2B0RA

Crystal structure of cyclase-associated protein from cryptosporidium parvum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
b'RQVVTNGSPKVELQKDTYLVENHVNCADPITLSEGSIKNKVSVRCSQNSRIIVEQKVNSIFIENCVGCIFLVNGVISSIEIVNCDDIKLQMTGIVPTISLDKSNKVNIYTSKEGKNVEVYSSKSSEMNLLFPGEEEGDWKELAIPEQFVTKYNESKGKLESMVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords possible adenyl cyclase-associated protein
publication title Structure and function of a G-actin sequestering protein with a vital role in malaria oocyst development inside the mosquito vector
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Unknown function
total genus 49
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08603 CAP_C Adenylate cyclase associated (CAP) C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2b0rA00
1K4ZA 1HF2A 2BX6A 2B0RA 1KQ5A 2YUHA 4V02C 3BH6B 3BH7B 1K8FA
chains in the Genus database with same CATH superfamily
2O0VA 4XMYA 1JTAA 3H09A 3KRGA 1JRGA 3VSUA 1QA1A 1QRBA 4W8SA 4C2LA 2BM4A 4MXNA 3SQVA 1WXRA 1PLUA 3B8YA 2VJJA 3FY3A 2NT6A 2PYGA 4KH3A 5DNSA 1RU4A 2BM5A 2V5IA 1K5CA 1EA0A 2O0WA 1QCXA 1QA2A 4OZZA 3GRHA 3PSSA 3DU1X 1LLZA 3LYCA 1TYWA 1KCDA 2J8IA 3GQ7A 4YZQA 4Z03A 3PETA 3GQ8A 4OJLA 4YDTA 4XLAA 2XTYA 4OJPA 3GQ9A 1KQ5A 2B0RA 4I84A 4NK8A 4U4BA 4XOTA 4XONA 1IB4A 2X6XA 1BN8A 2NTQA 2XTWA 2PYHA 2VBMA 3VMWA 1RWRA 3SUCA 3AK5A 1O8LA 1O8GA 1KTWA 1QRCA 4XKVA 4YFOA 1O8KA 2BM6A 1O88A 2QX3A 2O17A 4Z06A 2NSPA 4YZAA 1O8DA 2O1DA 4XLEA 2X85A 1LLWA 1OOCA 4JRAC 2INUA 1CLWA 1OFDA 2VFOA 3N6ZA 2QZAA 1LM1A 1QJVA 1DBOA 3LMWA 2O6WA 3B90A 3JX8A 1NHCA 1O8JA 2Z8GA 2IOUG 1VBLA 3SYJA 2INVA 1HG8A 4OJ6A 1TYXA 2NTBA 4OM9A 1TSPA 4YC5A 4YCQA 2XTXA 2VBEA 2YUHA 5C1EA 2VFQA 2BM7A 2XC1A 4XQFA 1DABA 3BH7B 2W7ZA 3EQOA 1EZGA 2XT2A 1O8EA 4W8QA 1K4ZA 2G0YA 1X0CA 2X3HA 1PE9A 4V02C 3SZEA 1WMRA 1DBGA 4AVZA 2VFNA 3NAWA 3GQAA 5C1CA 1TYVA 4OPWA 4XLFA 5JMCB 1KCCA 1QQ1A 4YELA 3SY2A 2NTPA 4XKWA 4XLHA 1PXZA 3B4NA 2UVFA 1GQ8A 1XG2A 3EQNA 4YZXA 3TH0A 1OGMX 4YEIA 2EWEA 1QA3A 3ZSCA 2BSPA 2QXZA 4W8RA 2NSTA 3P4GA 3PSZA 1O8FA 4XOPA 4W8TA 2F3LA 4U49A 3ZPPA 1OGOX 2QYUA 