2B1IA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 220
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1iA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1iA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1iA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1iA03
1CE8A 1C3OA 1PL0A 2YVQA 5H3LA 1B93A 1THZA 1P4RA 2IU0A 1T36A 1BXRA 2XW6A 1VMDA 1IK4A 1WO8A 1JDBB 4EHIA 1M9NA 2IU3A 1ZCZA 1S8AA 1A9XA 1C30A 1G8MA 2B1GA 2B1IA 1S89A 1CS0A 1EGHA 1KEEA 4A1OA 1PKXA 3ZZMA 1OZ0A 2X8WA 1M6VA
chains in the Genus database with same CATH superfamily
1BYUA 2ZIXB 4C3VA 5CT8A 2XKJE 3BFKA 3EA5A 4A16A 1U0EA 2QG6A 4WESA 1NVKA 1XJ5A 1UPGA 1GKKA 3FJ1A 3AFGA 2VRCA 2VQDA 1G9TA 4PC1A 3CJHA 2D1QA 3I39X 1E1RA 3FCEA 3QUSA 1K2VN 3LL7A 3FTDA 2PANA 2W11A 3CNQS 3QJ5A 5H82A 3CJHB 1Y5RA 4L8VA 2BGRA 2C5AA 3DP7A 3DZJA 2XJ4A 1CUBA 1G41A 1R88A 2IZZA 1J95A 3GEBA 4MUEA 3E9CA 1KVSA 3KSMA 4RKEA 4BU0A 3DV9A 1RTTA 5GZ1A 1H2MA 2GGSA 2PS9A 2Q7EA 1YS2X 1X7HA 1VMKA 3DO6A 5GQSA 1XCBA 1DTEA 1UPXA 2P8SA 1GNSA 4HDMB 4ZWNA 5HMLA 4K8RB 4IIJA 2E87A 3UYKA 4CM8B 3NHYA 1L4NA 4LMRA 2ADPA 1EX7A 1I7DA 1O6GA 2YIBA 2PX2A 4ADSG 1LBHA 2OT5A 3TGUH 1S0VA 1PT9A 2BGIA 2WI8A 3O0TA 4GI1A 1P1FA 4LH7A 2RK6A 4CM6A 3NYRA 5DT9A 4CMKA 2IFTA 3L79A 1UEXC 1GNRA 2YQZA 3FUUA 5CU7A 4WHMA 4XAQA 2BGWA 4GR4A 1ETHA 1Q0PA 3R7BA 3V4SA 2FFHA 3FLMA 4B2LA 2FWRA 3N1UA 3PHIA 4AJOA 1OB2A 2YYSA 3P0FA 4R16A 1Y8RA 2UVPA 4TVSA 3K31A 1VM6A 3Q4HA 5AM0A 1I6MA 1R6VA 4P4GA 4E31A 2A3RA 2DKFA 1R6NA 1Q44A 1JDVA 5H02A 1YK0A 4HK4A 2FN3A 3ZN0A 2PU5A 1TLLA 1WRBA 2WMYA 3C3XA 2B98A 4Z4EA 1RPOA 1H0RA 2OBBA 3GFTA 1Q14A 5FI3A 1ZM7A 2Q73A 1MIOA 1XZJA 3MJDA 4W6ZA 4W1SA 4XVHA 3WGUA 5GTDA 3KPUA 3O1HB 1BFUA 5FOXA 1TUBB 3U0ZA 1IEQA 2RH8A 4QYMA 3COVA 4ZT5A 4I1OA 4B44A 1QLHA 4EFLA 4YV0A 2G9ZA 4X94A 1ONBA 1E2BA 1JTEA 2QN8A 5BR1A 1KR5A 5LD2C 2QLMA 4W1PA 4WOPA 4ARZA 2WA2A 3UQ8A 1ZGAA 5TQVA 2JBAA 1I94O 1MP0A 5A5GA 1L5FA 3G89A 4OQQA 1FUYB 4ZEOA 5E38A 2GDSA 2J7PD 1JFFB 3KX2A 1OSNA 3OTGA 3PFIA 1X9GA 1T1JA 4DYHA 4CH6A 3FAKA 4JEUA 5EP1A 2H1IA 2Q5CA 1XJQA 3I37X 5F1OA 3TTUA 1ONSA 1IBCA 4NU6A 2YFYA 5JCOC 3CJTA 2GKGA 3DBLB 4LDAA 3SK0A 3F90A 5E2BA 3R9XB 3V9PA 1RRKA 2XE4A 5DCUA 5U4QA 3KR0A 2BT4A 3DLBA 1NW4A 1UDXA 3AVXA 4NEHB 1EQAA 2HI0A 2RGNC 1XREA 4F1KA 3VZCA 4B6PA 2Y9PB 4PQGA 5EFZA 4RVCA 2JLYA 5DN6G 2H17A 1J0DA 2PZBA 2P30A 3ZVMA 5KDDA 1L5WA 5EPEA 1RWBA 2ERYA 3JSLA 3HUFA 5JDIA 2XD9A 1XD2A 2Y71A 3V42A 1I2ZA 2WKQA 4QX6A 5DHQA 2AXQA 1CJKC 1KAOA 3NYIA 3OA0A 4FDUA 3UXEA 3WNDA 4AICA 3L2OB 4B34A 4KGZA 2G63A 1E1RG 3X1YA 3RT3C 3MOIA 1J2TA 1GPMA 2HKIA 1JPVA 4V3BA 1U99A 2EBOA 1GPWB 4GQIA 2JLZA 1Z6GA 2I55A 1Z4MA 5AJYA 3HDQA 5AKGA 2GA9A 4LJ4A 2DOKA 4C3UA 3EX8A 2IEGA 1I4WA 2UKDA 5BVHA 3CSXA 2BRUA 2E1PA 2QTNA 3GDWA 2Y05A 3D4IA 4KN8A 2G1AA 2PUTA 5DCWA 3OFNA 1VE3A 3AERB 3PWSA 1F8GA 2UXCO 2XVZA 1H9AA 4KGDA 1Y67A 4ARVA 2W22A 3EPRA 3AEZA 4Q9HA 5JD6A 3L1JA 3IDZA 2GAAA 1JAYA 2A5GA 3IIIA 3LECA 5DRYA 3SX4A 1UAAA 4TSFA 4DDTA 1MAWA 2HJDA 4KQXA 4LBVA 4O59O 3T9CA 1D1SA 2W2OA 2XMCA 3ACDA 3W2FA 3W6UA 2E75B 2ZQ5A 5C34B 2X0EA 1OT3A 2CCKA 4GC9A 3M4NA 2CV2A 4PV1B 1MNAA 2CW5A 2EINB 2C5EA 2VK2A 5K7SA 5ILQA 4L87A 4I50B 1WE2A 3LWNA 4ZK2A 5A2QN 4MUYA 1RPRA 3F4BA 3D31A 5DO9A 5JSUA 1UJ5A 1GPNA 1FYWA 1GUFA 1KYIA 2IA5A 4XQCA 1SZDA 5DHTA 4B82A 3QXGA 3RUCA 1WCIB 1EVQA 3L0PA 1YSDA 1NM5C 1BCSB 1W7AA 5KKCA 1Z74A 2XXJA 3NRCA 4HQ6A 1TD9A 2JGIA 3F98A 3RF7A 5B30A 3LJKA 1ZL8B 4L3OA 1UF9A 3JQCA 4QU9A 2DWEC 4XXHA 3I2YX 1D2CA 4DQUA 1J07A 2WTBA 2PL5A 4WLOA 3ZGVA 5C9ZA 2ZR2A 3FJYA 1JR2A 1SVMA 3G0CA 1OTXA 1QO9A 1OI3A 4IVRA 3CE6A 3N8IA 5FNVF 3DL0A 4BWYA 2R00C 2XCLA 4MQEB 1E9SA 3ADBA 1QJCA 1JU3A 4KH1A 1KERA 4OQEA 3U7HB 1Z7EA 2J09A 4GVPA 1F14A 1GL9B 4IF4A 4RGVA 5F2NA 3FIJA 3LPCA 3OPYI 4QVIA 3TI7A 3DLTA 5HR5A 1EZZA 2OUKA 3PC7A 5DZSA 4HVLA 4UBJA 3HY3A 3ZHVA 1MO3A 4ZQHA 2HR1A 4ZO8A 3ZWVA 3U7FB 2I99A 1FC0A 3DVSX 4J0CA 2H1LA 1E4EB 4IOLA 4MVJE 3DB2A 4Y6OA 3L7CA 3TR5A 3MCTA 5LJLA 2Y0CA 5LLTA 2O96A 4PC7A 2R9AA 3WMXA 4RHFA 1Y4MA 1S01A 2HMYB 2OILA 4LWSA 2IOFA 4MV6A 3R3JA 1GRNA 4NWIA 5B1DA 4K0KB 1OHHG 4O8XA 3PDWA 2P77A 2MDTA 2I7TA 3KQQA 1WKVA 3R6TA 3ZHCA 3EDMA 3X1DA 5AUOB 2D1RA 1Y8ZA 3JS5A 4KVGA 3OMIB 3CLUC 3QNUA 4AJJA 4YR9A 2O59A 3B70A 4M8SA 3P8ZA 1XHFA 1KI7A 1O6ZA 2ACVA 2ACEA 1DT3A 1GU1A 4UUQA 1B0AA 4KV7A 3VC3A 4L51A 1TVKB 4U00A 3S68A 4RSMA 4A0SA 1M2KA 2TMYA 1B2LA 3R3XA 2BC9A 3PUYA 4FLZA 2NV6A 2Z57A 4LK2A 2WLLA 3OZSA 3L9DA 2CVPA 1D1TA 2ZT5A 3FBWA 1SR8A 3L02A 4HRXA 5DGIA 4DPMA 4PG6A 1Y5NA 1S9HA 2VEDA 1IOVA 4ZEVA 3EDCA 1SRYA 1M5TA 2BR3A 1SQQH 2JIZD 2ZITA 2CFIA 2P2YA 3ELUA 2F4NA 1YC2A 3CNEA 2Y69C 3G9UA 3NATA 4V0MA 2R44A 2N47A 4KFUA 3WJAA 3R7WB 5LQDA 2A1UB 1Q3EA 4P5PA 3ESYA 2FOLA 3H17A 1X1DA 3JWIA 4MGIR 4U39A 1K8AW 2ID4A 3E6AA 4F60A 1YXMA 2OYCA 1TA0A 2OO7A 1JAXA 2YV2A 2ZUUA 3TGWA 4K40A 4DIFA 4YP7A 1A9QA 4TWAA 4MS2A 5LZ8A 2XGGA 4BB9A 3PDCA 2F1KA 3KQTA 3RNLA 5HQ3B 4G6ZA 1Q3HA 2ZJ1A 4MITA 2XKAA 5KIAA 3V1LA 1QBGA 2SKCA 5CH3A 4TKVA 1E1LA 3L1VA 3AY0A 3G71V 3QMMA 4JJAA 4NVPA 3AESA 3IJEB 3LY7A 