2B1IA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 220
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1iA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1iA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1iA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1iA03
1M6VA 1C30A 2X8WA 1PKXA 1VMDA 2IU0A 1P4RA 2IU3A 1C3OA 1ZCZA 1IK4A 2B1IA 3ZZMA 1T36A 1CS0A 2XW6A 1CE8A 1BXRA 2YVQA 5H3LA 4EHIA 1G8MA 1WO8A 1EGHA 4A1OA 1S89A 1OZ0A 1B93A 2B1GA 1S8AA 1PL0A 1THZA 1KEEA 1A9XA 1M9NA 1JDBB
chains in the Genus database with same CATH superfamily
2EFYA 2UYQA 4C0KA 1EGQA 1H6CA 1PR6A 1K4CC 4FFKA 3GQBB 3CH6A 1P31A 3LT4A 3LSTA 5KCZA 3NYIA 3HJHA 1EG7A 3BL5A 1S3GA 2PLFA 2FSGA 3F7TA 2QL6A 2JATA 1D3AA 1AU9A 3W9SA 3PNVA 5TDHA 2DYKA 3VDMA 4JDPA 3S68A 3RYHA 1B43A 2QB5A 3IUBA 3WGLA 2N75A 1K86A 3G8AA 4IH9A 2NU8B 3WZ2A 3I01M 4HGNA 4W5OA 1VKHA 4EJ0A 3FOWA 3NIWA 2IP1A 5L3DA 3W5BA 5K8TA 4MVMA 1VRWA 2PUJA 3ABSB 2D06A 2B98A 2C59A 1JP7A 3LY7A 1COWA 3ZOKA 1PSZA 2R8RA 4IZIA 1FMTA 5CTAA 4IJQA 3NANA 2ZRKA 2Z9BA 3FBWA 4WTOA 4WF9V 2WJAA 1OZGA 2V4MA 4ZU1X 4HOYA 3WIEA 3IR5A 5TPZA 4K9RA 4WN9A 3O93A 1QDUA 3FSRA 1NN1A 2XQGA 4XLZA 4J7KA 4YCMA 4KO1S 3ZDQA 1H05A 5CA1A 4Q66C 4C6TA 1YCGA 5CAEB 1MZVA 4IXNA 1HZZC 4F2DA 3WJAA 1W0KD 2OV1A 3JASA 1D6MA 4PG6A 5I5EA 1PM9A 2OIEA 5EWJA 5K1XA 1PYGA 3ABKB 1DBVO 2VHQA 3TG8A 3RAEC 3BKWA 3H84A 2PL1A 3NGLA 1RLOA 2ZE8A 2IPNA 1YS7A 3DHYA 4PLYA 1CDZA 2WMNB 1ND6A 2WLHA 3C1TA 1RWNA 4LF6B 3Q9UA 2GRUA 1KFJB 1TAGA 3B9PA 1L5VA 3V1UA 2QP4A 1Q95A 1JPUA 4B3GA 2JI7A 1R3DA 1QV9A 1I33A 4YB8A 1O94A 1E89A 1JF8A 1L7EA 5HFLA 2V9ZA 3H9EO 4DGQA 3VVMA 3ADKA 3IURA 3Q3GE 4FB4A 2C7RA 2AOVA 3WWOA 1ULSA 3GVCA 4ZWNA 2ZRBA 1TMKA 1EUCA 1D2AA 3MYYA 1ECPA 3IYLW 5JV5A 2IX9A 1JQEA 3R7SA 1JT9A 4WK0B 2OHFA 3LTEA 2XNKA 2Q3MA 2K2QB 3PJSK 4P1ZA 3TI9A 5GM2A 1PNMA 5A9SA 4FDUA 4HBGA 5AXAA 1JJVA 3CC2V 4YCDA 5HMLA 2AV6A 3S70A 2CL0X 4NYJQ 3JQAB 1UOQA 3K4HA 2HJRA 1RRVA 4DYVA 4DADA 1G98A 2PVSA 3ZE2B 1S4QA 4QDKA 3M8AA 2PZAA 1IMOA 1SQQH 3WGHA 1WQ3A 2PX0A 1B8VA 3HMQA 4QU8A 4KPEC 1KVUA 2PBLA 4MSJA 1NQVA 1WP9A 1C7RA 3U7EB 4RFSA 2OO5A 4DCCA 1QP7A 4P5DA 3BAZA 5DLQC 2HHCA 3OPYA 4X64O 2GAAA 2D7DA 4G2NA 1E0AA 2JANA 4U3JB 4XWAA 5KQPA 4LJSA 1WEHA 3RDPA 4IX9A 4XOIA 3THYB 4DA9A 4EQZA 2BTOA 1NLFA 3FGPA 2F64A 3VR2A 2A5JA 1E6KA 3E53A 4F86A 4KXLA 3RKUA 2LO1A 3C7KA 1KQGA 4LOKA 4RAQA 3WRVA 5F7JA 1M2WA 1G63A 2FQYA 1ONBA 5BSHA 2FGKA 1ZC3A 3OSZA 5TQ2B 1AHPA 1XEWX 4HTFA 2YZKA 2WFMA 3ZLBA 4HO1X 5THQA 3WFJA 4YBRA 3HCOA 1U0EA 4E5SA 4JVMA 2JFXA 2CLCX 3MIIA 4GPIB 5FNVB 3W5CA 4XZ3A 1SESA 2ZS9A 5EQJB 4BFLA 1Z35A 3RFVA 4CEJA 5AW6A 3OX2A 4HGOA 3A27A 3KQYA 4TKZA 3NUQA 3KZOA 2CWDA 3AL0C 1US6A 1IBSA 5BRAA 3WWEA 1T9CA 3TZHA 2RHOA 3DE3X 2DECA 1Y76A 3E0QA 4JJ4A 4ND7A 3T7CA 1XYVA 3HPRA 3R5TA 2ZJ0A 5KTPA 1DC5A 1J2RA 1R6AA 3GFBA 1ID1A 1LTHR 1IXRC 1ZGHA 1US8A 5D7BA 1Q57A 4GT1A 8GPBA 1F4PA 1T9ZA 4PZLA 2B2XA 5DYYA 1ANKA 1GDHA 1E1KA 3OQVA 2WAOA 3C74A 3K3WA 3ZWOA 3FRJA 3A4VA 1VMDA 3MT0A 4JHLA 2ZYAA 1G5PA 4DMFA 5E3HA 2XDQB 4EG2A 4KFSA 2XCTB 6CHYA 1IB6A 2EP5A 1U2DA 1WHTA 5B1IA 4JTAB 4QSHA 2CTPA 5T4EA 4REOA 1E69A 2R00A 3DBHB 5KOIA 4YLEA 3P9CA 4QE9A 2ZRPA 1ZY2A 5JSUA 2PL5A 4RJTA 4LJ4A 1LDYA 1M1YA 4PLPA 5A05A 2CL5A 4KO2S 5H6QA 4GL4A 4I2VA 1YR2A 4HI0E 4OHOA 2FZLA 3EQ6A 3GEGA 3Q87B 1KEWA 1OJLA 2V96A 4KZPA 4EMBA 1K6MA 4EHHA 4J2OA 5KMGA 2P91A 5CYGA 4A03A 2XVAA 1L5MA 3MAJA 4X3PA 5FBZA 3O5AA 1T5DX 2Q4PA 1N6PA 3WQBA 1FNCA 2QRMA 2NP7A 1C0EA 4A3SA 2J0UA 1Y6XA 3OWOA 3O2QB 2G1PA 1M56C 1G1AA 4MJ7A 1M2KA 1Z34A 2EGHA 1YQUA 4XCXA 4WV3A 1L5ZA 4CLOB 4B3TO 4YFVA 2ZBVA 1GKYA 4TKUB 1M6WA 4MRSA 3KCQA 1HDZA 4OI2A 3U26A 1RJWA 3I6YA 2H52A 1LXCA 2D59A 4IOKA 1GNPA 3EOBI 3L6DA 1A8QA 1ULZA 1K75A 2PUHA 1ZP6A 1V8DA 5DKFA 1HY3A 1I7SB 1GQFA 4BL5A 5I8WA 5EIWA 1VGQA 3I53A 3EX7C 5BVHA 2BFEB 2Z3IA 2WTBA 2ZE5A 4NBKA 3R4VA 4OU5A 1W5AA 4PX3A 1IQPA 1UT8A 1WXIA 2E48A 3WKDA 3RWRD 4JKYA 3VSCA 3HU5A 4CCYA 3C6XA 1LVUA 4M3NA 2R5WA 2XSZA 2F9FA 5JNTA 2CXQA 4ID9A 5CVTA 1EI9A 4PLFA 1S01A 5CK4A 1N3IA 3PNBA 2G70A 3TRHA 1CNEA 1C8BA 1XXHE 2ADPA 2VIIA 1URPA 3A1FA 1N4CA 1U0FA 4KXMA 1A2BA 4KWTA 3ZVNA 2UXCB 2LIVA 3FWNA 3QF4B 2HIHA 4KNWA 3KR1A 4KQEA 4YXFA 5AOAA 3BX1A 4R2XA 3CGWA 2QM8A 3COJA 5LR6A 3E7DA 4RKWA 3D3KA 2QL9A 1EEHA 3OM3B 4P4LA 3B9RA 5D8DA 1I36A 4NEHB 4FNGA 2JCVA 4B73A 4IHQA 2MR6A 1ZIXA 4WOBA 4JL6A 4V1CB 4ZJYA 4LG1A 3K8OE 4ZOEA 4W5WA 4JBWA 1IXSB 4XDZA 4M37A 1E1NA 4ZKEA 1SUCA 2EP8A 1JG6A 4ZK6A 2HVJC 4TLLB 3ZHCA 2YMMA 3S2YA 1OI7A 1YD7A 4N12A 2VYQA 3KL4A 4JLPA 3GJ7A 2JVIA 3VH4A 1EE9A 1NNLA 3A1EA 3K0AB 5LOVA 3D0KA 4XB2A 1S9HA 4P34A 4EKNB 3K30A 1XDBA 3H65A 2X41A 3OF2A 3KTFA 2WHRA 4NBSA 5HX7A 4XLLA 4H08A 4JS0A 3T61A 2PUAA 4WZBA 2Y1XA 2B2CA 4F45A 5J43A 1QOZA 3CX6A 1CUZA 3HDGA 1I4EB 4M1TA 1TZMA 2HZ7A 3K15A 3HZRA 4NXMO 3TSWA 1KJ9A 2GT1A 5FL7D 4CDMA 4JJ6A 1K68A 3NTVA 3W78A 1E1YA 4MDYA 3W4KA 4JL5A 2X0DA 1MA1A 4Y2XA 1NXWA 3QQ5A 4G0QA 3CRVA 2P7HA 3UTDA 3RSHA 1JU3A 1EM8A 5LQCA 1JJFA 1A1VA 1T0HB 5B30A 3OKPA 3D3JA 1VSUA 1D1QA 4F3CA 2J7PA 4FSXA 4CCAA 