2B1HL

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug29 peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSASGTPGQRISISCSGTSSNVENNYVYWYQHLPGTAPKLLIYRNDHRSSGIPDRFSASKSGTSASLAISGLRPEDEGDYYCAAWDDSRGGPDWVFGGGTKLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 2219, light chain
total genus 43
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1hL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1hL01
2BNRA 1YYLH 43CAA 1LO4H 2LVEA 3N1MC 4HWEH 4LHUA 1XGUA 3CXDL 5I16B 4K7FA 3I50H 3HMXA 2PXYA 2BSRA 2J2ZA 4E9LA 3HZVA 3TBYA 4JFDE 2P8MB 4WHTA 3SKMB 4HZAA 3LCYA 4X7FC 3VWKD 4MS8C 3BIKB 1C7SA 3VXMB 1BD2D 4HUXA 5I1JL 2X4PB 4NYLB 1VPOL 3D69A 4YE4L 3I3BA 2XWTB 1KXQE 5F44A 3HE7C 5BO1L 3MRLA 4P4KB 1IEBA 5T3ZD 3L3OA 4KRLB 1PYWA 2NXZD 3MROA 3QI9A 3FB8B 3J7HA 4QGYA 1R5VB 4TNVF 3P0GB 3BP7B 4KQ4L 1QLRB 3QUML 3WIIL 3LQAL 5KTEH 1ZA6B 5D7SH 1WEJH 1IAKB 4OZIF 5T3ZH 4PJBB 3QXAB 2P5EE 4RDQF 3QUZA 5D7IA 5GISH 3VXQA 4JLRA 3H3KA 4JO3L 4EIZC 3AY4A 4NRZA 5SX5K 1YEFL 5JUEL 1PKQE 2YD4A 3D87B 1ZS8A 5F97E 3PL6A 3RZWA 5D93C 5A2LH 2WWKO 4U05A 5HJ3B 4M48H 3W9EA 5EOCH 4K3EL 4CN6A 5IVOA 5DGQA 1KELH 5D2NA 4L3AA 4P5MB 4RDQG 3CSBA 2EEBA 1NBYB 2GJ6D 3PDOB 4Y16A 1D6VH 4NHUA 1RZ7H 3KS0H 5DWUL 5HYSG 5C0EA 2B7DT 3OV6A 5KZCB 3TWCH 1F2XK 2XA8H 5F9JA 4GSDL 2JKXA 3IAQA 4OLWL 5TQ2H 1L0YA 1Z3GH 15C8H 2AERT 3IU4L 4BKLB 5AYQA 5JHLH 2R4RL 4QRQB 4OD2B 5ILTH 3SJVD 1C12A 3U4BL 2C1PA 2DI8A 3LZFH 1WTGT 3RJQB 4L9LA 2DLFH 3L3DA 5ALBL 5KSBA 3FO1A 4B41A 2R8SH 1RZ8B 2F5BH 2HG5B 3DUHA 4G8GD 1FAKT 1H0DA 1F6AB 4HJJL 3Q2CA 3ULVC 4FTVA 1KFAL 4HWUA 2A38A 1CTNA 4M6MH 3BKJL 5IWLA 1CFNB 1ETZA 3O45A 5HHOE 3PHOB 3QB7C 4Y4HA 3BD4A 3H7LA 2FJHB 5IHLB 2AS5M 3QHZL 1HCVA 5CZXC 1DQLH 4JQXC 3L5XH 2HRLA 2YZ8A 2CKNA 4G6ML 4R4FH 3GJEA 3V5DA 2DL9A 1U92A 4QY8A 4EI5C 4JFYB 4JDZA 3DX6B 2A9NH 5I1KL 1H5BA 1WBYA 1Y6MR 4JM2F 2B4CH 4NQCD 3BKML 3T08A 3FJTA 5C2UB 5JXED 3PGDB 1TJGH 4WEBL 5T3XL 4XPGL 2FZ3B 1WC7A 2W60B 5I1AA 2V5MA 5IQ9A 5KS9E 3CK0L 4HX1B 4XNZB 5JR1H 4IMKC 4L4TB 2XT1B 1WT5C 3EOBB 5EOQL 3T3MF 1NC4B 3MRFB 3T0BA 1U8OB 2VDQH 2G2RA 1ITBB 2VLRD 1LE5B 1EO7A 2CD0A 4LSPH 3DGGB 2RFXB 2DIBA 4P2RD 5D7JB 2P24A 3QPQC 5GZOD 4ZFFA 1FLRH 2ZNXA 3A0OA 3S3SA 4Y88A 3WDHA 2Y72A 4CL7A 3IXAB 2ICWJ 5TDNA 4Z6AT 3GSRB 4PJFE 1CFTB 2AKRB 5C0RH 1CZ8H 1G6VK 2BJML 5DZLA 3NAAL 4PJFB 5DZOA 4UV7L 4XPHH 3BAEL 1JL8A 2I60H 3IDNA 3BO8B 3NA9L 2B39A 3P0YL 5BQ7A 4WTZA 1K5NA 3B3IA 5EU6B 4ETYA 1T1YB 4M00A 3MRJB 2YD2A 2YD7A 3SOBH 3SY0B 4JLRB 2E6JA 3K2UH 4R7NA 3TNMA 3I6GB 1JZ4A 4PB9L 3FTGA 5IVXB 4H1LH 4Q0XH 4CNIA 4GRLC 3D3VB 2CDEA 1YN6B 4WY7H 4PV9B 4X6DE 1QLRA 3VW3H 2R1XB 5DD0L 1W72H 3QIUA 3B6SA 1SJHB 1VSCA 3OJ2C 5HHXL 5F71A 2XPGB 5L9DL 2Z8RA 1JPTH 4OSUH 3U4EB 4Y5YC 4DOHB 1AIFA 5FF6A 4YHNB 1G1CA 3L3KB 4NP4L 3LMJL 4M7ZC 1NL0L 3ULUE 3NH7H 4OZFG 1M05B 4ZXBA 4P5TB 1N0LA 3C2AL 3QUZC 4P3WA 1SBSL 1SJXA 4MA3A 3UTSE 5FYJE 3SGEH 5IMKB 2YSSB 5BJTA 2MNUA 1MHCA 2FYYA 4M93C 4JZOB 2P7TA 3VWJA 1B0RA 3Q48A 4X8JB 4F37F 1V7NH 4UTAH 1MRDL 4Z18A 4N5UA 1IGML 4Z95H 4RMTA 2AK1H 2X4OB 3GJFA 4IOIA 4XRCA 4KJQD 4AK1A 4M4RA 5HVWA 2CJUL 3QUMH 3WIIH 1EFXB 1AGBA 3CD4A 1CXKA 4JREB 5M7QA 1SJVA 1A7RL 4Y8DC 2WQ8A 3ZTJH 5ACMA 5TF0A 1FBIL 3K8MA 3SKJL 3NCJL 4JZNB 5H94A 4XHQA 1P7HL 1PG7L 4X4ZA 3MRKA 2EH8H 2GSGA 3P77B 5SWSE 3RNQA 1OTUC 4H25A 5IB1B 1DQJB 2OI9B 1OTUD 4FP8H 1OF2A 1P7KB 2KZWA 4XAWH 1CF8H 1YECH 2FEEI 4XCYA 5A2FA 3M8OL 4M1DH 1INDH 3FB5A 2CXGA 5E2UH 5FM4A 1R3LB 2NY2D 4QEGA 4GS7B 1RUAH 5HYSA 2YPKB 3MLUH 2Z91B 4YBLC 4PD4J 2FJFB 4ELME 5ABDE 4OZIE 1ZHLB 1HOCB 3QIBB 2HRPH 4HUVB 3G6JF 5E4EC 4X6EB 2X4NB 3CFJB 4NZUH 3ZL4L 3DTXA 4LEXL 1N6QH 3QQ4B 4FQCH 5FDWA 5DMIL 5FYJD 3TBWA 3RGVB 5T5FL 3GBNL 3F58H 5TH2A 4XNMB 5C6PB 2X44D 2YXMA 5GGVY 1CK0L 2XKSA 1D9KB 3VG0L 3MFFB 3LRSA 1DQMH 2BOBB 4MQXC 4OFPA 1F90L 1RIVH 1D9KD 3LOWA 2E7HA 5FOBA 5IEHB 2E9JA 4YHLH 5EBMA 2VH5H 3A6BH 5E8OA 5BV7H 1ODAA 5DWUH 3PE9A 4Y16C 5FO8B 3C5SB 3NBNA 1TVBA 2MJWA 1IKNC 3MRHA 4HDIA 3P4OB 3JZ7A 5EZIL 4YWGH 3VRJB 2WZPD 2YMXH 5B8CC 1A02N 3OG6B 2BX5A 2F74B 3MRMA 4WI4A 2EDFA 2R0WL 3FQTA 1Q1JH 2BFVL 2CIIA 3HRZA 5IT2L 3QPQD 5GZOC 5TJWK 5C6WH 3L6FA 2IPUK 2D7TH 4QOKA 4X6BA 2AJZB 2IJ0C 3OB0H 3D1MC 2IBGA 4K7PX 2BY1A 4S10A 5D7LD 1A6TB 2HWZL 3F12B 4KRMB 4XPGH 1MAMH 1WEJL 5BS0D 4WEBH 5CP3A 1HSBB 4PRIE 5BS0A 1K85A 2Z8WC 2PO6D 1KN2H 3AFLA 3ARWA 3BZEA 4O2CB 3TZVC 4PJCE 4XXDB 3SDCB 1JNJA 1JGVL 4G8IB 4N8VA 1EO8L 4XXCC 4UT7L 1GGBH 4NC1E 5T33H 5BZWA 1BQHG 4NZTL 1ONQB 2KPNA 5IFJB 3MRDB 5C9KA 2ZCKH 1Q72L 3VFNA 2OTWA 3KXFB 5JA8B 1OPGH 1CL7H 3FN9A 2VDRH 4QT5A 1KFAH 4KUZL 4HIEB 5FYKU 4PJIB 1OARH 1QFWI 2Z31D 7CGTA 2IQ9L 4QRRD 4H88L 4WO4B 4J12A 2NXYC 3D2UB 4G7YH 2OJZH 1IGTA 4GXVL 3MGOA 5D6CB 3QHZH 1FFPA 2BRRH 2JK5B 4H20H 4UNTA 2X6MA 4R26L 5KVGH 2CSPA 1U8NA 2DYPB 2VQTA 2BNQB 1FZOB 4DKEL 1BF2A 5CINH 3S36X 3NCEB 1RZIB 4WWKD 1CE1L 1EEYA 1P4IH 2EO1A 3DIFA 4PR5B 3RDTB 5T3XE 5MENA 1EXUA 1L0XA 4PJFF 3MJ9A 1HHJB 1NBVH 3N06B 4XBGA 4Y1AD 5MEQB 3HNTL 2F74A 1G6RH 1HSAA 3PGCB 2XN9D 4PJXE 1CT8B 3WE6A 1J8HA 3PV6A 1MEXH 1NBYA 4ZG1A 4L4TE 4KJQC 