2B0RA

Crystal structure of cyclase-associated protein from cryptosporidium parvum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
RQVVTNGSPKVELQKDTYLVENHVNCADPITLSEGSIKNKVSVRCSQNSRIIVEQKVNSIFIENCVGCIFLVNGVISSIEIVNCDDIKLQMTGIVPTISLDKSNKVNIYTSKEGKNVEVYSSKSSEMNLLFPGEEEGDWKELAIPEQFVTKYNESKGKLESMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords possible adenyl cyclase-associated protein
publication title Structure and function of a G-actin sequestering protein with a vital role in malaria oocyst development inside the mosquito vector
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Unknown function
total genus 49
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08603 CAP_C Adenylate cyclase associated (CAP) C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2b0rA00
2YUHA 1KQ5A 3BH7B 3BH6B 2B0RA 2BX6A 1K4ZA 1K8FA 4V02C 1HF2A
chains in the Genus database with same CATH superfamily
3SYJA 3GQ9A 4XR6A 1JRGA 2UVEA 4OJLA 4XLFA 2BM5A 3SUCA 4OPWA 1O8DA 2VBMA 3PSSA 2XT4A 2PYGA 4XOTA 1WXRA 2O17A 1EE6A 1HG8A 1OGOX 1LM1A 2X3HA 1PE9A 4OZZA 2QZAA 4YZAA 1O8LA 1O8MA 3ML3A 4I84A 4XKVA 1O8JA 2BM4A 3GRHA 1RU4A 2XC1A 3VMWA 2X6XA 4XORA 1O88A 2EWEA 3H09A 4XMYA 3LMWA 1K4ZA 1RWRA 3DU1X 2BSPA 4YDTA 2NT9A 1EZGA 2O0VA 1KQ5A 4OJPA 4YC5A 1JTAA 2B0RA 2NTBA 4NK6A 4XONA 1LLWA 2X6WA 1PXZA 4XL9A 1X0CA 3TH0A 1TYWA 2PECA 1OGMX 2INUA 3B8YA 4JRAC 3UW0A 2IOUG 2BM6A 1BHEA 2NZMA 4W8TA 1WMRA 1HF2A 2NSPA 1AIRA 5JLVC 2NT6A 1O8HA 1RMGA 2VFQA 4XLCA 3WWGA 5JMCB 1PLUA 4W8RA 4MR0A 4XNFA 4XOPA 4HWVA 2VBEA 2G0YA 2J8KA 1O8GA 1IA5A 2BX6A 1GQ8A 2VFMA 3EQOA 3NAWA 2X85A 3BH6B 1IDKA 1TYUA 4YZXA 3LYCA 2VJJA 1KCDA 4URRA 1KCCA 1QJVA 1O8IA 2QYUA 3KRGA 1VBLA 2INVA 3LJYA 3SZEA 1K5CA 1QA3A 2VBKA 1IB4A 1XG2A 1O8KA 1OFEA 1DBGA 4C2LA 3FY3A 4XN3A 3B4NA 1NHCA 2XTXA 2Z8GA 2XTWA 4XLAA 3N90A 1KTWA 1TYVA 2UVFA 4XKWA 2QY1A 1CZFA 2VFPA 2XT2A 2VJIA 5AMVA 4YZ0A 3EQNA 4OJOA 4U4BA 2YUHA 4AVZA 1QRBA 3PSZA 2PYHA 1DBOA 4YZQA 3VSVA 2W7ZA 1BN8A 1IDJA 2X6YA 3AK5A 4XM3A 3VMVA 2VFNA 4PMHA 3PETA 4XLHA 3SQVA 3T9GA 1CLWA 4OJ5A 2IQ7A 4XLEA 1QA2A 3B90A 3ZSCA 3GQ7A 3BH7B 