1JXAA 1AI5A 1M2HA 1THTA 1YUMA 3PVSA 3DT6A 4CLRA 1BL8A 4LY6A 4WK2B 1K9SA 2NUPB 2Q1SA 3BFVA 5D3QA 1TIYA 1Y1RA 1B26A 2ZTHA 2FDXA 1ECJA 2CMHA 3LV8A 3AEZA 2NXNA 1GADO 2RONA 1XEFA 3BWBA 3GLIE 1JGTA 4MLZA 5JQWA 5JATA 2RIRA 4MGEA 1QF6A 5HM6A 3CCEV 4YPFA 3E83A 1IQ0A 2YZMA 3FUTA 1QHTA 3IDOA 2ES4A 4W99A 4GPZA 1FP4B 4ERNA 2ID4A 4RF3A 1XFAA 3SVZA 4Y1RB 2J3IA 4UEQA 1NN5A 3PIRA 3LCUA 1T5BA 3D0OA 1W19A 5IT5A 3SJUA 1RRMA 5EJEA 2X8AA 1JIVA 1YVUA 3BE8A 4L8VA 2FW0A 1XCBA 2DH5A 3TCUA 2PJDA 3HJCA 4AMGA 2B8WA 3G5MA 4YPOA 4RQUA 5EHGA 3OX1A 2Q62A 3VU0A 1P44A 5IDJA 2ZRDA 4MTOA 1NY5A 3ASZA 4FBLA 1L9XA 2ZJAA 4TMXA 1JYSA 3PHBE 1FFHA 4X7BA 4EJ2A 3ZZTA 2IPLA 2ZSUA 3GGCA 2CLDX 2RH4A 5GADl 1PSWA 3RVOA 3ZK7A 2POQX 1CHNA 2I8AA 2QRKA 1J5XA 4CKEA 4H9GA 1YHYA 5C8YB 1R4NB 2FFRA 2E5LB 2LBPA 2RJ3A 1Y6JA 2VXCA 3LPDA 3NTQA 4BEJA 5TF4A 1IH8A 1UFKA 4KYIB 4UARA 1LBHA 4QYTA 2FHSA 2A5LA 1PNRA 4JT4A 2QSAA 1VMIA 4TX1A 1DDIA 3R7WA 3SM9A 4BFCA 2XUQA 2XD4A 7REQA 2QMUA 2G76A 5HUQA 3ASOB 5ICGA 1EEXB 5A5DA 1T3HA 2FDRA 1PZEA 3CYFA 4GNRA 2Z3JA 1SRRA 1GXSA 3U40A 4BJ5A 4BVLA 3M33A 4BAGA 3HYTA 1DARA 4G67A 1NVTA 5KVSA 5GV8A 1DO8A 2A9QA 4P93A 1F7YA 3JQ9A 1OCEA 3OOJA 2YXDA 3O0DA 4IIHA 4ABYA 2O14A 4YP5A 5K0ZA 4KP7A 3W3AA 2YJZA 2IJGX 4NPHA 3UTCA 3GLGE 5HBGA 3T0GA 3P0JA 1W0JA 3CCBA 3EHEA 3H5NA 1G5FA 3KBOA 1SC3A 5EJ5A 2G38A 2QX9A 1FJXA 4L57A 1QHGA 3E2PA 2EJTA 5A4IS 4L9RA 3U17A 4H6VA 4EUFA 2HEIA 2X4IA 3R7LA 3RUPA 2Q2VA 3ZY4A 3FFAA 3EEBA 1ADFA 3KPJA 1G9XA 4RHYA 3NDJA 2GCGA 4KBYA 2AR0A 4PQFA 5KHIA 3EGEA 2GZSA 4MYUA 3H9QA 2ZROA 3BPSA 2OMEA 3PDCA 3E2IA 3MXOA 1M5IA 1CP3A 2YRXA 2Q3EA 2P9YA 3BGDA 3R0QA 1IBMB 1YZHA 2OT5A 1TLTA 1G8KA 2V74B 2J9XB 2XAFA 1FSPA 1EDEA 1YQDA 1HFJA 3OT4A 4RUKA 1JA1A 5FBRB 4U5XA 2HBZA 2VP4A 3PFBA 4ZEOA 2RAVA 4L5JA 2XAHA 4OIFA 4D81A 4F7OA 1PJCA 4HZUA 3U4QA 2FQXA 1RWOA 1H8HG 5J5AA 3DZJA 5E38A 3NIFB 3BABA 3EPPA 2P8JA 1YCHA 1UDBA 5H3CA 1ZTEA 3VO9A 4UAGA 1QG2A 1CQIA 1XJQA 1KKUA 4HGRA 2VF8A 3X2SA 3QJGA 4ZOLF 1PL0A 2WKWA 4I4TA 1D5AA 4HFRA 4XXHA 4YX9A 2WE7A 4W5RA 1KNQA 5D6OA 1SVNA 1T6BY 2KW5A 2J48A 5L45A 1YJNV 3WICA 221PA 4CL3A 2G07A 3V48A 1N32O 4N0EA 4TRRA 4EPRA 3TXYA 4KN5A 1WA5A 4UFZA 1RCTE 2ENWA 3L8CA 3DCYA 2XUFA 3RG2A 4C4OA 2OORA 2W6JA 5L4SA 3TVTA 4M86A 3BWXA 5IUJC 2A0WA 1QK4A 4MWCA 2HEPA 5FTLA 2VDJA 2J3LA 3WYFA 3I4CA 3KV3O 2Z2JA 1TAHA 2LV8A 3EGDA 3WGKA 1X7DA 5H4HA 5LGNA 4RUEA 1OLXB 3VRHA 3P9PA 4Z86A 3OE1A 5A5GA 1S2NA 2VZEA 3GJQA 4Q3EA 4ME6A 3ZIAG 2R6ZA 4U0KA 2GGSA 5I3CA 2ZI3A 1FXKA 2DFDA 3H83A 1PGPA 3OTFA 4M1EA 1BVYF 3AG2C 5CDSA 3OEHA 421PA 2IYUA 3WOVA 1D04A 3INTA 3HADA 3ESQA 3EXFB 2I7VA 5FFMA 4NAVA 4CS2A 4Z2YA 1E1QD 4BBZA 1JEEA 2E89A 4PELA 4PPNA 4ZI7B 3W8EA 4NAUA 3SYQA 1H2YA 4TV8A 4GUDA 4TRNA 5J9FA 4KDCA 4RA9B 5AXBA 5EYPA 4IO0A 4PZDA 3R6TA 1OC4A 2R72A 3UT0A 2Q0HA 3DAOA 3SZUA 5L3RA 4FVTA 2IYRA 2WWXA 1YFLA 2P7IA 4EJMA 4NE2A 3IP5A 3JYHA 4GOXA 4WIAA 4R3UC 3OMWA 3F9CA 2DLNA 2X2PA 3A1WA 4GGOA 3UENA 3L7OA 1SQPH 3LM8A 2M2IA 1P72A 4RLHA 4QEDA 4YDHB 5HSGA 2AHRA 4J0GA 1V16B 4L7VA 2JFFA 4D7TA 1YDHA 4CBCA 4R8RA 3KEQA 1EYZA 4P2GA 1FFCA 1QHHA 4Y2VA 1FFXB 1X42A 3E2MA 2OXEA 1P7WA 4RLFA 1RADA 1Q1BA 2EKQA 1VQMV 2VDQB 4A1FA 4F6RB 3O4IA 2WVAA 3LQ1A 4PYJA 4L28A 4H15A 3VR5H 3HKDA 1NBWB 1F8XA 5BR1A 3KLBA 5BQXA 3QWAA 1UKCA 3C39A 3LUKA 3RT9A 1QIHA 1P0QA 4FLXA 1MQSA 3RK1A 3QVSA 4NENA 2VTDA 2HT6A 1HFEL 3K31A 3LYAA 721PA 3L9WA 5JPDA 4EIWA 3UC9A 2W2KB 3LP6A 3N8IA 4I0XB 3RTGA 4ZAGA 1L4KA 4BGDC 3APOA 2DQ4A 4XIIA 4EPTA 2GA8A 5H2FZ 1D4FA 5KYXA 4GQIA 4D5EA 2MIIA 4FP9A 2N0SA 1X7XB 3R7AA 3AUKA 3OZFA 2NVUB 4M55A 2H18A 2VJPA 4IFTA 1JQ5A 3TNDA 1P2GA 3BMCB 5A71A 3OEED 2EIJC 3JYLA 1G2QA 2A2ZA 2CHEA 5B5EZ 2JVDA 2G17A 2Q7OE 2FUKA 3S5UA 2EFCB 1CNMA 3F74A 1Y82A 4I50A 2M7WA 1T24A 2JCXA 3U6BA 3AINA 1OZ0A 3L1VA 4JLUA 4X91A 3D43A 1UKEA 2XOKA 3PR1A 3T9AA 3R7DA 3PF8A 3JWEA 2QRNA 5AVZA 4C5BA 3IE2A 2H06A 1BIFA 4WBXC 3O82A 4HKTA 4B46A 3ZPGA 1BMFG 2FG6C 1UXGA 3R3HA 4Y3UA 4W5TA 1RBMA 3A70A 4H33A 4DV7B 4RYLA 3UJ6A 2WWYA 3PNQA 4OGGA 5DT2A 4GMFA 5DM2A 2PH7A 4CHTA 4JA2A 4PIVA 2G9RA 1IG3A 3O1JC 2A1TR 4N0DA 4LJ8A 3OTQA 1JHOA 4MLDA 1XMOB 2RHRA 2NU6B 3IUJA 3O74A 3D6MA 1OUMA 1V8OA 5AVUA 5IBQA 2VJDA 2H7XA 1Y3DE 2XMGA 2HPAA 3KWMA 4GBJA 2IBMA 1L8AA 4JJ7A 3OTIA 4EAAA 2OGSA 1Y8QA 1UPAA 4RDXA 2ID9A 2V0GA 3SR0A 1SVSA 4L4YA 3B1KA 3PQ3A 1H9BA 1WZNA 4UD6A 1ORHA 4OGQB 4O8XB 5GZ3A 3VC1A 1HX7A 1Q0SA 4BWGA 2O8DA 2Q3CA 1SXJE 4G2KA 1YBFA 5BN1A 4DF3A 4MW8A 1V4BA 1ISHA 4O5OA 1VYHA 7GPBA 5AK3A 2GI4A 1E62A 2CH7B 1YHNA 4I1UA 2VAWA 4I9GA 3IAHA 4M1MA 4K05A 3TL6A 2DBZA 3DTVA 3KP1A 3W7SA 1ZNQO 2C0PA 4MUJA 4RKEA 5CLFA 4X60A 4HAOA 1ZK3A 4NS1A 4N7BA 2ZR7A 3V6MA 4Y1GA 3GY0A 5AH0A 3QXJA 2IP2A 4N41A 1Q21A 2ZQZA 2QJRA 2YFKA 3M81A 4AG5A 2FQ1A 1XBTA 2SKDA 3N75A 1KZ1A 2SCUB 5FOUA 4OXIA 1QR6A 3OZWA 2ZKLA 4YCNA 4R2JA 4P35A 4MUKA 3G8YA 1CRZA 4E4RA 5IARA 1C0LA 5JMPA 5JWPA 1R50A 3ZHOA 2HA4A 1T9BA 2P9GA 1X0XA 3QW2A 4C9BA 5AUNB 4NTXA 2A8YA 1OTXA 5CD1A 2Y1LA 5C81A 3GJRA 1ZHFA 3A4YA 2ZNJA 3HSYA 3TLZA 4GHWA 4BQSA 3BE6A 2FMXA 3RAJA 3OQBA 2QTNA 2XB9A 2XGGA 