3AMKA 1ZAGA 1IKFH 1DBJL 1I8LC 3ZHKA 1FNSH 4NRXA 3D85D 1DVFB 1B0RB 4M7JH 4MB4A 4NQDA 4XPBH 1KPRA 4XBPB 1MQ8A 1T83A 4B5EA 4NOBA 5J8OA 4OIIH 4FQCL 2KZ1B 2LQRA 4YNYA 3LPFA 3DV4A 3EO9L 1QRNB 2Z0BA 4IHOA 1AHWB 3VXTA 2YC1A 4R8WH 4S1QL 4EJ1C 5E6YA 1HSBA 3GHEH 2GJ6B 1AXSA 4Y4FC 4FZ8L 3KPRA 5DDHA 1DJSA 3SPVB 4AG4L 5DJ8A 3WLBB 5MHSD 1A21A 1A2YB 4LSPL 2EKSB 4QOKE 1FE8H 5SV3A 1RZKC 5DHVB 4LEXH 4R6UA 4AENA 3OWEA 3RKPA 1YY9C 4CRPA 3VXSB 2QQNH 4KQ3H 1WF5A 2DDQL 3IU3A 4P0DA 4ENED 1CLOL 1F4YH 5GIRA 3MLTA 3F7PC 4WWKA 5IBUG 3VXSE 4D0BA 5JIIA 2NXZC 3GSNL 3VWJC 3KPOB 1MCCA 2LU3A 3ESUF 2E27L 4JJHA 2X70A 2QQLH 5TFSH 1CFQB 2ZP0T 4YZFE 2F53D 4FQXA 3LKNA 2EEDA 2MQ0A 3HMWH 2GFBA 4I3GA 1JRHL 2ZUSA 5F6IC 2XN9E 4DVRH 3KG5A 2MFNA 5I1IH 4G43B 2WK2A 2YSSA 3SO3C 3V5KB 5CEXB 5DFVD 4PJXA 4NQVA 3VGFA 2PTVA 3MLTB 1IGJA 1AO7D 4WWKB 1M05A 1T80A 1JNLH 2ZJSH 4RFOH 3VRIA 4PJ8B 4XP9L 3O2DL 3QQ9D 4RRPG 4UT6H 4HULB 4JHAH 4HT1H 3CH1B 5FA3A 5CEYA 3NACH 4PRNB 4ZFOL 2DICA 5LGJB 5LQBH 3ARFC 5GS0D 4AMKH 1MRCH 1MY5A 4D3CH 3SE9L 4O5LL 2JCCF 1GZPA 1P2CA 5E9DD 4ZUTA 1WT5A 1C5CH 1WITA 1MIEH 3WYRA 3DXAE 1V8HA 5GGUB 5IROC 4U49A 2X05A 3WFEH 3TN0C 1ADQA 2ZUQC 1UKQA 3MRLB 2VH5L 3A6BL 1P7QA 4R7NB 3TNMB 2G60H 4NRXB 3TVMC 4Y19D 2JK5A 2BZDA 5MHSE 1NGYA 1RJZB 3B9AA 2UZIL 1ORSA 1OTTD 2IMNA 4O9HL 3VD7A 3D18A 3U4EA 1HH9A 4ZSOB 4OM1H 1SQ2N 1QYGH 1AC0A 1T6WA 4PREB 1IQDB 1WBXA 2P8MA 1UH2A 4P9HL 4WHTB 2Y23A 5SWSA 1FLTX 3SKMA 1W2KT 1HZHL 4WUKH 3VXSD 4PJIA 1G7HA 1KB9J 3HE7B 3SBWC 5I71B 2P46B 5DQJB 3D3VA 1I7ZB 4YHKL 4KZEL 4PLKC 3VGBA 4AT6A 1OGTA 2H8PA 4P23B 2BNRB 43CAB 4RIRB 4PS4H 2AJSL 3ARFB 3ARBC 4RFNC 1G6RA 4IRSA 4TN9A 3MXVH 1K5NB 3CVIH 1FZOA 3X14B 4M7LT 5EU5A 2YZ1A 4PRHA 3QP3A 1PVHA 1D3CA 3GMPA 4PJHB 2F54D 1AO7A 3BMVA 3DX8A 1S9YA 1IGMH 2RHEA 2V5TA 5F6HI 3R0MA 5HHVH 3O6FB 2Q8AL 1XF3B 1XR8B 4OZGE 5BW7C 4KI5F 4K3HA 3EDFA 1WVZA 2WBJB 5IB2A 4I5BB 1I1FA 4GAFB 3JV6B 3F6IA 4F37K 3BSZH 3IF1B 2AV1B 4NKMB 4NJ9H 1A7RH 1NEZB 3WNOA 1FL3B 5DVKA 5I9QB 4PRPB 4WO4A 3VFNB 4JFYA 3WXVH 4NHUB 1WQVT 1S9VB 4FQQB 4RNRB 1T04B 1I7UA 3G6JE 4L1DA 5ICXA 4LNRA 3S35L 5D2NB 5INCA 4ZFZB 5EWIH 4GLRI 4OB5L 2VZ1A 4HX1A 2VZVA 1TTUA 3BRGC 3QEHA 1BQHA 5A16A 2VIRA 5C0JA 43C9B 4TUJA 4UTAL 3F12A 4OZFA 3AS1A 4WJ5A 1PFCA 2ZUTA 1QRNE 4Y4KB 4Z7UE 2APBA 4XP5H 5C08E 4R0LB 3FQNA 5ESVB 5JQ6L 2ZUYA 3HE6A 4BZYA 5C7XL 5TH2B 4FQ1L 4WW1A 2IH1B 1L9NA 1JGVH 1D5MA 5IM7A 2V7HB 1ZA6A 4MAYC 2VZUA 4PRIB 4X0KA 5GHWL 5C2BL 3TA3C 1A7BA 4DZ8A 4JPIB 3F58L 1BBDL 5AUMB 3ME0A 5E08H 5TE6H 1XGQA 4LRNL 3BUYB 3VI3E 1YEKH 1IKFL 3QDJB 4NKDA 4OTXL 5SWZB 4L4JA 5D5MF 3VRJA 4F2MA 2XQBL 3T77B 1T2XA 1NBVL 1NLBH 2YRZA 3KHQA 3KAAA 5FO8A 2EIZA 5CZKA 1M6OB 4HV8A 2DIAA 1NC4D 4RMWA 3M1BA 4JANA 4M43H 2RB8A 3PGDA 1NSNL 5DUMH 5KVDL 4OF3A 3ARED 3QIUD 3O3EB 4ZO8A 2AP2A 2BNQE 4R26H 4JFED 5HD8D 1BZ7B 3KS0J 3HPLB 2XZQL 3PHSA 2C4XA 1C8PA 1A9BB 1S7XA 2KL6A 2DLIA 3D39A 4OZHE 3TF7C 3T0DA 1ADQH 3DVNA 1ZS8B 5BO1H 2CLRA 4R96A 1DDHB 4OD3H 3UTSA 3S34H 1CE6B 2GSIA 1K3IA 4K3EH 4WDIA 2OS7A 4ZMAT 1S7UB 1MPAH 1QRKA 3BZDA 3B9KA 4N0FB 5F7EL 1SM3H 4LFHD 5DLMH 3CMOL 3CH8A 4RMUA 3O9WD 2DQCL 2EE9A 2NY1C 4MXQD 4PJHF 3RZCC 2DQEH 3EO9H 3RVUC 1R0AL 3WNPA 1C7TA 4UIKL 4QRPE 5LGJA 4L4VD 3SCMC 1D5ZA 3F7VA 2OMBA 1TZHB 4NBYB 2R2EB 1CD9B 3DV6B 5I8KH 5ICYB 2VL5A 3GM8A 5FKPA 2VXVH 4MJ5B 3RWFB 5IVXA 3D6GA 4FQXC 5I8EA 4LNVA 4EIGB 1RI8A 1HK6A 3QH3A 5DFWH 4YX2L 3TWCL 5JA9A 1FIGH 4K94C 3BPCB 3U30C 1Z9LA 4P2RB 5IIEB 4RSVA 3DROB 1UXWA 1FYTB 1RZJC 1AQKH 2NLJB 1K9TA 2AAVA 4I2XA 4NHCH 2J7LA 2VLLB 3PWJA 4PJEB 3P11L 3QWRD 1O7VA 5FAAA 4EZMA 3EUUA 1E4KC 3CSGA 4AEEA 4YFLI 2EYSB 3OJDB 4PJGF 2IBZX 5DUBA 5ADPL 3ARBB 3OR7A 5F7LB 3D2UD 4WO4C 3FTGB 4JO4H 3QIUB 4PLKD 1P4BL 2GJJA 2O5ZH 4S2SB 2LABA 5I1IL 4DKFL 4D9LH 3M17A 4Z8FH 3QQ9C 1A9EB 5LBSH 3TVMA 4NFDA 1LDPL 5SWQB 3QCTH 3T4AB 4FQJH 3UJTH 2IH1A 4YC2C 5D2LE 2VDQL 5ITBH 1QRNA 3RTQB 5TQ0H 1UC6A 3MV7D 4KRPB 4OLVL 3AB0B 1I9JH 5B39A 3M17B 3NACL 4L4VE 4DZBB 1QSFB 4NN7C 3QWRA 5JNYA 3WIFB 3X3FH 4GBXC 4JFPA 5EU4A 2PXYC 4L1HA 3OGOE 4V1DE 1FE8L 4NKDB 4PRPD 2WIIA 4Z5RA 5EUOA 3N1FC 3GJFH 5F21B 4L29A 4I77L 2AKRA 3RVTC 5KW9L 3ARGC 2EC9U 4FQQA 2JJTC 4UB0H 1E6JL 3NABH 1F5WA 1T83C 2CH8A 2R1WA 4OCRL 5BOPA 5L88H 1RHHA 5I8OH 5F7FA 2BVOB 4J23A 3KXFE 2QQLL 5TFSL 1FFOA 3BP6B 1NAKH 1MCQA 3H0TB 3IJHB 3L3HB 2H3NB 2KH2B 2BSTA 4OFVA 4D94A 2FZ3A 1ZVSB 5CIPA 4BQ9A 3WN5A 2QV2A 1EPFA 2FRGP 4G6KL 5JW4M 1MFDL 1KXTB 3OKLB 2IAMC 4XAWL 1BQHB 3CVHA 5C09A 1BJ1J 3PWLB 1EDQA 1V7NL 4O02L 4XP4L 5FYKL 2FX9H 5IB5B 3WHXA 2FEDD 1PQZA 4WEUD 2VR4A 3MXVL 4R2GC 1KBGL 5GGSY 3KPPB 3FRPG 5EU7C 5J1SC 1UM6L 2I24N 4GUPA 4PP1D 4TQEL 5DURD 3GZKA 3MLYH 1D5BA 1K8IA 5C0GB 1TZIB 2CUMA 4XX1G 1TQBB 4M7ZB 4OD1L 1A47A 2IANE 4Q9RL 4G42A 2HG5A 2J1KA 5DD0H 5BZDA 3MZGB 5KSVB 2W0KA 1IE5A 3S36H 4K3JH 1E28A 4PJAE 1UG9A 2ITCA 1CZ8L 2BJMH 4JFFD 1UWXH 4JPWL 4PRPE 2EDQA 4ZQKA 1RIVL 3SQOH 1SJEA 3SDCD 3FQXA 5C0CB 3T2PA 1IILE 2FL5B 3MLXL 1OAXH 2LVCA 2GCYB 2J4WL 4GRMA 4H1LG 3BN9C 1WISA 4X83A 4I48B 1A6TA 2ICWA 3VFVA 1BEYL 3ARFA 3GSWB 4NP4H 1J05B 2E6QA 1ED3A 5TDPA 