1WXQA 4UCQA 1Z0KA 4WEQA 1EYZA 1TECE 1LNQA 3ZE9A 3IP5A 2FPSA 4BBPA 3OLCX 4BO0A 4D82A 3VC1A 3MINA 2HXVA 1IBMB 2IBTA 2XVYA 5KHJA 2QKSA 5CXQA 4BGDC 4DR7O 4O0LA 4HXGA 2EX4A 1BCRA 1PLLA 4KL8S 3LX4A 4H1HA 4DW0A 1ULHA 2PX8A 2YQ5A 1M0TA 3RYFA 1EJBA 5DECA 2Z56A 4JA0A 3CRRA 4PX3A 4HWOA 1Q2UA 1GTSA 3CB4A 4WQMA 1D5CA 5DPMA 5C1OA 2HEPA 2D3OW 1JBKA 2JHPA 3JQ7B 4B73A 3PA8A 5DYYA 3RAEC 2QM7A 3AH8A 2EC5A 1EUDB 3A70A 1OA1A 4KDFA 1KMIZ 4RTPA 1PL0A 2J33A 3RKRA 3DM5A 1NC3A 2PMCA 1GM7A 1TPZA 5DHAA 2MHCA 3OR6C 1VLZA 3NYQA 4HH0A 5EJFA 3ZKWB 2R48A 4CQLB 1N2JA 3EMBA 3W9BA 2GHYA 4Q4HA 3O03A 4ZCSA 2IOHA 4EJSC 4YO8A 2LE0A 4DMCA 1C9JA 2I3ZA 5CYOA 1U2DA 5GAOA 1GCAA 3RYHA 1WVIA 1GITA 2X76A 3ABLC 1XTVA 2Z9CA 1DVRA 3X2QC 3RYHB 3W7BA 5LZ9A 3NFYA 1AJEA 4LV5B 1RSOB 3CN7A 4JLJA 3G7NA 4I9QA 3TEMA 3ZBTA 5FWYA 1KRXA 3CINA 4LF8O 5B1AB 1HNZB 1DPFA 1E9DA 2WZDA 1GPJA 4I1UA 1A9PA 2Y1XA 1L5LA 1Y76B 2BCEA 1RJWA 4OP3A 4K81B 4TL7A 1RLUA 3WIBA 3LZCA 2XMDA 5HE8A 4YRPA 1KFCB 1DS6A 3F5MA 2OFPA 4FQ7A 4KLCA 3ONNA 2VIIA 5ADHA 4U7NA 1DARA 1A4UA 1LDEA 1IHUA 4M1EA 1RHUA 4DCOA 1G6OA 1ODKA 4IJQA 4K9LA 2FN9A 3KWJA 3TSZA 1S7CA 3PFWO 5J5VA 2VKQA 1UIRA 3OP1A 4EITA 1ZIDA 3T9DA 1KZ4A 1K9VF 2OWOA 3WRVA 5BOSA 2YSUB 3HP7A 1QORA 3C8MA 3T4PA 3P2IA 4BB0A 4BFTA 3A1SA 5KHHA 4BU1A 1ZIYA 3FE2A 3G85A 2Q0AA 4DC9A 3KTAA 4LJSA 2ADMA 4E07A 1RKQA 4GICA 2VPYA 2F43B 4DLAA 4F3WA 4JI7O 1UBJS 5FOVA 4EJMA 4URWR 4QIWF 2Z2XA 4HOYA 2XYPA 4LVNA 4ZEXA 2XT6A 4JAAA 4L5BA 4REOA 3S2IA 3NAZA 1R6XA 4XDKA 4CKWA 4CN8A 3THXA 4V3CA 2F3SA 2IQIA 1JPXA 1QBZA 4C7VA 4JL6A 4Q03A 4KOEC 1OAKA 2AJBA 3IV6A 3HBAA 2BGMA 4HQ0A 3R5XA 4NOLA 3EVAA 3ZY2A 4BDTA 2UXDB 2WKSA 4F4IA 1KI3A 3QK7A 3TLJA 4YT2A 2O2EA 5I7SA 1Z45A 1GQRA 3L1UA 1F4MA 1W9HA 1Y3DE 3UOWA 5HMMA 3UKOA 9ATCA 3I55V 2ZTHA 3HA7A 3EZGA 4GT1A 2G5TA 4IOMA 4YQFA 1A4RA 1BMFA 3CUUA 4P92A 3GXOA 3OQJA 3FF4A 3KXPA 5DX1A 3EZYA 5HEKA 3TQRA 1C7ZA 2VS0A 2WJJA 1RR6A 2QVGA 5JCJA 2Q6LA 3F7OA 2OCKA 1KEKA 2P78A 1T2AA 1R5TA 2WF7A 2H2WA 1U04A 1P0PA 2LCIA 3UNXA 3BL5A 3OICA 5AICA 2FPRA 1GCUA 3LG2A 5L4LA 2PUBA 1P2SA 2NXNA 1NVDA 1MJNA 5FHQA 3MDSA 3JTEA 4PAWA 1ABEA 3O91A 5CB4F 3ZRVA 3VVMA 4NV3A 2VHCA 4H2DA 3BRWA 3TPCA 4WY5A 5B2EA 4UVDA 1FDWA 3H97A 2Y0EA 3CF2A 4GMXA 3WHPA 4FOPA 3ZLTA 4AKHA 4G0PA 1SN7A 2MSCB 2XUQA 2NWQA 2HDNB 3LPMA 2XRYA 3ZEAA 2OGZA 2G80A 1M2OA 4YIHA 3PRYA 1AKUA 1T4MA 1Q0LA 1H9BA 5CW1A 5E1MA 1VHWA 1PEYA 4R50A 4HAIA 4CFZA 1XI2A 4ITUA 1DEAA 3K70C 3CF4A 1KFJB 2I0FA 2CWWA 5KX5A 1UT6A 4LYJA 1LRJA 1WB5A 2W00A 4MVJG 2F3RA 3E8HA 2ZDIC 1E3LA 5AM4A 2EW2A 3ZD6A 1S2LA 1TI7A 3DDCA 2E74B 2I1QA 3FUCA 4I5FA 5G4KA 5LQSA 3SDSA 2IWHA 1CERA 1D2MA 2G40A 3A26A 2DPMA 3MRXA 2WNIA 3JQ6A 1NZDA 1EB8A 1IFXA 1GGJA 2EKPA 3ZNNA 4X6YA 1RZRA 1ODCA 2VSNA 2DULA 4YAJA 2CE7A 2JD2A 4LWOA 3V2UA 4AUMA 4CCWA 1ZN7A 5JFGA 1T1GA 1G3RA 2JK0A 2DLDA 3VHQA 1OPXA 2VDNB 2B8TA 5A4IS 3UAXA 5IE9A 3CVOA 3ZBQA 1SCKA 4PIPA 3UTDA 2JS3A 5IABA 1U2TA 4K03A 4MVJF 4MUBA 4WERA 4EG8A 1PP4A 1X7WB 4AS2A 1SZXA 2QORA 1ZH8A 2FAXA 3HWWA 4MB0A 4A0RA 2Y0IA 8MHTA 1M2OB 2CY0A 1FS6A 4LXXA 3UXMA 3VH3A 1LUWA 3FR8A 3OIGA 4NCAA 4FIZA 5K0EA 1D9ZA 2GARA 1U3WA 1JA8A 3CIFA 2VDVE 2WA1A 1I8TA 2YIDA 3BCHA 1Q0SA 4TZ6A 2QE7D 2ORVA 1OCOC 1EDZA 2Y76A 2FW6A 3AF4A 4MJLA 3JASB 3ZWKA 4G89A 4EB3A 3F5FA 5C3MA 2ODEA 5IAGA 4DR2B 4JI4O 3DC6A 1F17A 4PWYA 1YS7A 4IS2A 1RXWA 3SHWA 3IMGA 1V5IA 3DKPA 3ZU4A 2P0EA 2DQZA 2PH3A 3EFBA 2FW7A 2JH8A 1T9GS 2VHUA 4O2BA 4IDCA 5KZMB 2DB3A 3HK2A 5AVXA 1BW9A 3E8GA 2FVYA 1MKYA 3FVWA 4GZMA 1SUCA 2FPPB 4I8IA 4K9RA 1UJ6A 2P6MA 2VUSA 3ONVA 4M0CA 1ZFNA 2JRCA 3GG9A 4U5XA 2RKBA 3RG2A 5B3SB 1LK0A 4C07A 2VTKA 4TZKA 3CX4A 1QMGA 4WA7A 1G2IA 3ZD7A 2AA3A 2GM5A 4JFRA 4BNLA 4FFKA 3AYZB 3DZKA 5DYIA 3ZW7A 3Q7EA 2AN5A 4GEKA 1ZAKA 1LDGA 3NBQA 1OLXA 2EDAA 5EIBD 3SDZA 3QLVC 2JKVA 3VHLB 4DGSA 1MXFA 2CUKA 5CLHA 1L4YA 5FWNA 1S02A 2I3DA 2X9GA 1NSYA 5I7HA 3CMMA 4Q20A 2L42A 4HAUA 4I9GA 3DCIA 4OFXA 3EVBA 1EJ2A 1XLWA 4OAPA 1KDPA 3ZZ0A 4IHAA 4I46A 5ICEA 1VQ9V 3HJTA 3JAWA 4OHZA 1ZUNB 1GRQA 4JAVA 2VHTA 1B1CA 1RAAA 5BPHA 3DTVD 3CT4A 3VR6D 1PUIA 1GTRA 2O1XA 5INTA 3VJRA 4XVQA 3LRPA 4BNXA 3SXUB 2DPLA 3GUUA 2WZBA 3HDTA 1XO1A 3B2NA 3DCJA 5BYKA 5TEVA 2P87A 2VK4A 1SUIA 3UG6A 1DTWB 2ZKLA 4LC0A 3KT0A 4TTAA 1PFVA 5DTIA 5BVHB 4GXTA 3KPJA 2A58A 1XVAA 4HDSB 2QSZA 4QPNA 3K5OA 1YDMA 3OGCC 2Q6TA 3V7FA 4AN1A 2KWIA 3TGLA 5KTNA 4YEDA 2VHVA 3GRAA 1V9PA 4JBNA 3NRJA 1AO3A 2QW0X 4LDRA 1N6OA 4PHHA 5DX0A 5HBRA 4TKZA 2CYAA 4KWTA 5FOWA 4G3MA 3EGEA 1K5PA 5M5BA 3MQ2A 4GF5A 4I6GA 4TN5A 3UOGA 3WJ2A 1URFA 4HADA 4Z5XA 1R7RA 2EJTA 1GN2A 4PQYA 1VPTA 2B4KA 5EUQB 3ZDAA 1XQ9A 3GJ8A 4KBGA 3UK0A 1CR0A 1ZJJA 2NTNA 1E1RD 4QG3A 1Q82W 1NXVA 2J5QA 1QUFA 3CG0A 3ES9A 4L8WB 3HYLA 3UAYA 3SHQA 3JR7A 2C2BA 4OUDB 4V03A 3QG1A 1HDZA 2VUHB 4LH6A 2C2YA 5FL3A 3OUFA 4GDMA 5K4GA 2F1RA 1EM8A 3N6XA 2ZZNA 2J85A 1E9EA 3LXXA 1E99A 2C2HA 3I1IA 4J0QA 2W8ZA 4RORA 4QM6A 5MN4A 4HN9A 4YQEA 5B1SA 2C5BA 3NEYA 3OIDA 5IDXA 4FPXA 3H05A 3QLJA 2Y4UA 1E1QD 4OGQB 4JUBA 5BMVA 5JS1A 1KJQA 3K94A 1DXQA 1E1NA 1QVAA 4ENRA 2DOSA 3DA8A 2ILVA 4DV1B 