5TX7A 5FTWA 1PJBA 3WK9A 2QJFA 3WE7A 1JSRA 3F7NA 4NZOA 2ICAA 4E6PA 3NBMA 3CR7A 1W8DA 4ZD6A 1BCRB 3KOMA 2Z8YA 4JBIA 3GLUA 3IMKA 5CXSA 3I6IA 3OM1A 1FU8A 10MHA 1RVDA 2XUIA 4R98A 5JQGF 5D51S 3BN3A 1NV9A 4IIUA 4H7IA 5I47A 2V1DA 4YMSA 2CFSA 1YTFB 2VAMA 4UHFA 2ADFA 2E74B 2P4KA 4OJQA 4IJ5A 1KU6A 1HDOA 4HB3A 3RVPA 1YR3A 1L8QA 2VZ9A 3P4UA 2KPOA 4Q6GA 2XHBA 1SCUB 1U11A 4G27B 4GPTA 2UUPA 4BB6A 1YH3A 3GN1A 3HXOA 4ZHQB 1YIDA 1YR7A 2P4SA 3UF0A 4EVIA 2XW6A 3OT7A 1DKUA 3GA0A 1VPEA 1L4NA 3NBAA 3K0FA 4JVSB 4DR2O 3W4JA 1FDSA 3COZA 3AY3A 1YKSA 4RSHA 4C06A 2QR5A 5CITA 5KYNA 1V48A 2DHQA 3ZZ0A 3BMOA 2EGGA 4XW2A 4G5XA 4IF6A 1O8BA 3M6FA 4D8XA 1RFGE 2C5LA 1Y5LA 2LIPA 2FFJA 3CC4V 2PWYA 1VBMA 5DISB 1U6IA 1ZW6A 1YJCA 3QE4A 2FKXA 1ODCA 2BONA 4Y2TA 4XI9A 1TAEA 1Q44A 2HHLA 4LCBA 2OFFA 5HQJA 1H1DA 1X39A 2II6A 1OAOA 3BBLA 3QHQA 1E6MA 5K0TA 5HRUA 3LYUA 5EIBD 2ZTMA 2JAXA 3GJZA 5REQA 5K6RA 4YRJA 2Q3FA 1OB5A 4RWUA 1E2FA 2WMDA 3EIOA 5J2UF 1BS1A 2YIDA 3ZCUA 2O0LA 1O95D 3I05A 3H4IA 3VYVA 5IP5A 3O8QA 3EWAA 2QMOA 1A5TA 4RSGA 3QKWA 4O8ZA 1ORRA 1TKAA 3RAPR 3HM2A 1AR4A 1PGNA 4WNAA 3ZI7A 1QYWA 4CMIA 3HU2A 1X1EA 1DZIA 2ZYTX 4WXPA 2XMZA 5KA5A 4OHMA 1YJ9V 3V6LA 4BLVA 1USVA 1XD2A 1XQ9A 3K2BA 3HK2A 4Q16A 5CN0A 1SC4A 1L5QA 1SIOA 5E8RA 1GYPA 1WO8A 3ETDA 3QRWA 5CA0B 4KR0A 2X9VA 2D8AA 2R2GA 5COBA 4IDDA 2QX4A 3W9YA 2QD1A 5AYVA 4B33A 1FLVA 2IY9A 3DE2X 1ZESA 1U3UA 2Y4OA 2OZKA 3VBCA 2PX6A 5TNXA 1HBJA 5M52C 4HXYA 1PWXA 4MW0A 3WTBA 4EA7A 3C6KA 4PHCA 5I9LA 3RQIA 8ATCA 1T5EA 1CUIA 4JI5B 2ZB4A 5FL3A 1AK2A 1UJ2A 3PJFA 4M6WB 2C00A 3RE1A 2FPSA 1E9SA 3ABLC 1OZAA 2ZFUA 4M22A 3GZJA 1EH5A 2RJNA 3OQ6A 1PL4A 3IPYA 1VLVA 3BMNA 5KTRA 3QBJA 2X4LA 4GMXA 1UM9A 3PWKA 1W36C 3TPCA 3AKYA 2NT4A 3ADDA 4IGFA 2KYRA 2WWVD 4RV4A 3RYCB 4HH0A 1ZKDA 2AHYA 2NYUA 3JAWA 5LQMA 2FFQA 4DJEC 4GYWA 3EXAA 5T57A 1UFOA 1RIIA 2C29D 4BLUA 4QYIA 4DNQA 4P9NA 4RIEA 5B57C 1GTOA 3P96A 3FVVA 3PYXA 1TU3A 5LZ5A 3DBIA 3PPYA 5CHEA 1RI4A 2IHTA 4JLMA 5AI0A 4ZD5A 1QX4A 1ATIA 3VOAA 3EXEA 4EYKA 4C3OB 1C8KA 3SBOA 4BPRA 1Z37A 3AG6A 2XGSA 4MKHA 4JF3A 1DAIA 3AG4B 4CG3A 2OYQA 3EAGA 3L8GA 2J9ZB 3QVOA 2Y69C 1ZL8A 2VTKA 2PNJA 1XLWA 4B7ZA 4YAJA 2F1MA 2AMYA 2FY8A 3WNDA 4JXJA 4B44A 1N3BA 4OP3A 3KCYA 5F3RA 1W25A 2BW0A 4RFVA 3VOSA 2ZOSA 3UW1A 1A9TA 3PXCX 2XMCA 4D8YA 4OXNA 4DK0A 2H5EA 4LNAA 2CWWA 4ZQGA 4FZ1A 4HDQB 3GN2A 1N5LA 5EUMA 5ALLA 4MQEA 3KYBA 4Q7QA 4JJZA 4XUCA 1Z4NA 2WYOA 4Y9SA 5SZHB 5IZCA 5HFAA 4ETMA 1A5ZA 1G21E 3KSBC 2CV0A 2EIKC 3WK5A 4P4SB 3D7SA 2P4EA 2EJRA 4B6GA 1NV8A 1WNFA 3ZBHA 1PNQA 3QVUA 1R9GA 2OHIA 1YUNA 3SWWA 3MWYW 3LWDA 5DNEA 1YGYA 2Q7DA 2PL9A 1RLMA 4Y2GA 5LBIA 4BEVA 3P7MA 1Y5NA 1E2IA 5BQ3A 4BCBA 4WESB 4G07A 3QFHA 2I22A 3PGLA 4HVTA 3FVTA 4JC5A 3H1BA 1ZD4A 2HR1A 1UUFA 3QMPA 3E61A 1Z7WA 2WQ7A 5BN3A 1UMCA 3UOAB 4AYWA 1G64A 3DNFA 2C2HA 1X8XA 2BLLA 4KTVE 1N2GA 3N2GA 5IWCA 3AG7A 3OBBA 2NQ8A 3U7FB 4ZEXA 4BFWA 2BPOA 3IDAA 4MICA 2NX8A 2HO5A 3FROA 2JIOA 5WRFA 1QIFA 1VRVA 1IBCA 3ZYZA 5JXWA 1YJXA 4UHKA 1N5JA 2ON6A 1JA8A 3ND6A 4R1LA 4B7AA 1U1DA 1TEHA 1P39A 3RKRA 3RBXA 2H4FA 3F3SA 2CZQA 4GDFA 1BS2A 1P4HA 3JYCA 3DUFB 3JSAA 2RPZA 2ZEJA 1OV9A 4BV3A 4L0QA 4MZXA 4P0PB 5KUKA 2OD7A 1MC5A 2P4VA 3PI6A 4XJVA 1A76A 2MTBA 1FB5A 2WTMA 5JNUA 5BY1A 1WP8A 3P71T 2ZUBA 1IMJA 1KOGA 2QYTA 2GK6A 3QVJA 3K79A 1SU6A 1KBHA 3BXXA 4UBKA 3JRNA 3DPSA 2RJZA 3ORFA 3LVFO 3WL6A 3BFXA 1FFYA 1PGQA 4NNPA 2KHZA 1FK8A 3SYKA 3QUAA 2PLAA 2QX8A 3UMRA 2IWRA 4Q18A 4M0FA 2YHIB 3RAFC 3G9UA 1XV5A 4RHCA 4FFLA 3CN7A 3LLVA 4IIJA 1CQJA 4DMMA 3AVUA 1Y4ZA 1W8IA 1VJCA 1HUQA 4XPIB 1Q20A 4EB3A 2WOOA 4U2CA 4J1TC 5JSKA 1KAHA 1JJBA 2BL4A 2C83A 4MGHA 4DIDA 3E8FA 4OJKA 2V1UA 2FP3A 2VSYA 1VQNV 2D0PB 2GDZA 4BRUA 4YPVA 3ZHSA 5LYJB 3G7NA 3LOPA 2WSIA 5CXQA 4H7KA 2XNDG 3OMXA 2XMPA 3CVVA 4WXYB 3HJGA 2EXXA 1MJHA 3WWPA 4TTAA 2C8VA 1M33A 1OCCC 1Z7YA 3AG3C 3OOYA 3AERA 3JQ7B 4ZVKA 2E55A 5L6LB 2YHAA 1DWPA 1SU8A 4NCJA 4BGEA 2PLNA 2ACVA 1N5MA 1BT8A 4CKCA 2J6CA 2WNSA 2E6UX 3ASNB 2J0SA 2PEZA 4NTZA 4C4XA 3IPAA 3WGOA 2P4HX 4TLBA 1HEYA 3CPEA 5DBOA 5COAA 2O7SA 3DLAA 4KDFA 5HZKA 3FAKA 3VR5A 2GWRA 5IM5A 4ZVVA 4QQNA 2J6HA 3U7GA 2O52A 3RBZA 4H3VA 1XLUA 4EF4A 3V2IA 2VO1A 1EVIA 1ZM9A 4PPFA 1FS6A 4EA8A 3FI0A 4FFSA 3BPZA 1IBKO 2K4MA 3RRXA 3FBGA 3U13A 1KH1A 3ZD7A 3UK6A 4JN6B 3V97A 3OFKA 1B6SA 2QRZA 2I6GA 3GLKA 4X1OA 2RAFA 3Q12A 5DNYB 4A82A 1NT2B 4CEIB 2VPQA 4QDOA 2YYAA 1PYDA 4HEJA 3O26A 3EBOA 2IF0A 2BEKA 3H19A 5F7OA 3HJBA 2UXCO 5A0FA 3EC2A 1DELA 3TOVA 1E60A 1BH2A 1OXXK 4PO9A 3BT7A 3L46A 1XTRA 5B7GA 4PV1B 3T3MB 2GLXA 1LLFA 2FW9A 3GX1A 3CCSV 3CLTC 3FNRA 1M90W 2ST1A 3L0OA 3BDIA 1NBOA 4A2PA 5AM3A 2HHHB 3VNUA 1KJQA 2PGAA 4I6JA 1E66A 2L6LA 1RRCA 5CDYA 3UJBA 1YU9A 3MGAA 5EWLB 2XB8A 4M7WA 2IXBA 1E58A 1ZJZA 2PMBA 2MK3A 4R1SA 2YEVB 2PMKA 2XXAB 3ZWVA 4NATA 1KMHA 1IOWA 2OAGA 3AUJB 5I4IA 4P3NA 3K1AB 3FMIA 4ARVA 4MT8A 1H6DA 2WSSA 4I8DA 4C89A 4YR7A 4WCFA 4DHEA 1V3VA 3OFNG 2GPYA 5EZYB 3PHJA 3P5SA 4UHCA 4QDZA 5EWMA 4BEBA 5C8VA 3N0VA 4PHFA 4OCNA 2JASA 2XUJA 5H0IA 3T7RA 3ACCA 3I01A 4PX2A 3I9MA 4CIVA 1N92A 1KS2A 1U9YA 2YVQA 1Q8IA 