5DO2C 4MNQD 3TBVA 4D3CL 4NQVB 2X4TB 3INUH 2FHBA 3O11A 1KLUA 3I3EA 5T1DH 4UV7H 1YC7A 4YDIH 1A6VL 1V7ML 2GITB 2NY2C 2N7BA 2XWTA 3PQYB 5T1KD 3LEYH 4K07A 4Z7VB 4MJIA 3O0RL 3E3QC 2CMRL 2FIRT 5F8RC 3QWOA 1MCJA 2AJXH 3HC0A 1YY8B 4P48A 4H8WH 3NZ8A 3FB7A 2RAMA 3O8XD 3RZCB 5F7DB 3QXAA 5MI0B 1OSPH 3CC5A 4JRXB 1IT9L 4Y5XB 1TZHA 1KTRL 4QXWA 4QCIA 2J6EH 2JB5L 4NRYB 5JHDE 5DTFA 1CN4A 5BXFA 4LFHG 4LPCA 3QT2A 5ALCH 1R5VA 1WZMA 5DC4B 5DJ2A 3ARBA 1BMGA 1NGWA 1QBML 3ULUC 2FGWH 1MFNA 1UCBL 3N9GL 4PD4K 3EFDL 5EUOF 5JDSB 4JRYB 2NX5B 4JDVA 2Q6WB 4X7EC 4HBCL 1KCSH 4PJBE 5JXAH 4PJEA 2J8UA 5LCVL 3TA3B 2QADC 4YNYB 3WIHH 5FKAB 2WLYA 5JDJA 4JY4A 4MA7H 4X99B 1EGJL 3GKWL 3DVNB 3VFTA 3T09A 5I2IA 3RZCA 3HLAA 3RWIA 3SDAD 1KEGH 3HMXL 1A3LH 3E2HB 5IB4A 2OL3B 1SVCP 1IC5H 3C6LB 4PRPA 4GBXD 4HUWA 2ADGA 1NCAL 1OAZL 1E4XL 1KLGB 5MEQA 4PJAA 3QJHA 4CJ1A 1FIEA 1HHGA 3KPRD 4H5SB 4D8PA 4OJFL 1FNGA 2CLVA 5AYUL 3V4UH 1EEQA 3C2AH 3TCLA 1WFOA 3GJFK 3MOAL 3UPRB 2I07B 5CS7A 4IEFB 4NO5A 2QSQA 4U6YA 4PRBB 1R5WB 3L1OH 1HQRB 1JP5A 2YPLD 2HN7A 4HF5H 3PNWB 3EYUL 5JMOC 1BLNA 2VL4A 5FHAH 1YEJL 4Q6IB 3GFUA 3JUYA 4Y5YA 5DI8A 2BNRE 3WV0A 4MNGB 1CICD 1NCUA 3ZE0F 3D39B 3T4YA 4NM4H 3PWVA 2A83B 2H2SC 3CGTA 5EZJB 1Z9MA 3SQOL 4NQCB 3UZVB 3EYOA 3O2VL 2ATPB 3JV5A 3MJ9H 3ARGD 5GS1B 3FQNB 4JY6A 2VLRA 1X6LA 1BREA 5MEND 3WFBH 4X4XB 1SBBA 1YN6A 5I15L 3RNKA 2R0LH 1K4CA 3LSOB 1PZ5B 1FHGA 3B8SA 2J12B 4CMMB 3EFFB 1OWRM 4DQOH 1FZJA 2CIKB 5EU7E 3MJGX 1DCLA 3VCLA 1MIML 2EIEA 3TH3T 3OKLA 1BOGA 4U31A 4XX1E 2HT3D 5IQ7L 5D2NE 2D03L 3A6CL 2HJKB 4OLZL 4A2LA 1O5DT 3MCG1 4K8RC 3T0EA 4LQFL 4XP4H 5FYKH 3VU2A 5I1JH 3QXWA 1K8DB 3UBXG 3K1DA 3L9RA 2Q3ZA 1GC1C 4TUOA 1DN0A 1XEDA 1MI5A 4ZUSA 1LP9F 4GKZB 2R9HC 3LN5A 3ZHLA 4TPRL 3X11A 1AD9A 5A40E 2VLLA 1AP2A 5AAWA 1A6VH 3CZFA 3IKCA 5FGCB 5EOTB 5J12B 1R5WA 5D1QD 4HWEL 3MCLL 4OI9A 4M6OL 1QOKA 2EC9T 4KK8D 3U1SH 4F8QA 3UXFA 4Z8FL 4QHMB 1DQDL 5CP3H 3V6OE 3V6ZB 3QH3B 5GRXG 5D7KD 2V5RA 5KW9H 5EBLB 1S9WB 4JRXE 4GAYB 4M7JL 4HIXL 4XPBL 5SWZE 4YBQD 4BM7A 2QSCL 3AAZA 3SJVA 3IDGA 1ZT7B 5F89A 3OGCA 5F7HA 3CJJA 3QDJE 4UDUA 2OXHA 3ZDYE 5J11C 3V79C 1DBJH 4B0MM 2HT3C 3ZDZE 3RPIA 4KRPC 5C0BD 1KB5B 2EXWC 4H88H 3FQTB 3UAJD 3HKFA 1B0GA 1I9IL 3BGMA 2A83A 5CMAB 3HLAB 1IKNA 2DIJA 2WBJA 2OTPA 4YHPB 1YMME 4ELMA 2E7BA 3RDTD 3ARGB 5DJ0B 4IS6B 5F3HB 3EAKA 4KUCD 3HZYB 4XCNA 1NC2B 4ZODA 5D5MA 1JZ5A 1T0NB 4GG8A 4I9WE 5E8OB 3ZKNC 3VXNB 3MRNB 4U6YB 4QTIH 4LSTL 1G6RB 1OAKL 5GGTA 5FA3B 1MI5D 1EFXA 1HINH 3KJ4C 5KJRH 3QO1A 4HGKC 3RU8H 1EFXD 2GT9A 1W0WA 4GG6A 3KVQA 4R0LC 2YUVA 3U7YH 2APXA 3RWEB 1UZ8A 2X4UA 4PJXB 4LLUA 5I30H 2FX8H 1U6AL 3RY4A 1HHKB 3TZVA 1MHHB 2CRMA 2P45B 3A6OA 5DJCB 3EYVB 5D4QA 1EEZA 4KKAC 3RRQA 1ZVHA 4XPAH 3WXVL 5SX4I 3SDYL 4GG6B 2P8LA 1QSEE 1HILB 3S4SB 5GISL 4WU7A 1IT9H 1YEEH 1YEGL 4QRPB 5EG6C 5EORH 3THML 4QNPE 3GMQB 4PJ9D 4YHIA 3WIHL 1J0IA 3WD5H 2BNQA 1BAFL 4LAQL 2OX5A 3D3VD 3NCYP 2PTUA 2ADIA 4RRPA 4PUBL 3LY6A 1KLUB 3OKNA 2GJZB 1T21A 3BQUD 3EZJB 5HDBE 3PABA 4JFDB 4OCYH 1F2QA 1P6FA 1Q9LB 3P0VH 1KNOB 1B4JL 1F4XH 1NDGA 3IT8D 4D0DA 5EA0L 4KTYA 5IV2A 3C09C 3QFDA 5LGKA 2NPLX 3VFMA 5CEZE 5CEZH 4C4KT 3BD5A 1FYTE 2DB8A 4X6DA 5MP6L 3Q6FA 4QYOA 3MV9E 5IK3B 1DSFH 2AQ1A 5L7XH 1AY1L 3HI6H 5IW6A 1NANH 4WHCA 4ONOA 4ZPTA 2ITCB 1IC7L 2E7LC 1Q9OA 2CIKA 3VCLB 1XIWA 3EO1B 4YBHA 3HS0B 3QISA 4HUNB 4BQBA 1TETH 1Y0LB 1RZGA 3SGDH 1DFBL 3QZWG 3IDIA 3VXUA 1MFBH 5C0DB 3FO9B 1MCRA 2EE3A 4MSWA 4XPTH 3D25A 4GKZA 1MCPH 1W0VB 4BZ2H 4K55A 3MCLH 3EO0A 4GXUN 4HG4K 3L3KA 4PJFA 2KDGA 2E6PA 3C8HA 4F7TB 1UWXK 4P2OB 1P5VA 4YK4B 1LO0L 1CDJA 1WV7T 3C60D 4X6FB 4WNQA 1ZTXL 1A2YA 3T4YB 3TN0B 2G2RB 2YBRA 1RVFH 4EDWL 4PR5A 2VMFA 4AZ8A 1BECA 4LIQE 2DAVA 4NT6A 3TN0D 2QSVA 3VD5A 2FO4A 1LEKB 4OTXH 1FCCA 1IGYA 2DMBA 1FZJB 4HC1H 1JBJA 3T0EB 4NFBA 1RK0A 5CJ8A 4HHAB 4QHNA 5J0BA 3BD3A 2C4FU 4MXWL 4RFEA 3GMRA 5FO7B 3S34L 2O5XH 5FB8B 1I3GL 1DQDH 5I6XB 1IGTB 1R3HB 3QULA 5GRJH 3MFFA 43C9A 5GHWH 4EDXA 5IQ9B 3GJEB 5CEZD 1CU4H 5A2JH 3UP1A 4RA3A 4OLYH 3I6LD 4EVNA 5F6IB 2CK2A 4E5XB 1FORL 2I9LA 3CFIC 1MH5A 1BZ9A 4LDEB 2R0ZL 2GKIA 5I66A 5EBWB 2MCPH 3MRGB 4CW1B 2X7LB 3T1WA 1IGIH 1F3DH 4DWHA 5CJ5A 3CCHB 5E95B 3PNWA 2B1AH 3K46A 2X89A 3HFMH 3PP4L 3IFPA 1R3LA 4N8VG 4OLZH 5FYLH 2XQYK 3DIFB 1NANI 3SDDA 3O6FA 4YH6A 2AABH 3QIUC 3V95A 1A9EA 1FZMB 2XZCH 4EOWL 3CFCL 3TA3A 5F96H 1F6AA 3QQ3B 2NZIA 2VWEE 2VITA 3UPCA 5KG9A 3OKKA 5IOPA 2QHRL 3IETB 1IC5L 5F7UA 4OT1H 3CVHH 3EYQC 1QBAA 4BZ1H 1DEEB 4APQB 2R23A 3WFBL 2ZKHH 1EFQA 3V0AC 2VDKL 1YMHA 4PY7A 3FHAA 3ZTNL 3GK8H 8FABA 3TN0A 3B5HA 3VMPA 3V4UL 4LSVL 4NM8H 2XYCA 3O4LB 2BXZA 3MOAH 3PWJB 2RQ8A 2HYMA 5HI5C 5EIQA 4C54A 4YGAB 2FBOJ 3GMOA 3C8KB 1BP3B 5IIEA 4I0CC 4PTUB 1S7QA 1JGDB 5JLZB 1NFIA 2GK0B 3KPNA 1FRGL 2OLDA 4YGVA 1J0JA 4OF5A 2DKUA 3S88L 1N6QL 1KELL 4LCUA 5IB3A 5FM8A 1DQTA 3RL1B 4X5XA 3KJ4B 1IM9B 2RR3A 1BWWA 2A1WL 3OR6A 5F9WB 4X99A 1X5YA 4YR6A 4OCWL 4XMKL 5FDWB 1LO2L 3VXOB 4Z7QE 5FF6B 3FT3A 1OLZA 5FGCE 1UJ3B 1A0QL 3MUY1 2FX7H 3C2SA 4X6BB 2CKBH 4OGXH 1IQWL 1ZVYA 1SEQL 4EBQH 5CKAA 4HUVA 1LD9A 1AR1C 2O93L 4L8BA 4JO1L 