2B1IA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 220
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1iA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1iA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1iA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1iA03
1S8AA 1T36A 4A1OA 1C30A 2XW6A 1IK4A 1WO8A 1B93A 1JDBB 1C3OA 1PKXA 1VMDA 1P4RA 3ZZMA 1CS0A 1G8MA 1M9NA 2YVQA 1A9XA 2IU3A 5H3LA 1OZ0A 1BXRA 1CE8A 2X8WA 1PL0A 2IU0A 2B1GA 4EHIA 1KEEA 1EGHA 1S89A 1M6VA 2B1IA 1ZCZA 1THZA
chains in the Genus database with same CATH superfamily
3T1VA 2Q3EA 1GPWB 1VMAA 2P6MA 3UMFA 1U5CA 3ZLJA 2VUTA 4YJ2F 1YAHA 3U5TA 2JL1A 2UUBO 4GOMD 1YBFA 3CD6V 2TRSB 4DUYO 2I3DA 1GRCA 1QLWA 2JEZA 4YP7A 2RE8A 1VPEA 1PGNA 1T9CA 1ILWA 4HAYA 1U0TA 1UKAA 2ISSD 4FOLA 1V9LA 4L6AA 2GBFA 1G8FA 4EQ6B 2GPAA 4CFYA 1M1XB 3WWDA 1RYZA 2NPOA 3LWDA 1O6FA 3OTHA 2EX1A 4CT0A 3CRW1 1L7NA 5LDHA 2J0QA 3C70A 4DO2A 3AYXB 5IJWA 3JAWA 1PHRA 5H3CA 2AEFA 2PL1A 3L71H 4E1AA 2BLLA 4CV3A 1JFFB 4HJXA 5E3IA 5IAOA 5KTOA 5DECA 3V46A 5HUJA 2F43A 2Q29A 3K0HA 5JMTA 1CJSA 4ZVRA 4H59A 4FDUA 3B09A 3GRPA 4KGDA 3CRZA 3ISVA 1KAGA 3ET5A 4G5XA 3ROGA 4LCPA 4ND8B 1HGXA 1QGED 2WYIA 4B48A 4JOSA 3E3MA 3MFYA 4C0HA 4J1QA 2IHKA 4FLVA 2QTVA 2CLLB 3VR1A 3ZDEA 3I5XA 2A9FA 2GHIA 2ECKA 2Z58A 3OT4A 4QBHA 4OXIA 2DU8A 3CNQS 2XB2A 3SIWA 2NXCA 1XPRA 1PBNA 3A3OA 4NYKA 4YREA 4TVBA 5EIWA 4D26A 3E82A 1OH8A 4DCOA 3DXRA 1E64A 4CC6A 3B8MA 2J7PD 4TTRA 1PEKE 3O65A 1MB4A 3K9NA 4K9DA 2BGLA 2IS6A 4RJIA 1XMIA 1OHHG 3K6SB 4LG1A 3TNLA 3GJZA 2ZJ0A 1HR0O 2BFOA 3S0JA 3ZGLA 2FJPA 1FRZA 1MJHA 3WKBA 1YUBA 2MSEB 4WIFA 2CE7A 2ZRKA 2P2YA 4YNBA 1L5HB 2VPIA 1R0RE 2BHNA 1SKAA 4RHTA 2QOEA 1G6OA 2B1JA 2BKLA 3CLKA 3IAS6 3AINA 4RAOA 3K72B 4GXQA 1I3LA 2IXEA 1O6GA 1U90A 3EMDA 4FT4A 3T5DA 3ZMUA 1MXHA 2FPOA 4JEIA 3ZDXB 1SKMA 2WMOB 3OCXA 1PDVA 2AG1A 2Q8QA 2HRZA 4PLTA 3AI2A 4CMGA 1PFKA 4TL6A 5IYZF 3HJUA 3I6IA 1A95A 3AL3A 1TA9A 2VOJA 4I14A 1ZJJA 2H00A 4FFBB 1UPUA 4MW1A 4L72A 2GCOB 3ORYA 1GTMA 1XK6A 4BU0A 4XYBA 4DVGA 4CV0A 5HQ3B 2EYUA 2BMVA 1TVKA 1FF9A 1D7AA 2I4TA 3CNNA 4PO1A 4MQFA 2HU2A 2YC4C 3OIWA 3EZNA 2ZVDA 3OQJA 4L8LA 5B1HA 3DDSA 3ZLVA 2O7QA 3E84A 4M22A 3ELWA 1OLUB 2VTVA 3H11B 1Y6ZA 3AI7A 1ZM3A 3R40A 4ZT3A 3BL6A 3UGQA 4ZHQB 4ND8A 4KQ2A 2Z9CA 4WKNA 1YBMA 5K03A 3EGVA 4D9GA 2WLJA 1CKEA 2GK4A 1VFNA 1J0CA 1SQGA 3A6FA 3FBTA 3SYRA 2O2YA 4W5WA 3IR6A 5D7NA 4GMDA 4O8XA 1TJNA 2AWOA 2JBWA 3PWTA 4ZO8A 5JI3E 2EILB 5IVKA 3LKDA 3G0IA 4IPTA 2JBHA 4MTCA 5HQJA 3DMNA 1UBMS 1FTSA 1K9VF 5DM0A 3UMBA 2A1IA 1CEQA 2VAXA 3IHTA 3QJGA 2WJHA 2BFCA 4XD7A 1PQYA 1YQTA 1SA0A 2EW8A 3LK7A 2P2SA 4K6HA 3E8HA 5TT0A 2VP9A 2ZKOA 1MX3A 2QVLA 3ENZA 4JJAA 3RYCA 5AI6A 3DPIA 1E2IA 1RHJA 4C7JA 4JLVA 3X1DA 1MX1A 2NZWA 4PZLA 5B1EA 1M93A 4ZI7B 1E7RA 1M6WA 1U3TA 4ZXFA 1L0LH 3RB8A 1VLVA 1ZL0A 3HY6A 4J7ZA 1Z47A 2WPDA 3FUUA 4ZC1A 5HDBB 4PG6A 4O4JB 2GO1A 5JDIA 3UXHA 2A3QA 3QP9A 3PEWA 5IYZA 2Y92A 1MJGM 3NPAA 2VWGA 1N2ZA 4NE7A 2W90A 4HGPA 3PJFA 4BVAA 4BBJA 5ELLA 5I4KA 5IXSA 5K09A 2ZI9A 5AVTA 1QX3A 3IVRA 2HBQA 3BB1A 1QHEA 2UXBB 3BEDA 2QUHA 1WMDA 4EF4A 3AV0B 2EZ9A 1BXKA 1HT0A 3BQ9A 3CUTA 4EHAA 1RE1A 2ARHA 3D6UA 3Q40A 5DLYA 4JV5O 1TQ6A 1Q19A 5TGTA 3F73A 3MWEA 5SV2A 2BZGA 2X0LA 4WW0A 1F0NA 4FMCB 3R44A 2O1XA 2JHPA 4X1YA 2JHAA 3HJCA 4MR9A 4NAVA 1I1NA 2VPYA 5K3BA 2V7QG 3L4EA 4B7ZA 1OIWA 4CS2A 3I2KA 3NT5A 3SYOA 2FR8C 3LY7A 4MIKA 4JBYA 5DNEA 5TC4A 5J4KA 3RU7A 4M0KA 3OLXA 4X8OA 3MAAC 3PT9A 4IZOA 4QGAA 3JWPA 3RC1A 3WGVA 3FE2A 4TXNA 1MIOB 4FI3F 4IJUA 1P44A 2PWYA 4ZV7A 4S3MA 4KDEA 4KP7A 5AKKA 4I4LA 2DFKB 4UUJC 1L8DA 1XAGA 3Q88A 1XNRB 4IRMA 4JI8O 2F43B 4RD0A 4UCFA 3CX3A 2VCEA 4YJ3F 3QFRA 4RX1A 2NQ2C 2Z5FA 3FNBA 1NXVA 3BK2A 5IN5A 4U7TB 5JROA 3LHIA 3N1UA 4RQUA 4Z5XA 3ONWA 2VWHA 4U9UA 4LY3A 3R6TA 4DUPA 1OFUA 2JVIA 4FJ1A 5FLEX 2XGMA 5DBGA 1SRRA 1EFRA 3C5HA 4RJ2A 2NIPA 3PHJA 1PSDA 3TMKA 3NYWA 4L74A 4KODA 1C7EA 2W37A 3BTVA 4DWJA 4UDNA 5J63A 1QGUB 3G02A 1PK9A 1YVEI 4WCDA 2R7AA 3DTVB 3G79A 1DKMA 2JIZG 2FYUH 5COQA 3I1FA 5HIJA 3ZJTA 2OBCA 1T5SA 4ONEA 4JBLA 1Y81A 3S3XA 1ONBA 3VU9B 4BOYA 3B7WA 1KEWA 1OYWA 1QO0A 5JMPA 2BOCC 2IQ5A 4U2BA 5K0ZA 4OCNB 2OBYA 2CCJA 4HWGA 4L9AA 4FVMA 4XDLA 1NTRA 1R0KA 3AM4A 4UNQA 1AJEA 4EEZA 2FFBA 2XMGA 3TAUA 3TIVA 9GPBA 3AXSA 4HB4A 1GYQA 4XUGB 4RIEA 5KNBA 1I08A 2HVVA 4FWIB 1MB9A 1TVEA 1YR1A 3QFFA 5LA6A 1Z5NA 3GLRA 4LW8A 5E1OA 2UZ1A 2B5WA 1X9GA 2F8LA 4BFUA 3W2HA 2YN4A 4WASA 3TW8B 5JQGF 4W5RA 3D0QA 1NR5A 1FCJA 1RRVA 3PDCA 4LSWA 4AK9A 3UW3A 1CQXA 3HUUA 4JLWA 1QPZA 3HBAA 3I2HA 3WYEA 1E2PA 3QK7A 3ML0A 5FNVB 1CT9A 3E86A 1R0CA 1XEFA 4B4UA 4EG5A 2VJBA 2MR5A 3QBJA 4LJ4A 5F64A 4NDNE 1WCYA 2D2EA 3TG8A 1G20E 1GVNB 1W9HA 4OL0A 3QI7A 1PV0A 2KM1A 4PEVA 2C29D 3ND6A 1QS0B 2IC5A 3L4BA 3RWBA 2CC2A 3OBBA 3D3WA 2BPOA 4HDMA 1EXNA 1U2QA 4MVMA 2G7ZA 2NUPA 2PWPA 3G2KA 3BCHA 4X5OA 4B5LA 3C24A 1Q1NA 2XWSA 2PKQO 3IQZA 1QE0A 1KVQA 3LQQA 3QJYA 3SJZA 1Z6PA 1Q7BA 1L8AA 3KZOA 3QVKA 1U99A 2RGYA 3ANNA 2V03A 4RGBA 4CH3A 4YS6A 4OLBA 1CZNA 2EIKC 3HBLA 1YI0A 2QPAA 3P0RA 4RO2A 2YIMA 2ZK7A 1I1QB 