3FUWA 2C2XA 1HF3A 4GM0A 2VTBB 2ORIA 1KA9H 3C3EA 1G4YB 4YQYA 3EDRA 2O2YA 3ZNQA 1Z6ZA 1Z5NA 2OCCC 2VJBA 3OFSA 3FPCA 4WFEA 3LQRA 4EHAA 4YT2A 3LI2A 1Y1QA 3T7DA 3K72B 1Q0ZA 4AN4A 2GFHA 1BWQA 3PWTA 1W2WB 1XRLA 3ORYA 3FKQA 3CW8X 3C3BA 2EZ8A 1F1JA 4S0XA 3R6WA 3K7EA 1EFRD 3DQZA 2Q9AA 1H38A 3TE6A 1MV5A 3HACA 4RVOA 1KFCB 4DCVA 1V71A 4LVOA 4CGZA 4D82A 2WVJA 3RU3A 2HQRA 1XROA 1H69A 1P84F 1E7QA 3KYJB 3ZHZA 2GBCA 1R4MB 2IHUA 2QTRA 1VG1A 5CJPA 3H5WA 5MFZA 4XM1A 2CE2X 2Q45A 4FR5A 5KX5A 4AFNA 4F5EA 2ZM6B 5CXXA 2IS6A 3C4VA 1C1DA 2IYAA 3K70D 1RJDA 2BFAA 4FZVA 4P08A 4P58A 3CCQV 1K27A 5EJFA 2RCVA 3KYDB 1DT3A 3SQOA 4PLHA 1S8AA 4ML3A 5KQGA 1S8NA 2GV9A 2V8OA 5HIIA 3MCZA 1JFTA 5IVIA 5E2BA 4DV6B 2QLBA 1QIKA 3W5DA 4MR8B 3BF7A 4KDRA 3TVDA 1H2LA 4IQ0A 1X3LA 1IOZA 3ZQKA 3UMCA 1EA5A 5IF3A 2I80A 3SQNA 3PE4A 1IX9A 3A0RB 3F7YC 5DYGA 5EINA 5F1YA 2Q41A 2P77A 5FORA 1C9YA 4HDMB 2VR1A 3ZW8A 3FRIA 3DQPA 1U4OA 4Y2SA 3OQIB 1JIJA 1FEZA 4REQB 2DFLA 1P2FA 4R8VA 4NE9A 3JYQA 4HEA6 1PVVA 3U3JA 1EDBA 5LP6F 3EXG1 3E1SA 3FE2A 3G85A 3R5HA 3P9XA 2NU9B 4B5LA 4P2ZA 3HVUA 3NOOA 1GKUB 2ZNRA 3ERCA 1NVFA 4GSYA 4IIXA 3SMQA 2CNBA 2IEBA 3COWA 3L0DA 3GPBA 3KNZA 1SUWA 3E4DA 2J87A 4TVOA 2FMKA 4R2LA 4DQDA 1JI3A 4H7JA 1JLLA 1TAUA 3ZMSA 1MA0A 3SHOA 2CVPA 1GIAA 1X7YA 1T9DA 1WDWB 4GDMA 5CR9A 4CZZA 3E35A 1HOTA 1F20A 1RPTA 4B2LA 1U2SA 1Z22A 3MGBA 4QPKA 2PR2A 2RH5A 4I3HA 1XVTA 5ALOA 1K73W 3IUPA 4FGLA 2HJ9A 3DDSA 2NZUG 2XA9A 1A98A 3SP1A 4B3MO 3EA5A 3MS2A 4YJHB 3AYZB 3MAGA 3GRAA 5IHXA 1WSDA 1AKNA 2N9UA 1R8XA 2ZIXA 3K8QA 4FJCC 4BIZA 1GFZA 4FZ5A 4JI6B 1J24A 3E84A 2C5HA 3RRFA 2V6IA 5F51A 2AN5A 4FFBA 1EUYA 3AZPA 4TVKA 2NO6A 4NONA 2VJMA 4EG5A 3IVMA 3PQ4A 3GCXA 2ZSDA 5H02A 1T6YA 5FIUA 4XWYA 3E5MA 3RTDA 1B73A 2R6AA 4NCAA 1XX6A 4YQEA 2Y1CA 3S28A 2EJBA 1Z5WA 2C42A 3W6OA 4ZT4A 5KEIA 1U94A 3N5KA 2VHCA 3U5ZB 2GNPA 2QUKA 1JDPA 1B41A 2AUTA 2YJ4A 3ZBTA 1GSOA 3MFYA 1TK3A 3KXKA 3LX6A 5AKYA 1CUVA 2ZITA 2QMQA 4ZCLA 1E5XA 1EUDA 5DK6A 4TM8A 5E4FA 3RYIA 4E2LA 2VPIA 3ANYB 1VL6A 4EF6A 3HTXA 1M5UA 4B6JA 4MTLA 4U3FH 1CKEA 4ZREA 4IXMA 5CDTA 3VU1A 2QN7A 3CHXA 4A6EA 1BS3A 2MW2B 1DQRA 3IUNA 4M9RA 3ABQB 4PRZA 1UMBB 5J2TF 2JLCA 3RNOA 3LCCA 1BCCH 2G25A 2F8SA 4LHEA 1RXIA 1RQNA 4OQZA 4BNWA 1C30A 1QCCA 3ZS9A 4RCYA 4XJSA 5AO9A 2E7ZA 3RVNA 1ZD3A 4LZOA 5HPYB 1GN9A 4UUOA 4C1NA 2BBWA 2PZGA 1WXEA 4Z9BA 2RAUA 5B3SB 4PU0A 2AC7A 1A8PA 2C9ZA 3NNDA 2CDRA 2Q73A 1X13A 5KWSA 1E7WA 4X8AA 5DCUA 3VU3A 4QG3A 3KHSA 4L0CA 1MBZA 3ZX4A 3KJIA 4Z54A 1KI3A 4LWSA 3LSUA 5EXTA 1WZEA 4KL8S 1T1GA 3PG5A 2HR3A 3Q1LA 3H5TA 3D2CA 3IKTA 1U5CA 1LVGA 3G0DA 1DEOA 1Y6FA 4FGSA 4HNRA 4I19A 2LUOA 2COUA 1O5IA 3RIMA 4EQ6B 2F3UA 3X1XA 3NWEA 3U62A 3WGYA 1W581 4DXWA 3R6DA 1DEAA 5CRIA 5LA6A 4B3IA 3BKXA 2CB0A 4KU4A 2ZR2A 1QC5A 4N9WA 3NHJA 3KU4A 1GGNA 3CCMV 4NJMB 4PG5A 4WT7A 1I0HA 1BOOA 5BNWA 2YIMA 2QMHA 4J49A 1EMDA 3PX2A 5KYUB 4J7ZA 1J2JA 4B3JA 4DYHA 4KFUA 3EDMA 2DAPA 1KBOA 1J97A 2I87A 3FNBA 2W98A 1E7SA 1DIOB 1RXUA 4NPAA 1RWPA 3ECCA 4FPPA 1BN7A 2RGNA 2HRZA 2H9IA 3TMYA 4IUCS 3T9BA 1QHIA 5K3FB 5MFPA 1BE1A 3WLJA 3PXBA 1FW8A 2XA2A 5TMBA 3RARA 5CEFA 5E6RB 6NULA 1LPSA 4IIJF 1E7RA 1ZUIA 3RVLA 2FP4B 3PGJA 2FPRA 1GPAA 3SYOA 3OZEA 4JYYA 4MI3A 1GVHA 2ZATA 4J0QA 1GCGA 1PFUA 3AFIA 3CRQA 3BY6A 2P6RA 1DO0A 4LRQA 4NLLA 1RHRA 1E79D 3OHPA 4G9EA 4OXRA 1EZZA 1RS0A 1R6TA 4PQTA 2Q6OA 4CMEA 2H94A 3T1NA 1F7UA 3DJYA 3ZU3A 4KUHA 1XI2A 4FYHA 3LC7O 1IOLA 3L0CA 3WDLA 3ZRXA 3ICWA 4ZT7A 2W58A 1QPZA 1ALNA 3A58B 3ZHTA 3IBCA 2HT1A 4DUYO 2O3TA 3ZTWA 4I14A 4DBLE 3I92A 1X7WA 1O96B 2V3VA 4FVMA 2C78A 3TEMA 2ZUDA 1LKZA 1XR3A 4O1HA 2MSNA 4E15A 1SG9A 3TR5A 4UBNA 5HYVA 1KD1W 3ONWA 2BEWB 1AG9A 3C3AA 5A5FA 4NOKA 2X0FA 2UUOA 2O9JA 3ZCQA 3ZKWA 3UK0A 4P86A 3MMPA 3ZRWB 3D6TB 1QHYA 5L3GA 2VK8A 4EGAA 3HL4A 4O4LF 3CKLA 3HXLA 4PLWA 5KOJB 3FCUB 2OOSA 4QJ5A 3F3MA 1E1LA 3DSQA 4WSOA 2IKQA 4RHTA 2C7QA 2GBGA 3QEJA 2JCYA 4ITVA 3ADPA 1W48A 5M2QA 5B3LA 4KHPB 2QTWB 4RAIA 1BFDA 4X71A 1E2LA 3ZHXA 2JD2A 3SMVA 4LDNA 3P45A 4KYTA 2QMYA 3THXA 1PIWA 4DT1B 2PD4A 3B1YA 3LE8A 4N7RA 5TMEA 5FBKA 1A3CA 3CINA 1EK6A 3IP6A 1XIVA 3VR3D 2ZRGA 4Z1VA 1EX7A 4MOWA 1FLAA 4QBIA 1SA0B 5L3EA 1OKKD 4YJKA 5EIFA 2ZAMA 1VRCA 4JUDX 4BGVA 1NE7A 4A8JA 4J91A 5LQUA 4GXTA 3LHSA 4CW7A 1FJGB 2A1IA 4NFSA 1MCZA 3TD6A 1XMOO 3T3PB 1PT5A 2LDXA 4E2YA 1ESDA 1FFSA 3HN2A 4JNCA 4GRDA 4C0AC 3EY4A 1L0BA 2H48A 2C94A 1O6BA 3GU3A 2Q9CA 4BKUA 1E1CB 4HWRA 3I5UA 5A4DA 5CA1F 1G7TA 4X9QA 1WBDA 4UU8A 4FC6A 4PS0A 1P62B 2QV0A 1Q16A 1VP3A 3DYIA 3DC2A 1Y3HA 2EU8A 3QEKA 4N23A 5HIMA 4TZTA 1L8DA 1Z6TA 4D2IA 1BEZA 4OATA 4KNYA 2X5XA 4ZIRA 3JQQA 1E9AA 1S2IA 1DC7A 4UTZA 2ZTUA 5DHPA 4HMQA 5FPTA 1SVMA 2Q27A 3D0RA 4F4IA 2P1ZA 4CNQA 4RM3A 5J4KA 2EBFX 4RDCA 1PQYA 1NM5C 3V2HA 3UAWA 3OOSA 5CP8A 3QTLA 1SUAA 4DA8A 2GBLC 1Y6RA 2QYOA 4GPBA 2AR9A 5BORA 3VVLA 2P41A 2AWOA 1WR8A 1YIOA 2A7XA 3D3EA 2YJGA 2Q5ZA 3VSDA 4BNGA 4X89A 1J9EA 3GFVA 3O95A 3CH5A 1QYCA 1IG0A 1DQPA 2PZSA 1TKBA 4FI3C 1G7RA 4YT5A 4M8NE 1C7JA 3LQKA 3RS7A 1YVRA 2CFTA 3VM6A 3HP7A 1J7JA 2B3ZA 2BEUB 1T15A 3UXEA 4GYYA 1TD9A 1E6CA 1YB2A 4RNDB 