4BFIA 3FN0H 3OQ3B 3MGAA 3OF6D 3P4MB 5EIVA 3FOLA 1RFDH 1BVKB 2E8ZA 3LQMA 1CFSB 3WS6C 3K81A 3IXTB 3ULUF 4DUXA 4Q2ZB 4MSWB 1XGTB 4H25B 2DMKA 5GRUH 5IB1A 4QRRB 3RVUD 1Z9SA 1U8JA 5D72L 2ADIB 1NMAL 4P4KA 2PYEA 4Y1AA 1RAMA 4AIZA 1G7PB 4KV5E 1FN4A 3DX9B 3SCMA 1U6AH 1OTSD 4YHIB 4PGDA 1QSZA 2Z8SA 1BHGA 1I9IH 3C5JB 3BRFA 4C57C 2Z31A 2DQIH 1JF6A 4HC1L 2BNUB 4J6RH 1JF1B 1CXHA 3IU3B 1P4BH 2O5ZL 3AMLA 3GIZL 3L95A 1ZHNA 3P4MA 5JZ7C 1MCIA 4LARH 1GRWA 4G5ZL 2E7CA 3PWLA 4OCRH 4PJIF 3HUJA 2AJYL 5MERA 3LKQA 5KSUB 1U8OA 3OPZL 2VSDA 2EIZB 4IRZH 1MJ8H 3DX7A 1AY1H 5CILH 5J9PA 4MA3B 5JMRA 4MJ4A 1LWRA 1ZHKB 1MCDA 1QFPA 1MHEA 3EOYG 1HIML 2WP3T 2E8YA 4IRJD 4NQXA 4X5XB 2Q76A 4M7KH 2AI0L 1CBVL 3JBG7 1IZKA 2IGFH 2R69L 4JGMA 1SVZA 1WJ3A 4ELMF 5CBAB 2B2XH 3KPNB 35C8H 1LEGA 4GKNB 4BH7B 2K9UA 3HZVB 4O02H 1QR1A 2OQJB 2XRAL 3WL9B 2C3XA 1IM9D 4P9MH 1GSMA 1C08A 2W07A 3O2WL 5JW3L 4UDUB 2DQGH 4CN4A 1YQVH 2BDNH 4XXCA 4ODSL 4Z7WF 3GBNH 3MFGB 1P53A 2DM7A 3SY0A 1CICC 5EA0H 1YEIH 1S9KC 2XXMB 4DKEH 4MDJB 1OAQH 3NN8A 4G7VL 1XF2A 1LK2A 4BK5A 2C3VA 5ENWB 3WKNA 3FONB 1RZ8A 1JGLH 3ARRA 3VFGL 3O6FC 4GXVH 2EH7L 2YHGA 2FX9L 2K1MA 4KHTH 2VLJE 4QNPF 4LNRB 1K6QH 2VLME 3RVVC 1H3PL 4YDLC 1T7VA 5E00B 1BIIB 3OL2A 4KY1H 1U8LB 4XMLH 2MQCA 1G7JA 5HI3D 2AQ2A 1FL6A 3MXWH 2NTSP 4M1CD 2PYED 5DHYA 1OL0A 4O51A 1OAYL 2YR3A 5DJXA 5F7WC 4LVEA 4Y89A 4X9HA 4PGCA 5TE4L 5E03A 3KYOB 5DSCB 1PY9A 1L9MA 4LVHC 4QHKJ 5DQDH 2Y06H 1D5MB 2DS4A 1LDPH 5L6YL 5K59F 2ERJB 1E6JH 1MCPL 2IPKA 4RGND 3O3AA 4N0UB 1M4KA 4Z76B 2P8PA 4O2EB 2UWEE 3BPNB 1LP9A 1ORQB 4NCDA 1A6UH 5BV7B 5IF0A 2JIXB 2HFFA 2XKNA 4UZGA 5IT2H 3U48A 5HHQB 4YDJA 4L4VB 1REIA 3X3FL 4PRID 2IPKB 4LF3A 4C56A 1MCOH 3JSSA 3QO0B 1GGIH 1PKOA 2HFEB 5C0ND 4N8PA 1UB5A 1KJMA 1F8TH 2H26A 1YYLL 3RIAK 3ZE2E 1OT2A 1MVUA 4RAUB 2X2YA 4XTRD 3LKOB 5D7JA 4O4YL 2X4RB 1YC8A 4FTVE 2VJXA 5HYSB 5BOZG 3N1QC 4D9QE 2P49B 5AYUH 4FQLL 2UVFA 4ODXA 3TO4B 2VE6B 4U1MB 1OD7A 4GMSH 3UPRA 1PG7X 2BC4B 2KQNA 3IDIB 1QFUL 1VDGA 3LKQB 4QXGL 1FVEB 2Y07L 2QKIB 1HQRA 4C58B 4DGIH 5F1IB 1QHOA 4URTB 1C5CL 1J1OL 2V9TA 4JFEB 3MOBL 2I07A 1A3LL 1CD1A 2F5AH 1UCBH 4GRLB 1JWUB 4A6YB 1ZSDA 1JPST 1BVZA 4JM2B 3OKEA 4YQXH 4J4PD 3NZHL 5GS3A 3SHSA 5HVHC 3O3DB 2VXSH 4UTBH 4OZ4B 1MOEA 5J89A 1U3JA 3MRNA 1M1SA 3RA7H 4MNGA 3JV0A 2Q20A 5ERWA 1G9NL 4Z77A 2G75A 4GAGL 2XXCB 4XCNB 5BJTB 5TGBA 4KK9D 1RUQL 4U1MA 1T7ZA 3BDXA 1YYML 4PLOB 1EJOH 1LNUB 3X13A 2FX7L 5EC2B 4WFGE 4W70A 1P7QB 1ZLSL 3RGVC 3OG4B 5CGYC 1HKLH 2VABA 2YS4A 2EIDA 4EN3A 3ULUH 4AENB 4NO3B 4PRDB 4I4WB 2LU7A 4LSSH 4NQEB 1KB5A 1C1EL 4FTVD 2AXGA 4RQQA 4OFYD 4Y4KD 2CLVB 1YNKH 2H26B 4F9PA 2HKFH 1UADC 4TULH 3AXLB 1ERNA 1K6QL 2YD3A 3CC5B 4JRXA 1BFVH 1MLBA 3RIFK 1JPFB 1IGJB 1NUFA 3VRIB 2IAMA 5IMMA 1TLKA 5HGAA 3CU1A 1CICA 4QOKD 3B8YA 5IEKA 2WINA 3LQZA 3FAXA 1EHXA 2ZPKH 5GRJL 1I7RA 3BEVB 4JKWA 5CCKL 1OM3L 4JJ5B 1J8KA 1T22A 2EDEA 4H26A 1AQDB 2HVJB 4WTXA 1GGYA 4OT1L 4CMHC 5C0FA 4QRRA 1E4XH 5F70A 3OXRA 4GXUM 4YHYC 3ARTA 4TNVK 3NPSC 2X4TA 1NAML 4M1GH 5D7IB 4AIOA 4FFWC 3GSWA 3T1FB 5IBTH 3V4VH 5IP4A 2RFXA 5IMOA 1BX2A 1B88A 4PS4L 4O58L 1JYVA 3FQUA 4WFGD 2R2HB 5BW7A 1NCAH 4ZFOB 4Q7DA 4N0YH 4MXVE 4WCYH 1IEAA 3QUKA 1NCTA 5JW4Q 2EDDA 1CTOA 4KVNL 1OT1A 1G1YA 2B20A 2BVPA 1PZ5A 4FQ1H 1KT2B 1DANU 1FFPB 3H9YA 3QWOB 5DR5H 2ZCLH 1X44A 4IRSB 4Y4KA 3D0LB 4TOYH 4MZ2A 1FSKB 4GBXB 3CCHA 4MX7A 1FZKA 4WWKC 1X5AA 5D1XD 1UEYA 5JPNA 3KPSB 5EO9A 1KPVA 5JIPA 1AC6A 2QTEA 4KV5F 4HWBA 4LLVA 4PG9B 4JQVC 2I27N 4MWFA 4F58L 4LKCB 4ETQB 4ODWA 3OKOA 1AD9B 3H6JA 3U7WL 4LLWA 1P6AB 3PGFH 3IDUA 3CVHB 1Q0YL 4WFHD 1JWUA 5I8CA 1HSAB 1JPGB 2AQ3A 3HE6C 4O51B 4FTVB 5C8JA 3S35H 3DX8B 4OCXH 3WHXB 5D7JC 4XPHL 3DPBA 4J8RB 3FQRA 4HKJA 3L3GA 2IBZY 3QEUB 4KJWC 2JIXD 2HKHL 2B4CL 2D4DA 5DD5H 5DGRA 5HHVL 2AK4B 3HZKA 4DUVA 5HPMB 1S7WA 4GO6B 3L5XL 4HWNA 2C3HA 5BZDB 2ARJQ 3G6AA 2WQRA 1NLDH 3QG6B 2YEZB 1M7DB 1S7SB 1YZZA 3MA9L 4U2ZA 1XF2B 4X6CA 1CGYA 4Z5RB 2BVOA 1N4XL 4Z7NF 1DL7L 1IEHA 1U92B 3TA3D 3B43A 5F7MC 3C60B 5JNYB 1KOAA 2XWJA 2V17H 1I1YB 3P73A 1LO5A 1N6UA 1FP5A 5ISZE 4M5ZL 4H0HB 5FOBB 2Y6SD 5HXMA 3E8UH 4K2UH 4ZUVB 5CSZA 3IYLW 4JFDD 4WTWA 4GMSL 3PWNB 1H5BC 3QIBC 1VKXB 2YD1A 1DUYB 4JHWH 3NTCH 3O3AB 5C7XH 5E4EB 3G6JB 3RGVA 3DSNA 1BVKA 5TQ0L 1ULVA 2RJMA 3NFNA 3P30H 1KTLA 4JG1H 5T3ZE 1IZJA 4WFHE 4HMEA 2C1PB 5C0AE 3OTTA 1R3KB 3RTQD 4JFQA 3S37H 4LVNC 1L6ZA 4XI5C 3BGFC 5J13C 3DNKA 2HT2C 3S37X 4QCIB 3L95B 1PEZA 5KOVC 3EDKA 4YR6B 1J11A 2DQFA 1N3NA 4EI6A 5D70L 1BIIA 3NZ8B 4PJ8C 4X4MA 4I18C 3BKCL 5E8EA 2NY0B 4NJ9L 3K4DA 4OBSA 3C5SA 3HR5A 1IFHL 5IESH 1R24A 1T2JA 1YNTA 1YECL 3DO3A 4WI7A 4U6VL 3QDMB 3DHMA 3DROA 4NQTA 4NQDB 3O9WB 3IJSB 3Q0HA 3S97C 3WS3B 3K2MC 3UTPE 1U95A 3EJJX 2DQCH 3U79A 1FAIH 1MJUH 4XP6H 3G08B 8FABB 2D0HA 1U41A 5JDSA 1ED3B 5ISZD 1IAKA 4HK3N 1X4ZA 4WU5A 3FOLB 3EDEA 1AXTL 2IFFL 3WKML 1V5JA 3F7VB 4IJ3B 4IOFD 4XBGB 2A2QT 4S1DD 3TO2A 3V52L 1NBQA 5IG7B 1U9KA 3EKCA 1OTSC 4OZHF 4FFVC 1N0XH 4JFEE 1N2RB 1OW0A 2FHCA 5JW4N 5L2JB 1U8QA 5DURB 2EH7H 2DF3A 3P3YA 2V5SA 3ROLA 3U9PH 3CLEL 5I71C 3IS0X 4G6JH 4L3EE 4Y4HD 1MF2L 4G42B 2GK2A 