2B0RA

Crystal structure of cyclase-associated protein from cryptosporidium parvum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
RQVVTNGSPKVELQKDTYLVENHVNCADPITLSEGSIKNKVSVRCSQNSRIIVEQKVNSIFIENCVGCIFLVNGVISSIEIVNCDDIKLQMTGIVPTISLDKSNKVNIYTSKEGKNVEVYSSKSSEMNLLFPGEEEGDWKELAIPEQFVTKYNESKGKLESMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a G-actin sequestering protein with a vital role in malaria oocyst development inside the mosquito vector
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Unknown function
molecule keywords possible adenyl cyclase-associated protein
total genus 49
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08603 CAP_C Adenylate cyclase associated (CAP) C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2b0rA00
1K8FA 4V02C 3BH6B 1KQ5A 2B0RA 1K4ZA 1HF2A 3BH7B 2BX6A 2YUHA
chains in the Genus database with same CATH superfamily
1TYVA 1OGMX 3EQNA 3VSTA 3KRGA 1EZGA 4YZAA 3SQVA 1GQ8A 1RU4A 4KH3A 1O8HA 4V02C 5AMVA 1PXZA 3SYJA 1IA5A 2VFNA 3JURA 3LMWA 2BX6A 1TSPA 3LJYA 2O04A 1RWRA 2VFMA 2J8KA 3B90A 3N6ZA 3NAWA 1TYWA 4W8SA 4YZQA 4YFOA 4XOTA 1HG8A 2IOUG 1NHCA 4XMYA 4XNFA 4XONA 3SUCA 3ML3A 4XLFA 1O8GA 4U4BA 3TH0A 3VSVA 3ZSCA 2BM5A 2EWEA 2UVFA 1IB4A 2NTPA 4XQFA 5C1EA 1CZFA 1HF2A 1X0CA 2W7ZA 3EQOA 3GQ8A 3GQ9A 3VMVA 2O6WA 2J8IA 4MR0A 1KCCA 2X6YA 2NSPA 2O0WA 3PETA 5DNSA 2Z8GA 1O8DA 4OM9A 3AK5A 3P4GA 4YCQA 4W8TA 1BN8A 3B8YA 1QRBA 2X85A 2B0RA 2XT2A 1O8IA 1QQ1A 2XT4A 3GRHA 3LYCA 3WWGA 2INUA 3T9GA 1K5CA 4OJ5A 2X6XA 2BM4A 3RIQA 3GQ7A 4EW9A 1LM1A 1O8KA 2O0VA 1O8EA 2ODLA 1QCXA 4XR6A 1EA0A 2XTWA 4XL9A 5JLVC 2BM6A 2BSPA 2V5IA 1AIRA 2PYHA 1JRGA 2X3HA 3NB2A 4MXNA 4W8RA 2QZAA 4XOPA 3SZEA 3B4NA 1EE6A 4I84A 3VSUA 1BHEA 4OPWA 1OFMA 1OFLA 3ZPPA 2NTBA 2VBMA 4OZYA 3PSZA 2G0YA 1WMRA 4PMHA 1WXRA 1KCDA 3DU1X 1RMGA 1JTAA 4OZZA 4XM3A 4YC5A 5C1CA 2UVEA 4URRA 1O88A 1OFEA 2QY1A 2NTQA 3BH6B 3JX8A 4OJPA 4AVZA 2VJJA 3FY3A 4NK6A 2VFQA 4YELA 3GQAA 1TYXA 1QJVA 4XLHA 4OJ6A 4XN0A 1H80A 1CLWA 2NT9A 4HWVA 4Z05A 2IQ7A 2XC1A 2BM7A 4YDTA 2NZMA 1IDJA 1OGOX 3H09A 1IDKA 1K8FA 1QA2A 1O8LA 4JRAC 1L1IA 