2IOFA 4OHFA 3QBVA 3WL4A 1MOPA 3EXIA 5EJGA 1MGPA 5A3QA 3R2NA 2X0LA 3W8DA 2CMDA 2TMGA 3INNA 4FYMA 3DT9A 1P2BA 1JTEA 3PFGA 2DLCX 1V1MA 2ZYHA 3DHEA 1VE1A 3QKIA 4DMUB 1P8JA 1U99A 3JZAA 4UJ5A 4IOLA 3LX4A 2WIJA 2GOYA 3EC7A 4BIOA 1N8RW 3TIGA 2GFQA 3D1JA 3WYEA 1GV1A 3FPAA 3RYTC 5B1DA 2W9XA 2NYRA 1KRHA 1JEJA 3VX8A 1XRSB 1VHLA 3L1JA 2G5PA 4GI5A 5H70A 1XUQA 4JLOA 4HGPA 1TYCA 2ISCA 3T0FA 2X58A 3VDNB 3ENZA 3HCBA 4G37A 5CH5A 3OM8A 1MABB 3IP1A 3UMYA 3AF0A 4LN1A 1G42A 5U1PA 4XDLA 3COVA 4IJUA 1NURA 2QVCA 1M72A 4HT3B 1E9FA 1G7SA 2H3HA 1GZUA 4F5YA 3NIGB 3TTWA 3MSXA 3HE3A 1DV1A 2VVTA 5T4FA 1VG8A 5ESWA 2Y99A 4ATNA 3PFWO 4OB7A 1QFZA 1PS8A 1JBQA 4BBPA 3FXAA 4C0JA 2JZCA 2FPPB 2YXHA 4MP6A 1M67A 1X8KA 2AW3A 2R8PA 1NW6A 1YB1A 4YHBA 1EFTA 1OBHA 2AOTB 4WDRA 5FPQA 2FUG6 3RHSA 1V54C 4FZ0A 4ED9A 2XCSB 4PLZA 2R60A 4BLOA 3U3XA 4FYXA 3WIUA 3GYBA 1E2EA 4ZCSA 3K4PA 4UUPA 4B7UA 4MWOA 2ZUWA 3L7DA 4HN4B 4JB3A 4I8IA 1A4UA 1X8LA 2ETNA 2KBFA 2QROA 1BXRA 2WNIA 3E9MA 1UWVA 1VPLA 1QRUA 8MHTA 2J6BA 2C5SA 3G6WA 1NPYA 5CXUA 4WKGA 5LKAA 1XOIA 1PUXA 2O8VA 2X2OA 3VISA 1LY1A 4TXLA 4DLKA 3C1OA 5I7EA 3RIEA 5JVDB 3TKLA 4JELA 4EWLA 1TTHA 4G81A 4P5PA 1JJOA 3HBLA 5AVJA 1DTWB 4L22A 2VK1A 4A0HA 2IIBA 5JZSA 4MEJA 1B4DA 1K88A 1E59A 5IYDO 5SZIA 4AD8A 2QN8A 2IYVA 1G20B 1G8PA 3LNCA 4K0RA 3H3FA 1NYTA 2OC9A 3P0RA 5AK0A 2I76A 1DQSA 2VPTA 3CRMA 1XILA 1XA3A 3AB3A 4NZMA 3G2KA 1DKRA 1AXRA 3WFIA 4YAFA 4LGVA 3TRIA 2PGXA 3WBKA 4JI5O 3UWMA 1YBAA 2W43A 1K6XA 3V4LA 5IVDA 1Z33A 1F8YA 4X84A 5JBQA 1EFPB 2VHUA 2OV8A 2HSZA 2IZ7A 4K1RA 3OEYA 1E63A 1S5HC 3CGGA 5LDHA 2P9CA 1T8SA 1QE5A 1QCYA 1IHXA 4J3FA 3ESAA 3GAMA 1FUYB 1E98A 2F4VO 2BGRA 1D2RA 3BGSA 2RGWA 1ZIDA 3KQNA 1E2QA 2CXSA 4IWXA 3AHDA 4I9WA 3K9NA 1TZCA 4TLCA 3KCXA 3CRRA 5I7SA 4MH0R 1UEXC 5HA5A 1Z7BA 1ORQC 3DGEA 3VXKA 4BX0A 1UDCA 4OPHA 2A5GA 2Q5HA 3BD8A 1EQAA 3OZBA 1LDGA 1Z4LA 2YUAA 1ZD5A 2X8LA 1KVQA 1GM8A 1II8A 4LDAA 1DQZA 1JYEA 3AETB 1KDRA 1V7ZA 1ZUNA 2X7RB 2H4JA 2EG9A 1KY3A 3ICQB 2QTOA 3RSGA 5AM2A 4G0WA 1SBTA 3ZUGA 3GEPA 2IJJA 2AZ4A 3H1GA 1WB7A 2YRWA 4GWLA 3F1KA 2VXOA 3ZI0A 3WGGA 4RO2A 1YZLA 4K0KB 3SX4A 2DJIA 2QZ9A 2ODTX 1YOBA 4LF4B 1D6NA 2DT8A 2ZI7A 3T1HB 2JFNA 1GNQA 5HHTA 3CX4A 2DERA 2DUMA 4K86A 3AG2B 3C90A 5CBGA 4V38A 1UJWB 4GPEA 2WF7A 1NONA 1FYVA 5F5XA 3ZVRA 4LECA 1Y1PA 4MV7A 2WOJA 1TJ5A 3M1AA 1Z6GA 4JVLA 4FOOA 4QE7A 4K6FA 4EMSA 2C7GA 2XWQA 3N70A 4R8CA 2QQ5A 5GVRA 5LA6F 1HNWB 2W4MA 1DAKA 1COWD 3IUSA 4UXHA 5U9CA 1I51A 4FCWA 1AOXA 1ZN8A 3TAUA 4BNKA 4AXXA 3NP7A 5EIXA 1IXZA 1JHRA 2H1CA 2J45A 2XMDA 4WN3A 1AI6A 4DIKA 5TPZD 1B16A 1XRMA 3DL0A 3IC7A 2JKZA 4XIYA 4G4IA 4OV6B 2Y8EA 3N74A 1YOVB 4PYMA 1AI4A 4FS8A 1KFKB 3UJCA 1C4WA 3TRFA 3L0YA 1OT3A 1YR9A 2YJ6A 4DMKA 2Z3WA 1GGJA 4KE7A 3UAYA 2FN7A 1A0OA 1RRKA 4JJAA 5DW3A 3WJ1A 4HNQA 5H7XA 3WLSA 5ECYA 2PD3A 2IDJA 5BVGB 1H2XA 2XMRA 4G0XA 3RVDA 1I7DA 2BOCC 2C2MA 4IGGA 3N7AA 2JEZA 4EVRA 1ADCA 5LOVF 2OBFA 4KFTA 3TBKA 4QOEA 3DOUA 2BI8A 2J4DA 3V4ZA 3GDHA 4IRXA 1R0LA 3F78A 1UOOA 1KPGA 1FP1D 4PDVA 1DG3A 3LSQA 5GINE 4UU7A 1OBFO 1HEUA 1T3SA 2IUSA 1HK7A 1NIPA 5IULC 2H9AA 1QWOA 1KQPA 3ZJ4A 2WF5A 3T4UA 4UHDA 4R83A 1YZKA 1UADA 2EWVA 3F4BA 4ISBA 2XQKA 1NDUA 3AF3A 3TTUA 3L92A 1M3SA 4KVZA 4JI4B 4CLXA 1UKYA 2A79B 4PCLA 4Q3CA 1QZXA 2QKCA 1L5RA 2KKWA 4ARCA 4GECA 2W6ZA 1LGYA 5A1JA 4N3GA 1V1JA 5JHHB 3BWDD 3AJRA 2DR3A 4MUAA 4EPWA 4H1VA 1Y80A 5M29A 3E9YA 4QU0A 4ZU3A 3CZ9A 5CMUA 2EIJB 2GNOA 5C35A 3TRDA 4U7DA 1B6RA 1C80A 2XGJA 3RR2A 2QVZX 1EIZA 2HJGA 4GP6A 3LD9A 3A0UA 4HFMA 5K6AA 3KYCA 5KDLA 3DBOB 1K98A 2VNJA 5F3WB 1YSCA 4X88A 2FR1A 1O87A 4YMLA 4MR7A 4JLWA 4PA9A 3BGIA 1AE1A 4TV9A 3PNMA 5DT9A 2ZSFA 3NW9A 4W1PA 3IDQA 4L95C 1XXHA 5JR3A 4RY0A 1VA5A 3OZCA 4IV0A 3EDCA 3UUEA 2WUDA 1YMQA 2YNMD 1FMFA 4EHDA 5I7FA 3IUMA 1DSSG 2OCLA 4OD0A 3M9XA 3W9UA 2UUCB 4ZVRA 4H7HA 4IHKA 5PNTA 3LXMA 4L2IA 4QPJC 4B45A 4DLWA 5FV4A 5ECGC 1FS5A 5JH7A 1GFSA 1WQ4A 1D9XA 2Q7EA 3FDIA 2W22A 3DLHA 3ZN1A 2ET6A 3ND8A 5IC4A 2A14A 4ZZ3A 1WMBA 4YGXB 3RVRA 4L15A 1GAXA 3PWSA 5C37A 1MABG 2V7GA 2QL7A 3C70A 3ICVA 4S24A 2VT3A 4OGLA 3LDUA 4PNPA 3RKSA 1Q1NA 3DG9A 5BN4A 3W0LB 1CQZA 1XMPA 3VZDA 2HK8A 1QG4A 4LDZA 5FTNA 4J2TA 4BMSA 4RQAA 5TEWA 3ZQ6A 4PN3A 1VLLA 2JBAA 3JALA 3ACDA 3T0IA 1DINA 4OI1A 2I6QA 4Z2WA 2V55B 4Y6LA 3GHHA 4OP1A 2ZIMA 4D4LA 4HDCA 2R7AA 1AZLA 1CS0A 5I9TA 3D7RA 2HQSA 1BQ4A 3UMSA 4L8FA 2OWDA 2FSHA 1GUZA 1QK3A 2YDXA 1EE1A 3SZLA 4IUBS 1U90A 2C07A 3GEHA 4BAZA 1SR8A 2Y05A 2NZ8A 2RKWA 1D7OA 2H8PC 1MENA 4P54A 2CEKA 2GRJA 1KO4A 4WKBA 5I4BA 3KJEA 4UASA 1SC1A 4DG8A 2HHHO 1PTJC 2NSHA 4MVQA 4R84A 1T13A 1LX6A 2YSUB 4OCLB 2O50A 1JKJB 4JMPA 1GTVA 1UDWA 3ISVA 5AM4A 1CQPA 3GVIA 3GDFA 4F9EA 4I4IA 4ZJUA 1JAYA 4L4XA 4RESA 5KI6A 4OPMA 1XYGA 3GLIA 1FDOA 3MLAA 3NV9A 4KQGA 4P82A 3RG8A 5F2NA 1NZDA 4ZVNA 4M60A 4TXNA 1MQ9A 3MRXA 1NI4A 3BORA 4FC7A 2QNIA 5J4YA 4PXYA 2HPVA 3C6QA 3PQDA 1T0IA 1B06A 3WKAA 5IRCD 1ZG3A 1L0NH 4WLVA 4XDHA 1MZEA 3FYIB 4C4TA 3UO2A 3KQLA 4HRWA 4DA7A 3GXBA 4X6XA 2WICA 3PKJA 4DOMA 2BFFA 3P30A 4OQMA 4ARSA 1HYGA 4YRKA 5TEVA 4C1BA 1P1CA 4LF6O 1FXWA 4I5EA 