4ZXBC 4G8GE 1VFBB 3O3DA 5I1DA 4MJIB 4U1NB 7FABH 3CSYA 1RSFA 1K8IB 5JIHA 4CW1A 1EUTA 5IJKC 1CVRA 5D1XC 4M43L 3TJEH 4HPOH 1X5GA 1S78D 3MYJB 5CGYD 2CLZA 5DEGB 2OTWB 4PLNC 3DSFH 3QG6A 3NGBB 1YMMA 4UDTA 4TSCH 2ADFH 5BV7L 1J05A 4PTTB 3U0WL 4NWTH 3U7AA 5D1ZB 3UTPD 1EH9A 4JFEA 5EFIA 4WHDA 3I50L 3T77A 4QF1B 4M1GL 3TVMD 2VITB 1SEBB 1B3JA 2A0LC 4CADB 1IGYB 4NHCL 5JW5B 2JJTA 5A3IC 3HZYA 4MLSA 1BBJA 1L7TH 1TVDA 4IM8A 4KWUA 4N9GA 1KCRL 1EK3A 4JGUA 1T1ZB 4ZXBB 1Z0MA 4ZTPH 1KJMB 5SWZA 5I1EH 1G7LB 4XNUL 2NW2B 1FPTH 3BE1H 4L29B 2Y7QA 3C08L 3W0WB 3QO0A 4P2RE 1DL7H 3WN5C 4V2BA 1JWMB 1TNNA 4FXGA 4L3ED 3IFNL 4DCQA 2C1OB 4EXKA 3IB4A 3FQWB 4HWBL 3VXOA 3S9DB 2CDEB 4MNQA 1BPVA 3REVA 4FP8L 5KSBF 3MO1A 3VH8B 4KMLB 1QPXA 5D2LF 5CSBA 4JFOA 1WCBA 3WLWD 4TSAH 4POZC 5CINL 5DJAA 4NN5C 2O61B 1LILA 4JQVA 2P44B 3AROA 3IJHA 3L3HA 4BFGA 3P40A 4D0CB 3BWUC 3VFMB 4BSWA 4ODBD 1NEZA 4U1GB 2HTKD 3QQ4A 1GZQB 3MV7E 1MAML 3U0TB 3WJLA 3WMSA 4LHQB 3B9DA 1XGQB 2DOCA 5DD3H 4KPHL 3ULSA 3ZE1E 2J88H 1A6WL 1GAFH 1DN0B 1OP3H 3ARDD 1II4E 1SMOA 5DI8B 4W68A 4TSBL 2VQ1A 2PCPB 3QIWB 3BN3B 4NKMA 4V1DD 5B8CA 1MELA 1F90H 3DGGA 1A3RH 1W72A 2VISA 2BHYA 1BQLL 2JELL 3QIWD 1KC5L 1KIQA 3P9MB 4PGEA 1LMKA 3E1F1 4V1DB 2DWDB 2X1PA 1ZGLB 4EQ3A 3G04B 4U0RC 2FIKA 1JGUH 1T5XA 2DQTH 4WIQA 5C09D 1CICB 4LSDA 2NNAA 4FQIL 3RTQA 4Z7NE 1RZGB 3PJSB 1BJ1H 3V6FB 4BZ2L 3P30L 3QJHB 4LVOC 3E6HB 4MCYA 3KWWA 1LO3L 3NPSB 3ARVA 3I75B 2XTJC 2QADB 2DLTA 4JDZB 2VXQH 2ZJSL 2E7LA 2H8PB 1JWMA 4QGTA 1INQA 3OR7B 1XIWC 4OCWH 3MNWB 1I9RH 1NCDH 2XZAH 4OKDA 1DQML 4NCC2 1C08B 4FZEL 3MRCA 5K9JL 1RJZA 1FFNB 4NQSB 4KKLC 2A6JB 4BH7A 3ILQD 3QIBA 1N0XL 2EDHA 5A2KH 5BCAA 1ZK9A 3QULB 5E1AA 1HYRC 3BQUC 3OSKA 4NRZB 4ZOAA 3ARGA 3HMXH 5DJ0A 1HNFA 2N1KA 4J4PC 1JNNL 2C4FT 4PJBA 4M9PA 5JR1L 3G9AB 1RJCA 1PW3A 2UZIH 1ZXQA 2A74B 3T3ME 4Y7MA 4U1IA 2NY5H 2ZSWA 4ZNCD 2G5BA 1J12A 3BPNC 3WS6A 1R5IB 4F7CB 4R4BA 1OGTB 4HWZB 4UQ3B 2R2EA 3DV6A 3BIBX 2G5RA 2YA2A 3H3PH 5I18H 1G7HB 2MQ3A 5ESQB 4YDIL 3HMWL 5IKCA 4EBQL 5E8NA 3W2DH 1NMAH 1W0VA 1R5IA 4UINH 1XGYH 1AXIB 5I1DB 2A9MH 4MMZC 4LLYA 2ZSWB 2IH3A 4KVCH 2FIKB 5BRZB 3BIKA 2CO7B 5J7CC 5EH1A 1OSPL 4FMKA 4CUCA 4QRUA 3CZFB 4UMGA 1JYXA 1XMWA 1OPGL 4PJEF 5GRVK 3X3GL 3H9SA 5D71L 1JMZA 2EECA 1RQ5A 3IXAA 2UUDK 4QLRA 4OGXL 1QYGL 1T2QH 4JRYA 1N3NB 1TNMA 4JPIA 1JTTA 5IFHL 2NR6C 5L88L 1UFUA 2DI7A 1YEJH 1HHHA 2EIBA 5D1ZC 2PN5A 2XWBB 3O6KL 4Y4FD 1CXEA 4RX4A 4YHMH 5E8DL 4AY0A 3CDCA 1G7QB 1CGWA 2CPCA 5KS9F 3OX8A 3BP5B 5JW4R 2BMKA 2AV7A 3E8UL 1WWWX 3CIQA 4K2UL 3QEQB 5CEXA 4HWBH 2ICEA 5E2TL 5IF0B 5L2KE 1FFRA 1WCBB 5AD0B 5ITFB 3IDGB 4CNIB 1IAIM 3VXTB 1NCWL 3BKJH 3HG1D 3ORJA 1YY8A 4UAOC 4LU5L 5CHNA 1L6XA 3QG7H 3SE3A 5IJKA 3BISA 2VTFA 4ONFL 1I3RB 4OBRA 4RBPK 4Y19B 3KPMB 1QHPA 4PB9H 5IR1B 1HXYA 1NFDF 2DQFB 4KAQL 4GRWE 1RZ7L 3L7FA 3VFRA 5HHOA 4QXUH 1BQSA 1S7VA 4MHHG 7FABL 2FEDC 3O11B 3CDYA 2FR4A 1W72L 4LARL 4ZUSB 3IU4H 3HI5H 3RVWC 5JHLL 4OLWH 3SO5A 4TNWK 3BGFB 1ROWA 4HSQA 5FGBA 5F88A 4C56D 3T0EC 1QA9B 4P23D 4U6HA 3PIQA 3MLSH 3VFUB 5JXEA 4QHLA 3BRDA 1MLCA 2EICA 3P4NA 3VMNA 1QBLL 1RK0B 3GKZA 5CZVL 4IJ3C 5I1KH 1DUYA 3VXRE 1PY4A 2AI0H 2BHZA 5DMJB 2JF1A 5E9DA 5EORL 3BH9A 2W38A 3WBDA 4JY5L 1CLCA 1G7IB 4MVBD 4OUUA 2DD8H 4UAOB 1YUHA 4QXTB 1F45A 2YPLE 5T3XD 1FFNA 1Q9WA 2P43B 3BGMB 1IVLA 5C0RL 1Q38A 5JUEH 3MOQA 4HUWB 4DKAA 3MA7A 2COQA 2CRZA 4KPHH 3EJYD 5DD3L 3LEXB 4QO1A 5EBWA 4NFCA 3RWDB 1UT9A 4ZFGH 1P5UA 5I15H 3HG1B 1A6PA 1KB5H 3SBWA 5KN5A 2ED9A 3LH2H 1X7QA 1PG7H 2BVPB 4LSRH 4U6VH 5B4MC 1PKQA 5I1HL 2Z31C 1OOAA 4U1HB 1A3QA 4U6XB 4FABL 4JY4B 1CDUA 3QQNA 2NNAB 5EZLB 3ZSTA 4MNQB 4L8SC 3TLRA 1A7OL 5HYIA 4XVTL 3QEQA 3F7RA 2NY7H 4V1DA 1FVDA 3BIAX 4FHBD 4XP6L 5E0QA 1FH5H 2A77H 5T1LA 4HAGA 4XMLL 1QNZL 2WBJC 2FX8L 1L7TL 1MCWW 1JUFB 1T1XA 5C0BB 1CDGA 4KJYB 4P4RB 4POZD 3LZFL 4WW2A 4GG6F 4YHKH 4C56E 3KPQB 4P23A 4ORGA 4K71B 1KC5H 4XNYL 3W11D 3IDYB 3D25B 3WSQH 1I9RL 4QTIL 4HIEA 3T0VA 1LP9E 4JFZL 4P5MA 1GZQA 4ETQA 3OXRB 5ACLA 5ID1B 1U95B 3L7FB 3NFPB 2VXVL 1Y0LA 4OQTL 2HJKA 1INDL 1CLZH 4QF1A 1S7TB 5HHMB 2PF6A 3GMQA 4PUBH 4WUUE 2F5AL 1UGNA 1FNEB 2YA1A 2B1HH 2V2XB 1E4JA 5GGSB 3WNLA 3P4LA 3MV8E 2XTLA 3SN6N 4C55A 3VFWA 1TVHB 3FO2A 4HCRL 4RMQA 2C1OA 1BVLB 4ZOBA 1OAYH 2AV7B 4HWZA 1RJLB 5D7KE 3E6FB 1HOCA 5SWZD 2QQKH 4R90L 1G7MA 2CRIA 3VG0H 3ZDXF 3KLAA 2O26U 2ZUQB 1J87A 4YDKL 2FJFA 1G7LA 1G0YR 3IJYA 1N5AA 1RZKL 5L6YH 3F8UB 2MCPL 3E3QE 1Z9OA 1U3HB 4RGMC 1ZHLA 1QLFB 1IAIL 5L2KB 2H1PH 4KKNA 3TT1H 1YEGH 1YEEL 2IPTL 3OZ9H 4Q9CA 5C0FB 2YA0A 1GGCH 5HY9B 5IGXL 5H2BA 5JW5A 4G9FE 1JHLL 2ZZUT 3C6SB 4F9PC 5HYJA 5IEHA 4KI5E 4WGWB 3S96B 5HYEA 3UMTA 4FOMA 5DD1H 4NO5B 4HC1A 4Z95L 4NYLA 3GM0A 2X10A 3DLQR 2N4IA 3M8OH 5ERWB 1MHPH 4AYFA 2VLKA 4PGBB 2RCSL 3O6MH 4O58H 4PJ5D 2FCBA 3IFNH 1XGRB 6FABH 5AAMA 1AD0A 1DEDA 1JYNA 4L3EB 1MWAA 4P5KB 5EC1B 3KLHC 3SKJH 1KGCD 4HXAL 3L5HA 3VWKC 3HZMB 3QFJE 4EUPB 1ES0A 3CSYB 4U6TA 3LVEA 1I1AD 3MV8D 1H3TA 5E6ZA 2D7NA 3O4LD 4XBEL 1QKZH 1U91A 5AWNH 4F7EA 2OL3H 5C0CA 2VISB 4MA8L 1UXSB 2BC4A 3TYGH 5IBUB 2F54E 1WGOA 1T20B 3BOVA 1VFAB 2A6DA 4MQXD 