2GDZA 3IQWA 4Z1VA 1DTWA 3B7GA 4EY3A 2HVVA 3GC6A 1MF7A 1LPBB 3E27A 4ZARA 3I2GA 3OZIA 3WGNA 1ISRA 5JNUA 2NLJC 5HUJA 2CYBA 1GPUA 3TRJA 1DOAA 3BILA 2FPUA 3LT0A 1UM8A 2XUDA 5AJTA 2DKOA 2HXYA 2F48A 3BC1A 3HLKA 2GH1A 1F9EA 3P2KA 4NBRA 2ZIXA 1E2IA 5LIPA 1T0JB 3AL3A 3ITEA 3L6EA 3W4KA 2UZ4A 1UBOS 1XTIA 3RH0A 3BB1A 4JIGA 3I2KA 3W79A 2AEEA 4FOSA 3G02A 3VU3A 5M7EA 5IAKA 3KQOA 1EVIA 5TT0A 1IY0A 1GAJA 2RDMA 3QZUA 2ZJ6A 2WV9A 1JR3A 3W2HA 3IFXA 1YZBA 2C20A 3JTMA 5EP3A 3WE7A 5FP0A 3EPKA 1QONA 3CMAV 4NZMA 1YBAA 1E3IA 4WBNA 1MB3A 3L8CA 4LXQA 1P5JA 2PD6A 3DMYA 4AZWA 3KJGA 4IJ6A 4HNQA 1A2KC 1FMJA 3TKAA 3FWKA 1Z7YA 1E66A 4Y1EA 4UAJA 1KC1A 3SX2A 4HTFA 2VJKA 4OGKA 4FVMA 3RJ5A 2IS1A 2I1LA 5JI3E 1XU7A 1SHTX 4BVLA 4X84A 3UJCA 4WFKA 821PA 4EB6B 1HNNA 2XVMA 3A2LA 3HS3A 5TQ0A 5CFZA 4H13B 3OLXA 1JR6A 1GAWA 3DXRB 2R97A 5EKTA 4YRZA 5JO0A 5CTJA 5TQ0B 2FZEA 1XBTA 3KYCA 3IVRA 4AN0A 1Q5PA 3AUXA 2OZKA 3A4LA 1F2TB 2YWDA 2L6LA 3IDOA 4ZAVA 3Q15C 5H3HA 3VKVA 5LXTF 4DFDA 5K03A 2XZOA 1ZOOA 2GYYA 3O9ZA 1UFVA 3OC6A 1E1KA 2YEVA 4KLAA 3RARA 5C5EA 5CAEA 2QQEA 1H22A 3E9MA 3F0TA 4KUMA 1GA1A 2WK1A 2O3QA 3HACA 3LSYA 4F46A 3QOWA 3WKAA 3T12A 5KQMA 1UEJA 3ITKA 1SQ6A 3K6RA 2OZLB 4Q9KA 2V03A 1ZC3A 5LGTA 4FCVA 4J1NA 3TNJA 1AQ6A 2H06A 3WGKA 1SXGA 2FMUA 3FYCA 4U9IS 2A1TR 4BIOA 2IU0A 3GGDA 3ETEA 3A9SA 3MIIA 4UARA 3DGFC 3DQZA 2GPNA 3HBLA 3ZV3A 2JI8A 4FSXA 1TJ3A 2H1VA 1U8CB 5KVCA 3X2SA 4M99A 4PLFA 2IHJA 2JLXA 5FPHA 2H85A 3IPLA 2IEAA 4G36A 4UE2A 1YFKA 3EW7A 2HD4A 3AV3A 5DLPA 1B6TA 5C7IO 1UBMS 2BCJQ 3KHTA 1U2ZA 2XGSA 1Z33A 2BMAA 2LNDA 2FG5A 5IDQA 2D2FA 1FEZA 2IIBA 2PSDA 2M32A 1MN6A 3N39C 3O65A 3U9LA 4UNQA 1YQUA 1PD0A 2J0VA 4MW5A 1ZCZA 1XMVA 4YFYA 1NN5A 2X0KA 3HSKA 1FFXB 4MUFA 5EC8A 5EHIA 2VT7A 2HRQA 3FPFA 1F4PA 2HMTA 1NFRA 2YINC 4OQYA 4EKNB 1GNVA 3G88A 4Z9FA 4C3ZA 1RWOA 1YKSA 3HSYA 5IJ0B 4P7JA 5J59A 3A9VA 5GPBA 2A14A 1AR1B 3OEWA 4O2AF 5B7QA 4N6NA 4URFA 2BMEA 2XUGA 1OLUB 2XUFA 5HSGA 3LLVA 5ITVA 2VXBA 4GX5A 3RW0A 2GXUA 3BZBA 4MVXA 3N8NA 1BEEA 3FB8C 2O0MA 3L4KA 1R8JA 4GLOA 3VKGA 3D7LA 3HNPA 2Q46A 1QIIA 1SA0A 3KZOA 5E6SB 1TKAA 3F1KA 5EINA 3AIOA 1K8ZB 1N8KA 1R0XA 2OO5C 3PI6A 2IH3C 2PYZA 4HWGA 1YB7A 4MX8A 1C9EA 1PJLA 2JCXA 4BVBA 1W88A 4F9EA 4ZGWA 1PT8A 2W6IA 3W2GA 4DLNA 2Z4TA 5FFFA 2PMEA 2VF2A 5BW8A 2KYRA 3TOSA 1ODJA 1P0IA 1B42A 3EULA 2AOXA 3IPAA 1BXGB 3HA3A 4Z3OA 4HYYA 1M8PA 2RBGA 3P32A 4JDUA 3TQQA 1GN6A 3EUFA 4KR0A 4N39A 3BMCB 4QECA 5K99A 4DPLA 3AVVA 1BVHA 4QXAA 1XYVA 1RM1B 1KDTA 4CV3A 2YICA 4Y2SA 2I91A 2FEWB 4AO6A 3DTTA 4HD8A 4NXNO 3ZJVA 1PBTA 1U8FO 4LRWA 3F6EX 4LPSA 1EP3B 2PZLA 1YR2A 2QDKA 2D2VA 4CI0B 5KYWA 2XMZA 2IDKA 2YJ4A 1O9HA 3RUDA 1CVIA 3ABRB 3KL4A 1GNPA 1G1MA 1KO1A 1LFDB 2VT2A 1ODFA 3JRXA 2QF7A 2Z5VA 3OMAB 5DM2A 3NANA 2AYYA 2I6QA 1MZEA 4K9MA 1KI9A 5AKJA 4ZQIA 4YRNA 2QN1A 3REFA 3F5QA 3FETA 2ZRKA 3G6BA 2NU8A 3K4QA 5BN4B 2NSYA 3TRDA 1V55C 1Y9AA 4PQTA 3JD2A 2JFPA 3L8ZA 4TV9F 4TYWA 4E5UA 1YA4A 5FL7D 2QWNB 1P17A 4UM5A 4QHSA 3LYHA 4FP9A 5FKJA 4BTEA 4OHYA 4KUEA 4PYMA 5ER9A 2W0MA 1L7EA 1IBKB 4UVAA 1ZGGA 2IY8A 3W77A 4A5SA 4LD2A 1N2SA 2WT4A 2XMGA 5LOVF 3U4QB 2A2ZA 3MAGA 3W7WA 3KE9A 5EFOA 2FSVA 3ADKA 5GMOA 2EIKB 4QNNA 2LCQA 4W5TA 3CVYA 1VF5B 5LP6C 1NQUA 4LDJA 3W9YA 1RRCA 4XYGA 4HZ3A 4QBFA 2MINA 2O1EA 2ZUVA 2ORWA 4Q16A 5D85A 4FR5A 4NOJA 2WWVD 5HG0A 3LGAA 3RK1A 2EL9A 2I7VA 4IDQA 2GZHA 2B20A 3PFHA 1H8HA 2TS1A 5BV1A 3B8FA 3PPIA 3T5PA 2XEXA 4JBLA 1M2FA 1WU7A 4PEVA 3UHPA 4AC9A 1IQUA 5J2TF 5I6DA 1ZD9A 2QAGC 1WA8A 4F92B 1MV8A 1AQNA 4ZO4A 1GFWA 2I4LA 4BAUA 4IHKA 1W4AA 1XQWA 3H1EA 5A1TA 4RZ3A 3K8OE 4P30A 2OHXA 1Z9BA 2WU3A 1GPAA 4BO8A 3KFLA 2BBWA 2YHUA 2FCRA 3I64A 4U0KA 1BAPA 1JB1A 1W1UA 2XBLA 3ZK7A 4X8LA 3RC9A 3SJAA 3DE0X 3AOEA 1L8AA 3Q98A 3ZEIA 1OTYA 2DQKA 2W48A 3K9BA 1XZKA 3ENWA 4QU5A 1RM3A 1GG9A 1Z8NA 5IW8A 1HE4A 1IBLO 1ACMA 2OP1A 5E4TA 4YJ3B 1UK6A 2D0DA 2O05A 1J0XO 3BWYA 4R1NA 4B17A 1NW8A 3CEMA 4E2FA 1KQFA 2PPLA 2XOXA 4E46A 1U3GA 5L3GA 2FMXA 1JP7A 3VM6A 4P7FA 3FROA 2VN8A 3VO2A 1KK2A 1YB4A 2EJWA 3EOZA 2H3OA 3N9IA 3ZIAG 2YNMC 1PV2A 3ZYZA 3ACBA 5BXZA 2HA3A 1WCYA 1GDTA 2FR5A 4UW9A 2W6MA 1HETA 3H87A 3U7EB 1TT7A 3QH4A 4HKTA 1WW2A 2W6JD 2Q5QA 4BC1A 4PCAA 1SIBE 4EG0A 2WJIA 2FZKA 3RRNA 4YPOA 9GPBA 1WXDA 2XH8A 1WMAA 1Q6IA 1WAZA 4XYMA 4IGKA 5E2AA 1CYEA 2O57A 1NI5A 5JZSA 2V7WA 4DR6O 2P9GA 3QFCA 4II3A 5IVIA 4CQJA 1H1LB 3Q85A 2VTBB 2XYVA 1ZHHA 2BGNA 1NJ6A 1Y5IA 1AVTA 2Q3MA 5FCDA 3SQDA 3JR3A 7AT1A 1AF2A 4LQ4A 5EWJA 5DBOA 4UCSA 2HCTA 3B1VA 1M1UA 4RANA 1LNSA 5HPYB 2EJBA 3N53A 1L5MA 3Q3IA 1VXOA 5LCXA 1X1AA 3H9BA 3W05A 2H0RA 3C3YA 3IAM6 3ROEA 1LEHA 1X9IA 1XVTA 3DXZA 4PAGA 1VQ5V 3ABMB 4RVHA 2V0CA 1N8SA 3EXEB 3TIXB 5D87A 2GT1A 3MT7A 4XE5A 1ZL8A 2ETNA 3BIWA 5FPRA 3OSZA 3GRYA 3Q7TA 4PZDA 1Y3AA 4Q6WA 2QRVA 4XIFA 4L75A 3H1AA 4TSFG 1PVDA 1QGOA 3HJCA 1ZCBA 3OLWA 5EZ6B 5DBFA 3NHJA 3WKEA 2YH2A 5DOZA 3JWGA 4C7JA 4LFCB 3GT7A 1T43A 2WB2A 2AN1A 1JLMA 4MS1B 4FJCC 4ARIA 1X87A 2OECA 1N78A 3KJEA 4C0AC 1WU8A 3C4JA 4X90A 1SC1A 2EHDA 3E9ZA 1R0KA 4HRVA 1NBME 3CV3A 4B81A 4F4CA 1CNFA 1M1YA 1TKBA 3OLVA 3LNTA 4FC7A 