO A;  3SXY A;  4OMY A;  1UMQ A;  4MFE A;  1BI0 A;  2X4H A;  1FOY A;  5IOZ A;  1KYW A;  2CQK A;  2JWT A;  4XLA A;  3K9T A;  1ENH A;  4R1H A;  1ZGJ A;  5L3E A;  2LD5 A;  3AL0 C;  5E3N A;  3K4N A;  3LA2 A;  3ABT A;  2JSP A;  2IAI A;  1H9T A;  4P9U A;  4I09 A;  5A2Q K;  5CLS A;  4V2G A;  1UHS A;  4OOI A;  1JHH A;  3JRB A;  4FX4 A;  1STZ A;  3E7L A;  1XX5 A;  3F0C A;  3CCU I;  2O8X A;  3GF2 A;  2EFW A;  3CC2 I;  3A03 A;  1XS9 A;  3CCM I;  4HX8 A;  4NC6 A;  4M6Y A;  2PJP A;  2RN7 A;  3HOT A;  1T98 A;  1KQ9 A;  1KU3 A;  1VTN C;  5E3M A;  2FUG 2;  2PMU A;  4LLG F;  2V9K A;  4BE2 A;  2MLK A;  4HZF A;  3H3U A;  2Z33 A;  1D5Y A;  1K78 A;  1D0Z A;  4U0Y A;  2UWM A;  3OYK A;  1XDS A;  1ETQ A;  4YEJ A;  1RR7 A;  5JLW A;  1IDZ A;  3W2W A;  3HIF A;  3ERE D;  3HUG A;  4S0H B;  2KHM A;  4TV7 A;  1YQA A;  1QHG A;  2ZXH A;  3QPL A;  3CO6 C;  2E5N A;  1P4A A;  1SD4 A;  4Y33 A;  4HQE A;  2M7B A;  1WJD A;  2DMU A;  3W6V A;  2KLO A;  1KU7 A;  4E7H A;  1ZK8 A;  2XGX A;  3QPS A;  2EQR A;  4N9H A;  1T33 A;  2VE8 A;  2E19 A;  2ZJ2 A;  3D5R C;  3JRD A;  2STT A;  1DP3 A;  4Q48 A;  4CSW A;  4CZC A;  3IAM 2;  2F4O B;  2VAS A;  3I71 A;  1AHD P;  1W7P A;  1FYM A;  2VOD A;  2EBI A;  2R5Z A;  5DDG A;  1APL C;  4NNJ A;  5LRR A;  1Y39 A;  1R36 A;  5E18 F;  1SVM A;  5B66 C;  2RQQ A;  1P92 A;  1IXC A;  3EUK L;  4CHU A;  1G2H A;  3R60 A;  3FHZ A;  5J1Y A;  2DTR A;  1RNL A;  4OU0 A;  2D45 A;  2G7U A;  2GA2 A;  1XN7 A;  2R7F A;  1S3J A;  2L9N A;  1YIO A;  1Y0U A;  2LNB A;  2XPV A;  4XRS G;  4XQF A;  1W7P D;  2BE5 F;  4O3M A;  2P6S A;  4A3C J;  3H9G A;  1FP1 D;  3LAP A;  1T95 A;  2DA3 A;  3O2P E;  3CF5 F;  2K7L A;  1WWX A;  4KN7 X;  2EFO A;  2ZME A;  1IN4 A;  1B1B A;  3HC7 A;  4A0X A;  1XG1 A;  2RRE A;  3AG1 H;  3SHF A;  5DM7 F;  2DDB A;  5IP9 J;  5E3O A;  1PP7 U;  3GVA A;  3A01 A;  1I3A A;  4IX7 A;  1XPX A;  1DUX C;  4HNU A;  1Z3Y A;  1TT5 B;  3C2H A;  3C1D A;  5TIS C;  2JJ7 A;  3EUA A;  2IS4 A;  5TJJ A;  5K1Y A;  4I7H A;  1ULY A;  3OYC A;  2X6W A;  3E5U A;  1JT0 A;  4UVA A;  3FDY A;  3G73 A;  4B48 A;  2FBH A;  2PEX A;  3RKW A;  2L9S A;  3RQI A;  3L2V A;  4ZC3 A;  4EJU A;  5C4X J;  1VQO I;  2MYS A;  5K5Q A;  1IG7 A;  2HYJ A;  5CVU A;  1LUJ B;  1QZE A;  3LOC A;  2DT5 A;  2Q0O A;  3HKZ A;  3LA7 A;  1MSE C;  3KLN A;  4ZYG A;  1K61 A;  4DZJ A;  3WHC A;  1SFX A;  4ZYD A;  2EPF A;  1BA5 A;  4MGR A;  4UB8 C;  1R23 A;  4HG2 A;  1S9H A;  2QEN A;  4PGG A;  1QA6 A;  1GVJ A;  4P1W A;  1FY7 A;  2Q2E B;  1VQ8 I;  3WTU C;  4L5J A;  1YJN I;  4QPO A;  1F9N A;  3OS1 A;  1YJ9 I;  2O03 A;  4XOR A;  2E34 A;  2L9R A;  3LQR A;  1VND A;  2WAQ N;  2HFH A;  3KIO A;  2DA1 A;  3S93 A;  2EV5 A;  4IKF A;  3I4M J;  1W5C C;  3BOQ A;  4HX7 A;  2VE9 A;  2VPR A;  4U87 A;  1ZG1 A;  4FT8 A;  2CWE A;  2JA2 A;  2IT0 A;  1E3H A;  1SVL A;  2F5V A;  1RUN A;  2ZNY A;  2KDZ A;  2DOD A;  4A12 A;  4P5O A;  3I64 A;  3DFG A;  4L0Y B;  3NAU A;  2ETH A;  2VKV A;  4XON A;  4D7M A;  1BOB A;  3A0H C;  2IA1 A;  2XPW A;  3FXK A;  1X2N A;  5B1B H;  2JA7 J;  1TW3 A;  3FBI B;  2AXL A;  1T56 A;  3B6A A;  3ONQ A;  1OIS A;  3DWL E;  3F6O A;  4M3G A;  1LFP A;  2XAU A;  3BG7 A;  5D5V B;  1XCB A;  1ZRC A;  3PFI A;  4M3F A;  2CS3 A;  4IHW A;  1OYI A;  2A6T A;  4FX0 A;  3CJQ B;  3KFW X;  2RC4 A;  2ESN A;  2XHK A;  2KIU A;  3K1N A;  2XGD A;  4ENM A;  1YRN B;  1KQ0 A;  2LP0 A;  3G3Z A;  3PIO F;  3CMA I;  4I98 B;  5DUK A;  3LA3 A;  3S3N A;  3L2U A;  2R7Q A;  2KL4 A;  2XDV A;  5M5W J;  1FIP A;  2M0C A;  2RGV A;  3IL2 A;  2Z2S B;  1VQP I;  2ZC2 A;  3JTH A;  3OY9 A;  5D8K B;  4DQ2 A;  2EIN H;  3VPR A;  3PSF A;  1BJZ A;  3HOV J;  2VT2 A;  1YIT I;  4BNC A;  3BJ6 A;  5GAG J;  4OAZ A;  1D5V A;  4BL0 B;  3PQJ A;  5ED4 A;  2CGP A;  2ECB A;  2ZB9 A;  3RZO J;  3BJO A;  2CU7 A;  3E5Q A;  2CSO A;  4C2U A;  3B6C A;  1HDP A;  3IWF A;  1VQK I;  1A04 A;  3C2B A;  5CQE A;  2X1E A;  5FGM A;  4LB6 B;  2LDU A;  3L2R A;  4FE7 A;  2VT3 A;  4OMZ A;  1R6R A;  1WSU A;  1RI7 A;  