4YEJA 2BX6A 1IDJA 4XLCA 4XR6A 4XORA 1H80A 3BH6B 4OJOA 4XNFA 4OZYA 2QY1A 4EW9A 4URRA 4YZ0A 2PECA 4HWVA 5JLVC 1IDKA 4MR0A 5AMVA 3VMVA 3N90A 4XM3A 1O8HA 1L1IA 1O8MA 2UVEA 1TYUA 2ODLA 4OJ5A 4XL9A 1AIRA 2O04A 2VBKA 2VFPA 4NK6A 2VJIA 3VSTA 3JURA 2VFMA 3LJYA 2NT9A 1K8FA 1O8IA 1HF2A 3NB2A 4PMHA 1OFMA 1RMGA 4XN3A 2J8KA 3VSVA 4Z05A 1OFEA 3T9GA 1OFLA 2IQ7A 2X6YA 2X6WA 3ML3A 4XN0A 3WWGA 1EE6A 3RIQA 1BHEA 2XT4A 2NZMA 3UW0A 1IA5A 1CZFA
chains in the Genus database with same CATH topology
1K4ZA 2G0YA 5JLVC 3H09A 3AK5A 4V02C 3SZEA 3N90A 1QRCA 1QRBA 1QA1A 2BM4A 2BM6A 2VFNA 1WXRA 1TYUA 4OJ5A 1TYVA 4KH3A 4OPWA 2BM5A 5JMCB 2VFPA 1QQ1A 2V5IA 4JRAC 2VFMA 3LJYA 3TH0A 1K8FA 1CLWA 2VFOA 3N6ZA 1HF2A 1QA3A 3LYCA 1TYWA 3JX8A 3P4GA 2J8IA 2IOUG 2F3LA 3SYJA 4OJ6A 1TYXA 3PETA 4OM9A 4OJLA 1TSPA 2BX6A 4OJPA 1KQ5A 2B0RA 2YUHA 3ML3A 2VFQA 2BM7A 2XC1A 3BH6B 4OJOA 3BH7B 2W7ZA 3RIQA 1DABA 1QA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4Z A;  1HF2 A;  2BX6 A;  2B0R A;  1KQ5 A;  2YUH A;  4V02 C;  3BH6 B;  3BH7 B;  1K8F A; 
#chains in the Genus database with same CATH topology
 2O0V A;  4XMY A;  1JTA A;  3H09 A;  3KRG A;  1JRG A;  3VSU A;  1QA1 A;  1QRB A;  4W8S A;  4C2L A;  2BM4 A;  4MXN A;  3SQV A;  1WXR A;  1PLU A;  3B8Y A;  2VJJ A;  3FY3 A;  2NT6 A;  2PYG A;  4KH3 A;  5DNS A;  1RU4 A;  2BM5 A;  2V5I A;  1K5C A;  1EA0 A;  2O0W A;  1QCX A;  1QA2 A;  4OZZ A;  3GRH A;  3PSS A;  3DU1 X;  1LLZ A;  3LYC A;  1TYW A;  1KCD A;  2J8I A;  3GQ7 A;  4YZQ A;  4Z03 A;  3PET A;  3GQ8 A;  4OJL A;  4YDT A;  4XLA A;  2XTY A;  4OJP A;  3GQ9 A;  1KQ5 A;  2B0R A;  4I84 A;  4NK8 A;  4U4B A;  4XOT A;  4XON A;  1IB4 A;  2X6X A;  1BN8 A;  2NTQ A;  2XTW A;  2PYH A;  2VBM A;  3VMW A;  1RWR A;  3SUC A;  3AK5 A;  1O8L A;  1O8G A;  1KTW A;  1QRC A;  4XKV A;  4YFO A;  1O8K A;  2BM6 A;  1O88 A;  2QX3 A;  2O17 A;  4Z06 A;  2NSP A;  4YZA A;  1O8D A;  2O1D A;  4XLE A;  2X85 A;  1LLW A;  1OOC A;  4JRA C;  2INU A;  1CLW A;  1OFD A;  2VFO A;  3N6Z A;  2QZA A;  1LM1 A;  1QJV A;  1DBO A;  3LMW A;  2O6W A;  3B90 A;  3JX8 A;  1NHC A;  1O8J A;  2Z8G A;  2IOU G;  1VBL A;  