1A9XA 4RTLA 3H5NA 4NSNA 3SHTA 4TGLA 1FCJA 1WQ3A 4KVAA 4Y1RA 2ZFUA 4PYJA 1SUFA 1CEQA 3R7AA 3SHFA 4MZXA 1N77A 3ZD9A 4CM9A 2JGKA 3D3WB 5LP6A 2RJOA 1UM9A 1A77A 3A31A 4QJIA 2F1MA 2BFPA 3LUCA 3EIFA 4ZT2A 4DLTA 1R64A 3Q40A 5ITSA 3ZCCA 1A9YA 3DHVA 3HYTA 3RIGA 5K01A 5KNCA 3HJBA 2GN1A 4HX5A 5JWPA 4MV8A 4BGEA 3ZWOA 2DBRA 4WK4B 4IDHA 3I45A 3H5VA 2AX4A 4IHQA 4MGEA 2XGJA 2PR2A 4YRIA 3WFZA 4LYAA 1NATA 3NH9A 2JCSA 3OPVA 4DCTA 3FPKA 3KKYA 3USCS 2FQ1A 2GFHA 1SRQA 1ZS9A 2QRLA 3LXRA 4Q4JA 2UUBO 1ISIA 4F7DA 2VAWA 1BX3A 1LXCA 3N6VA 3FMVA 5JYEA 2IIQA 1JJOA 4MSUA 1AO0A 4PYOA 2R2GA 4PGGA 4TSFD 1S3GA 4RF2A 1X7GA 1UPTA 3JQGA 4EZEA 1D2HA 1REQA 2G3YA 3GNQA 4DA8A 1DQYA 1P1HA 2AOUA 4NB5A 4M0KA 2WLNA 4ASUA 4KXMA 4ZT6A 2XTAA 4D02A 1ZXBA 4D56A 2OLEA 1GM8A 1HSZA 2OKCA 1R5NA 3GGCA 4PINA 3CF0A 3IERA 3NHKA 5AI0A 2O3KA 4W4LA 3P0EA 2WVJA 2PO5A 4OHBA 3UM7A 3KFVA 2OHJA 2VHEA 5EHZA 3I4CA 1WD5A 4F2HA 2TMKA 1FTQA 3I4LA 1P0MA 3DZHA 3LVQE 1E1QA 3AETA 4GR5A 4XFDA 5KYNA 3OLQA 1K8RA 5JXGA 3ABOB 3EG9B 5LP6B 1RRPA 2Q9LA 2JRLA 2ZRIA 4NC9A 2LXNA 5GJVC 5FLXA 4JT4A 4TT3G 4EENA 4GLBA 4CXMA 1USIA 2XMBA 4PDVA 4OLFA 4RF5A 4J9VA 2UXXA 1TZ2A 3IHWA 1NJGA 1OC4A 3TFWA 1OX4A 1CRWG 2BW0A 3OGIB 3G0HA 3LVRE 3NETA 4NNJA 2DHCA 4DB2A 1SQ5A 3CNNA 2OCBA 1TVKA 4G86A 2PKQP 4ZQEA 4JXXA 5DBIA 3JARA 2IXTA 1DBRA 2G8NA 3LC1O 3U31A 2Q0OC 1EDOA 1ZN2A 1YITV 1X92A 2GHIA 3PC8C 4J0IA 4X8OA 3AEQA 2JAQA 4RK5A 5HX7A 3IV9A 1DC7A 3AM3A 3O7MA 4YP6A 3M4YA 1O3YA 1G3IA 1FTSA 2BUBA 3PF8A 4PFSA 3FH0A 1G20E 4ZYTA 1JXOA 3FFXA 1Z6PA 3QVVA 5AW3A 1CF9A 3BGWA 4NZPA 3HZHA 2APJA 3G9QA 3U62A 1X1RA 3R2NA 2WU4A 1SVOA 2GR9A 4ZYZA 5BWCA 3CH4B 1PL8A 2ZYTX 1LK5A 4AP9A 2YOHA 1NN1A 1YH3A 2IW3A 1NQXA 4OVKA 5L95A 3IC7A 2CMHA 5ALVA 4LRUA 4CL0A 4F5DA 4H1WA 1QANA 4RZQA 3VAAA 3M70A 4YXWG 2IZ5A 3TOZA 2IEBA 5ALZA 1NUTA 3ASOB 1EXMA 4M53A 4F85A 3I6YA 3CNOA 1BDBA 1G8HA 1NYLA 1RI5A 1XGKA 2HB6A 4MV4A 1CF2O 1YFJA 1HI9A 1KS2A 5ALJA 5K8UA 1K06A 3FCUB 3V55A 5KAIZ 2E3JA 3H2SA 2KM1A 2IYOA 1MGPA 4F6EA 3KAJA 5A05A 3VZPA 4LY0A 5BSEA 6PFKA 5AIBA 5KOJA 3GZNA 1XP8A 3C3CA 4JB0A 3ZWDA 2Y4OA 3IUJA 4L0QA 2QTZA 4HHEA 2E9SA 4DCCA 1NUAA 1TM2A 3V4ZA 2FW9A 1OH5A 2P1ZA 5JZVA 4CKBB 4JK3A 4E30A 2DFDA 3DT8A 4LF5B 1E3JA 1FFGA 3CH7A 4J29A 5I3CA 3L0DA 3DEFA 4G9EA 3THWB 2XDWA 5JSZA 2HWWA 1BSVA 2AN9A 3QMWA 4TPKA 2DJIA 3DOEA 5DYGA 3RKSA 2TYSB 1QRSA 1XCJA 1FVXA 4FWIB 3ML1A 1CJVC 2PDAA 3CFYA 1QOQB 3QY9A 4QAJA 2X4IA 4O4HF 2MCFA 1WSDA 1Z4NA 2BMDA 4HAOA 2JIPA 2W2VA 3URKA 5KU1A 1DKMA 1W85A 3I0NA 5BOSB 4IJKA 1J24A 3PX3A 1QP4A 1ARZA 2PS0A 3R65A 3O9OA 1WUIS 2OK7A 2R1TB 3HCPA 3IFSA 5CT4A 1TFUA 1F0KA 4N54A 4RV5A 1W6UA 4DR4B 3I5UA 4IV5A 4G8BA 4YXWD 1FK8A 3ZDEA 521PA 2ZUEA 2EATA 3OQBA 2NN3C 4FR2A 1PPJH 3E5HA 5C4GB 5JROA 2Q1SA 2HJHA 3NEJA 4JI3B 2A78A 1ZSNA 3HGTA 4KQGA 3WJ7A 3IKLA 3L07A 5AOAA 2GVDC 3DDSA 4G07A 4GGPA 5CM8B 4B35A 4ZVVA 3IR6A 2C57A 3MWLA 3ZUPA 4CMJA 1V4VA 3SKVA 2XQGA 2FWMX 2HTFA 3EXHA 4G24A 3INRA 3H8WA 2DQSA 3MTIA 4COKA 5C4MA 1EH5A 4QFMA 1VG8A 2X8AA 3BHJA 4IEIA 1DUSA 1DMSA 2QTRA 3R7NA 3ZNQA 1CUFA 1OBFO 2GFQA 4KWCA 1NU8A 4GSLA 3O1JC 2ZWIA 1WB7A 4M9UA 1RAFA 1Z35A 4LF8B 5A5DA 5FBVB 5AD1A 1KD1W 5C52B 4UHJA 1FP1D 1Z6AA 1LDMA 5E4JA 5IRCD 3I6QA 3L0YA 3AOEC 3MGAA 1M0SA 3DONA 4N40A 3TXAA 2IE0A 4EG5A 2C92A 2FEMA 4V1CI 4C29A 4JI5B 1B8VA 3DEKA 3ZG6A 1NWHA 5F33A 1JE1A 3E3OA 1YSCA 1BWQA 2Z58A 4Q02A 4RDIA 1L4EA 3P4YA 4K8OA 5AYVA 4JD5A 1Q6YA 2XCSB 2Q5LA 1BN7A 3PDJA 1SEPA 1UBUS 2HWUA 4H3VA 4HZUA 5E6RB 1RW4A 4L5CA 5EP2A 3DQQA 3NDRA 1Y80A 5BO5A 3WL3A 2Z43A 4N0EA 1JEOA 3PIIA 4R7TA 4RJLA 4Q9IA 4OI0A 1W581 1YEWA 3LDDA 1Q81W 4M6WA 4EGCB 2QR3A 2GJSA 1K08A 3HEBA 5EWMA 4LHEA 2NAFA 3BDIA 5G2OA 2CN1A 3UK2A 4E5DA 3L7OA 1JQ3A 1ZESA 2NYRA 3BMNA 4JC8A 1WUKS 2B8JA 3EJ6A 3MTAA 5IBPA 3DV0A 2R6FA 3W5AA 2ATIA 2DQ0A 2NG1A 2Y92A 3EA0A 4JS0A 4EEZA 5L4SA 1LPSA 4YUYA 1DJLA 1RP3B 3L8EA 4K3UA 4QQKA 1CZRA 1GXSB 1QF9A 1I14A 2HHAA 4KYIB 4V0ME 5NULA 4A6EA 3JXEA 1Q12A 2DKNA 2HK8A 3CKLA 3LP8A 3FB7C 5HXAA 1VI5A 1PNLA 1K98A 2GUWA 1M6YA 4KMOA 3D3IA 4RPIA 5B1BB 3WX0A 4CF5A 2WABA 2V45A 4CLOB 3LYUA 1GO2A 3ILSA 3OJLA 4NEQA 4CLOA 1IG3A 4XCQA 2BJVA 1G59A 2AW9A 4P2ZA 3I01M 3NBUA 5HJ2A 3LUGA 4TXNA 4PSUA 3DDHA 4PC2A 2M7WA 3JWPA 4F56A 1YCHA 3HY4A 5ITWA 4ZQBA 1USUA 1S1MA 4MUHA 2Y6UA 1T34A 3SS8A 1QPBA 2PT5A 2V3WA 2JLQA 1OILA 3LL4A 1E7YA 4YRMA 3MMSA 1W36C 1WKBA 4ZJZA 1W0JG 2B5UA 2BZGA 1MC5A 1UBHS 2R85A 2XUAA 2BVNA 3EXIA 3BMNB 3UT5A 3GELA 4G1FA 4BEBA 1SXJB 1EBBA 4IP0A 3E9YA 3T52A 3SR2C 5IBRA 1PT5A 8LDHA 3NOXA 3VR2D 4X63A 4TSRA 2A3NA 3DZCA 3FFWA 2LO1A 3H5LA 1YMUA 3HO8A 5J5CA 4ZKEA 2WVHA 5J47A 4WDRA 5LKRA 4MKFA 3MPZA 2D6FA 2QD5A 2WJYA 3R66A 3BWDD 4OFWA 3STTA 2K5UA 2GAFA 3C1TA 4MTLA 3FSGA 3WBBA 4DNOA 5L8VA 1KKCA 2QTMA 3BCSA 4FYHA 4Y1GA 1QKKA 4ZGBA 1KP3A 1EZ4A 2DR3A 3H11A 5DW0A 4B8WA 3OCXA 4TKMA 5DEDA 1ZJ4A 4CKEB 3HLTA 4LJ9A 3PHLA 2WSSA 3QE2A 1G8MA 4M7OA 5I7VA 1BHAA 2JEYA 3KT8A 4NCIA 1G60A 1MQ9A 1Y1LA 3IXQA 4RSRA 3GIDA 4JASB 1LLDA 3WG7C 1X19A 2C4KA 3CXUA 4G97A 4V38A 4YJFB 4YONB 4CCSA 5KQSA 1SETA 2I22A 2QRGA 3ANTA 4OL0A 1QQBA 