4XOP A;  3ZQI A;  3IP4 B;  3ZN0 A;  4AC0 A;  2DPD A;  4U7D A;  2E2H J;  2WB1 A;  5B5E C;  1G3T A;  4IHY A;  1IN8 A;  1S7O A;  1CQT A;  1UHM A;  1ETX A;  2GIZ A;  2XSJ C;  4KIB A;  3ZMD A;  3M1C A;  5E8G A;  3SQN A;  3G4S I;  1WJA A;  4GYG A;  4XBF A;  2HPM A;  1RKT A;  2HYG D;  3QPT A;  5JHU A;  5BMZ A;  5J40 A;  4KIT B;  2FNA A;  2ESH A;  3I4N J;  2JVH A;  3JSO A;  1W5T A;  1P4W A;  4BAC A;  1F4K A;  4OIP F;  2GZW A;  3OYI A;  2IGO A;  4WF2 A;  5J8F A;  2XB0 X;  5JHF A;  2JSC A;  2K9S A;  3BZK A;  3J81 K;  2R7R A;  2Y75 A;  1LEB A;  3HRU A;  1T08 B;  3K10 A;  1U5T C;  4RAZ A;  3CMY A;  3HBL A;  1IN7 A;  1SAU A;  3R61 A;  3TBI A;  1HBX G;  3H5R A;  2W25 A;  3W6J B;  4AUX A;  1OR7 C;  4HPQ A;  4N9I A;  4IZZ A;  1GUU A;  1IRF A;  4XOT A;  4AID A;  1LFB A;  4A0Z A;  2HOA A;  4D7N A;  4YG2 F;  4EVI A;  1S7E A;  3FXQ A;  3H9J A;  3Q9S A;  4G6Q A;  3GFL A;  1Y1W J;  4I76 A;  5CVR A;  1OQY A;  2R7U A;  3WTT C;  5FJ8 J;  1V54 H;  3HRT A;  4BUP A;  3VWB A;  2BY0 A;  2BYV E;  2ELH A;  2Z3Y A;  1EH7 A;  2MFZ A;  2LBF A;  1MMN A;  4FE4 A;  2NOG A;  5KNL A;  2KJB A;  3HRS A;  2BY2 A;  3S17 J;  1I39 A;  4A93 J;  5JR3 A;  4XLE A;  1DGR M;  4LIT A;  2XKO A;  5FRO A;  4BY1 J;  3IHU A;  3J7Y J;  4I0A A;  2Z5U A;  4BQO A;  3HSR A;  3SFZ A;  1JUP A;  2KQR A;  1S7A A;  2L7M P;  3OYB A;  2JA5 J;  1WZ2 A;  2QBY B;  1RR8 C;  3LSR A;  1ERD A;  1YJW I;  4R79 A;  3QPH A;  1X1P A;  1J75 A;  2EZH A;  5E8I A;  1P4X A;  4LLL A;  3RIR A;  3GX4 X;  5K7H A;  3S1Q J;  5TGT A;  5E17 F;  2FA5 A;  3KP4 A;  4HX4 A;  4XK4 A;  1YS6 A;  3CLQ A;  1TQM A;  2KIS A;  2R7Z J;  1MMA A;  3CUQ A;  3OYL A;  2VPL A;  1S72 I;  2L01 A;  1OJL A;  4MTE A;  4IQJ A;  1YX5 A;  1JXS A;  1FT9 A;  2V1X A;  4LOC A;  1JUS A;  4FQG A;  1IZ1 A;  3DEU A;  3GW2 A;  2DT7 B;  3WU2 C;  3BTC A;  1IF1 A;  5F1R A;  1KGS A;  3M8F A;  2WY7 Q;  2EIJ H;  1MGT A;  1MKM A;  4LG3 A;  1IGN A;  2DPU A;  2FE3 A;  3BG3 A;  3OWT A;  2LY1 A;  1YI2 I;  3CJR B;  4RDU A;  5CVJ A;  3FZV A;  1HXD A;  3E6M A;  4BKX A;  2RQP A;  3TGN A;  2HTS A;  1WJC A;  4ON0 A;  2VN2 A;  3O3K A;  5HS8 A;  2AS5 F;  4BJ6 C;  4MNU A;  2L3D A;  2XIG A;  2YS9 A;  4DNC A;  2DFI A;  4XSX F;  3JCU C;  2QLZ A;  5FLX K;  4EM2 A;  3J80 Z;  3MKL A;  5EEH A;  2KKO A;  1IW7 F;  4BDY A;  2LC2 A;  1D1C A;  2PMH A;  1FBQ A;  3AG2 H;  3VDX A;  3RSN A;  5JI6 A;  1XSX A;  2AQE A;  2VC0 A;  3FKJ A;  5LGU A;  5IY5 H;  4HDU A;  3AG3 H;  2EFQ A;  3HJE A;  3PL8 A;  2OTJ I;  3SDG A;  1MNE A;  1EV7 A;  4IHS A;  2HQN A;  3W3C A;  3KEO A;  1TWF J;  1X3W B;  2OJE D;  3GUD A;  2P7V B;  1YG2 A;  1QO0 D;  2I10 A;  2HDW A;  2PMZ A;  3QP5 A;  1YOV B;  2GBY A;  1D0Y A;  5KHD A;  2YX4 A;  3GZN B;  5GTH C;  4CXF A;  3VFZ A;  3FXO A;  4Z6Y A;  2OQR A;  4RGX A;  1LPQ A;  2COB A;  1O57 A;  1BR1 A;  2B7E A;  3Q5F A;  2OPT A;  1TZL A;  2JTV A;  2DU9 A;  2NS0 A;  3CC7 I;  3FM3 A;  3OSF A;  4KDP A;  3GTM J;  4S04 A;  5IT9 K;  1J7K A;  2LRD A;  4UV8 A;  4N4N B;  3EPZ A;  3H1C A;  5AIQ A;  5LBQ A;  2XC7 A;  4KN4 X;  2NNN A;  1A6I A;  2HVQ A;  1D3Y A;  3HDD A;  2BHY A;  2V7F A;  1X58 A;  5K7Z A;  2W82 A;  5E79 C;  2DK5 A;  5HS9 A;  4UVC A;  1JJ6 C;  3FXL A;  4I01 A;  1X3U A;  3ZQC A;  1MW7 A;  1JGG A;  4RGS A;  3WGI A;  4KIS A;  3TED A;  2ELK A;  5E20 A;  4HQM A;  1ZG5 A;  4XN3 A;  2YSR A;  1HF0 A;  5IOY A;  4Z2Y A;  3G6E I;  2BHZ A;  2O8K A;  1WCM J;  2F4I A;  2HGC A;  2CMP A;  1T6S A;  3WHB A;  1WH7 A;  3N4M A;  2HDD A;  4CCM A;  3GTQ J;  3KYL A;  4G7H F;  2W1O A;  4Y15 A;  4XKB A;  2VUM J;  1WI9 A;  4PJ0 C;  2IVM A;  1A5J A;  5D5X B;  5DS9 A;  3M3Y J;  1R71 A;  2V79 A;  3P5J A;  4GCV A;  1Y0N A;  4BEH A;  2LVS A;  3DQV C;  1IV8 A;  4BXU A;  3H36 A;  2E1N A;  2W4S A;  2W7N A;  3DU6 A;  2ZJP F;  4XRF A;  3VOE A;  1TT0 A;  2KRF A;  3G71 I;  3WTV C;  4BXX J;  4C3H J;  4I6Z A;  1UG0 A;  2NVU B;  4RA2 A;  2WA0 A;  2L5Q A;  1VI0 A;  4RMN A;  4CCN A;  1BW5 A;  2JA6 J;  2Y9Y A;  1LDJ A;  4X0G A;  4JX4 