1Q1JL 2BFVH 3KDMB 1ZT1A 3JWOC 5T5NF 1ZOXA 5HYFA 4XWOD 2OJZL 5BVJB 3R1GH 3KLAB 4BSWB 5F89B 4YWGL 5T5FH 5I73B 1KLFA 3ABZA 3WE6B 4YDJB 3KGRA 3S6CA 1S9XA 4GUPB 4AEHL 5DMYA 4WW2F 3WFHB 3PWNA 4N8VB 5C08A 1C5BH 4R97B 5C86A 3NVQA 3RHWF 2AGJH 2VSCA 3GSUB 2X40A 1CGTA 4ONGH 3U2SA 4FABH 5IFHH 1HWGB 2CDFB 1MCNA 4Z7UB 3S5LA 1AP2B 3W0WE 1UCTA 1CXLA 3I9GL 5B22A 3BXNA 3FZUD 1BM3L 1RUKL 3UDWC 3QYCA 3D48R 4LASH 1ZVSA 2VDKH 3LN4B 3PP4H 5CIPB 3LN5B 3VI4E 2OZ4A 4EKXA 2PYFB 1MCFA 2VDML 4EI6B 1BWMA 2FATL 1OWWA 4FQPA 5IMOB 5CIPH 4M5YH 4YHNA 2P24B 3KR3L 2YN5A 4LCIH 5LWYH 1J1PH 1XCTB 5KAQG 4EI5D 2XTJD 4K23H 2Y25A 1QLEL 1ND0B 2Y36H 3IKKA 3LDBC 4XZUB 5F1SA 3P9LB 1XF3A 5JXEC 5T5NG 2X4SA 4RWYH 3W11C 1NGQL 1UA6H 3QWQB 4JY5H 3MV7B 4G6AD 1KPVB 3PGFL 4GRWB 4DTGL 3OF6A 5I74C 5C07E 3GSVB 2P48B 5DC9B 2O61A 4Z7OE 2CMRH 3MRJA 4QWWC 3WUWG 1TQBC 4I77H 1RK1B 3TFKC 4K9EC 2XG5A 5EDXA 3EFFA 4OLYL 3S5LG 3DBXB 5E6IB 5I1LB 1LE9A 4HH9A 1R3JA 3V4VL 2QQNL 3W9DB 4F33A 2NY4D 5D9SB 4JZJA 3G9VA 1W8OA 1P84K 4HEME 4GBXA 2XY2A 1VFBA 3T2QA 3UZQA 2RGSA 1G7JB 1H0DB 3RI5K 2Q76B 1A7QL 4N8CH 4DW2L 3FO0L 1YUHB 3B9KB 2AABL 1S7WB 4KROB 1DQJA 3QUMA 2ZCLL 4PY8J 3UTTE 1ES0B 4OF6A 3WO3B 1AQDA 1MSPA 4GRLD 2A1WH 3LPGA 1D6VL 3G6DH 5EN2B 2G60L 3WIHA 2C3VB 2EZ0D 2L0DA 3QDGD 1YPZB 5D93B 4OD1H 4LDLB 3LB6D 4PJGE 4FNLL 1BZ7A 1X4YA 3UO1L 4WHYG 2W59A 1FNGB 2J8UF 5DTFB 4L3EA 3UTZB 5C07D 4I18A 3C5JA 1IC4L 1QBMH 3IRZA 5ID0B 1URLA 4OCXL 5FECA 3VFRB 4I0PC 4UIMA 2ADGB 1DQQA 2RIKA 2OJEB 4RBPH 4M02A 4MCZA 4OZIB 5HDLA 1MAJA 2YN3A 4KDVA 1FVEA 4XP9H 5F1NA 5GJTH 5HY9A 4A6YL 1QFHA 1Y6KR 3GMLA 3QUMB 2FLBT 3QHTC 1KIPB 4G6KH 3QUXB 1F00I 3MRQA 1NDMA 3RAJL 1LQSR 3MNVB 3V52H 4L8DA 3Q6GL 4P59L 1QKZL 1SYVB 3FOMA 3ZYIA 5IHZA 5DD1L 5AD0A 3GHBH 2HT4D 1S7UA 2GAZA 1PEWA 3CFCH 5DHVA 1A0QH 1YNLH 2BRRL 1C5DA 4MD5A 3TBVB 1CQKA 3ULVE 3O4OC 2W91A 4L8SB 3CAFA 1IAIH 4NQEE 1IL1B 2J6EL 4MHHI 2GUOB 4RCAA 2ZSVA 2NY5C 5BRZE 6FABL 2GAZB 1DLFH 1KEMH 2ESVB 1RU9H 3LB6C 1NJ9B 2Q8BH 1OY3B 3FOMB 1FVDB 1S9WA 2VZTA 5DO2D 3BYTA 3O3EA 1VKXA 1OCWH 4OLUH 2NR6D 5ILTL 2X4PA 3QDGE 4HCRH 3VA6A 4Z77B 1M7IA 1F42A 4TRPH 2EE2A 2VC2H 3QEHB 3NCCB 1XF5B 1X7QB 3MRRA 4R8WL 4S1QH 4M7KL 5IB3B 2PKDA 1A1OB 4NSKA 4ZTPL 2D0GA 4ZS6D 5J11B 4NQDE 3EYUH 4IRJA 1AGCB 1NGZA 3VDBA 4HUXB 2VLKD 3DXAB 2AJUH 1RZJH 5GQBA 1I1AA 3MV8A 1NUDA 2JCCA 4UQ2B 4ZAKA 4MVBC 3TBYB 1B6DA 4TUOB 2ARJA 5D7IE 1YMHB 2D0FA 4MDIA 2BY0A 4KHTL 3R1GL 4M4PA 4TYUA 2ZUVA 4UOW0 5JQHC 3RKDC 2ZUUA 5C09B 5ANMA 3CXDH 5DDHB 1MFAL 1TITA 1OAQL 2ICWB 1AO7B 3CFKB 3AM8C 5KS9A 3FFCB 1HH6B 2NW3A 2DLFL 3KXFD 1W8NA 1HXMB 1HIMH 2B1HL 1SYSA 1FG2B 4OGYH 1N59B 2A77L 1FDLH 4LCWB 5GSRB 1G84A 3L5JA 4FQ2L 5D1XB 3LQAH 3QNZB 4MGXA 2Y06L 1NEUA 4O2FA 4OZFB 4UU9B 4Y5VB 4LCWE 3VXMA 5EZLA 4YUEL 3A6CH 5FFLA 2HA1A 3RL2A 5LGHH 4HD9A 3FAWA 3FRUB 1BZ9B 4HH8A 4RZCA 1A6UL 1EAJA 4PJHE 1ZMYA 5GS2D 3MXWL 1GHFH 4MWFB 1XGUB 4P4KC 4C83A 4DGVH 1T1WB 4R4FL 4LF3B 3RP1A 2RCSH 2VN4A 4ONHA 1FNFA 4TULL 2DQHL 4X9IA 1IC1A 3OJVC 1NGQH 1UA6L 3QNZA 4O2FB 1H3GA 4UU9A 2R56L 5C71A 4ZYKB 4PRAB 2HH0H 3VXPA 3SGJC 3TZVD 5MENB 3UDWA 2DTMH 1B9ZA 3V4PH 1VFUA 2BHUA 2IQAB 3UTTB 5MEOB 1PZUB 1VEMA 1R3HA 2NX5D 4ODHL 2HFTA 5I9QC 2EDYA 3GGWB 2Z9TA 4S2SA 1KG0A 2L4OA 3TFKD 3BP5A 4HHAA 4QHNB 2NY6B 4U1JA 3JTTB 4K9EH 5DRNA 4A6YH 2GY5A 3NN8B 5LAXB 4MDIB 5K9KB 4V2CB 3EFDH 3F65A 2VLJD 3HN3A 3MV11 1Z5LA 4G80A 4ORZC 3GMNB 1AH1A 3LRGA 4MNQE 3U0TA 2J5LB 1QSFA 2Z31B 3LS5L 2VLJB 1IC4H 5KVDH 1U8HA 3SE8L 1J86A 2WBJD 3VXUB 4OV6F 5EB9A 4PG9A 3RI5F 4D0CA 4DW2H 1L7IL 4UNVA 1CQYA 5F3BA 4HF5L 2YXFA 2Q86B 1WIOA 3GSQA 5EOCL 1E6OL 4OIBA 4XNQB 5D1XA 2A6KB 3AB0C 5D1QB 1HI6A 1X5FA 2DRUA 3CX5K 2NW3B 3C9NA 4GS7C 1MQKH 4G7VH 2FEEL 5KSUA 5JHDD 5FV2A 4L8BB 3OKDB 1OGAB 5D6DC 5TE6L 1G7QA 3K74B 2IF7A 4X9BA 3S98A 5HHXH 3PABB 1OGAE 1VFMA 5CBAA 4EXPX 1CWVA 3W0WA 4PRNA 3D85A 5IVXF 1RZJL 2NX5E 4KGLA 4HCRA 3NCJH 2VERN 4AQ1B 1I1FB 3L5IA 1ZEAL 3RWGA 1MREL 5ELIA 5JTWA 2YUWA 3U9UB 4TPRH 3RUGA 4Z7WB 1XF1A 3MRQB 3TBSB 5JOFB 3V5KA 3PWPA 3IRPX 1MCEA 4PJ8D 3X3GH 4MD4A 5D96B 1XR9B 2P42B 5E2UL 4XAKD 4CDHA 1S7XB 1MWAB 4P5KA 2D9QB 5EC1A 2X1OA 4NBZB 5HDOA 3U7YL 1QEWB 5D1QC 2WINB 1JN6B 3PG2A 4EUPH 1IMHC 3HPLA 1HILA 4X7TB 1IBGL 1MCKA 4XRCB 5DJZB 4I0PA 5H35A 4UINL 4X80H 1T03H 1AKJB 3SGDI 5HYJD 3ZMRA 1RUPL 1DEEA 1JK8B 3MMEA 4PJDF 1I7TB 3AU1B 1PSKH 3GIVB 4UB0L 2AGJL 2HLFC 4I3SH 1P4LA 4N0FA 4DQOL 3B5TA 5DC0A 1VFAA 2A6DB 2PTTB 2LFGA 4PJ7F 4PPTA 4ZQKB 1FCGA 1KENH 3FB8A 5M94B 1ZLVH 5IMKA 4I3RH 1S3KL 1FGNH 3O6LL 4Q6YA 1A22B 5HHMD 1IEBB 5D7LB 2H6PB 3IXTA 3VXUD 3DRTB 4GT7A 2XY1A 1ZHBB 1TJHH 3NZHH 1J18A 1FGVH 4FG6D 1DBAL 4MZ3A 5IW1A 2LTQC 5EU6D 1INQB 2P8LB 1CGUA 3OKDA 2YMXL 5I66B 3I85A 1DVFA 1TIUA 1UB5B 3RWCA 4P2QA 4NQSA 1G9NH 4NGHH 2HT4C 5C0CD 3VFWB 1GYAA 1PQZB 1GGUA 2Z35A 3O4LA 5K9JH 3RAJH 2PR4H 2UV3A 1EHNA 4OV5B 4ZPVB 3OKYA 3QXUA 1Q0XH 5MENE 4IRJC 3MRIA 3HC3H 2UY7A 4NWUH 2BSSA 4CKVX 4P57A 1FDLL 4APQC 1OCWL 4OLUL 3LKSA 5DVOA 3IFOB 4N0CD 3BX7C 3EZ8A 3RIFF 5IFAH 5BVPL 4Y16D 1XGTA 3ZDYF 3WD5L 3GMNA 1F8TL 3PF2A 2AJZA 5EULV 5J6HA 4YHPA 5DS8B 