2ZBGA 4FD2A 1F1JA 4UEOA 3HCRA 1IUKA 4UULA 5U9CA 2QRZA 4AM8A 3IJFX 3G67A 2Z8XA 4BVAA 1EVZA 1TADA 1XALA 1ZK2A 3HZOA 1W4BA 1D4OA 4NZOA 1XA0A 3WZMA 4ARSA 3WKCA 1W96A 1I5OA 2HZBA 4RTQA 5HS4A 1BIFA 2J7PA 1QTIA 1I80A 1W0JD 2E5FA 2CDNA 2X58A 3CC8A 3PPWA 2L0XA 4QUKA 5SZIA 1H2NA 3S2YA 2NSLA 1BZYA 1QHGA 1HYQA 2J59A 3FXAA 5FWXA 3EVEA 3S5UA 2FP3A 2CLKB 2WSSD 1ATZA 4RGBA 4FVTA 5C7YA 4OXNA 2QI9F 3FDJA 3U81A 2VJMA 3DEHA 3S28A 1ZMBA 5F77A 1E2PA 3RU7A 3T1VA 3RUEA 5E7MA 4FKBA 4CPDA 5AW1A 5DM0A 4RBNA 2VSFA 5GVRA 3VDXA 3BVPA 4FYWA 3LUFA 5AI9A 1KAEA 1MZPA 3ABLB 3NVMB 4HTFB 3QP9A 4JX9A 1EX9A 2C59A 3STZC 2UXDO 1VGVA 3B2EE 3V46A 1W36B 2VLIA 3AR3A 4RVDA 1TT5B 4R81A 4CLHA 2Z2KA 1KQOA 3HR4A 4FMDF 4GHWA 3ISJA 4GE0A 5BT9A 3GGPA 4Q05A 3T2MA 3B78A 5FOQA 1GKFA 5K8LA 3FM9A 2WM9B 2ZI9A 3K0KA 5ESRA 2XA2A 4RDHA 2PV0A 3VR6A 1NUQA 4QC2A 4JYPA 3DLAA 1XP5A 4IMPA 1T6YA 1XDGA 1WN5A 3W8FA 2R6DA 2ZXWB 1PR5A 4DWVA 1XCGB 3J7AC 1CEEA 5K8IA 1Y8QA 4KO3S 3M3HA 4WTOA 5FNZA 3UV7A 1AKRA 1U6IA 1VIYA 2JZCA 2ZB7A 4P82A 4NBSA 2C42A 3JCZA 2OCIA 4U7TB 4BNYA 3NTXA 4YAKA 2EKDA 4C0WA 2VFAA 3BN3A 4OO3A 1F7VA 2ENUA 3GAZA 1KO5A 5FBQB 1BE6A 1EHIA 3I2HA 4P5DA 2XA9A 2IHKA 3SYMA 5BV0A 3B52X 3MERA 4ZOLF 3I23A 1HFWA 4D96A 1UCFA 2ID9A 4JLDA 5GINE 1VJTA 3BL6A 2NTJA 3TLZA 3WKDA 2ZVPX 3NHLA 4WUTA 2AD1A 4Y9TA 4KXLA 3RUIA 3WHIA 4FM0A 1RFLA 1R4MA 3EC1A 1VXRA 4TV8A 2ETXA 2QLBA 2Z5GA 3KD3A 4MIEA 4NMXB 3BYZA 4AROA 3VNBA 3VDNB 2IF0A 5HW0A 5JVDF 1K4MA 4YCSA 1OI2A 4REMA 3I5XA 3GEDA 2C2WA 4A82A 1AS0A 4DLRA 3JWJA 4B71A 1GR1A 4IZHA 1QYCA 4GPEA 1H85A 1RIIA 4FM2A 3A4YA 3WQHA 4I9NA 1KDVA 3T1NA 5SY9A 1SESA 1X7ZA 4PNPA 2AWNA 2V7UA 3JQAA 4UEJA 5C31A 1OCOB 5JJJB 2NP7A 3UYLA 1QIFA 4B6SA 1J4AA 1QQ7A 1KZHA 1T6XA 1NQVA 1DDOA 2FJPA 1TZCA 1RXYA 3N0WA 4X64B 3ADOA 4FOLA 1CUSA 2ASEA 4GIBA 1KL7A 2PZ8A 2G88A 3WL6A 4BQSA 4BFCA 3WMRA 3GLSA 3AG5A 5IM4F 2HGSA 3LA8A 4WECA 1D6MA 1Z3CA 4TTPA 5I4CA 3ZJZA 3RSLA 3T1CA 1KEWA 2LBPA 4RQBA 4TL8A 5EPOA 3FN4A 2PZKA 1V9LA 1KMIY 3OY7A 3Q4GA 1M2GA 4DLYA 1DIAA 4X66O 3OZGA 1YR1A 3BHIA 4OL9A 3R3SA 1AHHA 2ZPAA 1BZKA 4HEJA 4XB2A 2PMKA 2ERCA 4D8WA 2YWHA 4IRMA 4LDQA 4HLUC 4OHPA 2Z0MA 4FIPC 1W4ZA 2CXXA 3LSQA 4M3NA 4CNBA 1JR3E 3K2QA 3T3PB 2O9JA 1GTJ1 1ZA1A 1QZZA 1LUVA 2ZWMA 3L0OA 1B93A 4J76A 3SOZA 3WQRA 1I5XA 4Y2XA 3OQIB 1X1CA 4D46A 1GXSA 1JA9A 1GPKA 3S8YA 3F97A 2YJZA 4LCNA 4A23A 3LPNA 2ZAOA 3M6WA 1P4JA 3UMGA 3HKBA 1M2NA 2GB4A 3STYA 4LFCO 2YJ3A 3OKCA 3UBTA 1AB3A 3R5HA 3TLCA 1OLOA 4HQFA 1CZOA 1SCUB 4JB2A 3K1ZA 3K59A 1N8RW 1G5PA 3U3OA 6YASA 1ZL2A 3QEAZ 1KQPA 1GILA 5K8VA 4ND4A 2B9EA 2CEAA 4KXFB 4OHKA 5IC6A 1H5QA 3U2QA 4FJ0A 2PJRA 5LDGA 3IEMA 2OM6A 5JV5A 4V1CA 2DYSC 1KARA 4TTJA 4JI7B 1AB5A 2QRUA 4Z2WA 1WDTA 2HJ9A 3HU1A 1SO8A 3SSMA 3T6KA 3V1YA 1B6GA 2JBWA 1BHJA 3BGVA 1KI6A 3KZ1E 3U3JA 1D09A 3M34A 5I4BA 1TMOA 3TCXB 4DIOA 3MHPA 4R6WA 1IAVA 4A5UB 1J8DA 4CQNA 1NRJB 1GOTA 3CZRA 4M8IA 4EAAA 2GTSA 4MJ3A 5B58T 2R7MA 4IO0A 3X44A 3QTBA 5HCNA 4KITB 1ODIA 1PQ4A 1WUJS 3LQKA 4K35A 4QUHA 3UJHA 4NI5A 4PVDA 4EHJA 2I2WA 4C6RA 2XQJA 2ICAA 2NYUA 4X6UA 1QH8A 4RIEA 1SH7A 4ZT7A 1ICIA 3SE0A 1L5YA 2EGUA 1ZD5A 4CV1A 3KYCB 4DT1B 3SBOA 4UOEA 3PNBA 5CFOA 1B7GO 2QTOA 3UGTA 4OKSA 2JI9A 1WAMA 3EZ9A 4QJBA 4O1IA 3QLVA 4JQOA 4ZODA 2I7XA 3ABZA 1H2LA 4NCJA 2QNRA 5BN1A 3RS3A 4X65O 1G8YA 3TTWA 3EF3A 2QAJA 5E9JA 1COWD 3WB9A 2BM1A 5IT5A 1UKEA 1L5VA 1V48A 3FKSA 1UX1A 2FR8A 4B3MB 1UWVA 1WWKA 2BI4A 4P9OA 1YV9A 3H5AA 1CY0A 4QODA 4BY9E 2B35A 2QJTA 2QN9A 1D2DA 2ZYSA 3D7RA 2QJOA 3AO0B 1FZQA 2HR3A 3GBPA 2X7XA 3BULA 1RC0A 2NQ2C 2HJWA 2OBYA 1ADFA 3B89A 1OWPA 3E58A 4X8MA 4DXDA 1H6DA 3MBKA 2XMPA 1U1GA 3H7IA 1KHTA 2ZBDA 4RELA 5SYNA 3RHZA 3WYGA 1GZ3A 1H2XA 5IN5A 3FB1A 3RWOA 5DSZA 2PRJA 3PJDA 3LIIA 3QF7A 1QFSA 2DGDA 4G5OA 4NBUA 2WJAA 3KOOA 1LVHA 1VQPV 4IM7A 5HDBB 3SGLA 1UJCA 2OD2A 2RGWA 3WG9A 1G3MA 4EAQA 2BOBC 1Q83A 4KIGA 1E63A 4BVGA 2D0OB 5D7BA 3GJQA 4EABA 2W98A 5EIXA 1BDIA 2NVUA 1E2MA 4YJ2F 1VF7A 2PAAA 3SG0A 5I9IA 3GV0A 3Q8WA 4YHHB 3AUTA 4ID9A 4ES6A 5G41A 2ADFA 2LKCA 2X2EA 3QKIA 3R5JA 1VQ6V 4X88A 2J9FA 2QTVB 3CH6A 3MELA 4HQLA 5CM9C 2VSQA 4RJIA 3K0AA 3QELB 3MS7A 1GFIA 1TCVA 2AC2A 2C2GA 3RFVA 1AMOA 2CZCA 1JEYB 2UXCB 4CUJA 3BH6A 1M0WA 4B3JA 1TX4B 3LBFA 4DLPA 2Q3DA 3NAGA 1BMFG 1CXZA 2HSGA 4J9UE 4LX8A 1OVMA 4RK1A 3RVRA 3S1AB 2I6XA 3G2QA 4QQRA 3P2JA 3VHXB 4A10A 2C9ZA 2XNDG 2YNMD 4LFBB 3PXCX 1ZCFA 3E05A 2ONKA 5G1OA 5FR1A 1AXEA 2IPOA 1X13A 3U4CA 5HUHA 4FFBA 1NQ5A 1DJNA 3D36A 2JJ1A 2QK4A 3AJ9A 3I9FA 2FW1A 3AL2A 3MTDA 1G8JA 3QU2A 4R1SA 4PYKA 2IS6A 1FXVA 1QAOA 2F66C 4KNWA 4F11A 2JIBA 3GUZA 4YLYA 2CB0A 2PBRA 3GVHA 2H2HA 3K0EA 4HVAA 4LK3A 2AOUB 4M0LA 4QPJC 3KIPA 2LIVA 1ESNA 3OE5A 4FX2A 4C14A 1H2EA 2RAFA 4MW1A 3PGLA 2ZT7A 2RGCA 3UMBA 3DB1A 1OCRC 5EYPA 1AC5A 1D8AA 1HRDA 2CK3D 4KCGA 4D9HA 1RC1A 1OYWA 2C2OA 4HYQA 2N46A 2XHBA 1UZLA 2CHVA 2CNKA 2O2SA 2OOSA 3KSUA 3UJ7A 4DUPA 4OXRA 1O9GA 2XGMA 4LCEA 4F3TA 4OK3A 3VR5A 1TXGA 4MCHA 4Q12A 3ZBPA 1DCFA 1FW6A 5AUQA 1VMEA 3LKDA 1SC3A 2OZPA 3LVBA 1FQKA 1ZNZA 2OHIA 1XCMA 2Y66A 2RC5A 1M7HA 4RE5A 5BN4A 2E4YA 3BWXA 