A;  3TW6 A;  2IBD A;  5JFR A;  4UY8 I;  3QOP A;  4BHC A;  2GXG A;  2CQN A;  3CC4 I;  2MA3 A;  1MDM A;  2R7V A;  1FWZ A;  2EJR A;  2WWY A;  2Q1Z B;  5GPC A;  2ZJQ F;  1MD0 A;  4G8X A;  4EJT A;  1ZG3 A;  1G6N A;  3ZMU A;  1JHF A;  1FIA A;  1VQ9 I;  2PLY A;  3WTX C;  2VJ4 A;  2E60 A;  3HUG B;  3J7A Y;  1HQC A;  5L3D A;  2J5P A;  4HBL A;  2FMY A;  4GGG A;  2BBY A;  3L2C A;  1LFU P;  2P5V A;  1QQI A;  3NWT A;  5F27 A;  3S3O A;  3IWZ A;  4E7Z A;  4ZYH A;  3WTW C;  2ME6 A;  4GO1 A;  5J4Y A;  3DPL C;  2K40 A;  2XF6 A;  3OOU A;  2CO5 A;  4RB3 C;  4A3L J;  1IUF A;  1HKQ A;  1I50 J;  4YFK F;  3HM5 A;  3H9Q A;  1R5G A;  3CCL I;  1D0X A;  3QWL A;  2JRT A;  2LMD A;  4CCJ A;  1TP4 A;  3WGG A;  5FLX Z;  1TNT A;  4M3D A;  1X4O A;  2VBZ A;  3S2H J;  1OCP A;  5FFX A;  2MLG A;  2X9D A;  4O5V A;  2UZK A;  1X1A A;  2XUB A;  5F64 A;  1QBJ A;  5M5X J;  1H0M A;  4RB0 A;  2X1C A;  2MH9 A;  2G7H A;  3ZMV A;  3LFK A;  1W0T A;  4M73 A;  3HKZ N;  4B44 A;  2FSW A;  4CUG A;  2H1K A;  5H6Q A;  2WAE A;  1TLH B;  3VYR B;  3ZRG A;  1Z6T A;  3I59 B;  5FB2 A;  2HNH A;  1TQI A;  2W57 A;  1ZLK A;  3E0J B;  1IRZ A;  3LWF A;  1W5S A;  2V6C A;  4XSZ F;  1Z7L A;  1G4D A;  2PX9 A;  3FXU A;  3CCQ I;  1IN5 A;  1YHQ I;  2K9L A;  1VQ4 I;  1HA8 A;  3MEX A;  2DA6 A;  4PDK A;  4P96 A;  5F1J A;  4AIJ A;  3G1O A;  2R7W A;  3W2A A;  2L7Z A;  1NH3 A;  5F0C A;  1Z7U A;  5CVV A;  5JLX A;  3KE2 A;  3TO9 A;  3K4J A;  3H5A A;  4AIK A;  3PM1 A;  3HOY J;  4XR6 A;  1MNM C;  1U0J A;  1FJL A;  5JVG F;  4IHT A;  3HB9 A;  4XM3 A;  3TP3 A;  2AXT C;  1IDY A;  3SZG A;  1O3Q A;  3J7A O;  3WU0 A;  1OKR A;  3BQY A;  1R00 A;  3I59 A;  4ZYE A;  3S3M A;  2MG4 A;  1TWG J;  2EZI A;  3ZXS A;  4FIS A;  1QPM A;  1XGS A;  4GXO A;  4PFP A;  3LFU A;  4A3G J;  4DBR A;  4DYQ A;  1D8J A;  3CLO A;  3GTP J;  5FKN A;  1Z91 A;  1IXR C;  3PNY A;  4RM3 A;  1YW8 A;  1VQ5 I;  1F5T A;  4U0V A;  1J9I A;  5ICF A;  5D5W B;  3PNT A;  3BPV A;  3ZGK A;  3HEF A;  3V8J A;  3KYC B;  4LK0 F;  4RLQ A;  1U9O A;  4F91 B;  5JVT A;  4BE0 A;  5FO5 A;  4IQ4 A;  2RKH A;  3U9G A;  2W85 A;  5H20 A;  1XGO A;  5K5R A;  2ZNZ A;  3E1S A;  3CO7 C;  1AKH B;  5EYR A;  4B8X A;  1G8X A;  4M71 A;  2ECC A;  1K4T A;  2HQA A;  5J4V A;  5D6F A;  4J00 A;  2FQ4 A;  4HA8 A;  3Q0W A;  2EZL A;  1OR7 A;  3HL2 A;  3IKT A;  3FXM A;  2L0K A;  2IGK A;  2LLK A;  3QYF A;  4IHV A;  2XV4 S;  2BXY A;  1SAX A;  2VJI A;  3FWE A;  2WAF A;  1SFO J;  4KUM A;  2KMU A;  2OUM A;  3TL4 X;  1LDD A;  2F6C A;  4M9S A;  1DGW Y;  3GLX A;  3KPH A;  1K6O A;  2AHQ A;  2MD0 A;  1S8N A;  2NS8 A;  5ICC A;  4XRM A;  4P9F A;  1DPU A;  3DKX A;  3ELK A;  4HDV A;  1Z05 A;  1RET A;  2NAZ A;  5K5O A;  2K3P A;  3FMR A;  5C3E J;  4AWX B;  3I54 A;  2LKX A;  4ENN A;  4HF0 A;  3BG6 A;  3PNV A;  4BY7 J;  3D1N I;  3B02 A;  1R1V A;  2K5C A;  2WAQ A;  2K9M A;  4FAS D;  3ABL H;  1W1W E;  2BXZ A;  3TW7 A;  2D2W A;  4UUS B;  5FKK A;  5BPD A;  2V26 A;  1AOY A;  3G1M A;  4BS9 A;  2P0W A;  4LIV A;  4CO8 A;  3CQZ J;  3FF5 A;  1OCO H;  3M7G A;  1TWC J;  1YX3 A;  1S29 A;  5DTD A;  5HLG A;  4C2T A;  3QRF F;  1WI3 A;  3PUF A;  2FF4 A;  2JMW A;  3GXO A;  4XKW A;  2NYX A;  1XC5 A;  2XAF A;  2IRF G;  2E35 A;  3D5L A;  3FK7 A;  4CCK A;  4MO7 A;  3DCF A;  2A69 F;  3FX3 A;  4Q47 A;  3ZCO A;  1XMA A;  2XAS A;  3Q0V A;  1QRY A;  4IEJ A;  2ZFW A;  5EZG A;  4CYC A;  3NQO A;  1R5I D;  1USS A;  3K2Z A;  1G59 A;  2XVC A;  2XB5 A;  5CJ9 A;  3ZQ7 A;  4LB5 A;  1SD7 A;  2H6B A;  4OAY A;  5HDN A;  3I3L A;  4QWQ A;  4CGZ A;  1QZZ A;  3EYY A;  3F21 A;  4V2F A;  2WV1 A;  5LHI A;  2H09 A;  5A2Q Z;  5LD2 C;  4OWR B;  1EKE A;  2HQ5 A;  4L18 B;  3DLA A;  1U78 A;  2QF7 A;  3BTL A;  4S05 A;  1H8A C;  4ASN A;  3SDB A;  3S14 J;  2ID6 A;  1X1B A;  3SYT A;  4EAT A;  1SEU A;  3JSP A;  1QU3 A;  2CQX A;  4E7L A;  2TDX A;  1KA8 A;  2DA2 A;  2IPQ X;  5AIP A;  5IYB J;  3DBH B;  2LK2 A;  5HNH A;  3ECO A;  3VB2 A;  5EF6 A;  2HOS A;  1UCR A;  3GTO J;  3S16 J;  4YFN F;  2M8G