2XRMA 3O26A 4I1OA 4R4JA 4Y6LA 2H0RA 1BOFA 3KUCA 2BFNA 2GJ8A 4OJTA 3SVZA 2GTSA 1AKMA 1EUYA 2H65A 1E9CA 4LC0A 4HQRA 1SCJA 2QLFA 4QXQA 4HNVA 1XPOA 1EFUA 2XOKG 2VDMB 5G4KB 5HS4A 3OU2A 3ZDQA 2GSMB 2XVXA 4F46A 3D81A 3GAAA 3X1KA 3FKQA 1KZ9A 2YZMA 4RENA 4PPYA 2DLNA 2ZIXB 4GEKA 4FFNA 2ZYIA 3R0ZA 3KR1A 5F35A 2W6ZA 3DGEC 3ZQJA 1PI3A 4B7UA 1JE1A 4BNDA 3SF8B 3LDFA 3FFQA 3EQ8A 3NC1C 3QHAA 4PS0A 1FU4A 1Z4LA 1IZ9A 2TMYA 1ZONA 3GDWA 5H8WA 2R4QA 2QJFA 3KM0A 1E99A 3DE7X 5DCUA 2BFPA 2YIAA 4XPIB 4BFVA 1H1LB 3F2IA 4WXYB 1AH2A 1HNZB 1EG2A 1Y37A 1TMOA 1GFZA 3DCJA 3GRZA 4DCGA 5DLPA 1SU7A 3ADCA 3I01M 5KEIA 1AOXA 3H6HA 3JQCA 4K5QA 1L5SA 2QE7G 3Q3IA 3MJEA 5BQXA 3OM1A 4NCBA 3LL7A 4OLAA 2I2XB 1K86A 3F7OA 3I1JA 4AHCA 4MVJH 5TEVA 3QLVA 1SS3A 1XTRA 2FWJA 4R54A 3DZ8A 1RKQA 3L5OA 3LDEA 5I8ZA 2XGSA 3BM5A 3RYHB 1UX0A 4Z9YA 2VJDA 3OT5A 4BTEA 4BFLA 4N01A 1CY7A 4OBWA 3NBZC 1L3IA 5TRTA 3KUKA 1J5XA 1FS4A 1PR2A 1XTUA 5FPQA 4EY5A 1HF3A 3DBHB 2AK2A 1TU0A 3IOYA 5D51S 3M7MX 2DAPA 2ZJ4A 4H18A 5B57C 4CL2A 4GKJO 5JYCA 5DFAA 3TXQA 2ZJAA 3HCPA 3ABUA 1G7SA 1DIOB 2KSQA 4S35A 3FLBA 1ORQC 1S9HA 1J56A 1PL7A 1XEWY 2FG6C 2WWWA 2JAWA 1THTA 4P2GA 1L5HA 2RI1A 5L3EA 4PLPA 3GYGA 4QATA 4WNCA 5AW4A 5DN6G 2NSLA 4B76A 3UKMA 3IAHA 1MW8X 4RTJA 4NH4A 4YAJA 4EK9A 4LFAO 2R4UA 5L3SB 1EQUA 3FAVB 5A9GA 2AOTA 2B83A 2W4QA 3IMGA 3NR7A 1UWCA 4IG9A 1ORRA 3ZHUA 3AVPA 3NIFB 4J6FA 3LSUA 3T12A 4AUKA 2JAUA 1DBWA 2O0KA 4OQDA 5IAAA 4M0FA 4JP3A 1N5OX 5AW3A 1A9YA 1RJFA 1YRLA 3I39X 2B21A 5E4YA 2GAAA 4BKUA 2COKA 1ZGAA 4II3A 2OCLA 2EFGA 2GRAA 2JAPA 3I04A 2O1EA 4PANA 3VDMA 3CC4V 1LJUA 5I47A 3TCKA 1MO3A 2Z3GA 2XT6A 3HBFA 4UNPA 5H4GA 1ONNA 3A58B 4J76A 1R64A 4TL8A 1K4CC 3AF5A 4PA4A 2A67A 1FUIA 1NVAA 2GM3A 2TECE 3FSEA 1J8YF 3GD7A 2HSJA 2VP2A 2IF2A 3GEDA 4KV9A 4QSHA 4CPDA 2GD2A 1U2RA 5DV9A 4AICA 4JLDA 1NP6A 3DLHA 2EIMC 3C1TA 4KLCA 1Y4UA 5ITVA 2JPDA 1JG3A 1Z18A 1B2LA 4GZ5A 3W6ZA 5EIXA 1VG9B 4C22A 2BMJA 3MT8A 2H59A 2E1PA 2VPPA 1QHYA 4P3XA 4PYOA 2PRZA 3KOUA 5FPSA 1VHTA 1GD1O 2XMZA 1GN4A 1SZJG 4OO3A 1KZGB 4DG8A 3U11A 1E3LA 1IY1A 2W2LA 1TQ4A 5CB6A 1RM1B 1G4YB 4MSWC 1USWA 5HBGA 3D6VA 4ZVQA 3TTVA 4JN6B 5KVCA 5MFPA 1M6HA 4J07A 4X64O 3M6MD 1Z6QA 4RPIA 3T06B 3AHIA 5IBPA 1RFLA 4TKUA 2ZUWA 2PNFA 2QNBA 4DR3O 1UXOA 3A6HA 4UDOA 5BVGB 3SVLA 3ASUA 5LPNA 4NV0A 3L8ZA 1OIVA 3AR2A 4PX9A 4JI1O 4JBGA 4WLUA 5D1HA 1Z5ZA 5KU1A 1DJQA 1LQTA 3OA0A 4BZPA 4PLFA 1Y5MA 3R24A 2XUJA 4GR4A 2I4OA 2PU5A 4KGVA 2VUIB 1J7KA 4DV5O 2ZREA 4Y6RA 2BHRA 2PH3A 3P4UA 1GGHA 3C8ZA 4IO1A 3G6BA 5M2QA 3O92A 3BGWA 3IAS1 4U2CA 2YIBA 3T15A 4RJLA 2J45A 1FYFA 3IMCA 3ZGVA 4DT1B 3QF4B 3SLGA 4LY9A 1PT7A 1O6BA 2NN4A 4IRUB 3RFFA 5CBKA 1Q2XA 2X5NA 4PFQA 4TRRA 3A1TA 3UK7A 3BRCA 3V4VB 2A9QA 4CH6A 1RWPA 3K2QA 7REQB 1CR0A 1ZLXA 2Z3WA 2BBTA 1G41A 4GI2A 4YP6A 2BMWA 2HJ9A 1Z37A 2HQSA 1V39A 4BUCA 1BCCH 1ISSA 1HV8A 4E13A 5LJLA 3W9BA 3QUBA 1HY3A 4AJHA 4MQ6A 3HRHA 4EITA 2A9VA 1E2BA 1TO2E 4Q66C 1E3EA 1M0WA 3E5RA 1QZUA 1DJNA 4IV5A 2KLBA 5D7BA 3TWOA 3AZOA 5TE9A 3PJRA 3SQXA 3V4RA 1NXWA 2FPGB 1M2HA 2Y76A 4Z1MG 3CSDA 4AB1A 4HWKA 1CUHA 5TQ0B 2B30A 4ZQFA 3H0KA 2H51A 4EQZA 1IRXA 4DC0A 4WKOA 4I7EA 4RVSA 1OH5A 1DQYA 2WG1A 2QZ9A 4ABMA 4FDVA 1QQ5A 1Q5PA 3QWHA 1DAMA 4KCGA 2V3VA 2V6MA 4WHMA 1H8HA 1NX6A 5H59A 1MTZA 3OX4A 4J3JA 4EPXA 5KOIA 5KU7A 3GLFB 1VLLA 3G0BA 2JFNA 5KA6A 3UW1A 4AMUA 3CEHA 2FW8A 3SM3A 1O7JA 4CIVA 4LC1A 4BGDA 3A4TA 1KO4A 1KZ1A 2PZMA 2R84A 3W3AD 3R75A 3FRHA 4FR0A 4QOIA 3SOZA 1C8LA 4V0MA 4DKXA 4YRKA 2Q68A 3QIVA 4H7EA 4DDMA 3ZKWB 2NO9A 4H7DA 4YCNA 3TZHA 1UK7A 2BFDB 2J1LA 5CURA 3N2GA 5CHEA 2QVYX 1K7CA 3HXQA 1U1EA 1P7PA 4F6LA 5KQPA 4ZARA 5EHNA 5ES3A 4CTKA 1NTZH 1OROA 5K4HA 1JBQA 4QO8A 1V25A 1H4TA 1YRQA 2RKOA 4ZDIA 4KFCA 1NULA 3M9LA 1NLFA 1E20A 1JILA 4I6EA 4MLZA 4EP1A 1YVPA 3HJRA 2NPIA 4K9RA 1JPXA 3LOUA 3UPDA 1GPMA 4FOOA 1S2DA 4IO0A 4YEDA 4FPPA 2VJKA 4I4TB 2VJMB 4F04A 5C7YA 1UOOA 1T3ZA 5EKDA 4BB6A 2CUGA 2HK7A 2XAJA 3CJHB 1P7CA 3EYAA 3G0GA 4Q82A 3D6TB 1ZIOA 3X1XA 2WJZB 2R7KA 3MERA 1SBZA 3HH8A 4JMLA 1SIBE 2D30A 1LU9A 4MA5A 1TCCA 2J6CA 3AEUB 2H2AA 1XJ5A 2QBYB 4X71A 1CPYA 1VYVA 3O0DA 1Q90D 5AW7A 1NVFA 4GXNA 4LYJA 1XMVA 2PL9A 4ZT4A 2SNIE 3W1WA 5GONB 5KSYA 4JLBA 1JWAB 3DCIA 1DEKA 4C4RA 1OH7A 1F20A 3DE2X 3VC3A 2PY6A 4IR7A 4K7JA 4P9EA 2QZZA 3HYLA 1Q15A 4KHPO 4P5EA 3DKIA 4G65A 4I19A 1BZYA 4KZKA 3A14A 4LOAA 2AC2A 1ZRMA 3CWZA 3K8ZA 2ITDC 2F8SA 4O8YA 3SR2C 1A76A 3R4VA 2OSVA 1XDSA 1CQJB 3GJ6A 3QU9A 4C4ZA 1HA3A 4EJSC 3QKIA 1YDXA 3C4VA 2P4QA 2XUQA 1W2WB 4BLQA 5EVJA 2O96A 4JUAA 2R44A 3L0PA 5AJTA 4DA8A 4JLAA 5C93A 1GARA 2XRFA 1FVXA 3EIUA 3KG2A 5T7BA 4FJ2A 1RLUA 4ZD4A 4E2WA 1JHOA 1JR3D 4MYRA 1E59A 1BTOA 1YQEA 4HAZA 3F71A 3EY9A 2DBQA 4FHCA 4OQ4A 2A4MA 2N75A 4TM7A 1A77A 1UAYA 3FFAA 3M70A 4KO1S 1DAKA 1XKQA 4TMTA 3ZZ0A 2UV8A 4OGLA 2ZJ7A 1SKUA 2GPWA 4Y8VA 4Z0HO 1Z73A 1ZGHA 2IPAB 4Z6KA 2MMCA 1MORA 1RJGA 1U5BA 2RI6A 1R6BX 2VH2A 3CNBA 3HEBA 3HYCA 1ZD8A 3LHSA 2UXCB 1EFAA 1K8QA 1DAIA 2OCIA 3BMCA 4KPGA 2DLDA 3RFTA 1JPVA 2A30A 1UZMA 2DHRA 3KTAA 1UQUA 3CCLV 1NXQA 3FB6C 1S8OA 1V5IA 3CF4G 3AM5A 1F6DA 