3K9LA 3MTBA 4QOHA 2BMFA 2WP0A 1ZBQA 4O2AB 2BEVB 1JG2A 3ENKA 3MCZA 2G1UA 1P44A 4YJDA 3SR4A 1XRJA 4WNAB 3ZDQA 1JKIA 1EN5A 4LZAA 4N0PA 5B2ZA 3KCXA 2B82A 3VX8A 1NAIA 2B2CA 2ADQB 1UC9A 4NV0A 1I0ZA 2QM3A 5JCZA 2EZ4A 4HPXB 4EPTA 3BEOA 4FX5A 1XLTC 1L5ZA 2HRBA 3FNGA 4H7IA 4MLCA 2WZCA 3U09A 1SBTA 4FMBB 3SMQA 2OV2A 3SF8A 4QZVA 3AEQB 1EFAA 4JEIA 1O0BA 5JJKA 3EDQA 5L4NA 5EEGA 3X2FA 1IN1A 5JJIA 1Y8CA 3INTA 1NZFA 2EF1A 8ABPA 4JI8B 2DPHA 2EFEB 1PV0A 1ISGA 2C0QA 2FDXA 2VUTA 4YJHA 4LJRA 1S1CA 5F1YA 3GH1A 1NTOA 4IDOA 2P5YA 1JXQA 1X15A 3PVSA 3VVCA 3WS7A 4LCPA 3CLVA 2MSLA 1VCHA 3X2QB 2F4VO 2ID7A 1FXUA 2X1LA 2Z1MA 3L82B 4N01A 4ZQFA 3RWBA 3VO9A 1OLSB 1NFQA 4JEMA 1Q0UA 3BEDA 1DAIA 2HKOA 2AUMA 3EG9A 1K3FA 4EKYA 4II7A 3ZMTA 3DFMA 1LQTA 4QA9A 4XB6B 5CDFA 4H9GA 2VQFO 1ZXXA 1ODTC 1UZMA 3E1SA 1X7YA 1W0KA 3H18A 4YK7A 3WLEA 1WXXA 1KI8A 1ESEA 4Q39A 4J7KA 4XFJA 5FO1A 2PTMA 4FLFA 2R8ZA 2IV2X 4L5JA 1JQKA 2OLKA 3WWDA 2P4QA 1AKMA 5AJUA 5YASA 5E6UA 3RWRD 4AJKA 5BVGA 4WNAA 1V25A 1LTQA 1H6CA 1LLQA 2BKXA 5AW2A 1Z6QA 3FYDA 5AJHA 3VUEA 3K5MA 6AT1A 4OB8A 2YV4A 3KV1A 1PTKA 3L77A 4RDCA 1PJ8A 4RS3A 4ZVMA 2KI5A 4UNRA 4IIJB 3ZWMA 1RLIA 3WLSA 5HM8A 3PXEA 4YNBA 4Z7JA 3IAS6 4WZBE 5ICGA 5IG2A 3U3DA 4XWKA 3CX3A 4YA6A 3VC7A 1RU3A 2A5DA 2YJTD 3GFBA 1NV8A 2OORC 2Q1YA 2F9MA 3JZDA 1DUVG 5C18A 3DZDA 2QTLA 3P0JA 5HKKA 4LXUA 1AM4D 2XQFA 2ACWA 3AUYA 4PY2A 4BVHA 3TPFA 5BNIA 2Q0SA 3AUAA 2QWRB 4QELA 4XASA 1UZAA 4A0FA 1CEYA 4N5HX 5LNK1 3W5VA 1CRZA 1U28A 4TWJA 3NEAA 1QVFU 1S4MA 4B47A 1A9XB 1SG9A 2ISQA 3CRZA 1Z5WA 2KLBA 1FU4A 1TM4E 1QHYA 3PCTA 4QOGA 3ABUA 4YI3A 5C7LO 1JIVA 3QNMA 3BSYA 3RVQA 1E1YA 4HYTA 4NV1A 4L4RA 2OVBA 1QC5A 5FTLA 1OFTA 4L8LA 4D9EA 1KYYA 3CRNA 3H65A 1FDVA 4MYHA 1E5LA 2B3DA 3UT6A 4J4TA 8GPBA 2RD2A 3PJRA 3RYCA 1OXKB 2CXHA 5CDYA 4B3FX 1TK3A 5FBKA 3ZS9A 2V1UA 2W42A 3D7NA 2V6FA 1A2QA 3PCXA 2MU1A 4O8ZA 4GZ6A 2FMLA 5DKFA 4OCNB 2GD6A 2O2JA 1IBRA 3FX2A 5IVKA 2FZWA 2GJKA 2Q9AA 1GGMA 4L50A 4UUPA 5TMBA 1A50B 3FOCA 2TSYB 4IILA 4E4TA 3SC6A 5CEFA 4JJ4A 4PSAA 4BZXA 1XILA 4JJ6A 2DHQA 3O8LA 4Q34A 3H86A 3RUPA 4AKTA 3WL7A 3OEED 4UJ5A 4DREA 2SCUB 1HYBA 2Y93A 1P7PA 1QKJA 4QT0A 2F17A 1IWPB 3GQVA 5JSFA 1BXRA 4A8HA 3QQ5A 5AVKA 2P27A 4ZPJA 4R8CA 4J49A 4U3FH 4QJFB 4RUKA 3B1FA 3SJQC 4EG7A 5EWJB 3FGPA 1PQWA 2DC1A 4HATA 5TVKA 2CHUA 4HCJA 1SKAA 5EP4A 4PS1A 1D7OA 2AFHB 2ZBRA 2VTBA 3LSSA 2X8JA 4O1HA 4W5RA 4BJ1A 2V6JA 3DL4A 3W2TA 4Y9SA 1VQOV 3M1LA 5FUBA 4HPJB 2XE7A 4X93A 4AECA 4B3XA 3TB4A 4CF3A 1ZAYA 4OHMA 5HIKA 4ASUG 3PHHA 3VYUB 1QWOA 2JLCA 2KBFA 2ZSDA 3NP9A 4BNNA 3N2NA 5G0UA 1NW5A 2IKQA 1IZ3A 5DTMA 4ZJYA 1D3AA 1T5IA 1WDWB 1XKLA 3AR2A 4HB0A 4EK9A 4EEXA 2RSLA 4H4DA 5KUKA 4OXIA 3UUGA 3CUTA 1RTKA 5CYPA 4BLSA 1H38A 2YKGA 2BTEA 5KYYA 1Q3KA 1WXWA 2EYQA 2GAIA 3QSGA 4CU2A 1RJFA 4OGFA 4HNTA 1A7JA 3FFAA 4LWZA 3ZI4A 4A8JA 3DMTA 1U7PA 3KLNA 4CL2A 2A0LA 3HRHA 1WV0A 2VF8A 5GZ6A 4WK2B 4HWSA 1GVHA 1KU6A 1E9CA 4YCLA 4RULA 1VB3A 4L7QA 4BGUA 3IEVA 3F3MA 5LNK6 4DSTA 3ZMSA 4YWHA 3NWJA 3GCWA 4FUTA 3R3WA 1J5EO 3A9TA 2XSZA 3UKDA 1P61B 2XY4A 4G81A 3I0MA 2W4MA 3H9GA 4ND3A 2CLOB 4PHCA 4PPNA 1S2OA 3GFQA 3LHFA 4P22A 1MLDA 4Q7MB 4U9HS 5H0IA 4B45A 3VZRA 4ZDIA 1JHOA 1JHDA 1A4XA 5M04A 1EA5A 3UWKA 4E12A 3QX3A 1L0BA 2RHCA 1NMZA 2RFLA 4K88A 1DFIA 1U9IC 1RPNA 5FYQA 1B73A 1CQWA 5JMOA 3GOHA 3TTVA 1MEEA 1BMTA 2I65A 1EP9A 4QTZA 5F1KA 5CEEA 5LQAA 2VCYA 2UZ0A 2FGKA 3LUHA 3F49S 1PE0A 4CKXA 4DJFC 5E2IA 4NQLA 3LHDA 1H05A 4UU0A 3URMA 1N9GA 4DA7A 1VL0A 4RLHA 1V6AA 2OXIA 4K1XA 5BOVA 4MOWA 5KYYB 4DV2B 2E4WA 1YQQA 4FDTA 5K2MA 3DMPA 4M49A 4AF6A 5C4IA 1CQJB 1A88A 3O95A 3SQLA 4WJZA 3SIRA 2MOKA 3T35A 4GUAA 4YRAA 1V3TA 4X62B 5B3LA 1CY2A 1G7RA 2H1OA 2EXXA 2ZB8A 4PNZA 4YCMA 1KVQA 1NI8A 1GRCA 2FWIA 3O2QB 4DLSA 4EF6A 3MOSA 3GPDG 2LZ0A 3Q3VA 2ON6A 4RLQA 4CNQA 4DRZA 1BEUB 1N34B 2CXTA 3HL0A 2QN7A 2XAQA 1T6BY 1XZMA 3ZQKA 3K15A 4D9FA 3O47A 3HWRA 1UBSB 4WV3A 1OZGA 2YS7A 3TL6A 3WWCA 4R71A 1ZNQO 2ZDHA 4UD6A 5IFKA 2I9KA 1DQPA 4L3VA 4YC7A 2Q6AA 3PGA1 3GI1A 3Q10A 4ISCA 3AVTA 3TTTA 1ITZA 3IT3A 3ZH2A 1XMJA 2PRIA 3RS9A 3VV3A 4Z9BA 4BN4A 4MHSA 1K6JA 2ANBA 4QULA 1I01A 1V11A 2GESA 2H7YA 1XKXA 1QR8A 2CMGA 3AONB 3EZLA 3JQ8B 2G71A 4HEA1 5B53A 4E2WA 5AKKA 1PEAA 5D00A 3SEAA 1IIBA 5DASA 1QPGA 2HK9A 4HNSA 1GCGA 3CCBA 4BKPA 2GZ2A 4N47A 3RSCA 2CXSA 1MIOB 4TLDA 2G06A 5CH8A 3PQ8A 1KZ9A 1IHDA 2P68A 2CXQA 3WGGA 4R8MA 5IX8A 1YE5A 3IQGX 2FMFA 1XI1A 1VSQA 2O3UA 2QWXA 1SU4A 5EMHA 2LW7A 3RIEA 3LDFA 2YN0A 2CHQA 2I4IA 4DIEA 1W85B 3ONDA 2D54A 4MSWC 1ODLA 2GCPA 3TNYA 3M8AA 3DMHA 3DO8A 1ZYUA 4FLYA 3HKDA 1YS4A 2DR0A 2J7KA 2QU7A 3CXHF 3I1FA 4NNPA 4F3NA 5DCLA 3R7WA 4HX2A 1N9KA 3BRQA 2ZW9A 1COZA 4WFGA 1IQ0A 4GOND 4D0LB 2H2IA 1PJSA 3TD9A 5JDIC 4Y9UA 1GG8A 2BDTA 1XYYA 1QLEB 1O8CA 4NYJR 4P3NA 5JSYA 3OP4A 4ZVNA 3SEQA 1WXIA 3VRHA 2B1IA 1C8LA 3PN1A 1QIMA 1GH6A 4EVRA 1CR6A 1Z0FA 2UYHA 4BP8A 1GCOA 1QQ6A 1S8FA 2CNBA 2HQSA 2Z4RA 4I2NA 4FBMA 4Q3EA 5SZJA 3OHMA 2XUMA 2WM8A 3IYLW 2TECE 4Z6KA 2P2GA 3AR6A 1KWKA 3E8XA 1FXKB 3KZNA 3OM9A 4H1TA 4EL0A 2GNOA 3M6LA 4JYAB 2BHLA 2VZ8A 2D7CA 4R84A 2IF2A 