1L7IH 3WFZA 4PY7B 4NN6B 2ICCA 4X98A 4IDJL 4X0KB 1UM5L 4P46C 4TVPH 4M93B 4BFIB 2NW2A 2MCG1 4KDWA 3NFSH 2ZPKL 1LE5A 4QTHB 3BQUA 3ZTNH 4M8QB 4KKBC 3E6FA 3BP4A 1NLDL 3MJ7B 3LN4A 4J4PA 3VXUE 4B7LA 4TUKH 3LN9A 1ITCA 2H2SD 2EO9A 1BFVL 2NY3D 4P3CL 4XNXL 2FGZA 1DUZA 2YD5A 3V0WH 2HKHH 2HKFL 1K4CB 3LSOA 3DV4B 2X9WA 3O0RH 3RVVD 4U3CA 3VD3A 1FORH 3LRSB 1I75A 4ODHH 4PTTA 5CJOH 4JY6B 4NZJA 3UEZA 4OCSL 3WFCL 4QY8B 5GS0H 3FFDB 1Q72H 4BSVB 4J3WA 4AT6B 4F7PA 2EDNA 4LSQH 4NZDA 2FJHA 1LEKA 5BVJA 2DWEA 2IADA 4IOSD 1FNLA 2ZOLA 3U7WH 2NY0C 1KB5L 3EYSH 2YPVL 3VGAB 4M8QA 5D7IF 1G7IA 1O0VA 4JO1H 3LEYL 5I74B 4Z78A 4P2OA 2LAGB 3BMWA 2RBLA 2AV1A 3QA3B 1NMCC 1PAMA 4LVHB 3CFDB 5FYKD 1HQ4B 2FECI 2NY4C 3GI9H 3IDJA 2B0SL 3GHBL 4PGZA 4HS3B 2H41A 5EO0A 4XCEA 3U0PB 2OR9L 5FUCC 3ZKQD 4OIIL 2R9HD 1YMMD 4U1KB 2ZKHL 2IANB 1UZ6E 1E0OB 4ZD3H 4WI5A 1JRHI 2W0PA 1BGXH 2FHFA 4XBEH 3GSUA 1MRFH 3HZMA 4LVOB 4I9WD 2M1KA 5EPMA 3TP4A 4PJAB 1IGCH 5C8JB 4MDJA 4AG4H 4PJ8A 2ZWLT 1UM6H 1XH3B 4Q9BA 4OQTH 2ZUWA 5LGHL 5FYLL 2VZ3A 3PDDA 4XVJH 1S5HA 2YRLA 3ARDA 4Y4KC 5FK9B 3GSXB 1FPTL 3BE1L 3HI6L 3N1GC 3NIDF 2GTZA 3QZWB 4PJGB 4LLAA 4XWGL 4KHXL 1NCNA 1E4WL 4AEHH 1K4DB 1MJ8L 3CVHL 3BH8B 4MMXC 4Q6IA 3UYOD 4E41A 4Q2ZA 1GZPB 1P2CB 3GBLA 1DBBL 4AMKL 3O41B 5F1KC 2XA3A 2BVEA 3FO1B 3MLXH 2GJ6E 1A7PL 5C3TA 3QUKB 1OF2B 5KBNC 3TIDA 1JHTA 4PP1C 3MNWA 4JFFB 3MREB 4WV1A 3WLBA 3WXWL 1HEZB 4GW5B 4J3UA 5FHBL 3KJ6L 3AM8A 3S7GA 4CMHB 4ZUWA 3SJVE 3HE7D 3OGCB 1JI1A 3EGSB 2VAAB 3FB7B 5E8PB 3MV9D 4NKQB 5L0QC 2XFXB 2DQDH 2R0LL 3S4SA 5EU3A 4L9DA 4WUUB 2DQIL 3V6BR 5B38G 1U8IA 4HBCH 3QUYB 4PJDB 5DMKB 1KJ2L 5ID1A 4YO0B 5DVMA 2XFXA 3ARZA 2CK0H 2KQMA 4UQ3A 4KROC 1LGVA 4ZNEE 3MBXH 4U3XA 1DLHB 35C8L 4P5TA 3SQBA 3TH2T 5DJ8B 5CD3A 3MTRA 1N5AB 2OR7A 4XMKH 4KJPC 2X1XR 5E99H 3PL6D 2YD8A 3GO1L 5HTSA 3ZDZF 4KTEH 4GRMB 4LBEA 1QSFE 4J3TA 5D1ZD 5IBLC 5FXCH 1DLHA 4IHOB 4ZS6C 1A6AB 4TSCL 4BYHA 1IJ9A 4HK0A 1NC2A 4NO0D 2V2TA 1I3VA 4YXHH 1HHIB 2GJ6A 1TCRA 4HS8H 1PJ9A 5DT1H 1ZANH 4QHUA 4R3SB 5IW3A 3RVXC 15C8L 4CMMA 1EMTH 1YEDA 2VLRE 3BKCH 1MQKL 2DM2A 1B2WH 1ZLWH 4JKLA 5C0AA 1OAUH 4RNRA 1E28B 1WIUA 3QUXC 3MUJA 4DN4L 2AJ3A 1IARB 3CFBA 1T0MA 1MHHA 4U1LA 1MIEL 4FNLH 4WHYH 4P46D 4CBPA 2EE6A 1N64L 3QNXA 1LK3H 3HCVB 3RX8A 3CXHJ 3N85H 4E0RA 3DO7B 4GQ9H 4RMRA 3NA4A 3EDJA 5F7NC 2UY6A 2E7MA 4APQA 1QEWA 1UH3A 5FB8A 3W2DL 3LPWA 5EOTA 3TBTA 4QHLB 3VD9A 1XR9A 1EEYB 5CBEA 3FT2B 3HZKB 4OFKA 4Z7UF 5DJ6A 5B8CB 3JVGC 5J4MA 4IS6A 1JZ8A 3TYFB 3X11B 2Z92B 3SKOB 3DETD 1NEZG 1IQWH 3H0TA 3F7YA 2Y5TB 2PO6C 2OP4L 4O5LH 4ZYKA 5D2LA 5FYLD 4CVXA 4GQPH 5EIIA 2BCKA 4Y4FB 2FB4L 3MRCB 5DQ9B 1KJVA 1EBPA 1U3HD 4WO4D 1H5BB 1WBYB 1VGEH 4BSVA 4NO0B 4HBQA 5CJBA 3RTQC 3GB7B 4W81A 3EYOB 5GGTH 3W9DA 1WAAE 4OD3L 3ARDC 3E6HA 4MCYB 4HDIB 5IFAL 1BOGB 3ARUA 4PBWD 3LEVL 1KUMA 2HT2D 4JPVH 4OZFH 1Q94B 4IMLA 4GAYA 4JJ5A 5FM5O 4LK4A 2XQYG 2H45A 3MUHL 2DMCA 5E9DB 3G5YB 4YAQA 4NZRH 1DUZB 3T8XA 1KIQB 1SYSB 2WSKA 1MLBB 1NPUA 3VFUA 3FB6B 3VA2C 2W9DL 4ODTH 4ODVH 1AE6L 4PBXA 4WRLA 3T1FA 1EIBA 4MA1C 4MLIA 4LPWA 1I1RA 4QOKB 4ZO6A 3G6DL 4P2YA 1E4XI 3ZTJG 4I8DA 3VFPB 5DHYB 3KPLA 5SWSD 3IFOA 3QJFA 3PV7A 2Z93B 3WS3A 2NQCA 5KANG 4A2MA 2G9HB 2Z4QA 1SYVA 4ONGL 4ENEC 2GFBB 1CBVH 3MSPA 3HR5B 1KJ2A 2IAMD 2BOBA 2VUOA 5I8KL 2YWYA 5F1NB 2GEEA 1TQCC 1J88A 2F58L 4B7IA 1D5IH 3HS0A 3NA9H 3P0YH 2DLGA 2P5EB 3QBTB 2A9ML 4ZNEA 1YQ2A 3HA0A 3KYNA 3FCTB 2VDLH 3PWPD 4Z7WE 1KJ3L 4QTHA 1RURL 2X4OA 4TTGA 3MRPA 4I13B 4WFED 1YEHH 5J13B 4CU7A 1JNHB 1QVOB 4M1DL 2C3WA 1EBAA 1ZT1B 4GG8B 4XCYB 4D9RD 1JIBA 1VENA 3WJLC 3MROB 3VGAC 3LKSB 2F53A 4I2XE 1A14H 1X5XA 5KSBB 4DK6A 5EFIB 1J5OH 1EO8H 4FXKA 4LP5A 2IH3B 1YYMH 4FQJL 5D71H 3UJTL 2V7NA 5I8EB 3PV6B 3BI9X 1Q9KA 4YXKL 2EYRB 1KIRA 3I2CL 4M62L 3MMEB 4BELD 1JPTL 4OZ4A 1MCHA 1EAPB 4KJPD 3REWB 3VWKB 1U8KA 4RISL 5D7LE 2HMID 1JPSL 1ZT7A 5F9OH 3B9EA 3OKEB 5GGRB 1NAKL 3L5WB 5JOEA 4NNYA 3PDOA 4U7MA 1SM3L 1GL4B 5DLML 2X9YA 2MSPA 5IW1B 5DUPL 2M2DA 4PB0L 2FWOB 1F3JB 3DI2B 2OK0L 1RMFH 2FBJL 4DEPC 1KJ2B 1QFWH 3ZKND 4XCEB 3U0PA 1FV1A 3FT4B 4Z0XA 1I1AC 3EYFA 2QKIA 1X5LA 1QBBA 5FUOL 3PWPE 5ESAA 3NFPA 2APTA 3UYRL 1EHLH 2F8OA 1NCDL 2XZAL 3PWPB 1CE6A 2GSIB 3TO4D 1OAUL 3MLSL 4WFEE 3SKUD 3BW9A 3EJZD 3Q5OA 2FO1A 3B6SB 2L7UA 1I8IB 3ECBB 4JFQB 1XCQB 3DGCR 5EBGA 3VG9C 4F57L 4GW4A 3KYMA 3RX7A 2XN9A 4NN5B 3W39B 3AREA 3N85L 5HHQA 4KK6D 2PYFA 2WUCH 2FSEB 5DYOA 5L7XL 4G7YL 1QNZH 1I3UA 3UTOA 5DK3A 2NTFA 2V17L 3ULVH 1FNSL 3OR6B 3GMMB 1PKQB 2JTDA 1NCCH 2W60A 1M6OA 1VADA 4LU5H 5SX4H 1XGYL 5GJSL 5MEPA 4RGNE 4NC0B 3QUXA 3V6ZA 2XICA 4X4XA 1XT5A 2NTFB 2CQVA 1A4KA 5KSAB 1LVEA 5IGXH 1UB6A 3GB7A 4FFYL 1MJ7H 3BO8A 3T0EE 5I75B 1EZVX 2OP4H 1Z2KA 3K8KA 1KJ2H 2EKJA 4PJCB 2UYLB 1BF8A 3RJDA 1WZKA 5HBBA 5KVEH 4BQ8A 1GIGL 1QR1B 1NCBL 4I5BA 4ORGB 4QXTA 5GGTL 2I25N 5DD6B 1UENA 2J6EA 2AK4A 2DLHA 5HPMA 3T2OA 5C0BA 3BH9B 3SGEI 5DRXB 2CUHA 3QPXH 1T7WA 1RULL 4PJIE 1HDMB 3FFCE 4N90E 5ACZB 4NNXB 4WW2C 1ZLSH 1HI6B 3EYFB 5I1HH 4D9QD 4G9DA 4HJGA 2WWMC 2DQHH 1LK2B 4ZDHB 4Z7VF 4Z7QF 5LBSL 2VKWA 5D1ZA 2P4AB 4JM2C 3TGXA 5J1AB 5EZIH 4NJAL 4J3SA 