3VMWA 4Z06A 4XLAA 1K4ZA 1O8FA 2NSTA 1O8JA 3UW0A 2QXZA 4U49A 4XLEA 1LLWA 4XKWA 2O1DA 4C2LA 3N90A 2O17A 4Z03A 2VBKA 1QRCA 2F3LA 1VBLA 4W8QA 1QA1A 1TYUA 2QX3A 1PLUA 4XKVA 5JMCB 1KQ5A 4OJLA 4YZ0A 2NT6A 1DABA 2INVA 3PSSA 1DBGA 2QYUA 2YUHA 1QA3A 2X6WA 2XTXA 2XTYA 4OJOA 1O8MA 2VFPA 4XORA 1XG2A 2PYGA 1PE9A 3SY2A 4NK8A 2VJIA 2VBEA 2PECA 4YEIA 4YEJA 2VFOA 1OOCA 1KTWA 3BH7B 4XN3A 1LLZA 4XLCA 4YZXA 1DBOA 1OFDA
chains in the Genus database with same CATH topology
1TYVA 2G0YA 2J8IA 3N90A 3PETA 2F3LA 1QRCA 4OM9A 5JMCB 1QA1A 3P4GA 3AK5A 1TYUA 4KH3A 4V02C 1QRBA 3BH6B 1KQ5A 3JX8A 2B0RA 4OJPA 1QQ1A 3LYCA 2VFNA 4OJLA 2VFQA 2BX6A 4OJ5A 2BM4A 1TSPA 1TYXA 3LJYA 2YUHA 3RIQA 1DABA 1QA3A 4OJ6A 2VFMA 1CLWA 3N6ZA 4OJOA 1TYWA 2VFPA 2IOUG 2XC1A 2BM7A 3ML3A 2BM6A 2V5IA 5JLVC 1WXRA 3TH0A 3H09A 2BM5A 1K8FA 3SZEA 1QA2A 4JRAC 1K4ZA 1HF2A 2VFOA 3BH7B 4OPWA 2W7ZA 3SYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8F A;  4V02 C;  3BH6 B;  1KQ5 A;  2B0R A;  1K4Z A;  1HF2 A;  3BH7 B;  2BX6 A;  2YUH A; 
#chains in the Genus database with same CATH topology
 1TYV A;  1OGM X;  3EQN A;  3VST A;  3KRG A;  1EZG A;  4YZA A;  3SQV A;  1GQ8 A;  1RU4 A;  4KH3 A;  1O8H A;  4V02 C;  5AMV A;  1PXZ A;  3SYJ A;  1IA5 A;  2VFN A;  3JUR A;  3LMW A;  2BX6 A;  1TSP A;  3LJY A;  2O04 A;  1RWR A;  2VFM A;  2J8K A;  3B90 A;  3N6Z A;  3NAW A;  1TYW A;  4W8S A;  4YZQ A;  4YFO A;  4XOT A;  1HG8 A;  2IOU G;  1NHC A;  4XMY A;  4XNF A;  4XON A;  3SUC A;  3ML3 A;  4XLF A;  1O8G A;  4U4B A;  3TH0 A;  3VSV A;  3ZSC A;  2BM5 A;  2EWE A;  2UVF A;  1IB4 A;  2NTP A;  4XQF A;  5C1E A;  1CZF A;  1HF2 A;  1X0C A;  2W7Z A;  3EQO A;  3GQ8 A;  3GQ9 A;  3VMV A;  2O6W A;  2J8I A;  4MR0 A;  1KCC A;  2X6Y A;  2NSP A;  2O0W A;  3PET A;  5DNS A;  2Z8G A;  1O8D A;  4OM9 A;  3AK5 A;  3P4G A;  4YCQ A;  4W8T A;  1BN8 A;  3B8Y A;  1QRB A;  2X85 A;  2B0R A;  2XT2 A;  1O8I A;  1QQ1 A;  2XT4 A;  3GRH A;  3LYC A;  3WWG A;  2INU A;  3T9G A;  1K5C A;  4OJ5 A;  2X6X A;  2BM4 A;  3RIQ A;  3GQ7 A;  4EW9 A;  1LM1 A;  1O8K A;  2O0V A;  1O8E A;  2ODL A;  1QCX A;  4XR6 A;  1EA0 A;  