2SHKA 1CIJA 2GUZA 2AR7A 5JT1A 1JA9A 3SJ7A 4E2XA 5A03A 3D36C 3F7MA 4P0TA 4DB4A 4OSEA 5KKCA 4P38A 3ROPA 4RC9A 4M7OA 1WBBA 2QBYB 3I83A 5JS2A 4KQFA 2IZ1A 3A36A 1F0YA 3GLSA 3JCUZ 2YS6A 3GI1A 3REQB 3I2IA 1WBJB 2G7MC 4I4TF 4CTJA 1BN6A 2ESRA 1JJIA 2YCBA 2W6NA 3WKCA 4V0LA 4B6EA 4KYVA 2FF5A 1JVBA 2NUTB 8LDHA 2JFUA 1WHSB 3UJ7A 2PQ2A 3CF0A 3TECE 1NVUQ 3TM4A 4G5RA 3KOZA 1UBNA 3RIGA 4RAOA 3NWJA 4CG2A 2NN3C 3LDCA 2HA6A 2ZM6O 3B78A 3SDBA 5C1BA 1C2TA 3OF5A 2IEIA 3PQ6A 4F96A 1DPGA 5KQMA 2DCUA 3KRTA 1ZMRA 5IYCO 1W34A 3AB8A 1G59A 2PFSA 4TS1A 4X45A 1CTQA 5AW2A 1G6OA 2QG6A 4FYIA 2GARA 1XZFA 3BEOA 2DC1A 5JI3E 1VE5A 2Z5GA 1CRLA 1SUDA 2D5CA 4DV6O 4CKZA 3BB3A 1JALA 3ZY3A 2DEUA 3KDAA 3FTPA 4IHJA 3GLGA 2P3OA 3L2OB 1U0LA 4AXBA 1XZLA 2X4DA 2AH5A 3BJRA 2Z1DA 4MR9B 3FUUA 1MJNA 2P69A 1Q90D 2OPHA 2UXBB 5B7PA 3RWMB 2QJ1A 3OAAA 1RKQA 2ENUA 3L43A 1OXKB 1LI7A 2AMJA 1LQUA 4TV8F 3DAFA 3VX3A 4QLBA 4DB2A 1YI8A 3I5AA 3WKBA 2DU8A 1QGUB 2FPIA 1WXWA 1ZCAA 2VL7A 1NX9A 1MORA 1GU0A 4UHBA 1LLQA 4C4YA 5HCNA 2EAUA 1XNRB 3C6MA 5G0UA 4A91A 1LPNA 1YDFA 4KZKA 3ZNOA 2XWPA 3ZOZA 4QHTA 1VIBA 3EGVA 4IINA 4D8WA 1N2IA 3HCWA 3RYFA 4RO0A 3MQFA 4KPUA 2IPMA 4QBKA 4K26A 5IUNC 5F1KA 5C52B 2GESA 1DXHA 3FB7C 5B1BC 1C29B 2PKYX 3JWHA 5BWLA 1HLGA 1X80B 1XCOA 4A0QA 3H5LA 3ZEAA 3WYGA 2ZDIA 6LDHA 1W36B 3RIHA 5JD3A 2C1EA 1XOUA 4PHGA 1TTQB 1R00A 4LQDA 2J7PD 2OBCA 1PNVA 1VBNA 2O07A 4WBNA 3BHJA 5D5HA 4EBBA 1MW8X 3GELA 2ZJBA 2G40A 6Q21A 2ZJ5A 4H31A 2JJ8A 3IIKA 4GSKA 1E1RA 5LIRA 1BTOA 3FPGA 3WDSA 3OJLA 5JCOC 1J99A 2GJSA 1RAEA 4H2DA 2VH5R 3G0HA 5DEOA 4J0JA 2ZE7A 3BRSA 2UZ4A 3SF0A 4KQJA 4RKRA 3ZEIA 5ILQA 5JFGA 3TCKA 4TWKA 2XVZA 1OX4A 1X7ZB 3LLUA 4BTVA 2HUPA 4HXFB 5D86A 1SBQA 2Y69B 2X42A 4NH4A 3KPYA 2A1UA 5G4KB 2JGDA 1M0SA 2PWPA 2HRCA 3EW9A 3OO0A 4QGPA 2IU3A 4I1YA 2W2MA 2P3SA 3WHIA 2X8JA 3NKFA 3CWBH 2G84A 4RZUA 1R2QA 2B0JA 1TUBA 4PLCA 3KQKA 1JH8A 1RT9A 4NQLA 1GM7A 2X8BA 4I50F 4DPKA 3B3JA 4X63A 1Q2XA 3GYGA 2ZSIA 4DPLA 5EE9A 3IXQA 1JX9A 3JD1A 2G9NA 3AEQB 3N07A 3AZOA 5LUAA 3MINA 3GLFE 3FPLA 1DAPA 5TQ0B 4AZ3B 4JOSA 3PJRA 3IKVA 3KAJA 4BO8A 1ZD2P 1XMJA 1GVNB 1CIVA 4AIIA 5DNDA 3TUZC 2V03A 4IS2A 1J06A 1JFRA 4UOZA 1KEKA 2B69A 1JLRA 1WWKA 4UDYX 1GA6A 3PQ2A 3M8KA 3QE0A 4Q3KA 3STVA 1QU2A 4EFDA 3LIPA 4E88A 3EASA 1I01A 5J59A 1RXWA 1NW3A 4ZEVA 3E18A 2IXAA 1AF4A 1XL6A 3H9VA 4NBUA 3ZHQA 1GSIA 4PLTA 1G17A 1AZSC 1CRPA 4RK5A 3AC0A 2WD9A 4IXWA 4URUR 3AKZA 1BGVA 3RU7A 1NL3A 1R37A 2CXNA 2IPXA 4B3SB 4HRQA 3I76A 2PIAA 5FBVB 1M1NB 3N05A 3FAZA 4YJ3A 1KJJA 4HUJA 4HEHA 3DPIA 1WXQA 1ETUA 1N6LA 1O2DA 5BRJA 3LA8A 3VU8A 1KK1A 2W6OA 2QRQA 1U2EA 2I6SA 1VF7A 1U80A 3HCDA 2FSVA 5BYJA 3CE6A 2XZLA 5LLTA 4PSDA 3AKCA 4JSRA 1MXFA 1YFJA 4PA6A 3KT0A 4PZZA 4EHLA 5DEDA 5IH7A 3ZPCA 3SHTA 5HZHA 3DXRA 4WINA 4PC7A 5DEIA 1Q1QA 1MN6A 5DK4A 3W3AD 3SNHA 4O4IB 2GPAA 5HCIA 4WZ6A 5BQFA 1OR8A 4RJ2A 1W0JD 4PDRA 3CHYA 3WO0A 5LL6P 4ZANA 2WSLA 4RTLA 3PEEA 3S81A 2VT6A 1L7RA 2GUGA 1FQJA 2LPMA 4N6OA 2PUCA 3WK8A 1FVHA 4G65A 2AK2A 3QY9A 2X0KA 5T41A 1HMYA 3ZW9A 3QUQA 2BR3A 2EKBA 4YP9A 3ROZA 4C29A 5JHGB 1NRIA 5H1YA 1F0PA 3MCUA 4OAQA 3Q9NA 3D0QA 4NVPA 1W4RA 1EE2A 3B8HA 3IQEA 4JITA 3TUJC 1J8MF 5B12A 4AB1A 4A6XA 1NUAA 1PI3A 4EH1A 1ZUHA 4NX2A 4G8BA 1H6BA 3UOGA 6GPBA 3D5EA 2OVBA 2JK5C 2FSPA 1FPQA 3OUSA 4AJJA 5AW7A 3AG3B 2IZZA 4ITRC 3TCXB 5CUQA 4AAYA 1VE7A 3T7KA 1GARA 1IAQA 4RVSA 3TSCA 4BE9A 2VWJA 1QE0A 3UG6A 2GKGA 3UWOA 3OUFA 2WWGA 3QYPA 5JDCC 1OZHA 1P0IA 3OLZA 2GPJA 2OUIA 2HN9A 2H63A 4YALA 1UBFA 3FMGA 4F4JA 1I7NA 2HLNA 3GMTA 2OWOA 2WD7A 3EYAA 2HC9A 2XNSA 4ZCIA 2NAPA 2PGLA 4KQ1A 4PZYA 2VATA 5I5GA 1RQ7A 3FYUC 2JS7A 2W6JD 1DTOA 2VZ8A 4OJYA 1J0XO 4DUZB 3LLCA 3R0VA 4KGDA 3DBRA 3PC8C 3OTHA 4BTEA 5FI3A 5FBHA 2WLSA 1R3IC 4M9QA 4E14A 4YN3A 1QIMA 1UXHA 1N0JA 2WNHA 4QIWF 5AR1A 1SXJA 3ZCXA 1CJBA 3SR3A 2JG3A 4Q7EA 3M6LA 4DZRA 4DR6B 3E1GA 2GEKA 4F9FA 4R41A 2Z98A 4J9VA 3KOOA 1HH4A 1IULA 2WJGA 5JJ5A 5TLSA 4W9NA 3FB5C 3DV2A 4BZQA 3TNFA 1EQUA 5FHQA 1RNLA 4QFDA 4L6CA 1KYYA 4NRDA 2WZQA 4MX8A 2QSYA 3OEHD 3HUDA 2JDID 2MYPA 2BN4A 3LY5A 2Q5EA 3I8XA 5BR7A 3RRNA 3ANSA 5HW0A 2LGJA 3KCNA 4PBSA 4Y6SA 4YCBA 5DOVA 1OI2A 4D5GA 4YRGA 4K9PA 2BELA 3KZVA 2ZRQA 4E5UA 1QRSA 2CFRA 2FPLA 1MX9A 4FDTA 3O83A 1PZHA 4KXWA 2F1KA 4B71A 4NP6A 2B4TO 1QH8A 2H57A 3V9PA 4PVCA 2BVNA 3WGZA 1GPNA 3CZ5A 3LUGA 2QE7A 1FJGO 4DANA 1KEEA 4BP8A 1YNOA 1UBOS 2QWOB 3DDHA 1U8FO 2E5LO 5HGJA 2B6NA 3PL1A 3A1UA 4OL0A 3ZH2A 1O57A 2ERXA 3OPQA 3Q3JB 2AKEA 1AI7A 2LGQA 1G1MA 3VR6H 2VN8A 1QM5A 3EW7A 4LF7B 2G8LA 4ANFA 1YB4A 1DC6A 1YVPA 3IOYA 2O2XA 4OO3A 1AO0A 2Q68A 1XZMA 2NTVA 2JLBA 3LHFA 1DUIA 2OCCB 4EMTA 2TS1A 4F72A 3LSYA 1W59A 3M4XA 2XUHA 3H1KH 1VQ2A 2EX0A 4KQ2A 3EDOA 4D4JA 1P4AA 1NQXA 3HU3A 4LR3A 4WFHA 4PI0A 2WU4A 3MUOA 3EAQA 2HH9A 3NETA 3IC9A 3KPVA 2PUTA 1Q17A 3ZD8A 4GEGA 2D5IA 4BVHA 2M6SA 4YFYA 5DPMA 5CYFA 1A7KA 5HZMA 5CB4A 4DIBA 5L7YA 1BCSB 4QNMA 5CBFA 3QJYA 4FS3A 4BJ3A 3COYA 4AROA 4TVBA 4ETIA 4HDKA 4R5MA 3G2HA 3IPRA 4OSPA 3BUSA 4LSGA 3UCXA 4OXSA 1SMKA 1YS9A 2XVXA 3OZVA 4YXWD 3EPRA 2RGEA 2W4QA 1M2OB 1JHUA 1FYDA 3MMNA 