3QNMA 4QWWA 5HG0A 3UCEA 2Q7EA 1N7IA 2D3OW 4O1IA 4UU1A 2EX3A 1UDAA 1ZESA 1Z68A 2C5HA 2W2PA 5KJ6A 5H70A 3F74A 3SJBA 3PEYA 4DDUA 2G8LA 5FBKA 4PQEA 2A0XA 4F4FA 1IJEA 4LJLA 1P5HA 2O6HA 5KQMA 2CH7B 1G3IA 2GEFA 2PN1A 1K4DC 1XTIA 4HDNB 4G0UA 3RIYA 4X7MA 5E2AA 1C81A 4FFMA 3R7DA 4DCCA 3IDSA 2CDBA 4R8VA 1V55B 3WNQA 3TMYA 3F6CA 3IV9A 2JG3A 4E2ZA 3TVTA 4E08A 1JQ0A 2C1ZA 2VHYA 2WOOA 5D1NA 4Z4FA 3EODA 4DXHA 5EXEA 2ZT7A 3G0CA 3OE5A 1T10A 1DKNA 4I6GA 2PKRA 4PG5A 2X2FA 1DPFA 3F4BA 3QEMA 4HQ0A 4CT5A 5EJEA 1SXGA 2PZAA 3VVBA 1JECA 2EKZA 3T9FA 3DM9B 1J00A 3NGLA 4R2WA 3FOEC 2UU9O 1IUOA 5JECA 3BWMA 1VLHA 4I50F 4EBBA 5SZJA 1WLEA 3CRRA 2WKWA 4WOCA 2IDZA 3P0EA 1J22A 2E4VA 1YI2V 4GZLA 2AXQA 1V3UA 3GAZA 4YUWA 2XITA 4C76A 1KYIA 4PNZA 2IM9A 4ZI7A 1CE8A 1MZFA 2ZBFA 4L16A 1OCOB 1EPUA 3DBLB 3RAFC 2A6PA 1JFFA 1NMEA 4RLSA 5EJAA 4I9NA 4ZU3A 4XM1A 2FWPA 4DIKA 2B8WA 2Q6KA 3AIIA 1G8YA 4ZZIA 1PQWA 2BF7A 3EARA 3KLBA 2WKRA 4L8FA 2I6QA 3IUSA 4F60A 2X23A 4JT2A 3CCFA 2AN5A 3MSXA 5AVZA 2HLDA 1MNAA 3UFXB 4US1R 2WSIA 1AZWA 3MPOA 1IVSA 3JYNA 4J0CA 3SY8A 4Z1MD 1SVIA 1VMEA 3NHRA 3HFSA 3RUIA 2K87A 4P9DA 4GDMA 1ZHFA 3GPCA 1XHLA 4P4UA 5LIRA 3G0DA 1VRCA 2AW5A 4W5JA 1DTSA 5DULA 2CXNA 1J0AA 3QFTA 3WWEA 3C3KA 3K4QA 2J3KA 2FKAA 3WGLA 4FYJA 3CVVA 4E7PA 1E2HA 1N2SA 4G1EB 4OHZA 3T99A 2ZSJA 5JZMA 4BWYA 4IOKA 1RCFA 5B4VA 1GLNA 3QWAA 4FVTA 3WE7A 1YOVB 4PF1A 5JEDA 1KKUA 1WB6A 4M9XA 1M1NB 1O5TA 2IS1A 1CEYA 3OZ7A 2VCHA 4C6SA 4WJKB 1NN5A 4REMA 2QDKA 4ARCA 3KOYA 1DKOA 5FORA 3W5JA 4BN5A 2OZLB 1W5TA 4NOMA 2EKDA 3GMIA 5F78A 2E76B 3BFKA 3PHLA 4L85A 2IV3A 4CYMA 3QEMB 1R7RA 5EBWC 3RHFA 5I6DA 4DV4O 3RS2A 5IN4A 4JYBA 5CEFA 3B2QA 1HXHA 4QQFA 1B16A 1BGXT 1P0FA 1UBJS 4A0SA 3AIOA 3FH0A 4J75A 4JJFA 3QOWA 3RS7A 3TLEA 1OLUA 1UC9A 4DUGD 3K70C 4LS3A 4DYHA 3C1AA 5EK0A 1Y6JA 3OEYA 4NFYA 1VF6C 1H42A 1OR8A 3NDPA 4FKZA 2C99A 4I2NA 1P75A 3GJ8A 1QDEA 1ZY2A 2BFAA 1XEQA 3DXZA 3O9ZA 3GFPA 5GONF 1HQDA 1VPLA 4BMOB 5HJ5A 4N7BA 5JY6A 3TGPA 3ETEA 4QGFA 3AGQA 3PD7A 4IV0A 2WF5A 2VZEA 2V0CA 2C8JA 1H23A 4MRMA 1U98A 2LFRA 3IQWA 2FRVA 4IMJB 3J81N 3GLIB 5IXYA 3GLHA 3D5EA 3JRWA 2VDUE 4JZ2A 1NYRA 1PFUA 4RZ2A 4UREA 5DGXA 1WV1A 3CJQA 3JZAA 4MW9A 3AMVA 4D6XA 4MQEA 1R3KC 1SA0B 4TLCA 3P32A 1QLEB 2CTRA 3FTCA 5CA0F 5F7JA 1VG0B 4C7OB 2HR3A 1HNNA 1MFPA 1M2OA 3LM8A 2IPNA 2VHWA 1FK8A 2ZIXA 1PK7A 1N25A 4UM7A 3PC8A 2IH2A 2JRIA 3MIIA 4IUDS 3AVTA 2RONA 1VQPV 1BW9B 1QYIA 3LGAA 3DO5A 1KY3A 5AKEA 3WBJA 4EPRA 3TTWA 3W6OA 4NTYA 2CFOA 3P71T 5IJ9A 5LDGA 1Z82A 3ZWKA 3OHMA 4P7GA 2GEUA 2WYVA 3WGZA 3UENA 1OX7A 1NVPD 3HRIA 2HDWA 3R7NA 2W00A 3NTQA 1LBQA 3DFFA 1T1IA 3JAMA 1TGVA 3BSYA 4OXYA 4GDFA 4BBZA 5BWMA 4H7PA 3C3TA 5JJKA 1WXDA 3SZLA 4HNGA 1DLIA 1RBZA 1NF8A 1KQFA 2CSXA 1I33A 2FMHA 3I56V 5ICCA 4JJGA 5K2OA 5EEGA 2P4EA 2Q9AA 2FOXA 3EDCA 1UXHA 3HGMA 2VRBA 5KNLA 4UPVA 4UV8A 4PYKA 5FWXA 4DB2A 1R0SA 3MNFA 1VYTA 3WGTA 3PT5A 4DABA 2NUPB 3PIIA 3ZQ4A 2XQGA 2ZNRA 3KSMA 2H11A 3UT0A 4KQFA 3MN1A 1QHTA 4MMZB 1U28A 1KP2A 4GM1A 4M1TA 4X00A 1BYUA 1ICIA 3TSWA 4DPKA 1M2VB 1BHAA 3VJLA 4YMWA 3T7AA 3H5AA 4REQA 2WQZA 3HWRA 4RD4A 4OLHA 2PUCA 1WB8A 1X1CA 1QQCA 3KXDA 4HWTA 4IDQA 3RUEA 2FW0A 1P9RA 5BVHA 3HUDA 3HP4A 5FUQA 3V4ZA 4JTDB 2C3OA 4IGIA 1EINA 5AW9A 2Q45A 1UJ4A 4ZT5A 4IXDA 1L7XA 4MJXA 2RCYA 5B4UA 2I8AA 3VA7A 4GX0A 2ZR3A 1YRHA 3LCCA 2XNDA 3KKPA 2P41A 4OPMA 3WJ2A 5A6SA 2R60A 4B6QA 5A6VA 5F76A 1QHNA 1V47A 1AB5A 4IIJF 5FNVF 1M1KW 1E1QD 2R8EA 3AX6A 4TWZA 3SS9X 4DRXB 2CUNA 2QX9A 5A3QA 4R2KA 4QU0A 1JHVA 2Y0CA 3JQEA 4Y1GA 1KMHA 3WMGA 5INTA 3GDHA 1JLLB 2OOKA 3ACBA 3EXEA 3QXGA 3ZVMA 2ZNVA 2WZBA 3O91A 3ASYA 3R6DA 4GL4A 2UXDO 3USES 3AHEA 3U10A 1QFJA 1RYYA 1BE8A 1UEXC 1ZIYA 2GYVA 3IBSA 3NZEA 3LI2A 2J9ZB 3N5KA 3R3JA 4EMSA 5CDUA 4E5SA 2J0EA 1Z13A 1HQKA 3A3KA 4L2IB 5ADHA 2YDEA 1H66A 1NG1A 4D25A 5JWPA 1ORWA 3FPEA 3RC9A 2ZSKA 2NZJA 4BB9A 4CF5A 3ADBA 1BHSA 1IHOA 3GH1A 1AZTA 1P45A 1T3HA 4IILA 2QRLA 2ZLBA 3FTNA 4TTVA 4HSGA 1QGUA 2WR8A 3H2JA 1RHUA 1V8PA 4NBRA 2F66C 1SC6A 1YCHA 2CSUA 3E48A 3BHPA 6GPBA 4ZQBA 3VKFA 1FDUA 3U09A 4BFXA 3QX9A 3FYUC 1TM1E 4UMVA 1FSFA 3ZWPA 5JAUA 2B3TA 5JNWA 2EW1A 4DEXA 5HQTA 5EHIA 4OFZA 1N36B 3GRVA 4MPTA 3H9JA 1U9ZA 1XUQA 2UXDB 4EJ2A 4JIGA 4YRFA 3VR3D 4O8CA 1DWQA 3PUHA 3LUTB 3OFNA 5GJWC 3LTNC 2DWOA 1BWSA 5KCMA 2PKYX 4QBKA 3UMSA 1FDIA 2B2XA 7MDHA 1PL0A 3LLCA 4LVCA 4MAAA 1WKVA 1P39A 2YBEA 5AG2A 1EBBA 3HKBB 1THGA 2VH1A 4JLJA 4L57A 5B3LA 3I83A 2Y9MB 5EHZA 5TMBA 1MBZA 1DGQA 2E9SA 1N0JA 1LPNA 3IDZA 5C8YA 1K8ZB 1RBMA 2XE4A 4N3GA 4JASA 3OICA 4BMDA 2IH5A 2V1XA 4P7JA 2W2LD 2IZ6A 3DMRA 3L5KA 4PGGA 2R00A 4V0SA 1U2TA 3N53A 2O8CA 3ACCA 2OMKA 3WYDA 5I5GA 1B7GO 1I80A 3VZPA 1TMKA 3AW9A 4PC7A 2Q1XA 3FR8A 1SBYA 2VAPA 3DOEA 3LPMA 4AN1A 2Q9BA 3QI2A 1WE2A 4I4CA 1KY2A 2X14A 3GPDG 4E0QA 3CLUC 5B6PA 4KV7A 4C04A 1M1UA 3WZ2A 2QD1A 4CG1A 4D0SA 2Q6OA 1CUCA 2QLJA 1WBJB 4L2IA 3MK31 3DTNA 4QQKA 1M34E 1PJAA 1HLDA 3FDXA 3ZV3A 3FF4A 3MWLA 1BSVA 1TZBA 3ND7A 4G0MA 4HAUA 5LC1A 2WIJA 1Y6FA 1YIAA 1R4MA 1JSLA 1DLJA 3LZ6A 4RVGA 1CR4A 5LQNA 1UX1A 1AQYA 2YCLA 1GTZA 4HXYA 3F6EX 3RQIA 5KMGA 