X;  2VOO A;  5IP7 J;  3OYE A;  3O6B B;  1E17 A;  4Q4Z F;  1RUO A;  2QSG X;  4DW6 A;  4MLO A;  4PGH A;  4PUS A;  1G3Y A;  4DIQ A;  4H4K C;  4JBA A;  3ABM H;  2R7D A;  1NG6 A;  1VQM I;  1CF7 B;  3HYI A;  4IXA A;  5H2F C;  1GV2 A;  4NC7 A;  2EV0 A;  1SD6 A;  1DDN A;  2DYS H;  1ZR4 A;  2FX0 A;  1EA3 A;  4O6J A;  2KRC A;  2O7O A;  1PUE E;  5F0F A;  1YIJ I;  2DXI A;  4A3I J;  2CW8 A;  4HAM A;  1Q1H A;  1T8I A;  2L4A A;  4B1R A;  1MBJ A;  2ISY A;  2UUZ A;  1GLN A;  5J8C A;  4YEL A;  2CUE A;  3KP2 A;  1RKW A;  3Q0U A;  4IF4 A;  2ID3 A;  5FRM A;  2KZV A;  4D1Q A;  1K4S A;  2NOJ B;  2R5Y B;  4EV0 A;  4HF1 A;  5BNG A;  1WJB A;  4AIH A;  3BC8 A;  5F08 A;  5HDG A;  3SZT A;  2X6Y A;  2CH0 A;  2VI6 A;  3ZQH A;  2XAH A;  4AU7 A;  3A4C A;  4IVN A;  5GPA A;  2IA0 A;  2M45 A;  2ME0 A;  2LY2 A;  2H27 A;  3C3W A;  4JP0 A;  2WBM A;  5HOO A;  2Y0S N;  1MH3 A;  1R4M B;  4A3K J;  3EQL F;  5FLV A;  4GDF A;  1B59 A;  1MMG A;  3FM5 A;  1PP8 F;  2KIM A;  4KJZ A;  5J6X A;  4DGW B;  4MHG A;  2R5Y A;  4BHP A;  2JZY A;  4YIF A;  1EF4 A;  4DYR A;  2M9H A;  2R4G A;  5J47 A;  3FXR A;  1NK2 P;  5FKO A;  2XAQ A;  3I9V 2;  3KLO A;  1U6G A;  1ZN2 A;  3TOB A;  1X2M A;  4BXF A;  4Y17 A;  4CCL A;  2LRE A;  2HOT A;  1XTA A;  1QGP A;  3OS2 A;  1TQP A;  4G7O F;  2E1C A;  2FOK A;  1G3W A;  4G9Y A;  3Q9V A;  1BI3 A;  2D1H A;  2X48 A;  2E2J J;  1WVR A;  2R7S A;  1W4M A;  4ZYA A;  3TDZ C;  1YO5 C;  5EGO B;  1TC3 C;  2KP6 A;  2HVR A;  1MDM B;  1H89 C;  4XN0 A;  4OIN F;  4ENJ A;  1YW7 A;  3K70 D;  2C6Y A;  2O3F A;  4WXH A;  2M87 A;  2OA4 A;  3PO2 J;  1CGP A;  4RAG A;  1SAN A;  1MZB A;  4QTR A;  2MW8 A;  2KPM A;  4IO9 F;  4JYK A;  1VQN I;  2A6E F;  1WPK A;  4ZJZ A;  2W00 A;  1ETO A;  4DJA A;  1YE9 A;  2LH9 A;  5HVQ C;  1S5L C;  4KT6 A;  1AA7 A;  1A35 A;  1R58 A;  2LR8 A;  3DEE A;  2FQ3 A;  2LY9 A;  3AKZ A;  1FMV A;  1I3Q J;  3OIQ A;  4HW0 A;  3GLL A;  4A6D A;  1V4R A;  2WV0 A;  1UZC A;  5ICE A;  2MC4 A;  2DFE A;  1B72 B;  1DU6 A;  3K7A J;  5M3F J;  3S2D J;  2VJJ A;  3HSE A;  1K78 B;  1LVA A;  4NBQ A;  2DCE A;  4HV6 A;  1HST A;  3O8G A;  1ZR2 A;  3CCV I;  1JKR C;  2LOO A;  3OYJ A;  5DV5 A;  4ESB A;  3REO A;  2FD5 A;  4BJT A;  3IH2 A;  2E1M C;  5HOD A;  1VQ7 I;  2ZKZ A;  3LSP A;  1LEA A;  2L02 A;  5LEJ A;  2KZG A;  2CQQ A;  5DCF A;  2B0L A;  1UAA A;  3LSH A;  1MJ9 A;  2N8G A;  4BYY A;  2OC6 A;  1U5T A;  1FZP B;  5TRD A;  1UFM A;  2OF7 A;  2L4M A;  1VF9 A;  2QWW A;  1SMY F;  2RV8 A;  4G94 A;  2LKP A;  3ZMT A;  3DPU A;  3CUQ B;  2JK3 A;  2QVO A;  1XMX A;  2HXI A;  3D0S A;  3K69 A;  1P7I A;  4ZZL A;  1O7L A;  2VLA A;  2VXD A;  5D6E A;  5IPA A;  1VQ6 I;  3CTA A;  5CVI A;  1T0F A;  3BT9 A;  3IRR A;  2V9P A;  1XB4 A;  4KMU X;  1GXQ A;  3K70 C;  1B9N A;  2ISZ A;  4M72 A;  4UUT A;  2RNJ A;  3BZC A;  3QYE A;  2R92 J;  4MIM A;  3CCJ I;  2HVS A;  1MBG A;  2DMQ A;  3RKX A;  4WK8 F;  2DJN A;  3T8T A;  1Y6I A;  1GT0 C;  1P7J A;  2H8W A;  1WRJ A;  3ABU A;  4HST A;  3HTU A;  5IP6 A;  2IS2 A;  1Z21 A;  4FCY A;  3QU3 A;  2QSF X;  1Y8R B;  1RES A;  3P9K A;  3M8J A;  1MBH A;  1TTY A;  3HPG A;  4WCG A;  1BI1 A;  1W36 D;  4DYC A;  1XGM A;  2NVQ J;  1BIB A;  4E7S A;  2BW3 B;  2VBY A;  3S32 A;  4MEY F;  2BY1 A;  5DCM A;  3RDI A;  1JKQ C;  5IYD J;  3JRI A;  4M9Z A;  4A6E A;  4F52 A;  3GO5 A;  1ZGW A;  1LE8 B;  1NHA A;  2K27 A;  1R4N B;  3BG9 A;  2NRA C;  3U1K A;  3JRC A;  4IL6 C;  2QBY A;  1I6H J;  3GWZ A;  4D5F A;  3DBR B;  3NEU A;  1YFH A;  3KX2 A;  4HV5 A;  2P5K A;  2BV6 A;  3CMM A;  2L2O A;  4X1E A;  1Z0X A;  2FXA A;  1XMK A;  1ZH5 A;  1T0F C;  5ICG A;  1Z3X A;  2V1U A;  1FTZ A;  2M7A A;  2JPB A;  5B3S H;  1FBS A;  1N75 A;  2X0L A;  5LGN A;  4RB2 C;  2O0Y A;  2M2E A;  1A31 A;  2KT0 A;  4FET A;  3MKW B;  4EJV A;  1HSJ A;  3C2G A;  3CJT B;  1TWA J;  1VZ0 A;  3OIP A;  1FLI A;  1NK3 P;  2JQ7 A;  2VON A;  2VBX A;  2E1M B;  5LHH A;  3M4O J;  2QUF A;  2ZBK A;  2R3S A;  4Q5S F;  3GTL J;  1UG2 A;  2X51 A;  4LMY A;  4BBR J;  