2D7OA 3DI3B 3IFPB 3V7AE 1VA9A 3GHEL 1AD0B 1I9JL 3V8OA 32C2A 2EXYD 3MYJA 3VFSA 4NZTH 1ETZB 3HPJA 4KTDL 3BWAA 4L3CA 4RIRA 1JF1A 4P2OD 1WK0A 3WIFA 3W39A 3ARXA 4X4YA 4LSUH 4KK5C 4HXBL 2PNDA 2R29L 4KKCD 1EUUA 5DRZB 3QIWC 4NUGH 1N59A 3G6AB 4JO4L 1BFOA 1EV2E 1CLZL 3ZKXB 4LVNB 5GRWA 3IAGC 5EC2A 4Y5YB 4UBDD 1CDBA 2C7UB 2IBBA 4M48L 4ISVB 1I4FA 4FZ8H 4XVTH 4TVPD 4I2XB 2W9EH 1P1ZB 4BKLA 1JGLL 3CDFA 1MFCL 3BZFB 3I02B 1CFSA 5DMGD 1RIHH 2XWBA 5FGBC 4FS0A 3AS2A 1I85C 1MFDH 2GYSA 1WBZB 4NDMA 3WNKA 3STZB 4HJ0D 4ONHB 1OARL 5T3ZL 4YXKH 5FUOH 1NMBL 3U4AA 3PXJA 4JG1L 1HHGB 1CGSL 3U36A 3WKMH 2VDOH 5E9DE 1TVHA 3MRBA 4KKLD 1A7OH 2WIIB 5DMKA 3MODH 4AEIL 4PGBA 2YD6A 3F5WB 2W0FA 2V2XA 1MEXL 2PYEB 2BNUA 3RL1A 1A4JA 1T66D 3FT4A 1WAAF 5LCVH 5BRZA 5DRWA 4NUJB 3D69B 4PJ7A 5F1OB 4YGVB 3U9PL 1CIDA 3V7MA 4HUMB 1M71B 3C6SA 3F5WA 3DVGB 1NJ9A 4K7PL 5DJYA 1UWGH 3LS4L 3VWKA 4F58H 4HIJA 1EJ6A 1U3ZA 2LV4A 4OCSH 2EKSA 5I6XC 4F7CA 4X6DB 3OHXA 4XPFH 4Y1AE 1UACL 3KPQA 3PUCA 4I4WA 2XN9B 1GC1L 3LKPA 3QFDB 1EZVY 1MJJB 5IMLA 1IM3A 1J0YA 2VABB 3CLEH 3E0GA 3R8QA 4EN3B 4J2XA 1B4RA 2I5YL 1FG9C 4EUPG 3S37L 4J6RL 4TVPE 3RUGE 2ESVE 3FN3A 1M71A 3BZ4A 4L4TD 4XC3L 3HR6A 1I1AB 2ATKB 3MV8B 4YAQB 3MGTA 4BK4A 4L8DB 2YKLL 4KK6C 5DFVC 4HIJB 5IJVA 5DRWB 2HP4A 1GPOL 3OXSA 2WBKA 3CVIL 5ESAB 1K2DA 4P23C 4G3YL 3EDDA 3NTCL 1U91B 1NCCL 4F7EB 5F7DA 5AG9A 1E27B 4U7SA 3SDAA 5FUZH 1NQBA 4BFBD 4WFFD 4M5YL 3FKUS 5I0DA 4JPKL 2ITDA 5FO9A 3QHFH 4WVRA 1G6RL 4XBPA 3S8WA 3DETC 1EEZB 3MBEB 2BSRB 2R2BA 4DK3A 2X9XA 2P5WA 4X7SL 1U36A 2P47B 4ZUWB 5LAXA 5K9KA 1PX3A 3FN0L 3OJMB 1TQCB 4F57H 4HZLA 4TUKL 2BCKB 1ZGLM 3GI8H 3NCBB 4IBLT 5K59E 2ILLA 3HI1B 3BAEH 3NIGE 1EGJH 3GKWH 5AUMA 4U0RB 4N0CC 3QUXD 2X42A 4HFWB 3KPRB 4K94H 3VDCA 1TENA 1VERA 1LO2H 1MNUL 2XG4A 5E4IA 5JO5A 4G9DB 4HJGB 2GW5A 4NBXB 3OKKB 5C08D 2F58H 5C70A 4LPUA 3ZLQC 2OCFD 2EDKA 5EO1B 3FQXB 2P5WD 3G5YA 4JKKA 3IVKB 2F5BL 3BP6A 3C09B 4JN2B 5DK0A 2F53E 4WDIB 1OW0C 4CGTA 4ELMB 2I60L 3T3PE 5I17B 2BVQA 3OKMA 4ALAL 3UBXB 1JNHA 3ZZ1A 1T1WA 1I1CA 5CJQH 2ADFL 2ESVD 3BVNA 4LLWB 5DRZA 2JB5H 4WGVB 1S7VB 1LE9B 1LO3H 3ILPA 5GRUL 3KR3H 4LL9A 2VNCA 4OI7A 3WL9A 3D5OF 2GIYA 1T04A 5J1TC 3DHJA 1BBDH 2X7LA 1EVTC 5CZXD 5IR1A 3TPKA 2J88L 4HXBH 3KPPA 1EHLL 2MHAB 4RWHA 5F7KC 3H7BA 4WFFE 3TT3H 4JFXB 4MD0A 3RA7L 4APQD 3ZE0E 4X9GA 2EH8L 2X4QB 4JVPA 5IFJA 3O81A 5DVLA 4PB0H 2Z92A 4JDTL 2PO6B 2VO5A 5IVZB 3AUVA 4NT6B 2ICEB 2AEQH 5HHPB 3KYOA 5DSCA 4HS3A 2ZG1A 4PJHA 3MJ7A 2BSTB 1IAMA 3P4NB 1A6WH 1GAFL 2CIIB 3HRZB 1I8KB 5L9DH 2WBWB 3LRHA 1EEUA 2XACC 5DUBB 5CGTA 1EHAA 5CEYB 5K93A 2VUYA 4JGJA 2IALA 3QXTA 4POUB 3EJYC 5C0EB 4KKBD 5C0AD 2R1WB 4JZJB 5KVFL 3WCYA 3ARSA 2ZOLB 2EDOA 2VDOL 5E5UB 5CFHA 4JKPL 1Q0XL 2FECL 3DMMA 4F7PB 3MRRB 2HVJA 3TBTB 5E08L 2XTJE 25C8H 4N1CA 5ENWA 1NUGA 4UBDC 5IEKB 1T66C 4O2EA 2E3VA 4NC2B 1MFCH 4PJ9A 5GIRB 4D0BB 3EYQD 2GQHA 4DGYH 2A6IB 4HUUB 2F54A 2CKBA 4ZFZA 2H32A 3SDXA 3BT2L 3Q1SL 1N8ZB 1T7YA 3ZKMD 3KYKL 3MCKB 1NDGB 1LD9B 2UUDH 4FXGB 4HJ0C 2GY7B 3BW9B 5MP6H 2DJ4A 4Q6IC 1J1OH 4LIQL 3B5GA 4JN1L 3ZKSD 4AM0A 3HTLX 3UAJC 4QRSA 2I5YH 1L4IA 1TMCB 1C1EH 3FB5B 1EA9C 1T1ZA 3MV9A 2ADJA 1T21B 1OSZA 3ULUL 2MPAL 5K9QG 3R0NA 4LHJB 3UTSB 4MAYB 1FLRL 1H15A 4WV1C 2YK1L 5INDB 1MWAL 3ES6B 1T22B 3DWTA 3RBSA 4ZPVA 1OB1B 2AK1L 3K4AA 3UTTD 4ELKA 4X6DF 4IOIB 3RPIB 3B83A 3MLRH 2FR4B 3EJZC 4H5SA 4D8PB 4XPFL 5ICYA 3KWWB 2B5IB 4MXVF 4G8FA 3FHQA 4J3XA 4LCYA 3MLPA 3PWUB 4HGWA 2I26N 3ES6A 1XZ0A 2HJLA 5SWSB 4MD4B 3QQ3A 1OTTC 1S8DA 2V7NB 4ZAKC 5FO9B 1Q8MA 4D9LL 3H3PL 5I18L 1QSEB 4GAGH 1ZGLP 1T5XB 2P1YA 2W1NA 4LGSB 3Q6GH 4P59H 3SDAB 3S96A 4FFYH 3UZEA 3C87A 3ARQA 1RV6X 5INDA 3VXNA 4DN4H 1QFOA 5D7LA 5I73C 2VZSA 3VJ6B 5FKAA 3OXSB 4RMVA 5DJDA 1H3WM 4S1SH 1MFBL 4DUWA 2Y5EA 2XPGA 2BXYA 3MUGB 4FQXD 2BMKB 1CDYA 2DTML 1BJ8A 1UWGL 3GIVA 3LV3A 2PW1A 1OQXA 3SPVA 2GTZB 4G8GA 1F3DJ 3QZWA 3S3PA 3SEPA 3WEXB 4QXUL 3HNTH 1MCWM 3KLHD 4ZXBD 4U7KA 5FA4B 2BNQD 3QCTL 2CKBB 1NAMH 4DEPB 4NUGL 1G9NC 4QKXB 2F8XC 1Z0NA 3V7AG 3JV4A 3GJFB 1G9ML 2FD6H 5BZWB 2MOVA 4NQED 3QG7L 4WJ5B 1GHFL 3B2VL 1B2WL 3IFLL 1MNUH 1GJIA 3MODL 2NYYC 2ORBL 3V6OA 1OM3H 4PJDA 4YHLL 3HAEG 3OAYK 4CN1A 4KRNA 4Z0BH 1MHCB 2QR0A 1OLLA 1EERB 2PW2B 1CCZA 3JWNC 4Z7WA 3RUGB 4B50A 5C6TL 1R0AH 1N7MH 4X8XA 4U1SA 2K7QA 1YJDH 3D85B 1AR2A 4NZUL 4EOWH 1B6UA 4AH2A 4N5EC 1FL5A 4MAUH 4OCLC 4HS6B 4QRPD 5H37H 5LKNA 3JWOH 4XVUC 1H3UA 4AIXA 5HHPA 1F4WL 4G8EB 1CD8A 4LDOB 1TDQA 3MR9A 2AJVH 3LH2L 2A6IA 1ZANL 1QD0A 4LSRL 4U2YA 5E6ID 3DRQA 4ZUUB 3EO1A 3T8XB 3ISWA 5C0NC 8CGTA 3M07A 3I6KA 2JIXA 3ZL4H 3EOTL 4FA8A 2AEQL 1OAKH 3HE6D 1JPGA 2C7UA 3SO3B 5IESL 1NFIB 1MCSA 5C09E 1KPRB 3UJJH 2CKBL 2GHWB 5I19H 2J8OA 3RNKB 1FAIL 5L8JB 1IAOA 4EEEA 5LXGH 3SE3C 1F97A 5E5MA 1T5WA 1J8HB 3BQUB 4OGYL 3MUGA 4CU8A 2IALB 4LRIA 1OP9A 4R4NC 1KCUL 2NCMA 4K3GA 1R3IH 4JO2L 1VGEL 1RZFH 5T1LB 2CXKA 1SEQH 4XMPH 5FYJL 3DRQB 2BVQB 3OKMB 3L3DB 5E00A 4QWWD 2EXYC 1TCRB 4UT7H 1RZIA 3DYMA 3HNSL 1J9CT 1NGXB 2X4QA 4ZTOH 1AGDA 5HGDA 3BPLC 2YBRB 4XCFL 5KANI 4DJMA 1MCLA 4P2QD 3UYRH 1F6FB 1JE6A 1JK8A 1WTLA 1FYHB 1XGRA