2LCFA 1QHFA 1ZOSA 3S8MA 2YJTD 3ZJYA 1VCHA 2GJSA 4F85A 1T6NA 3WGGA 2BSKA 1CRWG 1AZLA 2B0JA 3FUTA 3G2QA 4TMFA 4R0MA 5EHXA 1E1CB 1NXPA 3KP1A 3M89A 4GOXA 3AY0A 2UZAA 3LCVB 1JAZA 5ITZA 1QVFU 1CCWA 1D4AA 4NBSA 5FTMA 2GESA 4CDNA 1JG2A 1KI9A 3HDHA 2FL4A 3RBZA 2J6HA 3BXFA 1QV7A 2CJFA 5MN4A 1PNTA 1ABBA 1ULHA 4JZKA 5ULLA 1GKYA 2YWDA 4ZVVA 3RRBA 1J0XO 1N5JA 1YC5A 1YJ5A 3CZRA 4FK8A 2D00A 2OGWA 4AP6A 4Q03A 4TSRA 1HLGA 3JZMA 3D7SA 4QFCA 2QUKA 1XEXA 4M0LA 3G2JA 3ZIAA 3F7YC 4AZ0B 4U5QA 5F3WB 5DMHA 2VWKA 5ALKA 1KQ3A 4QBIA 1J7JA 5EJ6A 1JX6A 4RKRA 4EMBA 1P3Y1 1GCIA 3UA4A 3M2TA 3LVBA 3Q6NA 1NIPA 3EA5A 1P17A 4CIYA 5JJLA 2R9AA 1Q16A 1JEQB 1ZCFA 2G25A 2ZI5A 3S2ZA 3TVYA 5JCOC 1G2OA 1YRAA 3L46A 1I4TD 2NMVA 2J0VA 1E6WA 4F4CA 3IAM1 1A8SA 4F8JA 1ORIA 1QH1A 4MAFA 2L82A 4ZAFA 1JTEA 3LFUA 4UFZA 1EVQA 3WRYA 2EGUA 2WTNA 4NV1A 3WWCA 1H3EA 4MS7A 1Q86W 4JI6B 4NNOA 2HLNA 3WO0A 3SR0A 2IRWA 3Q7TA 2OBNA 1BHBA 3L7AA 4DV3B 1XTZA 2VBIA 3KZXA 1U80A 3QPVA 4DNOA 1BX3A 4NPHA 5K0CA 2W6CX 4DQKA 2EJUA 1NI8A 1PGQA 3RW0A 2WU0A 4FKBA 4TZTA 5IEJA 1YGPA 4O4LF 5KYTA 1NHGA 5MN6A 2Z5UA 1ZXBA 1SQFA 1JQAA 2P5TB 2WJWA 3ZS8A 1UL1X 1SXJE 1IX9A 2VWJA 4A5UB 1IXMA 4RK7A 3MINB 4BN4A 4YQEA 2A5LA 4CXMA 1WBBA 4QULA 4TYYA 2HMUA 4D0LB 1O95A 1HUQA 2V6GA 4HVCA 2IU3A 4C0KA 3NM4A 5U9CA 4JTCB 1UZUA 4D0NA 1MA1A 3JQPA 5A62A 4P0QB 1GLGA 1G8HA 1QZ3A 3WGKA 5JAMA 1AKRA 1GM5A 2JAOA 4LNAA 1AX9A 1CWUA 1QONA 1HT3A 1WV0A 1YVRA 5D6OA 5I7FA 1IDSA 3MB8A 3LKBA 4P53A 1FRFS 1CSEE 2J6BA 2PGLA 4NVPA 4HZGA 5JPIA 1SCQA 2NVUB 4L0DA 1CQWA 3ULKA 4A8PA 3VOTA 2PTHA 1WJZA 2NZUG 5LNK6 1NT2B 2IXBA 5DSTA 4RD3A 5JJNB 1WKBA 3EF1A 5FF9A 1AUVA 1QIGA 1QRDA 4FMPA 4JELA 4UTXA 1QYXA 1EE2A 2CEKA 5T64A 3WLSA 3D6FA 1H2YA 2VKQA 3G8DA 4K05A 1Y6XA 4N6GA 4RK4A 2X3FA 2IKQA 2F43G 3L41A 4EHHA 4RTPA 2Z6AA 1WL8A 4ROTA 5AHRA 5CB0A 1OZ0A 1XRMA 5J2TB 4XQ0A 4Y0AA 5H2FZ 1NW6A 3VTAA 5SY6A 4XCVA 2LXNA 1YS9A 1NUHA 4MSJA 3PCTA 4G9GA 3TEFA 3H17A 4C7XA 1CQPA 1JKJB 3TZQA 3UV3A 1QF7A 1R5NA 2QR3A 3MJVA 5FJIA 2PYIA 3BJRA 3GUCA 4BO0A 2NVWA 4DZTA 5DNDA 2JK0A 4AFNA 2BM1A 3JWJA 3UAWA 3GB7C 2QTSA 3D3IA 1CY1A 3TNYA 2O19A 3KTDA 5FR2A 3T7TA 4ZMRA 1ZH2A 3IPCA 2GUGA 4PAGA 2R6HA 4BNMA 3TXXA 2WKSA 1DAPA 1Z08A 2QMYA 4HYEA 1GRVA 3GWOA 1WKCA 4C3VA 4F5DA 4MWBA 2KPOA 3TJMA 4B71A 1EVYA 1SCKA 1TYBE 4B3MB 2P2NA 4NK4A 3QNEA 1M34B 2O20A 2PYZA 3DVLA 3GF4A 3JPYA 2WRZA 4N6NA 3HB3B 4RWZA 3VDRA 1IZ0A 1JEOA 2B4YA 2V65A 3PPXA 4QU5A 1U1FA 4OMUA 1GCGA 4OHKA 2B69A 3E7WA 3T3DA 4J1SA 3TOCA 1AUXA 2F3UA 1ESDA 821PA 3OR7C 3K9HA 2P5YA 3AEUA 3OT1A 4IP0A 4JZYA 2PUBA 1OV6A 1TK2A 4ITUA 1JH8A 4KU4A 1WCWA 5B1DA 2UUOA 2HSGA 3NEJA 2X0FA 3V6MA 3VDNB 5DT9A 4PSCA 4E2FA 2C2YA 3KUDA 5FTWA 4E70A 2O3SA 1NUAA 5IT5A 2VDNB 2Q4BA 5ESXA 1GUBA 4G1FA 1PIWA 3T95A 1KOGA 1NI3A 4P81A 3U3RA 1LXCA 4AS2A 2GDJA 2VA8A 3A1CA 3GZ4A 2EG9A 4Z1MA 3N58A 4W9NC 3EUWA 4QELA 5FBQB 1H5QA 2P11A 4LYDA 4FGJA 3ZHXA 2REBA 2OV8A 1Y76B 1ISHA 4RU1A 3VYTB 3PFKA 4BVEA 1EM1A 1BX0A 1WM1A 3P9XA 1Z5WA 1RLOA 5L3BA 2YV2A 3CB4A 3DXYA 4P3PA 4DYDA 3HN2A 5GINE 3OOHA 2NGRA 1PFQA 2DFVA 5FHRA 4MWDA 3JQRA 1QOZA 2FZLA 3E8MA 1WUIS 3GLVA 1DWOA 2PUFA 1A9XB 5CB4B 2R5NA 3C41J 1WN7A 3CZ9A 3MXOA 3EXEB 4LDQA 4XB6B 1YACA 3R0IA 1H3NA 1RHQA 2RH5A 4ZICA 3DZKA 3AHJA 4JI2O 3IQHX 2O06A 2YQ4A 3FF1A 1NJ1A 2I7CA 2KX7A 3I64A 4GAEA 2D2FA 4RZUA 3ZGOA 4A6PA 3RYCB 4E2XA 1KL7A 4AUMA 3WK4A 2GI4A 3W7UA 2IYWA 3U26A 3U4QB 3OTOO 5IZCC 2AEJA 3V5NA 2LTAA 4KO8A 3SIRA 1N2GA 1LC3A 1NXOA 2VRWA 2E1RA 5DP2A 4ZVSA 3LDUA 1GL9B 3ND9A 2IEIA 3Q8MA 4RK1A 1VP7A 3H9BA 1T5BA 3NBQA 4I4IA 1X9HA 1SZDA 4BE4A 2EKBA 3OLYA 1SIUA 4C14A 4FEYA 3N7AA 2IOFA 4NLLA 3OJEA 5ETJA 4BAGA 1CUEA 1XCMA 5M52C 1OIXA 3EN0A 3A0RA 2QM0A 2PXCA 1FD9A 4E5KA 2GR9A 1WHSA 1E9EA 5C8VA 2R2AA 1BU5A 2IF0A 2XH8A 3FNEA 1JHMA 2QK4A 2DFNA 3OCUA 4X6XA 5K6AA 3E8XA 5KOHA 3P3NA 1XQ1A 2QI9F 3ZU3A 1G2QA 3OZSA 4KXVA 3EVFA 4LWZA 4JAUA 3OJ0A 2MK3A 4B31A 3GPLA 3MAQA 1DKLA 4C3UA 5EQDA 1BRTA 2ZTHA 1KXZA 5DGIA 1W1UA 3VNQA 4CCYA 5LHIA 3KVYA 2C1EA 4QXRA 2WZDA 2QN2A 4C4PA 1J97A 4LF7O 1H1TA 3U1BA 1JKJA 1IAVA 1ZD4A 2LW1A 2UZ0A 2V55B 2XZPA 4FLMA 5KYUA 5KYKA 3L6UA 3JX9A 1ZLZA 1FLDA 4EFDA 1FSSA 3JQ7A 1AJQA 2QMHA 3JCUZ 3UFBA 4FFRA 4IVNA 5CW6A 3IC9A 3ABKB 1LJLA 4A8JC 5CXSA 3SHWA 1DKRA 3BCSA 2BRUA 2VPWA 3WLLA 1QTIA 3V7UA 1U0JA 1RZRD 3R41A 2MMGA 3Q2KA 1A97A 2WILA 5AK5A 1UMBB 2ZRCA 4EKYA 3NIGB 3K1ZA 4BN0A 4BO8A 4JYAB 1S8FA 4E11A 4LF5O 5GMOA 1QLNA 4ACBA 4O4LB 3NCHA 4DBVO 4A0HA 2INGX 2MYUA 3DP7A 4XWOA 5M34A 2OMEA 3NH9A 4QE9A 4H0FA 2WD7B 4ZGBA 1TT5B 2CBZA 2QTFA 2VTEA 3OLWA 2FOIA 3KZCA 1TZKA 2F62A 4LY6A 4XTCS 4QE7A 4XB2A 1YTFB 1TAHA 1RP7A 3ZHTA 2R3SA 4JVNA 5IJXA 1V54B 4UUNA 3AG2C 2DEUA 5LLTA 4OK5A 3HY3A 2O3TA 4XGIA 5JLAA 1O95C 4YLYA 4MINA 4CLRA 1QP0A 1UEJA 5T8KC 1ECBA 1W93A 4J7KA 3FAZA 5B7NA 5LB4A 1ODLA 3U7EB 2P2ZA 2IUEA 2AFIB 4WUTA 1JR2A 1KMQA 1OGJA 1HE1C 2OWOA 3M1YA 3I9LA 3PE6A 4OSOA 1CTUA 3HSYA 4Z8XA 2AGAA 1E8DA 1H3FA 2EZTA 2Y1WA 1QE3A 4LJAA 4QT0A 5D87A 4H08A 4KFRA 2FXVA 1J06A 3DOUA 3NYRA 4IVQA 1X7XB 1CQIA 3FW1A 5JCPA 1QFYA 5G3ZA 2K7ZA 1T9HA 2XADA 3FCOA 