1DP7 P;  1FTT A;  3F23 A;  2M1B A;  3FMQ A;  3GFJ A;  1ZYR F;  3LSK A;  3OL3 A;  3TO7 A;  2BY3 A;  1BI2 A;  2PQ8 A;  2AQF A;  3CUQ C;  4UVB A;  5E3L A;  2A5Y B;  1R1U A;  1R7J A;  4Y7N J;  2X6O A;  4RB1 A;  4B47 A;  4V19 K;  1OCZ H;  4ITV A;  5J3L A;  3HOU J;  1LB2 A;  2DDA A;  3BR6 A;  4PFO A;  2QQA A;  3BR5 A;  2KIQ A;  5M3M J;  2A61 A;  1F1Z A;  2LBF B;  5LHG A;  3BR2 A;  3F8B A;  1IN6 A;  3HG9 A;  6PAX A;  1HKS A;  3ASO H;  3W2V A;  1SFK A;  2EK5 A;  1IRG A;  1E0E A;  4ETS A;  3ML6 A;  1PYV A;  3OYN A;  4HSR A;  2E2I J;  4ZDO A;  2RVC A;  4PJN A;  1QNT A;  3BR0 A;  1I1S A;  2IW5 A;  3WG9 A;  2JUC A;  1YYV A;  3OS0 A;  1JI8 A;  3HGG A;  4LLN A;  3OMY A;  1PUF B;  1FMW A;  2E7X A;  1DU0 A;  1WJE A;  1TBX A;  1BOA A;  3KCC A;  5GAE J;  2FOW A;  2VXZ A;  1I1G A;  4EEF G;  1JKO C;  5CQG A;  1Z67 A;  3CCR I;  4A5M A;  1QZY A;  1J0R A;  3KP3 A;  2K4B A;  3KZI C;  1ZAR A;  2H1L A;  2Y0M A;  4BE1 A;  2BGC A;  4D0P A;  4OIO F;  2COM A;  5HS7 A;  4FTH A;  1V3F A;  1POG A;  4KNY A;  3RPQ A;  1ON2 A;  3WG7 H;  3T8R A;  4B43 A;  3FIS A;  3E6D A;  2XGE A;  4UHT A;  2EFP A;  4Y52 J;  1IO2 A;  1QVU A;  1XSV A;  3K2A A;  5L3G A;  3RI4 A;  3O8H A;  1WQ2 A;  3ASN H;  2V4J C;  3ERM A;  4L9J A;  5IT3 A;  1YW9 A;  1T38 A;  5H6R A;  2M3A A;  2XPU A;  4ESF A;  2E71 A;  1U8R A;  3TMO A;  2FEZ A;  2JVG A;  3AFH A;  4A3J J;  3OYF A;  2L54 A;  1FX7 A;  3BP8 A;  4MQ9 F;  1L3L A;  2RNG A;  3ABK H;  2STW A;  3DTK A;  2GOX B;  2EWN A;  2VQC A;  4JK1 X;  4F92 B;  3PIP F;  2P7C B;  5LLQ A;  4IOA F;  1HC8 A;  4QIW N;  2MH2 A;  1WGX A;  3HOZ J;  4A0Y A;  3MWM A;  2Z16 A;  1U5T B;  4U0W A;  2Y30 A;  4LJZ F;  2DMN A;  2L7F P;  1E3P A;  2AO9 A;  2M0M A;  3HGY A;  5GAH J;  5BQT A;  1BL0 A;  3V42 A;  3OSG A;  1FBU A;  1OYW A;  2DYR H;  4L5E A;  2I8D A;  3VEP A;  4HLY A;  2ZSH B;  2GM4 A;  2FBK A;  2YR2 A;  3A01 B;  4II3 A;  3LMM A;  4UNO A;  3LSG A;  1LQ1 A;  3F72 A;  4PZJ A;  2QQ9 A;  2ZXI A;  1QPI A;  2QCO A;  3BR1 A;  5F0H A;  4ESJ A;  4ZH4 F;  1ONV A;  1ON1 A;  4JOM A;  1ORK A;  3T0Y A;  2E5Z A;  3CZ6 A;  4RAY A;  5LGT A;  2MGQ A;  5ILS A;  4N0B A;  1D1B A;  2KIF A;  4XKC A;  1MMS A;  2CV2 A;  1D1A A;  1UST A;  1OCT C;  1WFX A;  2J5O A;  4BH9 A;  2MSY A;  2GIV A;  2NXN B;  1REP C;  1A6Q A;  2IA2 A;  4G7Z F;  3VYS B;  2HEO A;  2HZT A;  4M3E A;  2BW3 A;  2FML A;  2DFH A;  4K2E A;  1PUF A;  3OIO A;  3BJA A;  4C2M J;  3R0A A;  2HZD A;  5LRS A;  1HOM A;  1EH6 A;  1XDU A;  2H6C A;  3DP7 A;  3AAF A;  2CG4 A;  3BWG A;  1O3S A;  4HEA 2;  1ETY A;  2QM3 A;  1PVE A;  2GAU A;  2M4K A;  2EIM H;  2YX7 A;  3WE2 A;  1K6Y A;  1ZAO A;  3A1Y A;  3GTG J;  3VOD A; 
#chains in the Genus database with same CATH homology
 2HDC A;  3F8N A;  3T5X A;  1BC8 C;  3I5U A;  3GFM A;  3T1B A;  4KIF A;  3C7J A;  4G6D A;  3ECH A;  2CYY A;  3JAM K;  1KU2 A;  2Z99 A;  1MJB A;  1SFE A;  2BEO A;  2K86 A;  4KYW A;  2ZME B;  4YFX F;  3V7C A;  3RPU A;  1XCV A;  3ZP5 A;  1ZHF A;  2XAJ A;  4WX9 A;  3F22 A;  2XKP A;  3EET A;  3R0J A;  4AD9 A;  2HOE A;  3KET A;  1XGN A;  2M8E A;  1J59 A;  4P55 A;  1LDK B;  5L3F A;  5DYM A;  3MAJ A;  5CYV A;  4GYI A;  3WU1 B;  3W6K B;  4PCQ A;  1OMI A;  3V7S A;  2QYO A;  2DK8 A;  1IAW A;  4IRI A;  3GEZ A;  2O6G E;  4EJO A;  4FHT A;  4EGZ A;  1P6R A;  1MJA A;  2F5F A;  3ULQ B;  3TDU C;  5ERI A;  1UHW A;  1KU9 A;  3R6S A;  3MFK A;  1HW1 A;  1YS7 A;  2M30 A;  4L5I A;  2H94 A;  2HR3 A;  4EQQ A;  3E5X A;  2EV6 A;  2YU3 A;  4CIC A;  3WTY C;  3NRV A;  1S6L A;  1J5Y A;  3E6B A;  4KIG A;  2DQL A;  4NHJ A;  4UV9 A;  1FP2 A;  3L7W A;  2GQQ A;  1OPC A;  4EM0 B;  1BJA A;  3BRO A;  1O7F A;  3B73 A;  1I5Z A;  4KFC A;  5ILV A;  2K02 A;  3COA C;  3F3X A;  1D8K A;  1HW2 A;  3P9I A;  4M6X A;  3FMS A;  4HYE A;  4EGY A;  1Z1D A;  3TO6 A;  5DEQ A;  3TKY A;  3WTZ A;  5AON A;  5D5U B;  3TQN A;  2PBI A;  4CDG A;  2DBB A;  1L0O C;  4MTD A;  5HLI A;  4HOB A;  1C0W A;  1AWC A;  3HOS A;  5BS6 A;  3JAM Z;  4L9T A;  4M74 