2O04A 4MXNA 3VSTA 1OFLA 3RIQA 3JX8A 3N6ZA 1QQ1A 1K8FA 3GQAA 4V02C 5C1EA 4EW9A 4YEIA 5C1CA 2VFOA 1QRCA 1LLZA 3SY2A 1O8FA 2O6WA 3P4GA 1QCXA 1TYXA 4XN0A 4W8SA 1QA1A 4KH3A 1TSPA 3VSUA 1OFMA 2O1DA 2NSTA 4NK8A 2O0WA 2QXZA 1EA0A 4OM9A 1H80A 1OOCA 2F3LA 4OJ6A 5DNSA 4Z03A 4Z05A 2NTQA 4U49A 3JURA 4XQFA 2ODLA 3GQ8A 2J8IA 2NTPA 2V5IA 4OZYA 2QX3A 3ZPPA 1L1IA 1OFDA 1O8EA 2BM7A 4YCQA 4YFOA 1DABA 3NB2A 4YEJA 4Z06A 4YELA 4W8QA 2XTYA
chains in the Genus database with same CATH topology
3SYJA 3TH0A 3N90A 1TYVA 1TYWA 4OJLA 2BM5A 2VFPA 4OPWA 2VFOA 1QRCA 4JRAC 2IOUG 2BM6A 1WXRA 4OJOA 1HF2A 3P4GA 2YUHA 5JMCB 1TYXA 5JLVC 2VFQA 1QA1A 1QRBA 4KH3A 1TSPA 3ML3A 2G0YA 2BM4A 2BX6A 2XC1A 2VFMA 2W7ZA 3AK5A 3H09A 3BH6B 1TYUA 2F3LA 4OJ6A 4OM9A 2VFNA 1K4ZA 3LYCA 3PETA 1QA3A 1CLWA 3LJYA 4OJ5A 2J8IA 3SZEA 2V5IA 1QA2A 4OJPA 1KQ5A 2BM7A 3BH7B 2B0RA 1DABA 3RIQA 3JX8A 3N6ZA 1QQ1A 1K8FA 4V02C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUH A;  1KQ5 A;  3BH7 B;  3BH6 B;  2B0R A;  2BX6 A;  1K4Z A;  1K8F A;  4V02 C;  1HF2 A; 
#chains in the Genus database with same CATH topology
 3SYJ A;  3GQ9 A;  4XR6 A;  1JRG A;  2UVE A;  4OJL A;  4XLF A;  2BM5 A;  3SUC A;  4OPW A;  1O8D A;  2VBM A;  3PSS A;  2XT4 A;  2PYG A;  4XOT A;  1WXR A;  2O17 A;  1EE6 A;  1HG8 A;  1OGO X;  1LM1 A;  2X3H A;  1PE9 A;  4OZZ A;  2QZA A;  4YZA A;  1O8L A;  1O8M A;  3ML3 A;  4I84 A;  4XKV A;  1O8J A;  2BM4 A;  3GRH A;  1RU4 A;  2XC1 A;  3VMW A;  2X6X A;  4XOR A;  1O88 A;  2EWE A;  3H09 A;  4XMY A;  3LMW A;  1K4Z A;  1RWR A;  3DU1 X;  2BSP A;  4YDT A;  2NT9 A;  1EZG A;  2O0V A;  1KQ5 A;  4OJP A;  4YC5 A;  1JTA A;  2B0R A;  2NTB A;  4NK6 A;  4XON A;  1LLW A;  2X6W A;  1PXZ A;  4XL9 A;  1X0C A;  3TH0 A;  1TYW A;  2PEC A;  1OGM X;  2INU A;  3B8Y A;  4JRA C;  3UW0 A;  2IOU G;  2BM6 A;  1BHE A;  2NZM A;  4W8T A;  1WMR A;  1HF2 A;  2NSP A;  1AIR A;  5JLV C;  2NT6 A;  1O8H A;  1RMG A;  2VFQ A;  4XLC A;  3WWG A;  5JMC B;  1PLU A;  4W8R A;  4MR0 A;  4XNF A;  4XOP A;  4HWV A;  2VBE A;  2G0Y A;  2J8K A;  1O8G A;  1IA5 A;  2BX6 A;  1GQ8 A;  2VFM A;  3EQO A;  3NAW A;  2X85 A;  