3JSNA 1KYWA 1M57B 3IKTA 3VR6A 1P60A 4A36A 2H63A 4FDLA 4LHVA 3RGGA 4TM8A 4INAA 4YXWD 1X1EA 5CCEA 2VATA 4Q4CA 1GAJA 2D54A 4IFIA 3TIIA 4HRQA 4QPNA 4A82A 1TZCA 1O94D 3SZOA 1OW3B 1LS6A 5TXGA 5JCZA 3D4NA 2DYSC 3WMFA 4P2ZA 1DX6A 1ETUA 2YFKA 1ID1A 2DFTA 2PX2A 2QDOA 4K26A 3PXGA 4DOMA 1O0BA 1FMTA 2QX6A 3WKEA 2DPGA 4GR9A 3QTTA 2CXRA 1Y4SA 1M4UA 4NZYA 4ZYYA 3PFCA 5SYNA 3DC5A 2AWNA 3LMKA 4ZYZA 1LR1A 2NXJA 2HN9A 4H13B 1X14A 2ADQB 1BGVA 2Q50A 3K79A 2GARA 2QUIA 1Q3KA 2I22A 5FOTA 2J9YB 5KQLA 5H1YA 3IURA 3NFYA 2C03A 4A9AA 3NDIA 1JR4A 4DY6A 4DV1O 4ND3A 1FNDA 5AW6A 2D7JA 2G6VA 3GNLA 3R1IA 1H5NA 4BIUA 1ILEA 1RU3A 1E3TA 4CIDA 3E2EA 3IP3A 4WLEA 1DTEA 5DHSA 5F7ZA 3DEYX 3QSGA 3NIWA 4KH1A 3VPFA 3SS7X 4N7MA 1Z0DA 1E79D 1JEAA 5DEDA 1FP4A 3JQAB 3NS7A 2O9JA 1RKBA 4H17A 4B4DA 1JALA 3FNIA 3HB4X 1YV9A 1XDCA 4RXMA 1UJ5A 5CA3A 2WA3A 3CINA 2D1TA 5CDFE 1M1YE 2XTMA 1WHTB 2QR2A 4DUYB 1D6SA 4BUZA 3HU5A 4Y2XA 3NGXA 5ARDA 4R8CA 2IDJA 3ZZTA 2QBYA 3UO2A 4POOA 4DTCA 2HJWA 4GE0A 1KYVA 3U19A 2IXTA 3COJA 2YIVX 1RAHA 1OX4A 5GAOA 3X2FA 1LTQA 1UOPA 4YHBA 1I3CA 1X42A 3THRA 2XCOA 1UT5A 4I55A 4IL6Z 1PT8A 1ESCA 1U31A 1YU6A 2QPLA 1ULTA 2FPPA 4OHXA 5CR9A 5CVEA 4J0GA 5I7HA 2YOGA 4GMHA 1KQGA 4TYWA 3ED5A 3QFSA 3KCNA 3T8YA 4WLNA 3WWZA 1UWLA 5BNIA 4L4RA 1PR4A 1Q83A 4BZZA 4PV1B 3ZEDA 3QF4A 3WK8A 4F45A 2AJBA 2K2WA 1S4QA 3R6WA 2IT1A 3HI6A 4N5DA 4TMVA 1TIPA 1L5MA 4MB2A 3H1JH 1AJNA 3VX4A 4ZD5A 4BCBA 2QAJA 2CKDA 1FX0A 5THKA 2GN8A 5UKDA 4MTFA 3UC5A 3RVZA 3B6KA 4J90A 3H2SA 3Q5DA 2LFSA 4G3XA 4J7JA 4JFAA 4MNTA 4TROA 2P9QA 1KQOA 4DJTA 2CTWA 2MSKA 3STLC 1ZDMA 4QOGA 3TLYA 4DCNA 5ECWA 5BSKA 1T6YA 4ETIA 4OV6B 5HF6A 1WEKA 3I30X 4Z4QA 2R1ZA 4BZXA 3GWKC 2GD6A 4GQBA 4HSEA 2JGIA 1TQDA 3DEZA 3KZVA 1RJEA 1DELA 4QUGA 4X1OA 5JQWA 1L2TA 3PC2A 2NU9B 4CTMA 1VEWA 1RHKA 3CIOA 3AP1A 3G23A 3UH1A 3U9SA 5C80A 3SE7A 1KPIA 1W46A 2RC5A 1N4DA 2AD1A 4N8SA 1WF3A 4BE9A 3GEMA 2AJDA 3ER9A 1QYWA 3CEIA 4IIUA 4BNDB 2GJ4A 3GVMA 2PQ6A 5L7YA 1J0DA 3R5FA 4JBIA 4R9SA 1I2AA 2PHZA 1GPAA 1CR2A 3NRJA 1B3RA 1D2RA 1WEHA 4QDUA 4BWGA 4MLPA 2GSDA 2IUTA 4U7WA 3PRYA 1KWGA 4NKGB 1CDEA 5D84A 1Q43A 5JS1A 1E7MA 2CUKA 4EJSA 1FA9A 3HSSA 2C2KA 3I6QA 3S8EA 3N05A 3GLSA 3VPGA 3WFJA 1AXEA 2J59A 2TMDA 2QS9A 2VT3A 2FPXA 3ESZA 1H69A 2KG7A 3HFJA 5ELXA 4RTNA 3B3GA 3ZY4A 1TUEB 2YKGA 2GVNA 1L5GB 4A2PA 4MCHA 5JOQA 5CBGA 4X89A 1ZN8A 3FWPA 3GYBA 3PGVA 2RAVA 2VT2A 2P9HA 4FLEA 4MQ4A 3LVFO 1E4VA 1EN5A 1JG7A 1Y1TA 1P7BA 3A11A 3MRVA 4V24A 4ZAGA 3WMRA 5HOQA 1G0OA 3B2EA 3JAKA 1FY2A 3HM2A 4ZT6A 1K68A 5TPWB 3TN7A 4F8YA 3PEFA 3AJDA 2J32A 3MS2A 4WFIA 4N9WA 3MSCA 2CNKA 4Q16A 3W5CA 1R8SA 2RFLA 5KOYA 1VKRA 2FW1A 2XMDA 2NU6A 2AG8A 1PV1A 2BRUC 3GV0A 4KXUA 2ALJA 1C2YA 3CZPA 2HWKA 4U7DA 3U81A 2YWGA 3FIUA 1J8MF 3LOQA 3AB8A 1FUYB 2D2IA 5H5JA 2ZUFA 2NT3A 5JSZB 2KCQA 3RCBA 5KHHA 2WPNA 3F90A 4AJLA 3ZHSA 4GCZA 1VKZA 4IMIB 3WB1A 1ZUIA 4RANA 3ZBHA 2G67A 5CJJA 3RUCA 4R1MA 3TRHA 2VKTA 1DO2A 1K8YB 1M2EA 3GJXC 1JEJA 1OI3A 1XWIA 3OP4A 4PYMA 4Y0NA 1O08A 3EX7C 1HDXA 3IPXA 1VIBA 1Q11A 3DL4A 3W04A 4Q3NA 2AYYA 4EYEA 1O8CA 4KMRA 3ZK9A 2HF2A 3CUUA 2Y66A 3UXEA 4YRBA 3REQB 3SR3A 2JGKA 3PVZA 2KB1A 3QX7A 3TLGA 4A4DA 1MTOA 2VN8A 4JK3A 3H9VA 1GZDA 1OI4A 1T5LA 4GIBA 1LDGA 2K4MA 4B44A 2OBXA 4JT4A 2EFYA 4GUNA 2B99A 2Y69C 2AA3A 1M74A 4DR7O 2C5BA 2PKXA 2J5RA 4EFBA 1QVAA 2R1TA 1QVGU 3EVGA 5LUBA 3WMEA 4JI5O 1Z2DA 3GCGA 3ZXSA 1QV6A 5E9AA 2CLFB 2B4AA 3FMPB 4LXQA 1I2ZA 1FTGA 2ZIVB 2NVBA 2QV0A 2C2AA 3CSSA 4OYYA 2F4VO 2ONJA 1O77A 1N9GB 3TIGA 2W93A 2R6AA 4RFSA 1YFKA 5I3ZA 4OBBA 4FD3A 3WV4A 5E1MA 4N39A 1M1ZA 3DTVA 1YDGA 2LP7A 1SU4A 2G3YA 2HLPA 2NU7A 1R3JC 2WLMA 1C0PA 1VPWA 2H4FA 3ZHOA 1U7UA 1ZI8A 3KWLA 1XPJA 1J42A 1VSVA 1IB6A 3KLOA 3CYFA 3E61A 4RL6A 5CM2Z 1EDZA 4GKKO 3FWHA 3U0ZA 4FLUA 3MWYW 3G71V 1PN3A 3SPXA 3BA8A 1B1AA 5CP8A 2PX3A 1F06A 4DR7B 3E58A 4K28A 3UICA 1JSXA 4F56A 4FMDF 1BXZA 4PC2A 5LGTA 1PFVA 1SC9A 2WOJA 3E03A 1IIRA 4DQDA 4YAGA 1DC3A 5AM0A 3CC7V 1X7HA 3BCCH 2XLBA 3KR0A 3AF6A 2EARA 3HPRA 2E2WA 2G36A 1SBQA 2QM3A 3CW2A 2HA4A 1CX9B 3DP9A 1LSSA 3M5PA 4X97A 4C5CA 2F1RA 5A06A 4EUFA 1QTRA 1PKXA 2GZ2A 2VJQA 2ORED 1FE8A 4L7VA 1MRNA 5CAEB 3PZBA 3OHPA 3ZWQA 2PBRA 2C95A 2XZDA 5LNK1 4RZXA 3HO6A 3WLNA 2OGSA 5L45A 3ZK8A 1M67A 1ROPA 4FM2A 1J07A 1R4NA 3OUZA 2JIZD 3RKUA 1I0LA 1NJ6A 4J2HA 3S3TA 2RNBA 2NXWA 4HX2A 4PFSA 2O8DB 2G63A 1DRJA 5C4MA 5JH7A 1HRKA 3FYDA 3S2GA 1PNRA 1NVUQ 5AT1A 2D0IA 4ER5A 4ZAXA 4A6DA 1GPDG 1MF7A 2ZT8A 1DFIA 4ZVMA 4EECA 4IGKA 1MQ9A 4LYAA 3WRYC 4A1OA 5C32A 5LJIA 1YZHA 5EXPA 3DMDA 4ZVPA 5LP6A 3L8MA 4HZIA 1NBIA 5CU7A 3OEHD 1IG3A 4AO8A 4TVKA 5TIIA 4UTNA 1Q81W 2P9CA 5EIEA 1LQUA 5K45A 4KXQA 1W36C 2CJYA 4GVPA 4BPBA 3OTGA 3QVUA 3R9XA 1HQYE 3PUVA 3TUIC 4B0OA 3LP5A 1FSGA 4TMZA 3RYFA 2Q8VA 1GU1A 1LK5A 2UXNA 1MDFA 1QLHA 1UPAA 1Z0IA 2C5EA 2GNOA 2HMSA 2NTNA 2W9XA 3O4VA 4IUYA 4B43A 1DXQA 3ZD9A 2YICA 4FU0A 1GG9A 3AUUA 3KZNA 2I4NA 3IQEA 2FRDA 2GFIA 3L82B 5FL7D 1T0UA 2XCIA 4UEQA 5AM2A 5C51B 2XIQA 1CY0A 1MHTA 3F67A 1SKYB 3ADOA 1C7JA 1ZXXA 1IK4A 1YBAA 1Z6AA 5LQSA 1EU1A 5TX7A 5JJ5A 4JB3A 3TQSA 1AJPA 