3SYJ A;  2INV A;  1HG8 A;  4OJ6 A;  1TYX A;  2NTB A;  4OM9 A;  1TSP A;  4YC5 A;  4YCQ A;  2XTX A;  2VBE A;  2YUH A;  5C1E A;  2VFQ A;  2BM7 A;  2XC1 A;  4XQF A;  1DAB A;  3BH7 B;  2W7Z A;  3EQO A;  1EZG A;  2XT2 A;  1O8E A;  4W8Q A;  1K4Z A;  2G0Y A;  1X0C A;  2X3H A;  1PE9 A;  4V02 C;  3SZE A;  1WMR A;  1DBG A;  4AVZ A;  2VFN A;  3NAW A;  3GQA A;  5C1C A;  1TYV A;  4OPW A;  4XLF A;  5JMC B;  1KCC A;  1QQ1 A;  4YEL A;  3SY2 A;  2NTP A;  4XKW A;  4XLH A;  1PXZ A;  3B4N A;  2UVF A;  1GQ8 A;  1XG2 A;  3EQN A;  4YZX A;  3TH0 A;  1OGM X;  4YEI A;  2EWE A;  1QA3 A;  3ZSC A;  2BSP A;  2QXZ A;  4W8R A;  2NST A;  3P4G A;  3PSZ A;  1O8F A;  4XOP A;  4W8T A;  2F3L A;  4U49 A;  3ZPP A;  1OGO X;  2QYU A;  4YEJ A;  2BX6 A;  1IDJ A;  4XLC A;  4XR6 A;  4XOR A;  1H80 A;  3BH6 B;  4OJO A;  4XNF A;  4OZY A;  2QY1 A;  4EW9 A;  4URR A;  4YZ0 A;  2PEC A;  4HWV A;  5JLV C;  1IDK A;  4MR0 A;  5AMV A;  3VMV A;  3N90 A;  4XM3 A;  1O8H A;  1L1I A;  1O8M A;  2UVE A;  1TYU A;  2ODL A;  4OJ5 A;  4XL9 A;  1AIR A;  2O04 A;  2VBK A;  2VFP A;  4NK6 A;  2VJI A;  3VST A;  3JUR A;  2VFM A;  3LJY A;  2NT9 A;  1K8F A;  1O8I A;  1HF2 A;  3NB2 A;  4PMH A;  1OFM A;  1RMG A;  4XN3 A;  2J8K A;  3VSV A;  4Z05 A;  1OFE A;  3T9G A;  1OFL A;  2IQ7 A;  2X6Y A;  2X6W A;  3ML3 A;  4XN0 A;  3WWG A;  1EE6 A;  3RIQ A;  1BHE A;  2XT4 A;  2NZM A;  3UW0 A;  1IA5 A;  1CZF A; 
#chains in the Genus database with same CATH homology
 1K4Z A;  2G0Y A;  5JLV C;  3H09 A;  3AK5 A;  4V02 C;  3SZE A;  3N90 A;  1QRC A;  1QRB A;  1QA1 A;  2BM4 A;  2BM6 A;  2VFN A;  1WXR A;  1TYU A;  4OJ5 A;  1TYV A;  4KH3 A;  4OPW A;  2BM5 A;  5JMC B;  2VFP A;  1QQ1 A;  2V5I A;  4JRA C;  2VFM A;  3LJY A;  3TH0 A;  1K8F A;  1CLW A;  2VFO A;  3N6Z A;  1HF2 A;  1QA3 A;  3LYC A;  1TYW A;  3JX8 A;  3P4G A;  2J8I A;  2IOU G;  2F3L A;  3SYJ A;  4OJ6 A;  1TYX A;  3PET A;  4OM9 A;  4OJL A;  1TSP A;  2BX6 A;  4OJP A;  1KQ5 A;  2B0R A;  2YUH A;  3ML3 A;  2VFQ A;  2BM7 A;  2XC1 A;  3BH6 B;  4OJO A;  3BH7 B;  2W7Z A;  3RIQ A;  1DAB A;  1QA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...