A;  2HYF A;  2EFN A;  3N97 A;  3IKV A;  2CFX A;  2UXN A;  4I0B A;  2XAG A;  1KQ8 A;  3P9C A;  3MZY A;  3KZY A;  5LEK A;  2ZCW A;  1JE8 A;  1BBY A;  1ZGA A;  1YLF A;  1RZ4 A;  2QZ8 A;  1O3T A;  3ZPL A;  5FD5 A;  3F6V A;  2P8T A;  3WGH A;  3BZ6 A;  2EB7 A;  3RTR A;  4RGU A;  2DI3 A;  4RS8 A;  1BIA A;  4AVP A;  1FSE A;  3DV8 A;  4WXD A;  4NQW A;  2VC1 A;  3SZP A;  3I53 A;  1SFU A;  3KP7 A;  5IT9 Z;  2A3S A;  4KT5 C;  2CW0 F;  2GWR A;  2WC2 A;  1LJ9 A;  3F8F A;  3U2R A;  3V4G A;  1Z6R A;  4WXC A;  3I0T A;  4MEX F;  2HTJ A;  2WTE A;  3P7N A;  3ISP A;  5E1W A;  4LFU A;  3HRM A;  2EA2 A;  4YII A;  2M5W A;  3R4K A;  3M8E A;  4LG0 B;  3F8M A;  3K1P A;  3LQQ A;  3I58 A;  4BHB A;  2HWV A;  1FSH A;  1ZRE A;  3E6C C;  3K0L A;  4H0E A;  3L9F A;  2LF8 A;  3J80 K;  3DXJ F;  1E2X A;  4E70 A;  4HF2 A;  4OIQ F;  2YPR A;  4LD5 A;  2DQR A;  2E7W A;  2HKO A;  1ZLJ A;  5DD4 A;  3EDP A;  1JGS A;  3JTG A;  3F8C A;  2UXX A;  4MQV A;  3JW4 A;  3RYR A;  4L9N A;  2Z9O A;  3MCZ A;  2FBI A;  2Q2E A;  3V8L A;  2PN6 A;  2GXB A;  3U1D A;  2NNY A;  2HQR A;  2OAZ A;  3L09 A;  3WTS C;  3QU6 A;  2DAO A;  1H9G A;  2FU4 A;  3CJN A;  3PQK A;  4CZZ A;  5FD6 A;  1TW2 A;  2DLL A;  2MD5 A;  3C18 A;  5KK1 A;  5L3C A;  3OOP A;  1FOK A;  4B09 A;  1R22 A;  4ZZD A;  2F2E A;  2GA1 A;  4KMF A;  5ILU A;  1XD7 A;  1IXS B;  1R1T A;  2Y48 A;  4I2O A;  2RDP A;  1ODD A;  4OIR F;  3K1M A;  2OU2 A;  2Q8K A;  4LG0 A;  2XRO A;  2OZU A;  4BAY A;  1B6A A;  1T2K A;  1BC7 C;  2VBW A;  1CF7 A;  1W7P B;  2G9W A;  3J81 Z;  1GXP A;  1FPQ A;  2DO7 A;  3OV8 A;  1K7A A;  3KP6 A;  4QLC U;  1P2F A;  2F5C A;  4HLX A;  2OD5 A;  1U2W A;  1HW5 A;  2KJC A;  2P4W A;  5FFZ A;  4IPA A;  3QAH A;  4IJA A;  3ZMZ A;  1DPR A;  3HTS B;  5BOX A;  4KA4 A;  3E3V A;  5HDK A;  1B4A A;  3WOD F;  2HKX A;  3ZMS A;  2V1D A;  3RKY A;  1WKM A;  3DKW A;  2LF7 A;  1T39 A;  4EMS A;  1U3E M;  4XLN F;  4L9V A;  5DUI A;  3CDH A;  4EM1 A;  1G3S A;  4KIC A;  2V9V A;  3V7R A;  2A6H F;  3I4P A;  3V8K A;  3M9A A;  3DPT A;  1K79 A;  3RJP A;  3KP5 A;  3GZ5 A;  5D4S A;  4U7B A;  4M9X A;  1Z9C A;  3CUO A;  2O61 A;  3IC7 A;  1SMT A;  2PG4 A;  1GHC A;  1RIO H;  1KYZ A;  3IRQ A;  2W84 A;  2XRN A;  2P5L C;  2D1V A;  4LGW A;  2ZO4 A;  4IRG A;  3HHH A;  3S2W A;  1FNN A;  2PI0 A;  1FYL A;  1OYY A;  3GYH X;  3ZN1 A;  2LSO A;  1O3R A;  1FYK A;  2OZ6 A;  2VOP A;  5L3B A;  3BDD A;  3BY6 A;  5D8L B;  2HS5 A;  3BPX A;  2FNP A;  5DD8 A;  1SD5 A;  3DF8 A;  4I02 A;  3H92 A;  5F6F A;  4LK1 F;  3GFI A;  4ENK A;  2FRH A;  1IUY A;  3KZZ A;  3L00 A;  4Y13 A;  1ZRD A;  4F7Z A;  1TNS A;  4UXN A;  4BQA A;  3HSF A;  1UB9 A;  5HLH A;  2MC3 A;  3WE3 A;  1ZRF A;  5KVR A;  2ADU A;  4JQF A;  4WWC A;  2A07 F;  4RGR A;  2IP2 A;  2ACJ A;  4U88 A;  4A5N A;  4XLP F;  1PDN C;  2OBP A;  4UUV A;  2EA4 A;  3LST A;  3EUH A;  2JPC A;  2ZXJ A;  3GZ6 A;  3KEQ A;  5EEG A;  4IRH A;  2PFB A;  5D4R A;  1LNW A;  1J2X A;  4R8H A;  4A2U A;  3HHG A;  1EH8 A;  4EJW A;  1I6X A;  1FC3 A;  2MBF A;  2OQG A;  2QQB A;  3E97 A;  2W24 A;  2DW4 A;  4NB5 A;  5DCM B;  3ROU A;  2IJL A;  3QP6 A;  1I27 A;  2JT1 A;  1HKT A;  2F5D A;  3M1E A;  1R5H A;  4CYD A;  1BN5 A;  3LAJ A;  5E1X A;  1YTY A;  3EYI A;  3H3Z A;  1XSD A;  2P6T A;  2K4J A;  2F5E A;  5BPI A;  1BM9 A;  5E1Z B;  3TOA A;  3MZH A;  4L0Z B;  2A68 F;  3RYP A;  3MQ0 A;  1B9M A;  3SXY A;  4OMY A;  1BI0 A;  2X4H A;  1KYW A;  2CQK A;  3K9T A;  4R1H A;  1ZGJ A;  5L3E A;  3LA2 A;  3ABT A;  1H9T A;  4P9U A;  4I09 A;  5A2Q K;  5CLS A;  4OOI A;  1JHH A;  4FX4 A;  1STZ A;  2EFW A;  2O8X A;  3GF2 A;  4HX8 A;  4M6Y A;  2PJP A;  2RN7 A;  3HOT A;  1T98 A;  1KQ9 A;  1KU3 A;  1VTN C;  2PMU A;  4LLG F;  2MLK A;  4HZF A;  3H3U A;  2Z33 A;  1K78 A;  4U0Y A;  2UWM A;  1XDS A;  3HIF A;  3ERE D;  3HUG A;  4TV7 A;  1YQA A;  3CO6 C;  1P4A A;  1SD4 A;  4HQE A;  1KU7 A;  2XGX A;  4N9H A;  2VE8 A;  2ZJ2 A;  2STT A;  4Q48 A;  3I71 A;  1W7P A;  1FYM A;  2VOD A;  5DDG A;  5LRR A;  1R36 A;  