4D79A 1Z8HA 1R12A 5M04A 5TGDA 4DA0A 1Q7BA 1IBMO 2OXCA 3A7DA 4UPEA 1KI6B 1IXMA 1GGKA 3ZWXA 2C84A 1Z45A 4HUTA 3A6KA 4KREA 5E7QA 3QPDA 3SJBC 3V1MA 4UEKA 3GLQA 2O3RA 1PJ8A 1BD3A 5FWDA 4FHCA 1I7QB 3T7TA 4AULA 1N5IA 1SHKA 1K92A 1QONA 5HBRA 2C98A 1CR0A 5CDHA 5FPOA 1FTQA 1P8AA 5DM4A 1BYUA 4UV9A 1C9NA 3H9GA 1HDYA 4Q03A 4ENTA 1NRJB 3OZGA 1FXSA 5TPWA 4DC0A 2F00A 3EOZA 3EIWA 2QTFA 1LF0A 4L08A 2GD6A 5HQTA 4RWEA 5AJYA 3IOCA 1NR7A 1QQTA 1HL3A 1RR6A 4RXUA 4CTOA 1KYVA 4EKIA 4QFMA 2NU7A 3J80A 4YJFB 2IODA 3HJRA 3MRSA 1Z4IA 4RW0A 3T99A 3QVWA 3HBAA 3H0EA 4EZBA 5JSFA 4P0QB 5AMXA 4AWXA 1TD1A 1C3JA 2YC2C 1VHQA 3RW9A 2D54A 3VQWA 4KFCA 4B7CA 1E4VA 3WAJA 4FONA 2WWHA 4DY6A 1NMYA 1UK8A 1QF9A 2PMFA 2MSKA 3VNQA 4G4SO 4V24A 3Q41A 2XZTA 2DPYA 4RXTA 5CH3A 1UBJS 2EIMC 3UB3A 1PQWA 13PKA 2ZS7A 5L3QB 2VPYA 3HYRA 3C5VA 3ITDA 3OQJA 3PXUA 4BO0A 1QLEC 1F5SA 5DRYA 1CLUA 4Q4AB 3DFFA 1Y4MA 1MO4A 2GK4A 3OJ0A 4D25A 2MDTA 3HUFA 3Q6MA 4Y8VA 3NBUA 1KK0A 3DYBA 2J3DA 1NU6A 2NZXA 4EB6A 2ZAIA 4ITUA 1NMXA 3LFTA 1Q0HA 4FW8A 2PCJA 2W37A 2PZMA 4NR1A 2IU0A 3TLEA 2LNDA 3AF4A 2OD9A 4ZVQA 3G80A 4CT4B 4CEHB 2D30A 5KC9A 5CIQA 3F3KA 3RSOA 1HO3A 4FFOA 2X77A 3UKMA 5LBUA 1P75A 1MG0A 1RYZA 4HAMA 1OAKA 5FR2A 1NLUA 1NT4A 3W8NA 4BS9A 1OLSA 1H66A 4MQLA 3VKFA 1P9NA 4BMNA 5HMMA 4MS1B 4NC9A 4HPXB 5DI9A 3W06A 3UGJA 1WOYA 3I9V6 3DBLB 3BCRA 1GITA 4OGWA 4MS3A 2K1EA 4RM2A 4Q6WA 3IIMA 1NDHA 3G2IA 2V6JA 1H3FA 5KDDA 2AFHE 3W77A 4AJNA 5AW4A 1RI5A 4XB6B 1ZOPA 1D7AA 1RC0A 2V7UA 1WUKS 2Z57A 1B93A 3OFVA 2BFWA 1A04A 3FHCB 4RD1A 3NTUA 4E70A 1QYIA 4EGFA 3HLKA 1GPDG 3FB4A 1P45A 4P7GA 1M56B 3EYWA 2ZB3A 3HDVA 1LF5A 4TVSA 1B8OA 3TNYA 2FE4A 4B3FX 1FQKA 3N27A 2WINI 4BNXA 4QXQA 1E3DA 3AVVA 4IDBA 2AZ2A 5F2KA 3PFNA 2ZWVA 1I10A 2PUVA 1G21A 2X76A 4Y67A 3GJ4A 2ZDGA 3KZIZ 4AWBA 4Y1FA 3K0DA 2F6RA 3L7LA 2VNIA 1V41E 5IBPA 1BYIA 2E1RA 5JEDA 3GMDA 5JS6A 1D2MA 4GBGA 1DTSA 1VP7A 2QM3A 3F8WA 5LUBA 1BO6A 3JPWA 2A4KA 5HF9A 2EOAA 1O6FA 1Z16A 3G1WA 1DIAA 1TVMA 2D2EA 4HWPA 2ZRJA 4QUAA 5AJZA 3ZZNA 3I64A 4EUNA 2WJJA 4MMXB 3ZDAA 4CI0B 1F17A 4HAZA 5EPEA 4EFEA 1J56A 1A5SB 1EBFA 1BGXT 2I6XA 2P0AA 2OB2A 5CVUA 4BLPA 3SZMA 4K88A 2Z4SA 3BK7A 3E48A 3Q3HA 2QN9A 3RF6A 1Y4SA 2DQYA 3AVYA 5KREA 1RJ9B 5DHUA 2RBKA 1DJPA 3MC1A 3LP8A 1JWAB 1U1EA 3KTAA 2PY5A 4GR5A 3RFXA 3NWBA 2G7ZA 1IZ0A 3T1HO 5BSRA 5GY7A 1YJAA 4F8EA 3SHQA 5HKKA 4G9GA 4AM8A 1SF9A 4DV7O 1GKIA 3CKMA 3AWIA 4DTCA 1F4NA 1DC3A 1L4MA 4Z4HA 1P6OA 4AYTA 2ZDHA 1L4GA 2HF7A 3VKWA 3V1LA 2ZJ7A 1P7PA 5BOVA 4ZODA 4KLCA 1QNLA 3G7SA 1B23P 1HNWO 1W4AA 4JLKA 5F7XA 4CKBB 4XDJA 5FDFA 4NNJA 4P53A 3M4JA 4GSLA 4II7A 4OTZA 5UKDA 2ECQA 4H6WA 4HHEA 5LQNA 3DZIA 1G3QA 4UCQA 4FYYA 2COKA 2QUAA 1W44A 1TZ2A 3PFIA 3H2HA 3KLMX 1SCIA 3EQ2A 1KYQA 4O4JA 2QTVA 2WDPA 1LVHA 2X40A 5JAQA 1DFHA 2ZINA 3R0IA 4IX1A 2BD0A 3OZXA 3GUYA 3ILVA 3DZ8A 1XZJA 5KOHA 4P7JA 1FUKA 2V54A 4C20A 3TSYA 2WWIA 3ILYA 2OXTA 5ITWA 1U2GC 3PV0A 2WG2A 3IP9A 2GXAA 1RIFA 1ML4A 1TUEA 3STWA 4F4DA 3I09A 4P4TA 3D8UA 2R8OA 3T06B 1GLVA 2AGAA 5THKA 1GG2A 5EKSA 3FY4A 1TM2A 2CNNA 2I4RA 1FU4A 3C98A 1A9XA 1VSVA 3IEMA 2WDZA 3T1QA 3R9KA 2ZXUA 1YJ5A 1JEYB 2B30A 4O0LA 1GNVA 4YMWA 3C3TA 1G8HA 2KG7A 2NO5A 1DCFA 3FJOA 4UTOA 1DAEA 3M6XA 2XMSA 5A9TA 1V7PC 2J3EA 1UL1X 1FE8A 1GPYA 1Q6UA 1HPLA 2O8FB 4F1KA 4XUDA 2XCUA 3OJCA 4D45A 3FVWA 2GYYA 3U81A 1CR1A 2ODNA 4EYOA 4Q4HA 1G5QA 4D97A 4X24A 3S44A 4BMOB 1UX1A 4A6PA 4AJPA 5IJWA 1MZPA 5BUQA 3AOGA 1OHHG 4GUAA 1CJCA 4JZ2A 4O4HB 1R6NA 1Q22A 4DCPA 5AVSA 3MT9A 3E6AA 5KX5F 1WJGA 3FUXA 2X9QA 1KORA 4J0KA 3JW8A 3DEIA 1CUCA 3AP3A 1J22A 3D8HA 1Z88A 1YRYE 3VPCA 2VDKB 4PNEA 3HPLC 1L7VC 3IAFA 5KWVA 3CTMA 4P9PA 4PM4A 4AUMA 2GZ3A 2OCKA 3PA6A 3V7NA 4X1YA 1H8ED 2JKVA 1VHJA 3SX0A 3G79A 1ZW1A 1S5PA 2OE2A 1WZUA 1K8YB 3EJ6A 5T8KA 4D02A 3KD3A 1RP3B 5CH8A 2HSWA 3H7AA 2FN9A 1KKCA 5KUTA 1EBUA 1PAUA 3SKVA 1XZGA 4QATA 4KR2A 1N5OX 3L6CA 1LPPA 4WLFA 1PZFA 1FFBA 3JQEA 1R64A 3LUFA 4AMYA 1U7DA 2FHPA 4I43B 4IH4A 3MJFA 1T1IA 3N7TA 1OYVA 4OHKA 2RMKB 5JFTA 4UB6Z 4PR0A 4TLMB 4UCVA 2O8NA 4N54A 4L6IA 3CURA 5HF6A 4YMTA 1H4TA 1KMMA 3U10A 3HXTA 5C7LO 2VDPB 3AHEA 1WPBA 1RAGA 1SZDA 3DL4A 2BEVA 2PXXA 1U0HC 1K63A 5CT9A 4EJSA 3UWDA 2QM4A 4QYMA 1LDNA 1NMZA 3QE3A 3GRPA 3QELA 1HOXA 2HIMA 3ADOA 3K0SA 3P9RA 5AK5A 2VJLA 4F5DA 3MAQA 4PPGA 2F67A 3TH5A 2H4HA 2J9RA 2J4CA 2CV1A 1C3OA 3H11B 1S6YA 4M38A 4MRNA 5K2MA 4V0SA 3F4LA 3SY8A 5ITZA 1YJQA 4G1UC 3RS8A 4E0QA 3ZS8A 1UOPA 4UUBA 4CGYA 3K1ZA 3L4KA 3ZNPA 3OGCC 1RAAA 4NMHA 4GVXA 2QU7A 3S55A 3OT5A 3HXQA 2VWPA 2VJNA 3B3AA 4J0DA 2P9TA 3WIDA 5CK5A 4YR9A 4OHRA 1AQ6A 4BP9A 3TNJA 4KRFA 4Q37A 2QZ4A 4EJFA 4O2RA 3EIQA 2FMIA 3M9WA 4RZ3A 3UCSC 2PCLA 3HH8A 1QDLB 5IJ0A 2V6GA 1VCMA 2EZ4A 1JECA 4FHGA 3DV0B 4UM8B 2OTJV 4GI2A 1DBSA 1EGAA 3B1JA 3Q8WA 3SAJA 3PRKE 4RTQA 1G4UR 4CMJA 2J59A 1ISGA 4MRPA 1RWVA 2HXSA 4XOUA 4BN0A 3BRCA 5DGTA 1QXSA 3THOA 1W4ZA 1UWZA 4W9RA 3KK0A 3ZWQA 1FUUA 2O0MA 2CUZA 1E9DA 5K8LA 1W9HA 1MIOB 3BVOA 3O47A 3VR4A 4DNPA 3TIIA 4CRWB 3UXMA 4EEZA 2JGAA 1P1HA 3Q6IA 4OA8A 1AK9A 3DM9B 2G28A 2XRMA 3RROA 3IELA 1I2CA 2VEDA 4PD4F 3GB9A 2Q6AA 