1R4NB 1VL1A 2R8RA 3H3FA 4OQPA 4BIOA 1RQ2A 2QSUA 5EJMA 4L28A 3V7FA 3BIXA 2JD0A 3K59A 1QGOA 3LPCA 3V2HA 2I66A 3JY6A 4GE3A 4GI1A 4GWKA 1DJLA 2ZB2A 4QYIA 1Y3AA 5TMPA 1EZ4A 2WSSA 4HLUC 4F97A 1Z8HA 2CVPA 2YZ7A 1KKDA 2QWRB 2ZU0C 5AVRA 3WQQA 2BEJA 1KMCA 1N0WA 3ASNC 2FUKA 2OAP1 3VAAA 2CE4A 1B8VA 4XDGA 5HE8A 4HLCA 1ELOA 1JFSA 5K8UA 2ZITA 4QYSA 4YC7A 3C3MA 2JEXA 1XTQA 2HBRA 3KYBA 2JIQA 1EZVH 1E77A 3PR3A 5FL7G 5CRIA 2AXNA 1GITA 1KBQA 1AS2A 1EK1A 3PDUA 2KWIA 1OCRC 2C2HA 2WAXA 2YSUB 1PT5A 1AI4A 2PZ8A 2XMBA 1K6XA 2Q2NA 3FGOA 4JU8A 1JLRA 2BIFA 4RYDA 1M2GA 2ZYTX 1WMSA 5ITZB 4ZQIA 2CMFA 2CHVA 3A2FA 2RI0A 2H4JA 4I2VA 1Y9EA 4TT3A 1GQSA 5F1OA 2EJRA 3ZCXA 4C7KA 2HJFC 4DMLA 1D2EA 1GGFA 1GQYA 5AVQA 1Z3AA 1RAEA 3O2QB 4R41A 3M6AA 3VSCA 2XUMA 3RYIA 2OO5C 2GUZA 5ILQA 2QE7A 4OI2A 3LUDA 5D5HA 1EK6A 2JI6A 2OO7A 3GJ5A 5LYYA 3KSAC 3KQOA 4D9NA 2PUGA 1A32A 2OHOA 3GJ3A 5FUBA 4KITB 1THZA 3BA9A 4QUEA 4AJJA 1ZCJA 2UUBB 4BFZA 5KVVA 4MTGA 1FLNA 3ZX6A 1OFHA 4FFDA 1B0PA 3AVOA 2GEKA 2PA3A 4AROA 4YUYA 3NV7A 1LNQA 4PCAA 2DWDC 2Y0DA 4OYLA 5K0NA 2XCQA 1AHPA 1II9A 5DYNA 3TNJA 3QH4A 4L75A 4CIXA 4FGZA 1P0CA 2HK8A 4FLYA 2A3NA 3FHTA 2M1XA 1KY5A 4EEQA 4ZPJA 4MUGA 1GXSA 1NVGA 5HGJA 2VXBA 4G3MA 3IPYA 3NG1A 3TX6A 4BQIA 5FL3A 3SPGA 1I4EB 2QT9A 3AUFA 4G1CA 4G41A 3TLZA 3W5UA 4BV3A 2XT9A 1WUYA 2Q1SA 2HPVA 3CCCA 2BHLA 1T3SA 4B4KA 1BXGA 4GKAA 4N03A 3VZDA 4YROA 1ZO8A 2R8BA 1OI7A 1PFGA 4KH0A 3ROQA 1FFDA 3CBGA 1QKIA 1J24A 1IL0A 4MGEA 3UK1A 2H1IA 5J23A 4OATA 3T1QA 2ZYDA 5TF4A 4A2WA 1FRVA 5DE3A 4F6CA 2CAZC 5SZIA 1YS7A 4FTWA 2JGRA 4ALLA 4ZMSA 3L4KA 2ATEA 2B37A 4C3ZA 3QE2A 4PS1A 3OD1A 4CIAA 1EBFA 1X39A 2GTAA 2QRNA 2QVXX 3R0VA 4AJ2A 5KNDH 1P3JA 3FYSA 4OVKA 3E9ZA 2XQFA 1CUBA 1LFAA 3FWNA 4MUEA 2YXBA 3OEEA 4OAPA 4YX9A 2G1JA 2GZRA 5AKGA 4DCVA 3A36A 4DCUA 3R3SA 1MB0A 4XTRA 1OAOA 2CZCA 5HFAA 4EI7A 1ODFA 2BMDA 1IATA 2I3ZA 4NPAA 1IU9A 2CW5A 2OESA 3AU9A 2P8RA 2ZETA 1YE3A 3II6X 3UVEA 3HXMA 4EJSB 1XOUA 4YA6A 2RHWA 4XQCA 3GEHA 2UZ4A 1FNCA 3UBMA 1OBVA 4EPWA 4YCBA 4JY7A 5KC8A 4MROA 5DXJA 3PDIB 4FZ3A 1Z12A 3N86A 3MGBA 5C3UA 5EIFA 2DKFA 1ZUD1 2AFIA 4EJFA 1XAHA 4PXSA 3WMXA 1NT2A 3DUWA 2VF7A 1ADFA 3B89A 4Q7EA 1NQUA 3UJNA 1CXZB 2HC9A 2OYQA 3ONDA 5EIAA 4F7DA 1XQ6A 4R9VA 2NT4A 1NZFA 1XU9A 2XCRB 1WHSB 2ZTUA 5G0UA 1KOLA 2WINI 2QD4A 3PXDA 4TV9A 1SKYE 3AJEA 3B51X 3GFFA 5EFOA 1AO3A 5JTTA 1VSQA 3VH3A 5AICA 2J3IA 4NDAA 2BJVA 1QHHB 3AERA 4R5MA 5IK2A 3RV4A 3MJHA 3U7QB 1KD1W 1UC5B 1TFRA 1XQ9A 2QTOA 5EJ2A 2X0JA 4RLHA 3NBUA 4LISA 2BZ0A 3J81k 2XUDA 3PHGA 4M8IA 3EXIB 3EXG2 1L0NH 2ODPA 3G9TA 3PLNA 4Y6QA 1LBTA 2I2FA 3KV1A 3FHOA 3RRYA 2J3DA 3CZ4A 3INTA 1DX4A 4RO0A 4C6HA 1FVFA 2BV3A 3S7ZA 5FAKA 2XQIA 4EEXA 1SHZA 1JFVA 4D1YA 3SU8A 4KQ9A 5AJVB 3RRNA 4QZVA 4M0DA 2A79B 4KPYA 2QT0A 1HLFA 4RL4A 5GADl 4V0NA 3KU4A 4PX5A 4ML3A 2SBTA 4YRZA 2FKNA 1E63A 5E7QA 1ZCZA 4HV4A 4D3SA 3DXRB 1GZ4A 4ETWA 2BKVA 1RQXA 2TMKA 2FPPB 3V8EA 4E03A 3G0HA 2YR0A 5DNVA 3KHSA 2BDTA 3KB6A 5TPZA 4F71A 2E37A 1R15A 3DOIA 1EJ6A 3KQNA 3QXSA 2G1PA 2X5XA 1P4SA 3DF9A 2XF8A 4B45A 1NFRA 1MZVA 4MARA 2GJ9A 4XUCA 5E79Z 4K9OA 4PZ0A 3VH4A 3OD5A 3CJRA 1Y48E 4KEAA 5DMXA 3TJZA 2QNRA 3RJZA 1HE3A 2MWMA 4NZOA 5PGMA 4BP8A 1SQVH 2ON6A 3NDBB 3ONFA 4WQMA 1T4BA 5KAMA 4DSAA 1KAOA 3BKXA 2NU7B 2ZE7A 2WLSA 4FUQA 1TGYA 5E95A 2D5IA 3CZCA 5CT9A 2RGEA 4HLUA 4V3CA 5ITSA 1XZDA 5ALIA 221PA 3DE4X 1XL6A 1EX1A 4UHEA 2WLHA 3ZRSA 1MLDA 4GRAA 1V0JA 2IJJA 4YP0A 5FNZA 1R3DA 3JARA 2B3DA 3CCVV 5JCOA 1QCEA 1KBZA 2ZQYA 3CRCA 3NRCA 4HP8A 3T3OA 1N1EA 1U1GA 4G23A 3GAFA 2WYUA 4P3YA 1LBIA 1T43A 5D5PA 2X19A 4PC1A 3ZBQA 4GI7A 4ID3A 4RKQA 2PMWB 3L1IA 4A8HA 4BQOA 4C1BA 2CNDA 3HWSA 3KR2A 1A27A 5FOXA 1N5KA 2HJHA 2C04A 5AI5A 2EKQA 1JPJA 2GM9A 2PM8A 1E60A 1Q1ZA 1V9CA 4OSPA 4PM4A 2DC1A 3THSA 2IEBA 3BHIA 1SJ9A 4RC9A 5JRZA 2X3YA 3NO4A 4GP6A 4AF7A 4TQUS 5IE9A 1N33O 1CLEA 1CS0A 2FTKE 1W8IA 1WPXA 3HZRA 2CNBA 5KYWA 3N75A 2HCFA 2DLCX 3E4DA 2IOHA 5J4LA 3HY4A 3IO3A 4B85A 5IW8A 4DE5A 4XCQA 4OGFA 1ANKA 2CFCA 3A9CA 4LZOA 2AR0A 3TO5A 5KNCA 2ZYSA 1VJGA 2VS1A 4D9FA 1XZKA 3O90A 4XW2A 1NJGA 2Q62A 3SE0A 2W2OA 3DXXA 3MWJA 4JSRA 2WHPA 4XIJA 4FGSA 4NAHA 1KI6A 3MLAA 1SXIA 4KN8A 4AZSA 4F06A 4GYJA 4ZEVA 1BHQ1 3R20A 5HKKA 3PXXA 3OEEG 1VQMV 1ND6A 3NXKA 1M10A 3ELUA 3RABA 3E83A 3UXYA 4FIDA 4QQNA 3IFXA 3VZSA 3SSOA 4AYWA 2CJWA 4RD1A 1OCCC 1I1OA 2O3QA 4C21A 1Q7RA 1U0EA 3LW7A 2PKCA 4JAAA 4DUZB 3B20A 1G291 1UKZA 1Z07A 5A3VA 3X2SA 5SY9A 5G02A 1PEYA 3LNMB 2G5GX 3GL9A 3K2EA 1NE2A 1XX6A 1P84F 2VSFA 1V5FA 2GBLA 1AHHA 4L8JA 1KI1A 2CXUA 4BNNA 4D3ZA 2CMKA 3NKLA 5K3DA 5BNTA 1H2LA 1SVWA 3CPEA 4OFBA 3A4LA 4B82A 1BRMA 4QEDA 3PVSA 2CKMA 2D1QA 2FZCA 4TWBA 3CG0A 4UU8A 3E18A 3MJ4A 4HLDA 4NYIQ 4PVCA 2JLZA 1SCIA 4HNAB 4FB4A 2R1TB 3EPPA 2VQEO 4GZ6A 4EOGA 5JJEB 4OI0A 1A9ZA 2I2DA 4U0KA 3JWEA 3PC3A 1F12A 4G25A 4LDRA 4PLHA 1Z0KA 4IOLA 3T41A 1KQNA 2HX1A 3HU2A 3VSEA 2I6SA 4N54A 2I29A 3AETB 1QDLB 1NR7A 2CDYA 2R65A 5TB5A 4BNZA 1UKEA 2YS7A 4IW3B 3HL4A 4ZODA 5DTJA 1ZL2A 2V59A 3C3AA 1YZBA 4GMXA 1PR9A 4ACAA 1KI6B 1V48A 1MOPA 3N6XA 3IKLA 1OFIA 1L7QA 1W0KA 4OMCA 