4WCDA 1RRGA 1EFLA 2DHDA 2GPWA 2Z83A 4QDUA 5DX8A 1OXXK 1VPVA 3PEWA 4AXXA 1QIKA 2C4HA 2AJTA 3EIHA 5DXFA 2O19A 3FLAA 2GM3A 5CVJA 2PAFA 5LBQA 1L9XA 1BFKA 5LP6F 5CMLA 3FPCA 1O7JA 1XTQA 4DV3B 3LT4A 1VPEA 1TK2A 4MVJH 2F8TA 2CB9A 2YXBA 4PELA 2XMQA 2A59A 1U9JA 2ZBEA 3OD5A 3E9QA 4ZU6X 1HZZA 5JWRA 1R5XA 3FG9A 2ZD9A 2FN8A 3ZBUA 1DRUA 1N2CE 1A5TA 2WFZA 1QIDA 3N74A 4CCAA 5FA8A 3JQFC 1A9SA 2ZOSA 3E22A 2CLDX 5GTIZ 2G0AA 2QSUA 1O4WA 2VC2B 4GR9A 1XQVA 4UASA 2FI1A 4XM0A 4BP3A 4BWAA 3GMSA 4C89A 5G1NA 2GPAA 5IDJA 3LD9A 3IVGA 1PWHA 1PR3A 1XA3A 4ECEA 3H3JA 3BKXA 4CMGA 3AWIA 2R72A 3MB5A 4UEQA 3AWDA 3AINA 1DIRA 4AJ2A 1Z36A 4H35A 1Z8DA 2FMHA 3FFBA 1YKFA 2ZBFA 4BLQA 4OP2A 4CTJA 3ECAA 2BR4A 3P26A 5LBIA 2JGDB 3U17A 4D9CA 2BSKA 3S1SA 4F96A 2OL4A 1PF7E 3RS0A 1JX6A 2EVWX 5DMHA 5AVJA 1Q7EA 4MGYR 3MJCA 4NQZA 1RMYA 2H6EA 1TQ2A 2WFAA 3DBRA 4OJKA 1C7FA 3DSRA 1WTAA 4KMSA 2RHMA 3CM0A 1V7PC 3VAYA 4CS2A 4L8FA 1THTA 1WZ2A 3NGXA 3K32A 2XX3A 3H2HA 3MFYA 1CZLA 4K1RA 1QYVA 1W34A 1RYDA 2RHGB 3AERA 4GE3A 4KX3A 4EHLA 1ZO8A 3D6JA 1G8PA 1P1CA 2H00A 3RVZA 4BMXA 2XVAA 4LJ8A 2DPYA 2ZSBA 4KXXA 5JEDA 3U16A 2IYPA 4FHEA 3RT1A 4FDMA 2ORYA 3WVNA 2Z3HA 4EF4A 4KQ9A 3PG5A 2EFGA 5J4HA 2X13A 3UAWA 1V3UA 4A8TA 2UUBB 1L7DA 4US2R 4REQA 3QVGA 4X1KA 4GMGA 4D81A 3W5DA 5JXJA 1UL1X 4MARA 4RFVA 4N9QA 3T0IA 3R44A 1E2LA 4X85A 5HILA 1Q0RA 1L4FA 1AV7A 3H4TA 3MCUA 5CDFE 2IYWA 2QYTA 1EQ2A 3PWTA 4MO2A 4F8YA 2P7HA 3ZVKA 3ICEA 2FETA 4KDCA 3RIHA 4GI5A 1VL5A 1OMOA 3R5TA 5EE9A 1HQKA 4FXPA 4QOJA 3KELA 3OCJA 4DDHA 1G63A 4JR0A 3ML0A 3GB9A 4LHXA 1DAMA 2NTEA 2Q7XA 1DIHA 4G1UC 4KBFA 1QG0A 1L4MA 5AI4A 2D74A 2P5TB 2WJWA 2YXPX 3H4IA 1YQXA 1EX6A 4MPDA 3RCBA 2EOAA 1XNHA 1FXSA 1WXEA 3PC8A 3G79A 1CNMA 1P3Y1 1E4OA 1VE1A 3HXPA 5JH7B 4RZIA 4TYMA 3QLUA 1XQ6A 4MHOA 3C5WP 4QWWA 4R8RA 4YIOA 1WCXA 4NICA 3TZLA 3R6GA 4R1LA 2R7LA 4JROA 3L8DA 4QSMA 1TO2E 4LOHA 3L8HA 3TWOA 4TUYB 4GZRB 3QTCA 1U7ZA 2WV7A 1Q7BA 4LJYA 5JI2E 4X1YB 3ENQA 3RJMA 4RPGA 1QH1B 1RAHA 2BN4A 3UCEA 1KEZA 4OXQA 3DBIA 3SOPA 3ESBA 5K4HA 2PFKA 4D0RA 3VNUA 1E58A 2AVNA 5LD2B 4QUIA 5EMMA 4K9OA 4MTXA 1CR1A 1C3EA 2OEPA 2FYTA 2I78A 2JDIA 2V7EA 3WFJA 3O8QA 5FWYB 1JIQA 4BRUA 1AGYA 5DLEA 2C61A 3T61A 2NO0A 4LY3A 4JEHA 4RK6A 4NARA 3ZNOA 3KCYA 3ZIAD 2YZMA 1DCMA 2G9QA 1MIHA 1SVLA 3IP1A 2N74A 3DMFA 3KT6A 4KTVE 3PQDA 3Q8XB 3M6AA 1Q21A 1JIKA 1GTZA 3MZ0A 5ARDA 1ILEA 3CISA 2WG0A 3U4IA 2QIOA 3DZGA 4GXQA 5B3JA 4XKJA 4MB2A 2ZRBA 3OTOO 4DV7O 3H0KA 5DBHX 1XBLA 4BBZA 3VOTA 4D92A 5JTUA 5FADA 3FTFA 3W5IA 3BBLA 3D81A 5K0BA 3AKCA 2B2NA 2X5JO 3OCQA 3CGGA 5A7HA 4B9AA 3ZGZA 3VR6H 3IXMA 3TXYA 5J2TB 1EKXA 3USZA 4DEVA 1UMDB 5CA1A 3JQAB 4OU5A 3X1MA 1TTTA 4JI6O 2FK7A 4RK7A 1HEYA 2OAQ1 4UCRA 2GHTA 1QWSA 2DRIA 1ZGHA 4MGHA 1WG8A 4AL4A 4C9BA 4IKPA 4RH1A 4G3XA 1YZKA 4KYUA 2COUA 1GN3A 2PQ6A 2YHSA 3IAXA 4BGVA 2NTYC 1W8DA 1JRLA 3H9UA 3KXLA 2GO7A 3HVUA 5ENZA 3MUNA 4H3SA 7YASA 4HDCA 2OQIA 3CNHA 1SERA 1FFBA 1Z28A 3GZNB 5FWDA 3JATB 5EIBC 1ANKA 3ND7A 2AR9A 3OAAA 4LDPA 5L6MB 3M49A 5TIIA 3ZKAA 3PI7A 1K2WA 4MR9A 1SBQA 3MLEA 5FUVA 2AF4C 3FZEA 4UXJA 1RAGA 3TKLA 1DB3A 1R10A 4IINA 2PUCA 4G28B 1KPGA 4ENPA 3SJCC 1RYFA 3OZUA 2ESRA 4GO1A 5BV8A 4HLQB 3UV3A 4U7HA 1KJZA 1ISSA 2FG6C 1WS6A 1K63A 1VMIA 4FZRA 2ZU6A 3DFFA 2YS6A 1XDZA 4HQOA 4JELA 4EX7A 2YC2C 3CWQA 1JVMA 2R8RA 1C1XA 1P1JA 4S05A 2PUJA 2RGYA 4QHTA 3SE7A 3L46A 3KQMA 4XRRA 2F2TA 2MW2B 2GTIA 1F2VA 1AUPA 4JB3A 4M1KA 1JVNA 2WHQA 5IARA 2Q5HA 3B2EA 3GLGA 4MWBA 1EFHA 4RHUA 2BLNA 3TJRA 2WIDA 1HNWB 2PF4E 5HFAA 3AG6A 3T9AA 1DX9A 5LQRA 3OJOA 4PGFA 5JG7A 4DDMA 1D0VA 5TMPA 3R24A 3FCOA 1E7WA 1Z38A 1B23P 2ZIZA 1PDOA 4LI0A 2G8LA 3FD8A 3WLHA 4B79A 3U3ZA 5F73A 5JZMA 3EY4A 4NHEA 1MAHA 2G5GX 4OJTA 3ER9A 4AF8A 2B37A 3TKYA 3N2GA 1T9HA 3ZCPA 4UATA 3IMFA 4H15A 3CZQA 2AN3A 5M3BA 4FSDA 2X6TA 4AYWA 3HV0A 2G1PA 3JATA 5KWEA 4N18A 5DMXA 1M6VA 2AK3A 4JXJA 1N8NA 2I4RA 3H2ZA 3ZCVA 1B6SA 1ZOLA 4OHWA 1AUOA 4Q6BA 1IXMA 1YR9A 3D8RA 1EM1A 5F12A 3WLKX 3PJGA 5KSWB 3I34X 3TUZC 4LYEA 4MKHA 4D3DA 1P7GA 3HNOA 2EULA 4J0DA 4DMMA 5AHRA 1W36D 3OQIA 4AB1A 1IXZA 1DEKA 1YRQA 1ZW6A 4KIUA 4PICA 3FJOA 4V2UA 1VI2A 5CJPA 2R84A 3UXYA 5K0SA 3OBBA 3L7JA 3V33A 3GVPA 4D44A 3DG9A 1DINA 4ETWA 4EY4A 1J0AA 2C9OA 4W5OA 3GQBB 4X66B 1QHTA 5F5XA 3R6WA 3GGJA 1YU9A 1CUDA 1DKOA 2I03A 2R9IA 5EJ2A 4A2PA 4E1VA 1IVYA 4QUDA 5L45A 4N21A 4D8YA 2EIKC 4AX8A 4MVMA 1K6IA 4L4ZA 4LJAA 1K8XB 3U4HA 1H94A 5ALPA 1JTKA 2FXVA 1N3IA 4R9VA 5M29A 4DC0A 4GNKA 5LSAA 4ESVA 3I73A 3STWA 2JJMA 1UFQA 4FS8A 4AJ9A 3L70H 2C94A 2QXTA 3D64A 4MQ6A 4ND8A 3IEIA 1SUWA 1XMOB 2IW1A 2G7ZA 4ZCLA 2MMGA 4ZOAA 3PL1A 5J9PC 5FV4A 4WXMA 3DVAB 1TIYA 2ID8A 3SZ3A 1T8YA 1SBCA 2VDJA 3LRXA 1NT2B 1J9GA 4K2HA 2GXQA 1AILA 1M56B 3BAZA 3C3PA 4HB4A 4NMMA 1SRRA 1YFZA 2FWPA 2OFOA 2QT9A 2WC1A 3NNDA 1NVFA 3OEHA 4WI1A 3RIXA 1J49A 3SIXA 1SBNE 4YQYA 3WIUA 1NRWA 5KTRA 3P3PA 3C3KA 4LXIA 1OV4A 1FFHA 3F8SA 4WLNA 5CX4A 3VGJA 3ZN2A 2I7DA 1I9GA 4D9MA 3SBDA 1XLTA 4OATA 1Y82A 2P2LA 1AXGA 4KPUA 3V4OA 3QHQA 1KO4A 1UDCA 2ZYGA 4D25A 2QZ9A 1J2RA 1NBWB 2JGAA 1V1RA 3AQ4A 4V0OA 5DT2A 5F2OA 3SJBA 5JCJD 