5E18 F;  1P92 A;  1IXC A;  4CHU A;  3R60 A;  3FHZ A;  2DTR A;  1RNL A;  4OU0 A;  2D45 A;  2G7U A;  2GA2 A;  1XN7 A;  1S3J A;  2R7F A;  1YIO A;  1Y0U A;  2LNB A;  1W7P D;  2BE5 F;  4O3M A;  2P6S A;  1FP1 D;  3LAP A;  3O2P E;  2K7L A;  1WWX A;  4KN7 X;  2EFO A;  2ZME A;  1IN4 A;  1B1B A;  4A0X A;  3SHF A;  1PP7 U;  3GVA A;  1DUX C;  3C1D A;  5TJJ A;  5K1Y A;  4I7H A;  1ULY A;  3E5U A;  4UVA A;  3G73 A;  2FBH A;  2PEX A;  3RKW A;  4EJU A;  5K5Q A;  5CVU A;  2DT5 A;  2Q0O A;  3LA7 A;  3KLN A;  4ZYG A;  1SFX A;  4ZYD A;  4MGR A;  1R23 A;  2QEN A;  4PGG A;  1GVJ A;  1FY7 A;  3WTU C;  4L5J A;  1F9N A;  2O03 A;  3LQR A;  2HFH A;  2EV5 A;  3BOQ A;  2VE9 A;  4HX7 A;  1ZG1 A;  4FT8 A;  2CWE A;  2IT0 A;  1RUN A;  2ZNY A;  4A12 A;  4P5O A;  3I64 A;  3DFG A;  4L0Y B;  2ETH A;  2IA1 A;  1TW3 A;  2AXL A;  3F6O A;  5D5V B;  1XCB A;  1ZRC A;  3PFI A;  1OYI A;  4FX0 A;  3KFW X;  2RC4 A;  2ESN A;  2XHK A;  2KIU A;  3K1N A;  4ENM A;  1KQ0 A;  3G3Z A;  4I98 B;  5DUK A;  3LA3 A;  2RGV A;  3IL2 A;  3JTH A;  5D8K B;  4DQ2 A;  2VT2 A;  4BNC A;  3BJ6 A;  1D5V A;  3PQJ A;  5ED4 A;  2CGP A;  3BJO A;  3E5Q A;  2CSO A;  3IWF A;  1A04 A;  5FGM A;  4LB6 B;  2LDU A;  4OMZ A;  2VT3 A;  1WSU A;  1RI7 A;  3ZN0 A;  2DPD A;  4U7D A;  1G3T A;  1IN8 A;  1S7O A;  1UHM A;  4KIB A;  3ZMD A;  5E8G A;  3SQN A;  4GYG A;  4XBF A;  2HYG D;  3QPT A;  5JHU A;  5BMZ A;  2FNA A;  2ESH A;  3JSO A;  4OIP F;  1W5T A;  1P4W A;  1F4K A;  2GZW A;  4WF2 A;  5J8F A;  3J81 K;  2JSC A;  2Y75 A;  1LEB A;  3HRU A;  1U5T C;  4RAZ A;  1IN7 A;  1HBX G;  3R61 A;  2W25 A;  3W6J B;  4N9I A;  1IRF A;  4A0Z A;  4YG2 F;  4EVI A;  3FXQ A;  3Q9S A;  4G6Q A;  3GFL A;  5CVR A;  3WTT C;  3HRT A;  2BYV E;  2ELH A;  2Z3Y A;  1EH7 A;  2KJB A;  3HRS A;  5JR3 A;  2XKO A;  3IHU A;  4I0A A;  2Z5U A;  3HSR A;  3SFZ A;  1S7A A;  2QBY B;  4R79 A;  3QPH A;  1J75 A;  5E8I A;  1P4X A;  4LLL A;  3RIR A;  3GX4 X;  5E17 F;  2FA5 A;  3KP4 A;  4HX4 A;  1YS6 A;  1TQM A;  3CUQ A;  2L01 A;  4MTE A;  1JXS A;  1FT9 A;  2V1X A;  1IZ1 A;  3DEU A;  3GW2 A;  1IF1 A;  5F1R A;  1KGS A;  3M8F A;  1MGT A;  1MKM A;  2DPU A;  2FE3 A;  5CVJ A;  3FZV A;  1HXD A;  3E6M A;  2RQP A;  3TGN A;  2HTS A;  4ON0 A;  2VN2 A;  3O3K A;  5HS8 A;  2AS5 F;  4MNU A;  2L3D A;  2XIG A;  4DNC A;  2DFI A;  4XSX F;  2QLZ A;  5FLX K;  4EM2 A;  3J80 Z;  5EEH A;  2KKO A;  1IW7 F;  2PMH A;  1FBQ A;  5JI6 A;  1XSX A;  2VC0 A;  5LGU A;  4HDU A;  2EFQ A;  1EV7 A;  4IHS A;  2HQN A;  3KEO A;  3GUD A;  2P7V B;  1YG2 A;  1QO0 D;  3QP5 A;  4CXF A;  2YX4 A;  3VFZ A;  2OQR A;  4RGX A;  1O57 A;  3Q5F A;  2JTV A;  2DU9 A;  2NS0 A;  4KDP A;  3FM3 A;  5IT9 K;  4S04 A;  1J7K A;  4UV8 A;  5AIQ A;  5LBQ A;  4KN4 X;  2NNN A;  1D3Y A;  5HS9 A;  2DK5 A;  4UVC A;  4I01 A;  1X3U A;  4RGS A;  3WGI A;  5E20 A;  4HQM A;  1ZG5 A;  2YSR A;  4Z2Y A;  2HGC A;  1T6S A;  3N4M A;  4G7H F;  4Y15 A;  1WI9 A;  2IVM A;  5D5X B;  2V79 A;  4GCV A;  4BXU A;  3DQV C;  2E1N A;  4XRF A;  3VOE A;  2KRF A;  3WTV C;  1LDJ A;  5JFR A;  3QOP A;  4BHC A;  2GXG A;  2MA3 A;  1MDM A;  1FWZ A;  2EJR A;  2WWY A;  1MD0 A;  4G8X A;  4EJT A;  1ZG3 A;  1G6N A;  3ZMU A;  1JHF A;  2PLY A;  3WTX C;  1HQC A;  5L3D A;  2J5P A;  4HBL A;  2FMY A;  4GGG A;  2BBY A;  3L2C A;  2P5V A;  1QQI A;  3IWZ A;  4ZYH A;  3WTW C;  4GO1 A;  3DPL C;  4RB3 C;  2CO5 A;  1HKQ A;  4YFK F;  1R5G A;  2JRT A;  3WGG A;  5FLX Z;  1TNT A;  2VBZ A;  5FFX A;  2MLG A;  4O5V A;  2UZK A;  2XUB A;  5F64 A;  1QBJ A;  1H0M A;  4RB0 A;  2MH9 A;  2G7H A;  3ZMV A;  3LFK A;  4M73 A;  2FSW A;  5H6Q A;  1TLH B;  1Z6T A;  3I59 B;  5FB2 A;  1TQI A;  2W57 A;  1ZLK A;  3LWF A;  1W5S A;  2V6C A;  4XSZ F;  1G4D A;  3FXU A;  1IN5 A;  3MEX A;  4PDK A;  4P96 A;  4AIJ A;  1Z7U A;  5CVV A;  3KE2 A;  3TO9 A;  4AIK A;  4IHT A;  1O3Q A;  3J7A O;  3WU0 A;  1OKR A;  4ZYE A;  1R00 A;  3I59 A;  1QPM A;  1XGS A;  4GXO A;  1D8J A;  3CLO A;  1Z91 A;  1IXR C;  1YW8 A;  1F5T A;  4U0V A;  1J9I A;  5ICF A;  