4E14A 5IABA 2PG3A 5DHUA 4P8RA 3CW8X 3V7YA 4AF6A 3FCAA 1UMDB 3UMVA 4EKGA 5JC1A 1NXXA 2ZSAA 4FXPA 3WK7A 4TSFG 3CZAA 1AK1A 1DC5A 1GDTA 4QDOA 4FFBA 3OWOA 4O4JF 4ARZB 4C05A 1SVSA 2HQRA 3RE1A 5JARA 2RGCA 3DJYA 3Q9NA 4ZVUA 4JI7O 4UV9A 5AXDA 1KQSU 1RYNA 3DD1A 4KE9A 5KSOA 2NM0A 1LRJA 1RSOA 1GYPA 1AXRA 1ECJA 1BNCA 3N59A 4DSUA 1P80A 3ELBA 4ZI3A 1BGYH 2AHRA 1X7GA 3A25A 4LYHA 3CZ5A 3B1KA 2XYPA 3AHDA 3P2MA 2BHTA 2H5JA 1VA4A 4AJIA 5I7UA 3ENKA 4Y2SA 1R1BA 4RK5A 1FYJA 3PCRB 3FX7A 2M98A 3O4FA 1MAUA 4Y9SA 3V1MA 4R7CA 2CMDA 3K8YA 4CUZA 1JIKA 3ERCA 3JRXA 1US8B 4G4SP 2O05A 1PCXA 4KSBA 4LCOA 2F4NA 2AH5A 3JTEA 4ZJZA 5T67A 2MYNA 2XUOA 3CF2A 3OF5A 5A2QN 1H0SA 3ZQ6A 2JIDA 3U48A 4R6XA 4LBEC 4MCIA 4Q4AA 5EERA 5EXSA 4BNLA 1ZM4A 1YA6A 4S1TA 1SQ5A 3F7NA 4F92B 1R8XA 3T4EA 4U5XA 1NVMB 3HVHA 4PA6A 5BWCA 4EF5A 2XQVA 3RU9A 4MVCA 1ZJ4A 4MIYA 4DR2B 1NW5A 1XRRA 3PR1A 2DPYA 2WFLB 1IQ0A 1VMIA 3MBKA 3TCNA 1L8XA 5L4SA 1GFWA 3GROA 3HB5X 4X7RA 5IF9A 5D3KA 5IEBA 3WL5A 3RC2A 1N6OA 1XA4A 5HDQA 3FOBA 4K2HA 2YIDA 1RXCA 1EUDB 4CQMA 3IGAC 3T9CA 3ZJ5A 3D2AA 1WB4A 1UJWB 3DH1A 2WD9A 2A0WA 4BLTA 2RGDA 4RMJA 4ENWA 1Q1EA 2G6BA 1QLJA 1OD6A 4CBVA 3ZTYA 3QTLA 1SIOA 1EVEA 2FHPA 1RP1A 2OM6A 1WULS 3GQBA 3GW8A 4LOIA 4MZXA 3T7EA 5KYXB 1NJIW 5AESA 2BGWA 4Y1RA 1MCZA 3S7TA 3FCCA 1L4MA 1DEOA 4IVPA 3KLNA 2AV6A 5C5IA 4MTXA 2CYCA 3AUSA 1RWXA 1ZMXA 2JFZA 2RHJA 2Q5LA 2W8BB 1XXHE 1EK2A 1GUAA 2FMUA 3BPSA 4QHSA 4YTEA 1L4GA 2AQIA 1BWPA 5JNTA 1YVWA 1MC8A 1RCTE 3FYUB 2JCBA 3JQDA 2O8BB 4QNNA 4RE5A 2YC2C 1M5RA 4GKJB 2D59A 3TJRA 3B9RA 4QOJA 4AWXA 4ZCIA 4WBSA 1E98A 2XKAA 3IUEA 4TMYA 1Z45A 2XASA 3BMNB 3EC7A 3G67A 1UKCA 4OP3A 3WNDA 3CPHA 1ZD2P 1L0BA 3K5HA 3MF4A 5LU9A 3BL5A 3VDQA 1XHEA 2XHZA 1VB3A 3MWFA 4P3NA 4ZKDA 4Z4EA 1OKKA 3B2EE 1DRUA 2FW9A 2KKWA 3T9BA 1R73A 3IAYA 1G5RA 2WZQA 3EPKA 2WU8A 1KYZA 2GM5A 3UHFA 2Z30A 1V1MA 1URFA 3AEKB 1G6UA 2FB9A 3V1NA 1V2HE 5TISZ 3QO8A 1YB7A 2GRJA 5DM60 4XGQA 5ALUA 4DDTA 2ZJ2A 1WR8A 4FCWA 5IM5A 1K06A 4HFJA 4PYQA 1Z7GA 3GEGA 3MLBA 4U6SA 1CEEA 2CLEB 4QBGB 3NASA 2GPJA 2Q4OA 2VPXA 5C2JB 3WLOA 5FH9A 4F0JA 5BQFA 1DU4A 4ISCA 3R0QA 1LQ2A 3OESA 1B04A 3HYNA 2Y0PA 1W19A 3NI2A 1ZGJA 3O2SB 2WWTA 2WJIA 4P80A 2X6RA 2PI5A 2VK8A 2ZBUA 2HIHA 3RUAA 4B6GA 4BO2A 5AM4A 2OXCA 4ECEA 2I2AA 2JH9A 1TB4A 2VNKA 5EP1A 3MINA 4D8WA 2I54A 2YXNA 1QQ6A 4MQBA 3W8NA 3WDMA 3A6DA 4FQ5A 2OGTA 4NU5A 2Q9CA 3ED1A 3IB6A 2X1MA 3TUZC 2G0TA 1KPHA 1O2DA 1GRRA 2CXPA 3GIDA 3HBJA 1HDZA 3GRYA 3CMMA 3R3WA 1D5CA 2Q46A 2ZSEA 3HNPA 4ON9A 2BL4A 1DI0A 1C1YA 1XNGA 2CF5A 1KYQA 3O4GA 1REQB 2QTTA 5CLIA 4C03A 3H4TA 3ABKC 2W6JG 3O75A 4CS4A 2AUTA 2I4IA 1Q77A 2AE2A 1UBHS 4MVJP 3CISA 1XAJA 2FFHA 4OY3A 2Y1CA 1CG6A 2GK6A 4YCAA 4JUDX 5SZKB 3W5SA 4WFGA 3IKJA 4KQHA 3THXA 4P35A 4XYEA 1N6LA 3DT8A 4WGFA 1P1FA 1MO2A 5DLEA 5IT9A 2VSOA 4BO1A 4EQ6A 2OTJV 1TZ2A 4MUHA 4PHHA 1ZJZA 5EBLC 3CA8A 3I2GA 5GZ1A 4G2KA 1ZH6A 3OMXA 1VYUA 2H5IA 1AI5A 3DNPA 4JA2A 3PQ7A 4H6VA 1CD5A 4J2TA 3DV0A 4BGIA 4AKIA 4TUYA 5J2TA 3IOCA 3F96A 3QNUA 3EFHA 4IJ6A 1A7UA 1IVNA 4AJOA 2WLLB 1XF1A 1MEJA 4RA9B 1BJTA 2F8MA 2WSMA 3BC1A 4MOWA 4OHWA 3TLGB 3VR0A 3KZIZ 3LLSA 5G53C 4KMSA 4E2YA 5BMVF 4A3SA 5MHTA 1PD3A 2Y69B 3VH1A 4LH6A 4BLUA 1BE1A 1H8HG 1L8QA 4QPJA 1G6HA 2B1GA 2X2PA 4GI3A 1J99A 5EESA 4Q7LA 2JLUA 3GFTA 4XIIA 3WG7C 2XBLA 4DQVA 4GPD1 4HKTA 5JZ9A 1S89A 4RFLA 4LGCA 4HRVA 1SXHA 4I9GA 4OPAA 1F1BA 4H15A 2QTNA 5KC9A 1JHUA 4JP8A 1H4SA 1EX6A 1OXUA 2R9RB 3IV6A 5D6NA 1TM7E 5BRAA 3O8OA 1AQNA 2C5SA 1OC4A 5HBRA 1U0BB 5J2UF 1C3VA 3F3KA 1RMQA 2XQJA 5LZ8A 3AY7A 4MKZA 5GOZA 2EV9A 2JCGA 2JI8A 2ZOSA 4J0HA 1Q0HA 3VPHA 2CMHA 4JJIA 1G5FA 1ODCA 4YLEA 4RABA 5BWNA 1S5LZ 2P9YA 2XCUA 1FYEA 3TCUA 1L9KA 4CLOB 3SPCA 5I7SA 2IZ0A 4ZJPA 1JDNA 2JBAB 4M9RA 1Y7IA 3G8BA 3QKSB 1EP1B 2B1QA 2TMGA 4CU5A 2RAFA 5I4IA 1Z4MA 1NMSA 1D5AA 1P4AA 2NZYA 2QWXA 3F1LA 3GMTA 4NCHA 4Y18A 3RJ9A 3TZLA 3ZKAA 1XALA 1NJSA 5CW1A 1GDHA 2HF9A 1FPQA 3BA6A 2AZ2A 1GAWA 3Q1KA 2PLAA 1EX7A 3IQIX 1K2WA 3IXLA 3Q85A 2VHXA 2HCJB 4IHQA 3EHDA 1OFVA 2C9MA 3RT7A 1M0EA 2Z3IA 1S0VA 1QANA 2C0PA 3A31A 3PQDA 2NR5A 1HR0B 3BMOB 4RCZA 1IDN1 3DVAA 3AVWA 3R6GA 2E5LO 2XGJA 2UVDA 1RFYA 1EFVA 5IT4A 1YL7A 4H44B 2AIRA 2X8BA 3B36A 4GVLA 4F3RA 4QM6A 1RB7A 3D7RA 1Q14A 1U3FA 1RMYA 2VYVD 4HAOA 1X15A 1LY1A 1J2UA 5K8IA 4XVRA 1J8QA 2NVOA 3S6JA 3WIOA 3Q8KA 3EIFA 1U2EA 1Z7BA 1GPUA 4D99A 1JI0A 3UY4A 2OFWA 1SOVA 2PGGA 3OMWA 3SJ7A 4UOZA 2CNWA 1H2RS 1TJ4A 3A1WA 3H9UA 3IE0A 3HCOA 3TW4A 4K35A 4IHJA 2EKLA 4FDTA 2GQ0A 4MYUA 4QDTA 5T6MA 3NYQA 3OFNG 2HQ1A 3I3OA 1P9OA 3E2IA 1YR2A 1UM9B 4NBKA 2VHQA 1LS1A 1SBCA 2P1DA 2X8JB 5EWLA 5KKAA 5B30A 5ICSA 2J48A 3OM3B 3DHVA 3LT2A 2PGXA 2NU8A 3ZY2A 2R25B 2KBEA 1TKBA 1CUGA 1V4NA 4OG2A 5I7EA 1EEXB 1OLXB 3PUZA 4RTKA 2QX7A 4U8HA 3TQFA 1BGWA 1QDUA 5EZYA 5CB4F 1T2VA 3ER6A 2HHCA 4AS1A 6PFKA 1ZVJA 1WBDA 1F4PA 1ZD5A 3CY6A 2R72A 2A8NA 3O31A 3RS3A 5B64A 2PL5A 1QBGA 3E1KA 3VKGA 3H8JA 3RASA 1V4BA 2QJTA 1B14A 1T9AA 2WIKA 2VQFB 4XEHA 1OT3A 1XRNA 2C2GA 3CGGA 1W4ZA 2PYDA 4IF4A 3L8GA 3E7XA 3U40A 5DBFA 3STUA 2QXYA 3GRAA 1VMDA 4UEWA 3JWGA 4NS4A 5EFZA 1EZJA 