3BH6 B;  1IDK A;  1TYU A;  4YZX A;  3LYC A;  2VJJ A;  1KCD A;  4URR A;  1KCC A;  1QJV A;  1O8I A;  2QYU A;  3KRG A;  1VBL A;  2INV A;  3LJY A;  3SZE A;  1K5C A;  1QA3 A;  2VBK A;  1IB4 A;  1XG2 A;  1O8K A;  1OFE A;  1DBG A;  4C2L A;  3FY3 A;  4XN3 A;  3B4N A;  1NHC A;  2XTX A;  2Z8G A;  2XTW A;  4XLA A;  3N90 A;  1KTW A;  1TYV A;  2UVF A;  4XKW A;  2QY1 A;  1CZF A;  2VFP A;  2XT2 A;  2VJI A;  5AMV A;  4YZ0 A;  3EQN A;  4OJO A;  4U4B A;  2YUH A;  4AVZ A;  1QRB A;  3PSZ A;  2PYH A;  1DBO A;  4YZQ A;  3VSV A;  2W7Z A;  1BN8 A;  1IDJ A;  2X6Y A;  3AK5 A;  4XM3 A;  3VMV A;  2VFN A;  4PMH A;  3PET A;  4XLH A;  3SQV A;  3T9G A;  1CLW A;  4OJ5 A;  2IQ7 A;  4XLE A;  1QA2 A;  3B90 A;  3ZSC A;  3GQ7 A;  3BH7 B;  2O04 A;  4MXN A;  3VST A;  1OFL A;  3RIQ A;  3JX8 A;  3N6Z A;  1QQ1 A;  1K8F A;  3GQA A;  4V02 C;  5C1E A;  4EW9 A;  4YEI A;  5C1C A;  2VFO A;  1QRC A;  1LLZ A;  3SY2 A;  1O8F A;  2O6W A;  3P4G A;  1QCX A;  1TYX A;  4XN0 A;  4W8S A;  1QA1 A;  4KH3 A;  1TSP A;  3VSU A;  1OFM A;  2O1D A;  2NST A;  4NK8 A;  2O0W A;  2QXZ A;  1EA0 A;  4OM9 A;  1H80 A;  1OOC A;  2F3L A;  4OJ6 A;  5DNS A;  4Z03 A;  4Z05 A;  2NTQ A;  4U49 A;  3JUR A;  4XQF A;  2ODL A;  3GQ8 A;  2J8I A;  2NTP A;  2V5I A;  4OZY A;  2QX3 A;  3ZPP A;  1L1I A;  1OFD A;  1O8E A;  2BM7 A;  4YCQ A;  4YFO A;  1DAB A;  3NB2 A;  4YEJ A;  4Z06 A;  4YEL A;  4W8Q A;  2XTY A; 
#chains in the Genus database with same CATH homology
 3SYJ A;  3TH0 A;  3N90 A;  1TYV A;  1TYW A;  4OJL A;  2BM5 A;  2VFP A;  4OPW A;  2VFO A;  1QRC A;  4JRA C;  2IOU G;  2BM6 A;  1WXR A;  4OJO A;  1HF2 A;  3P4G A;  2YUH A;  5JMC B;  1TYX A;  5JLV C;  2VFQ A;  1QA1 A;  1QRB A;  4KH3 A;  1TSP A;  3ML3 A;  2G0Y A;  2BM4 A;  2BX6 A;  2XC1 A;  2VFM A;  2W7Z A;  3AK5 A;  3H09 A;  3BH6 B;  1TYU A;  2F3L A;  4OJ6 A;  4OM9 A;  2VFN A;  1K4Z A;  3LYC A;  3PET A;  1QA3 A;  1CLW A;  3LJY A;  4OJ5 A;  2J8I A;  3SZE A;  2V5I A;  1QA2 A;  4OJP A;  1KQ5 A;  2BM7 A;  3BH7 B;  2B0R A;  1DAB A;  3RIQ A;  3JX8 A;  3N6Z A;  1QQ1 A;  1K8F A;  4V02 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...