5D5W B;  3BPV A;  3V8J A;  4LK0 F;  5JVT A;  5FO5 A;  2RKH A;  3U9G A;  2W85 A;  5H20 A;  1XGO A;  5K5R A;  2ZNZ A;  3CO7 C;  4B8X A;  4M71 A;  5D6F A;  4HA8 A;  1OR7 A;  3IKT A;  2XV4 S;  1SAX A;  3FWE A;  4KUM A;  1LDD A;  4M9S A;  3GLX A;  1K6O A;  5ICC A;  1S8N A;  1DPU A;  4P9F A;  3ELK A;  4HDV A;  1Z05 A;  2NAZ A;  5K5O A;  3FMR A;  4AWX B;  3I54 A;  4ENN A;  4HF0 A;  3B02 A;  1R1V A;  2D2W A;  5BPD A;  1AOY A;  4CO8 A;  3FF5 A;  3M7G A;  1S29 A;  5HLG A;  3QRF F;  2FF4 A;  3GXO A;  2NYX A;  2XAF A;  2IRF G;  3D5L A;  4Q47 A;  2A69 F;  3FX3 A;  1XMA A;  2XAS A;  2ZFW A;  3NQO A;  1USS A;  3K2Z A;  2XVC A;  5CJ9 A;  3ZQ7 A;  4LB5 A;  1SD7 A;  2H6B A;  5HDN A;  4QWQ A;  4CGZ A;  1QZZ A;  3EYY A;  3F21 A;  5LHI A;  2H09 A;  5A2Q Z;  4L18 B;  1U78 A;  4S05 A;  4ASN A;  3JSP A;  2TDX A;  1KA8 A;  2IPQ X;  5AIP A;  3ECO A;  3VB2 A;  1UCR A;  4YFN F;  2VOO A;  3O6B B;  1E17 A;  4Q4Z F;  1RUO A;  4PGH A;  1G3Y A;  4JBA A;  2R7D A;  1CF7 B;  3HYI A;  4IXA A;  2EV0 A;  1SD6 A;  1DDN A;  4O6J A;  1PUE E;  4HAM A;  1Q1H A;  2L4A A;  2ISY A;  5J8C A;  3KP2 A;  4IF4 A;  4EV0 A;  4HF1 A;  4AIH A;  5HDG A;  3SZT A;  2XAH A;  4IVN A;  2IA0 A;  2M45 A;  2H27 A;  3C3W A;  5HOO A;  3EQL F;  1B59 A;  3FM5 A;  1PP8 F;  2KIM A;  5J6X A;  4MHG A;  4BHP A;  2JZY A;  4YIF A;  3FXR A;  2XAQ A;  3KLO A;  1U6G A;  1ZN2 A;  3TOB A;  4Y17 A;  1QGP A;  1TQP A;  4G7O F;  2E1C A;  2FOK A;  1G3W A;  4G9Y A;  3Q9V A;  1BI3 A;  2D1H A;  1W4M A;  3TDZ C;  1YO5 C;  1MDM B;  4OIN F;  4ENJ A;  1YW7 A;  2C6Y A;  2O3F A;  4WXH A;  2M87 A;  2OA4 A;  1CGP A;  1MZB A;  2A6E F;  5HVQ C;  1R58 A;  2FQ3 A;  4HW0 A;  4A6D A;  1V4R A;  2WV0 A;  5ICE A;  3HSE A;  1K78 B;  1LVA A;  4HV6 A;  1HST A;  5DV5 A;  4ESB A;  3REO A;  2ZKZ A;  1LEA A;  2L02 A;  5LEJ A;  5DCF A;  2B0L A;  1MJ9 A;  4BYY A;  1U5T A;  1FZP B;  5TRD A;  1UFM A;  2L4M A;  2QWW A;  1SMY F;  2RV8 A;  4G94 A;  2LKP A;  3ZMT A;  3CUQ B;  2QVO A;  3D0S A;  3K69 A;  4ZZL A;  1O7L A;  5D6E A;  3CTA A;  5CVI A;  1T0F A;  3IRR A;  4KMU X;  1XB4 A;  1GXQ A;  1B9N A;  2ISZ A;  4M72 A;  2RNJ A;  3RKX A;  4WK8 F;  3T8T A;  1WRJ A;  3ABU A;  3HTU A;  3QU3 A;  3P9K A;  1TTY A;  4WCG A;  1BI1 A;  1XGM A;  1BIB A;  2VBY A;  4MEY F;  5DCM A;  3RDI A;  4M9Z A;  4A6E A;  3GO5 A;  2NRA C;  1NHA A;  2K27 A;  2QBY A;  3GWZ A;  1YFH A;  3NEU A;  4HV5 A;  2P5K A;  2BV6 A;  2FXA A;  1XMK A;  1ZH5 A;  5ICG A;  2V1U A;  2JPB A;  1FBS A;  2X0L A;  5LGN A;  4RB2 C;  2O0Y A;  4EJV A;  1HSJ A;  1FLI A;  2VON A;  2VBX A;  5LHH A;  2QUF A;  2ZBK A;  2R3S A;  4Q5S F;  4LMY A;  1DP7 P;  3F23 A;  2M1B A;  3FMQ A;  3GFJ A;  1ZYR F;  3TO7 A;  1BI2 A;  2PQ8 A;  3CUQ C;  4UVB A;  2A5Y B;  1R1U A;  1R7J A;  4RB1 A;  1LB2 A;  2QQA A;  2A61 A;  1F1Z A;  5LHG A;  3F8B A;  1IN6 A;  6PAX A;  1HKS A;  1IRG A;  2EK5 A;  4ETS A;  3ML6 A;  2RVC A;  1QNT A;  1I1S A;  2IW5 A;  3WG9 A;  1YYV A;  4LLN A;  2E7X A;  1TBX A;  1BOA A;  3KCC A;  2VXZ A;  1I1G A;  4A5M A;  1QZY A;  1J0R A;  3KP3 A;  2K4B A;  1ZAR A;  2Y0M A;  2BGC A;  4D0P A;  4OIO F;  2COM A;  5HS7 A;  1V3F A;  4KNY A;  3RPQ A;  1ON2 A;  3T8R A;  3E6D A;  4UHT A;  2EFP A;  1XSV A;  5L3G A;  3RI4 A;  1WQ2 A;  4L9J A;  5IT3 A;  1T38 A;  1YW9 A;  5H6R A;  4ESF A;  1U8R A;  2FEZ A;  2L54 A;  1FX7 A;  3BP8 A;  4MQ9 F;  1L3L A;  2STW A;  2EWN A;  4JK1 X;  2P7C B;  5LLQ A;  2MH2 A;  4A0Y A;  3MWM A;  1U5T B;  4U0W A;  4LJZ F;  5BQT A;  1FBU A;  1OYW A;  3VEP A;  4HLY A;  2FBK A;  2YR2 A;  4UNO A;  1LQ1 A;  3F72 A;  4PZJ A;  2QQ9 A;  4ESJ A;  4ZH4 F;  1ONV A;  1ON1 A;  3T0Y A;  4RAY A;  5LGT A;  5ILS A;  4N0B A;  2KIF A;  1UST A;  2J5O A;  4BH9 A;  2GIV A;  1REP C;  2IA2 A;  4G7Z F;  2HEO A;  2HZT A;  2FML A;  4K2E A;  3BJA A;  3R0A A;  5LRS A;  1EH6 A;  1XDU A;  2H6C A;  3DP7 A;  3AAF A;  2CG4 A;  3BWG A;  1O3S A;  2QM3 A;  2GAU A;  2YX7 A;  3WE2 A;  1ZAO A;  3VOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...