1QCYA 1DTWA 5JDIC 1MSWD 5ALRA 1ACMA 1MX9A 3DC2A 1GN6A 1CC1S 3YASA 4ARZA 1R12A 3B5IA 3DZFA 4DIBA 1F2VA 4PDRA 2JRLA 4I6JA 3N2KA 5TJ9A 5IKXA 1PJBA 3RK4A 1VARA 2RHHA 3FRJA 4B09A 5J3JA 3PI6A 5I9IA 1OJHA 1GP2A 1SZXA 5HFLA 1M8JA 1WF6A 2CNLA 2J5KA 4L07A 2NV0A 3QVWA 1C9YA 2WSLA 2G09A 5CYGA 4XOUA 3WXMA 3GB9A 1R88A 4UBLA 2B9EA 4YR9A 4V0RA 3U1VA 1K33A 4OX9O 1PWYE 1Q0UA 4US0R 4YR7A 5BURA 3VFDA 5JYDA 4EAQA 1KU6A 2JCSA 2WI8A 2YVUA 5FP0A 5LZ5A 3ZWCA 1EA7A 1W8DA 2VQDA 2FYTA 2D2CB 4NF2A 2GYUA 1ESMA 2OB1A 1PBTA 2VSYA 2WJ6A 4BPRA 5K3EA 3AU8A 3TLKA 2OIEA 3DSQA 3A1FA 3K03A 3CF6R 3OJOA 5EIBC 1UPXA 2NTJA 4FYKA 1SFRA 4PBRA 3O8DA 4V0OA 3FLEA 2JF0A 2OLKA 4BP1A 4M49A 1N9KA 3WGUA 4XA8A 5C37A 2WIDA 4RV5A 1IN7A 1V7CA 4FOPA 2QL5A 4YAEA 1GCOA 1KYXA 2UXCO 3PUYA 5KO2A 1KYOF 4AP9A 4M9ZA 2HXYA 4YVFA 5DM1A 5A9RA 1KEVA 4D8VA 5DJ5A 2DBYA 1QNMA 4KIFA 4GO1A 3QIAA 5ALNA 3SVTA 3C6KA 5ALMA 3W6PA 4G0NA 5DCYA 2LRHA 2QVBA 2MSCB 2ZATA 4LOJA 3ZXYA 2DCUA 2DR2A 1GSHA 3IX7A 5AOAA 1VMGA 2Y2VA 4CF7A 2ZYVX 3PJSK 4MT8A 3P0FA 1TIYA 2ZXWC 4RM2A 3UA3A 3WADA 2D5LA 1VQ7V 3BG5A 1RJ9A 2WJGA 3R2JA 3ASOB 4GM4A 4I0XB 4K8XA 4DR4O 1NBMD 1Y63A 3BQMB 1Z06A 1ULBA 3DXFA 3JV7A 2YWHA 5T4EA 3K9LA 4BQEA 2OHVA 4DA4A 4G01B 3I9FA 3VBBA 2ENWA 1Y1SA 1U7TA 4Z4HA 1XYGA 1ISJA 2QAGC 4MEBA 1TEZA 5IC4A 1JEEA 1K1EA 2J9RA 2NO1A 2WIAA 3MUEA 3W2IA 1BVUA 4C08A 3PTAA 4WUVA 4ZCQA 5KOJA 5DW0A 5EP2A 3KJZA 1UBLS 1Z6GA 1YVUA 2ZFUA 4H1HA 3BDVA 4ZQHA 5FX2A 1VL0A 1FXKC 5FOVA 4TMWA 2FQ1A 4ZREA 2P7TC 2MCFA 5JC8A 1IPFA 4OGKA 4HVLA 4ZAZA 4P4LA 2EP5A 4KYUA 5F73A 3VV2A 2YVQA 2GM4A 2PLFA 4FI3C 4YCCA 1L4BA 4G8BA 1C3JA 3T94A 4C29A 1EFPA 1V3VA 1W0CA 2GCGA 2R11A 3CS3A 3O7MA 4QOEA 2OENG 4REQB 5EWMA 5BUCA 1A9PA 2I6FA 3NM6B 2P87A 2Z98A 4OF4A 3IB3A 1GCUA 5CT8A 5B3JC 1WB5A 2JJ2G 5FXMA 5JJCA 2E87A 1XZFA 3FNRA 4GKVA 1W4CA 4H0NA 4YH1A 5K3AA 4JL8A 4WZBA 4BJ5A 3EUFA 4BJ6A 4ZCPA 1AD2A 1GM7A 1EGMB 2NYRA 4XEUA 1CETA 1P2BA 1V1JA 5IT9N 1C2TA 1ZNXA 3MLEA 4KWHA 5E3JA 1C3OB 2EIXA 2HCBA 4N82A 4U3FH 2YJ6A 1NBME 4J91A 4OQZA 2WUGA 4XUEA 4N41A 3VKUA 2WPDG 5LQCA 2WLTA 4QPKA 1I1HA 1LPMA 2HFKA 2JFVA 4J4TA 1W36D 1W85B 4BV9A 3PDIA 3SX0A 4BHTA 3W2FA 3GA0A 3SZUA 2Y9PB 3GCZA 2Z5GA 3THOA 3BH7A 5H82A 1QH8A 1HSZA 4TLDA 1VQ1A 1TEXA 4L5YA 1GKFA 1RZUA 3PDJA 2X42A 5DWDA 4E32A 1K5SA 2H4HA 3ECAA 4D4IA 1VSBA 1QZTA 5K05A 3GLFA 5DH9A 1PYDA 3JASA 1KJQA 1HEYA 3ON5A 4C01A 4CKCB 1PJCA 4EKWA 1GG2A 4YRPA 3N6VA 2ZT9B 1ZMOA 2ZE6A 2QROA 3EAFA 3NQ41 1JIJA 1XMPA 3FSRA 4N0QA 1A5BB 1FYVA 1Z29A 3H1GA 4GBGA 4TS1A 1P7VA 4AAYA 2RH9B 1OA1A 1IHDA 3IUYA 3Q4GA 5BMVB 1J6UA 3E5HA 4RYLA 4X8AA 1YE8A 5KUKA 4HNTA 4P3OA 4BW9A 3HVIA 3B13B 4BLWA 3T1OA 5FT9A 2VBCA 1VG1A 2P40A 3NHAA 4WOJA 3RROA 4OCLA 1PR5A 2HMAA 2QEQA 1HE4A 1XJ0A 2WT9A 3FAKA 1AS0A 2C0CA 2W0XA 1UFVA 5A0VA 2DJVA 2IYAA 1W36B 3TQRA 2FSIA 1SM4A 5DB4A 3S2IA 1J1UA 1T9ZA 3IAXA 3U4IA 3SJQC 2Y0IA 3UHPA 1AXGA 2WMDA 1JA0A 2D3TA 3F6BX 1VBKA 4L73A 4QUKA 3SFVA 1CJTC 4ER0A 1YTUA 1DEXA 3E4CA 2HRDA 5B2ZA 1XMJA 4S1PA 1QIKA 5AVOA 3THYA 3J7AU 1EG7A 5F52A 4GOJA 4J3FA 1DZIA 5FB3A 4OUKX 3SEFA 5A5DA 2V8BA 3ZWAA 1BOOA 3LSTA 1FTWA 1NY6A 2B1RA 4KL8S 4OXQA 1BCRB 2IYVA 4PAOA 1BT8A 4UM5A 2Q0SA 4RD2A 1IZ8A 2I7TA 4KR7A 1EX9A 4W7IA 2W2TA 5D85A 3QE0A 1H0KA 3GJ0A 3C3CA 3QSYA 2IW3A 3H8SA 2CLHB 2EL7A 4UBJA 3D1LA 2BKEA 5AJXA 3NR2A 5KYYB 2OXEA 5KHIA 1WOYA 2JASA 3WG7B 2ODNA 5FTNA 3UKOA 2AKYA 2XRZA 2UVPA 5CA1A 1W48A 4RVNA 1ZK4A 3RNLA 4DAOA 2ZZKA 3DJFA 4EIWA 2RG1A 2OP0A 1MT0A 3C3XA 1CLUA 2C9OA 4LJRA 5I9MA 3TH5A 4BMXA 2P9JA 1N2JA 2JS5A 2C42A 3ZJUA 3K5OA 1B6RA 1H0HA 1U0HC 2CY0A 4D57A 4CLEA 3ESYA 1QK4A 4FJ0A 2P4VA 4O5OA 1Z5GA 3DF7A 1ES9A 5CFPA 3D31A 5DKFA 1R0WA 3V6LA 4PW0A 4WZAE 1XDUA 3PX2A 3S5UA 1Q92A 3UGTA 2AF3C 2VXYA 3EA4A 1NYQA 4YRAA 3N74A 3RK1A 2IYXA 4QKQA 4NPCA 1JQJC 1KO8A 5JAZA 3IMKA 3NHYA 4E5YA 3B1JA 5AVXA 1JGTA 4W9MC 1KEEB 3OWXA 4Y67A 4DA6A 4C2TA 1ZPDA 3NDJA 1I7FA 2KG7B 4WL0A 4ZZ1A 5K6RA 1X0XA 1QGDA 2IZOA 3PEUA 2A92A 1ZD1A 2POQX 4JUCA 4NMXB 3HA7A 2AEMA 5AOVA 1T36A 3ZLBA 4BKPA 3NORA 1A9SA 4DJ5X 1IEQA 3HO8A 4RAIA 4ZPXA 4MYSA 5CJ2A 1L4EA 1IMOA 3E1GA 4L7QA 5SY4A 4JODA 4MS1A 1QR8A 2DUWA 3VHXB 3CT6A 2XCTB 3J7TA 2M32A 2G07A 3MYYA 3IUQA 4EUKA 2AOXA 4RTLA 3AVVA 4O4HA 5C0OE 1K27A 3UXMA 1JEQA 1OXVA 3K30A 3MRSA 3K8QA 4Y9UA 1XBLA 2V6JA 4MRPA 3ZNQA 5BYAA 4KXYA 5DNAA 4V1CB 5FPHA 5HR5A 4B3TO 2IHUA 3G1UA 1XNHA 4PRZA 4HDKA 4U00A 4FMDB 3FRIA 4CNQA 4NMHA 4GL2A 2BE7A 8GPBA 3CUSA 4UARA 3LSQA 2FVYA 2AOWA 3EFFK 2DT5A 3FOAA 4FB5A 3ZE2B 4UOEA 2BCEA 3T5BA 1ZISA 3EIXA 3JQBC 4R31A 2CUTA 5K8TA 4GC5A 1R66A 4RACA 4PAWA 1T9BA 3A0UA 1RYDA 1ZCBA 2WVGA 3F78A 4DUGA 3R8FA 4TLLB 5BSUA 2A9JA 2YY7A 5IAEA 1GN9A 3M4XA 3Q3VA 1JSCA 1MOFA 3NT2A 4DY4A 5HCIA 4XVUA 4R2MA 1VDZA 2XEDA 5IANA 2YRFA 4Y6SA 5CLGA 1U8UA 4B34A 4QG3A 1TJ5A 2A35A 1QR2A 3BSSA 3RTAA 4EHIA 2VWPA 2WTBA 1ZUHA 2NV6A 3ZVKA 1PGJA 3H1FA 1U3CA 3L75H 2JLSA 3RSZA 3W9SA 1HSOA 1LDMA 4RDCA 4PN3A 3TOVA 4LRSB 3JAKB 5IAKA 5TPWA 1JAHA 2RGNC 4ND1A 3U0BA 3NVKI 2W71A 3CLSC 1S1CA 2GLUA 3JATB 1NRXA 3IPAA 4NZMA 4ZOLB 4CM4A 1QRRA 1J9GA 5HILA 5K1ZA