2XTW A;  4XL9 A;  5JLV C;  2BM6 A;  2BSP A;  2V5I A;  1AIR A;  2PYH A;  1JRG A;  2X3H A;  3NB2 A;  4MXN A;  4W8R A;  2QZA A;  4XOP A;  3SZE A;  3B4N A;  1EE6 A;  4I84 A;  3VSU A;  1BHE A;  4OPW A;  1OFM A;  1OFL A;  3ZPP A;  2NTB A;  2VBM A;  4OZY A;  3PSZ A;  2G0Y A;  1WMR A;  4PMH A;  1WXR A;  1KCD A;  3DU1 X;  1RMG A;  1JTA A;  4OZZ A;  4XM3 A;  4YC5 A;  5C1C A;  2UVE A;  4URR A;  1O88 A;  1OFE A;  2QY1 A;  2NTQ A;  3BH6 B;  3JX8 A;  4OJP A;  4AVZ A;  2VJJ A;  3FY3 A;  4NK6 A;  2VFQ A;  4YEL A;  3GQA A;  1TYX A;  1QJV A;  4XLH A;  4OJ6 A;  4XN0 A;  1H80 A;  1CLW A;  2NT9 A;  4HWV A;  4Z05 A;  2IQ7 A;  2XC1 A;  2BM7 A;  4YDT A;  2NZM A;  1IDJ A;  1OGO X;  3H09 A;  1IDK A;  1K8F A;  1QA2 A;  1O8L A;  4JRA C;  1L1I A;  3VMW A;  4Z06 A;  4XLA A;  1K4Z A;  1O8F A;  2NST A;  1O8J A;  3UW0 A;  2QXZ A;  4U49 A;  4XLE A;  1LLW A;  4XKW A;  2O1D A;  4C2L A;  3N90 A;  2O17 A;  4Z03 A;  2VBK A;  1QRC A;  2F3L A;  1VBL A;  4W8Q A;  1QA1 A;  1TYU A;  2QX3 A;  1PLU A;  4XKV A;  5JMC B;  1KQ5 A;  4OJL A;  4YZ0 A;  2NT6 A;  1DAB A;  2INV A;  3PSS A;  1DBG A;  2QYU A;  2YUH A;  1QA3 A;  2X6W A;  2XTX A;  2XTY A;  4OJO A;  1O8M A;  2VFP A;  4XOR A;  1XG2 A;  2PYG A;  1PE9 A;  3SY2 A;  4NK8 A;  2VJI A;  2VBE A;  2PEC A;  4YEI A;  4YEJ A;  2VFO A;  1OOC A;  1KTW A;  3BH7 B;  4XN3 A;  1LLZ A;  4XLC A;  4YZX A;  1DBO A;  1OFD A; 
#chains in the Genus database with same CATH homology
 1TYV A;  2G0Y A;  2J8I A;  3N90 A;  3PET A;  2F3L A;  1QRC A;  4OM9 A;  5JMC B;  1QA1 A;  3P4G A;  3AK5 A;  1TYU A;  4KH3 A;  4V02 C;  1QRB A;  3BH6 B;  1KQ5 A;  3JX8 A;  2B0R A;  4OJP A;  1QQ1 A;  3LYC A;  2VFN A;  4OJL A;  2VFQ A;  2BX6 A;  4OJ5 A;  2BM4 A;  1TSP A;  1TYX A;  3LJY A;  2YUH A;  3RIQ A;  1DAB A;  1QA3 A;  4OJ6 A;  2VFM A;  1CLW A;  3N6Z A;  4OJO A;  1TYW A;  2VFP A;  2IOU G;  2XC1 A;  2BM7 A;  3ML3 A;  2BM6 A;  2V5I A;  5JLV C;  1WXR A;  3TH0 A;  3H09 A;  2BM5 A;  1K8F A;  3SZE A;  1QA2 A;  4JRA C;  1K4Z A;  1HF2 A;  2VFO A;  3BH7 B;  4OPW A;  2W7Z A;  3SYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...