4I1SA 2AA3A 3FI9A 4KE6A 5AKKA 1NTZH 3NRCA 4RH3A 4B6SA 2ZJ4A 2MSWA 3FMVA 1D9ZA 3QPWA 3BRWA 4QUEA 3VC2A 1HORA 2XUOA 4BFYA 4YJ2B 3VR6A 1YDGA 2O95A 3IHTA 3IAEA 2RH8A 4I55A 5HWSA 1CJVC 5F4BA 4UCXA 4C6RA 2H7VA 2JGKA 3MFQA 1Y8CA 3QPUA 3BBPA 4FWTA 1NU8A 1C41A 2VG8A 3G89A 1U1CA 1N7JA 3EY9A 2AC4A 2O2SA 3D6FA 3HVRA 4OY3A 4QO8A 3CLHA 1CK4A 2IFTA 4M87A 3WYBA 3ND9A 4ZYTA 4NBNA 3VR5D 1OH7A 4JTDB 3NV7A 4OHYA 3CNOA 2PGOA 1E32A 4Q1EA 4K03A 4YMUA 3EMDA 5CPBA 1M34B 2OENG 3HVKA 1O4WA 4IVRA 1KDYA 3QK7A 4G01B 5BUZA 5A3RA 2PTMA 1ZD8A 1LUWA 4K40A 1RMQA 5EKDA 2JBHA 4K6HA 2Z3VA 3KLNA 4GKJB 1V54B 5EP2A 2VF2A 3AR4A 5FQNA 1QUEA 4I9HA 4QGGA 5CLLA 2XE4A 3NTOA 4ES6A 5LB2A 1KQOA 5ENVA 1QFMA 2DHCA 5KTNA 2I4IA 3GC6A 2P2DA 4FQ5A 3O3OB 5LXTB 4BAYA 2OR3A 3A8TA 4J16A 1LLCA 3VOUA 3IGAC 4AY3A 4C0QC 3OU2A 1ZLYA 3M99B 4X8MA 3QEMA 4INJA 3FD8A 2H2GA 3X2EA 4U2FA 2V7QG 3RC8A 4DBVO 4W5HA 4P6VF 3M7MX 1K5QA 3JQGB 3PHCA 4URXR 1V35A 1WUTA 4OCZA 1G0OA 2A3RA 1I6WA 1V9LA 1KP9A 3JWPA 2R86A 2CDYA 3OA2A 4ZDJA 3GRKA 2WSSD 2HNAA 3N2IA 4JWTA 3NH9A 2BSKA 2HXVA 3N2LA 5ISMA 3WFZA 2PS3A 1CXZB 4HQKA 4KQ9A 1A8HA 1TF7A 1KB9F 5HOEA 2W71A 4YJDA 4TTJA 3S5JA 1A7AA 4W9MC 1MQ0A 2ZR9A 1T26A 2Y0BA 1ABFA 2V7BA 4HRVA 3PDIB 4FCCA 3VKVA 2HIGA 3QVGB 4K6CA 1NWHA 2G0AA 1N9GB 1N2HA 3ORRA 3DNMA 1GQQA 1IN8A 4U7TB 4C7OB 5D5PA 3TQTA 5IKOA 3U9TA 1O94D 2Q7HA 1ZOSA 5CIWA 4QHSA 3AB7A 4ZJPA 2C4MA 1KSFX 1OD6A 4LC0A 2DSTA 3ZCSA 1K4KA 2H0RA 4ASUG 1NTOA 1Q0QA 3C5CA 1O9GA 2QQFA 3K9WA 2X1VA 5EBWC 5T4BA 4BMVA 3NC1C 3ES9A 5TS2A 4DJDC 3MMZA 5EMMA 2JAPA 4MW1A 4E51A 1C8LA 3JSLA 1THGA 3RC1A 1G9SA 5JWHA 3OICA 3R77A 4FX5A 2GN4A 1XZPA 3AM5A 5HUHA 2OM2A 4HDSB 1TZKA 5EMHA 1WS6A 2IY7A 1JFLA 1KI1A 1K3FA 2WF6A 5CURA 2BM9A 4J42A 3VHLB 2YVAA 4U02A 1DEHA 1D2GA 3JR3A 3T1OA 1QHFA 3Q7SA 2OZLB 1EK5A 4OJNA 3WAKA 1Q3TA 3Q7RA 4A5OA 4C4SA 4LYDA 5AHOA 4AJ4A 4CR7A 5K1PA 2OLJA 1F6WA 3LNMB 1B76A 1Y37A 2R6HA 4REMA 1SBYA 2R1VB 3K6RA 4YRMA 1WA8A 1KI8A 4UE3S 1H1LA 2QA5A 2YVLA 5EE3A 4FMTA 1SU7A 2P75A 4E0BA 3CMCO 3W7VA 2CJYA 2IYLD 2FSFA 3ET5A 4LXQA 2NOAA 2JS3A 4ZRMA 2CSXA 4HL6A 4E7OA 2QUZA 4WJKB 4I46A 1AJNA 4DABA 5A2QN 4JQSA 3DLBA 2YOHA 1T4CA 3VR2D 1XJWA 3OZDA 2JFOA 5DZSA 4Z49A 1L5HA 3ZY2A 4ZP1A 5KYKA 2C9BA 4CU2A 3TTXA 4POOA 4HYYA 3ACBA 3ZK9A 3ANNA 3DDCA 3KKYA 4NARA 1GTRA 1DG9A 3HRIA 1WXGA 3USZA 1VF6A 2AHOA 4ILEA 2O1WA 5F12A 3A3KA 2PKEA 2JB9A 1JQAA 3CY6A 4EI2A 2I2DA 1MJ5A 3LPMA 4F6EA 2R4UA 1MO6A 4D4HA 3RODA 1TIKA 1E3WA 5C46F 3WDKA 5L3ZA 4FHZA 3DFMA 2LWIA 1AQJA 2Y4NA 1FTSA 3E86A 1MB0A 4MVWA 4B3SO 1ECLA 2ZB2A 3VI3B 1XL0A 2ZYWX 3V4VB 4DNOA 1D03A 1U0OC 4XFKA 1X7GA 4IOJA 3GFPA 4P9CA 3T5AA 3VH1A 2C3PA 2XE8A 4M46A 3W34A 4EI9A 1O08A 1F8GA 1YC5A 3N0WA 2PSDA 1BDBA 1LNZA 3KSRA 4ND5A 3ABMC 4UBJA 3T9FA 4IRUB 1N5KA 2P87A 3F5TA 3Q2KA 2V4DA 1XU4A 1GG5A 4F2WA 5LKRA 4LZJA 5J9PC 1MB9A 5IK2A 1UC4B 3W3ZB 4J7JA 1AQIA 1NBHA 1X1SA 4H3KB 1YL5A 3ME5A 4J0HA 3IMCA 1R27A 4RA6A 4MKXA 1BVRA 2RI6A 4RGYA 4PFQA 3K5PA 1K7CA 4CL2A 3QZUA 2O59A 2DFTA 4I6EA 3G71V 3N8DA 5SYNA 4BWAA 1PV4A 5K5EA 2G5TA 1DAFA 1HLDA 5DXAA 3QWFA 1XVIA 1Y7HA 2GNAA 4Q3LA 2IUUA 3T94A 3C3DA 5ALFA 2JL1A 5IYBO 4ALNA 1PFYA 1XTKA 4LXGA 2RGUA 4AMBA 4G97A 1OQAA 4RGQA 1ZRSA 3FF1A 1DS6A 3EB9A 3SC3A 1L5GB 4EL0A 2IHYA 4R9RA 1NVVQ 3C3JA 4EPVA 2RGYA 1GTZA 3RSQA 1WDTA 1GTSA 3ONVA 4U8HA 3EFOA 3WB1A 4ZI5A 3DEFA 3DL7A 5ETJA 2WWRA 3U44A 4D46A 5GTIZ 2ZW9A 5P8WA 3B2EE 3QEAZ 2YV1A 4Q4JA 3EQZA 4QOSA 1KI4A 1CE8A 2F43B 1GRRA 1NP6A 4ZAZA 1K66A 2PU7A 2XHEA 1NYRA 2BMFA 4NMLA 1JTFA 4CFYA 3NPAA 5DNUA 1E61A 2DBVO 2AOUA 3T3IA 1B7GO 4ZMRA 2WKQA 3ZU5A 1ODTC 1TA0A 2J5KA 3HSSA 1AKVA 3CU5A 3GNLA 2IDZA 5CD9A 4M36A 2QDXA 1YBMA 2UKDA 1FJ2A 4WH0A 4HNAB 3AM4A 4KGVA 3X0DA 3V4FA 4DQXA 2BGTA 1A4IA 2CK3A 3K04A 1ZOIA 4URFA 3PICA 2IEZA 3WSVA 1H5NA 1QFYA 3CONA 5H5JA 2PBFA 3Q0TA 5LMNB 4KC0A 3FOBA 1EFKA 4KRYA 3UK7A 4PONA 1FBNA 1TZBA 2CF5A 4RORA 4YT8A 1UPFA 1PD3A 3ETEA 2XSZD 1XLTA 1G3IA 2AI3A 2CJWB 2VNHA 4DUZO 3DEHA 3OX4A 3D4LA 2NR5A 3VZCA 1V5IA 4HD8A 3BRQA 3JRXA 3TXXA 5LZ2A 1D1TA 1AILA 4BNHA 1XTSA 1L7MA 3NPMA 2HCBA 4UTXA 3QKSA 3UCFA 3W2GA 4CXMA 1PX2A 2YUIA 1PR1A 2CJXA 4KUGA 5H9CA 1RE1A 1RQRA 3W2TA 1XEQA 4KUEA 4OWPB 3IAS6 3TBFA 1YNSA 4GMKA 3T38A 1A9OA 4DRXB 1W75A 4MYDA 5L3FA 1WF6A 4HZ3A 3TZQA 4EPXA 4LBYA 2YS7A 4Z1MG 5JC1A 2NQTA 2VPXA 5K8VA 3CXHF 3ESXA 4NBWA 3T9DA 1ZCJA 4UZEA 1D6JA 5DCLA 4F9TA 2Q1UA 5FF9A 2WY2D 3C8ZA 5L3VA 4ZC1A 5FLXN 1QKKA 6REQB 2NSYA 3OE7A 4F60A 1GRCA 2PTHA 3PUWA 3A32A 2DM6A 5JJCA 2D5BA 1YHZA 2I2WA 5TQJA 3T3DA 3R0JA 1YF2A 1V8ZA 4BX8A 4FMDF 1OI0A 2W8BB 4BZWA 3ABLB 1KQSU 3SC2B 3ZV7A 5KU7A 4JV5B 3BXHA 3SXUA 1VG9B 1NW8A 2JK1A 3HI4A 2ZUUA 1N9KA 5T6MA 1YS2X 2ZI5A 5IAJA 1C1XB 3AKEA 3K3PA 3LUAA 3NVDA 1QO0A 2VXYA 4M1SA 3ENVA 1TQDA 3DVQX 3NNSA 4RD6A 3VOTA 1MF7A 2FVYA 5L51A 2IW1A 2MU1A 2PA0A 3ZMZA 4K9SA 2DR0A 3QBEA 4QUBA 2AN3A 4QFBA 3C4QA 1VJGA 1MFPA 4Y9RA 1NSTA 4DDHA 1I7FA 2BGGA 5E1OA 5AVVA 3B6MA 4C76A 4FGKA 1DJMA 3MQ2A 5KINB 4CM5A 5BMVB 2NMVA 3A3OA 3LGSA 3EDYA 4UNRA 4TKMA 3PQFA 4JI6O 2ZVPX 3R9XB 3ZGLA 4Z4FA 3ZY5A 4GFDA 3S2EA 5F2OA