1ZGZA 1H3NA 1D1QA 4G0VA 4RAQA 2L69A 3ZDCA 4EEQA 4LF4B 3O75A 3ILHA 1KYZA 2FQXA 3B13B 4HDRB 5DGXA 3S0JA 4YLGA 2NP6A 2M2IA 2PH1A 2JFZA 1XZNA 1PDVA 5DFAA 3TRKA 5KPDA 4DHEA 4H77A 2JJ1G 2QTAA 1X59A 4IPTA 3OO0A 3K9AA 2E4AA 3IQHX 4PW0A 2JJ2G 3DD5A 5JJCA 1KJ9A 3KCQA 2BTQB 1NDUA 2ODNA 1KU9A 4QDKA 4PDMA 5BP7A 2ZPTX 4KE9A 1C4KA 1ODSA 4NBLA 3AESB 4PFKA 2FLVA 2VRNA 3JVUA 1N7GA 5AOCA 3TG8A 4P35A 2FDCA 5KMGA 1WCV1 1DO2A 1PTJC 3Q0TA 4DDKA 4BV9A 1SQVH 1VDZA 4G67A 5CFQA 3FAVB 4CU5A 4UBKA 1YE8A 1WLEA 4MEBA 4RQAA 4ZT4A 1WEKA 4R5HA 1YZUA 1L4UA 1SCIA 3L6RA 2V7XA 3QPUA 4FIDA 1HPLA 1KF0A 2EGGA 4QE3A 3MWFA 2V8BA 2HJFC 1VI6A 3PZBA 1TAGA 2CCGA 4KKXB 1PFKA 3L7DA 2VPZA 3RHTA 4D4LA 4EPXA 4A15A 3P19A 5IFLA 2R8BA 5K6RA 1Z5GA 4IHJF 1RBMA 4FHGA 3O3NB 4EUEA 3I4FA 3GZTB 3PEYA 2VHJA 4QYWA 3QV2A 4WBSA 5AHXA 4RUFA 2QVZX 4PX2A 4DLWA 1W48A 2HUNA 3UBMA 1IVNA 2ZSJA 4RA6B 4Y98A 1L7MA 1NBIA 1QIHA 2CNOA 4A6DA 4AY2A 4ZHSA 5JJEB 1ZLYA 1TW3A 2DG2A 1KAHA 4ZOBA 1F2TA 5B66Z 1SELA 3SJZA 2C2MA 3VU9B 2EBUA 1VRWA 3JQDA 2G07A 4EHIA 1FDIA 3EWAA 2BOCC 2NZWA 2Y4NA 4EJ0A 1L6IA 2PX0A 1T26A 4P2GA 1E79A 3EYWA 3KAPA 2J0UA 2GV9A 3M6FA 1DTSA 1JU4A 1NXXA 2OXCA 1U0FA 4R9NA 2QRNA 3AC0A 2L2QA 4R9RA 2ZI4A 3FB6C 4XJSA 3TETA 3PE6A 4XVUA 2O50A 1U2GA 2VA8A 1CXZB 3OT1B 3IODA 5HRCA 2HHHO 4OWPB 1B41A 4QXQA 3BMOA 1M8KA 5K3DA 1GV0A 1LDNA 2KBEA 4JUIA 1L7PA 4MVOA 2WJ3A 2OHHA 2J41A 4LZWA 2FUCA 2RKWA 3GRFA 5GY7A 4UM7A 5NLLA 3TVDA 1E89A 3WK5A 5TLSA 1YDXA 1WP4A 3D6HA 3TZ6A 4XEHA 3ZXIA 5AW8A 5JE8A 4O8XB 4WXPA 1AXRA 3I9V6 4RH0A 4EY7A 2X0LA 3A0RB 2J5XA 4Q4CA 1PD3A 1KYQA 1TJNA 1G4AE 5J1TB 2OYRA 1EE2A 1KP9A 1P2BA 4GOLD 3RVMA 3BGIA 4JPRA 3HCDA 2OBNA 4PYIA 2NVUB 4HH4A 4UB8Z 2QWOB 4EEKA 4RPLA 2VP4A 4MS4A 3S4YA 1Z16A 3ND8A 5ALQA 5I01A 4MLZA 4C5AA 1GTOA 2GEUA 2NVBA 1GZ5A 1LK7A 4HAVA 1ZVVA 1SU6A 5IVHA 4GECA 4ETIA 1D0SA 2AZTA 1ZWKA 3Q3EA 4L07A 4ARBA 4DS3A 2UDPA 4DWWA 4W7SA 2GK4A 2ZAYA 1XNRO 4LHVA 1HBJA 2AHZA 4TQDA 1XZAA 2FOIA 5JXHA 4DSOA 3FYUA 3MAAC 4U7OA 1SS3A 2CD7A 2IYSA 3TBFA 2V9CA 4S3MA 4J0HA 1NFFA 2JKYA 3N2KA 3NP7A 4DC1A 3MJVA 4FFRA 3G4SV 1BH2A 4Q1CA 2B0CA 1P3DA 5K09A 3G1UA 3T3DA 3PQ2A 1WPBA 1UFIA 3DOCA 4I66A 2VQSA 1CJMA 4ZAYA 4ZU1X 1KE1A 2M6KA 3AIKA 1OFUA 3VQVA 2HN9A 2BMVA 1MA3A 1N4CA 1V8FA 1FBTA 3WGQA 3U5TA 3WGIA 2PW9A 4BV8A 2ZIUB 3CCVV 3FYEB 1N3BA 1TJ4A 4PRLA 1SXPA 2WYVA 3OX4A 5ALMA 3PHCA 3EZFA 2ZIEA 2H1WA 5EOVA 5CFMA 1BA2A 5JATA 1KNQA 4EI2A 2FE4A 3CVUA 4GYYA 2WD7A 2OE2A 5HF6A 1NR7A 2QL6A 4RD6A 1ZLZA 1NLZA 2G4VA 3QKSA 5E0KB 3ZWYA 4M55A 4DT1A 1FJXA 4TLMB 1RYEA 2JAUA 2ZI7A 1J33A 2ZM6O 1BHO1 4J07A 2PJDA 4FPPA 4J3NA 3QTTA 4BYMA 4DMKA 1RYZA 2C1ZA 2QP4A 2XAHA 2VSOA 3WRYC 3FTCA 4KMMA 3BIXA 3KQWA 4V1CB 2Z8ZA 3ETJA 2V5AA 3JAMA 3AG1B 2DFLA 3WBJA 4IUDS 1ZUWA 1A1VA 3ZHZA 3CF4G 3ZNPA 2X0JA 1TKCA 3AI1A 3PQ7A 1BD4A 2IVZA 3LUTB 3T5MA 2BSAA 1BX1A 1IQRA 1DIGA 2Q2VA 2PI4A 2XT9A 1BQ4A 1GKUB 2AZMA 3H1BA 3KLMX 4C4XA 4UZFA 1XXLA 4Y9DA 5KQGA 2Y48A 3T5AA 4JLSA 4DR6B 3M81A 5EZYB 3G2NA 5CNJA 1W0JA 4W5JA 2QEXV 2RDCA 1LA2A 1Z25A 3KKNA 3CUSA 3EIXA 4TKUA 4XQ9A 1AK9A 4KBYA 4AT1A 5LLDA 3R23A 2VJDA 2BONA 4Q37A 1GQFA 1JN0A 3OKFA 2ZIOA 1ECLA 2GOYA 1QRUA 4Z4GA 4MA4A 1IZYA 3BRSA 4F0JA 4UHHA 3PBKA 3U7QB 3ESZA 1CQJA 2GK7A 1SC5B 2AHYA 2VQEO 1O97C 3Q1LA 2ZWAA 1KK0A 1PJCA 1ZI9A 2AL7A 2FFRA 1IG0A 3CCEV 1II8A 2J9GA 3A2MA 3GJ7A 4RD2A 3V7YA 2XKBA 3AK4A 2WIKA 2QR2A 1RPAA 2YHIB 3T38A 2H4FA 2X86A 3M4ZA 4AF7A 4DEXA 1J06A 5BR4A 1FJGO 2PZSA 5JDCA 4AN4A 4LD4A 5BR8O 1H2AS 1KSHA 2XHEA 3WFVA 4Y6GB 3K5LA 3K06A 2R3SA 2IITA 2V1XA 3Q7PA 2NNLD 2TMGA 3R8FA 4HDAA 4PJ0Z 1KMQA 1EVLA 4CMIA 3O74A 1EG7A 2RH9B 3V8QA 2I3GA 4D3XA 2AXTZ 3EG5A 4K9SA 4B5KA 5DN6D 3H9EO 3F9RA 3S3XA 4EECA 2H5IA 1NR5A 2BBSA 3H1IH 2IYEA 1U5BA 4RWEA 1KY3A 5F7XA 3SPCA 2GCEA 3UMVA 2PGXA 3VOBA 3O31A 4IXNA 3OQ1A 2EJ7A 4X44A 3EVGA 1A9TA 4ZO6A 5DM6V 3IBGA 1T36B 1E9VA 3A4TA 4HDQB 2IODA 1W5BA 2X41A 3MTJA 1CRLA 3K09C 2HF2A 2FSUA 4E5KA 5CN0A 4ZTUB 1AIPA 2C1EA 4MWSA 4UUBA 5ED0A 2GVNA 4FD3A 3UMJA 4AURA 4BNIA 5KHOC 2QA5A 1UBCA 2QTGA 1HDOA 1UBLS 3H9JA 4GSKA 4ID3A 3L1HA 3CQ9A 1IJFA 2ERXA 5CYFA 5THQA 1DL5A 1QGED 3GLFE 1T15A 1Z0ZA 3QX7A 3SEFA 1IC6A 1FF9A 1ZZEA 3C6YA 3DHEA 4D0NA 4DJ5X 2WLMA 1M1YB 4QQFA 4RHEA 2WRZA 5J4LA 3HCCA 4I19A 4L16A 4NAUA 1YOVA 1QLNA 2R66A 3G2LA 5K3CA 1F0YA 3RBZA 4MVJI 1Z8FA 1R9JA 2JFGA 2ISSD 2IJIA 4GP9A 4GXRA 1OYVA 3UMCA 3FLEA 4A27A 1CY8A 4UVHA 1TAHA 1AKYA 4M60A 2UAGA 1Z2CA 2AI3A 3IEKA 4YRQA 2DLCX 4BUCA 1WN6A 1JQDA 1ST3A 5BWMA 1JG7A 2XADA 3MRTA 2J9FB 3QE3A 1M56C 3MJTA 4M21A 3W2IA 4BDSA 4RD4A 2QBYA 2GCGA 4JVMA 5IJZA 2RC6A 1N1GA 3UAOA 1YCIA 3LBNA 3VSBA 5BN5A 1RS0A 1L1RA 2BZSA 2E18A 1XMSA 2X6QA 1O96B 2QS9A 3QIVA 4GUDA 3QEKA 4L27A 5ALLA 5K5EA 3DC7A 2D5BA 2HU2A 3A9WA 1JEQB 2R1VB 3M1IA 3V8PA 2I8LA 2LJ2A 4BLPA 4HBNA 1DEXA 4HH3C 4JP2A 5K05A 5H3CA 3K5WA 1TU3A 1ESMA 2CC2A 3DYBA 3E89A 5ECYA 4AK9A 4H7KA 3D8CA 3D8SA 4WY8A 4XYEA 2Z1NA 3O84A 1SIWA 3G23A 1D8TA 3NBKA 5BNZA 3W5CA 3AEYA 4FFWA 1CIJA 4HAZA 4B40A 4ZVPA 1U97A 4C5BA 1NJFA 2YN4A 5CHEA 3CPJB 2D30A 1Q7TA 2ZCEA 1U98A 4J94A 4CTNA 4KJZA