2B1KA

Crystal structure of e. coli ccmg protein
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
LESALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of E. coli CcmG and its mutants reveal key roles of the N-terminal beta-sheet and the fingerprint region
pubmed doi rcsb
molecule keywords Thiol:disulfide interchange protein dsbE
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 48
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b1kA00
2V6OA 5ECKB 2V2GA 4ZL7A 2H72A 4BWQA 1XW5A 1WE0A 3QAGA 2I81A 3GH9A 4I6XA 3BJ5A 1X9WB 1OKDA 4RUVA 3HVVA 3GL5A 3EINA 4TR1A 1ML6A 1SJ6A 4O7HA 1ST9A 2GDRA 2H71A 2LSTA 3TCOA 1YDKA 1HNCA 5ELGA 1WIKA 4KE3A 1M2AA 5LNKe 1EEJA 3HVSA 1HYUA 1QMVA 1F2EA 2F3MA 1DE1A 4KCAA 1OAZA 2HYXA 4BPYA 4EO3A 1OC9B 1ZZYA 3LXTA 4HQZA 7GSSA 2H01A 5IO2A 2HSYA 4HEA2 4KDYA 4K1FA 3APOA 3I6AA 3M9JA 4CW9A 5ECPB 4MABA 3MDKA 2YNXA 1GUHA 3TJBA 4JZQA 3WGXA 1GULA 4Q5NA 4MCUA 11GSA 3UBKA 3LSZA 4MZBA 2B6MA 2FNOA 1C72A 3G9BA 3M0FA 4AF2A 3BCIA 20GSA 1NM3A 3KMOA 2VCVA 3VURA 1BX9A 1B48A 1V40A 4CDOA 5ECNB 4E8EA 3TJJA 2H19A 2H74A 2L5LA 1UVZA 3LYKA 1YY7A 1EWXA 1F9MA 5CRWA 1ZOFA 4KB3A 2DJ0A 2J9HA 5JWRB 1IYHA 1AC1A 4YQVA 1YKAA 1Z7RA 3F4RA 4PUFC 5ECRB 2YANA 5C04A 3E0UA 3UAPA 2L4CA 3W6GA 3BOAA 3M3MA 4WF5A 4XRAA 2E2MA 2V41A 3F6DA 3U5RE 10GSA 3ZREA 2MBTA 1VF3A 5DJMA 1Z7PA 2LV3A 1XW6A 4WETA 2L4QA 1O7UA 2QGVA 2HE3A 2VL2A 2FUG2 3FKFA 1JZRA 1F3AA 4K7NA 2WB9A 2H1DA 1RW1A 5F05A 1NHOA 2FHEA 3GH6A 1J08A 2B1KA 3DXBA 2G2QA 1YZXA 3GIXA 5AGYA 3D22A 3QAVA 2GZZA 2NTOA 4WXTA 4JE1A 4HJMA 2OE3A 5COHA 4HJ2A 4TOPA 4N11A 1XWGA 5HR3A 4ZB8A 3WT1A 3IXRA 2LS5A 2WDUA 4JBBA 4FYUA 2MMNA 2YWIA 3DD3A 3UVTA 1YEXA 3KH9A 2VLTA 2GZPA 4KSOA 2IL3A 4PGTA 1USBA 3L9UA 3P90A 4YQUA 3KGKA 1EV9A 1BYEA 3ERFA 1ZYQB 2YOIA 3C1SA 5J3RA 4MF6A 1PL2A 3DEXA 1ZCPA 1T1VA 4KCEA 4POMA 5ID2A 1W89A 2VO4A 2DIZA 4YH2A 2VCQA 3ZTLA 2NDOA 2PGTA 5IMZA 2IWTA 4OO4A 4EDYA 3ZFLA 2AB6A 3D5JA 3KCMA 1V57A 2HZFA 2RIIA 4FYBA 5LD0A 1QGVA 2LRTA 3HA9A 4JRRA 4GSSA 3ZYWA 4GSNA 3LXZA 3A2XA 4V1Ag 3GA4A 3QAWA 1O81A 2FWEA 2H30A 3QOUA 2V1MA 4AGSA 2C0FA 3DGQA 1TJDA 1EV4A 3TKSA 3UL3A 1LU4A 2C3TA 2GSTA 4HOJA 1S3AA 1U3AA 1H75A 1XIYA 4OWYA 4TW5A 5DALB 5KN0A 3UIWA 2R3XA 2OADA 3RHCA 2GSSA 4KH7A 3GX0A 2CT6A 5IIZA 1N2AA 3GRXA 2VCXA 4TR4A 1HD2A 1ERUA 4GSTA 3G7JA 1X0RA 4ZBAA 3VK9A 3EYTA 4IVFA 5CYYA 1X5EA 4F03A 3VI7A 4RI7A 3TGZA 2YZHA 3GV1A 3RAZA 1SU9A 2IPAA 2PWJA 1MD4A 1R5AA 4G10A 4Q5RA 3FZ9A 3EURA 2TRCP 1HNBA 1LJRA 4DSSB 4ULXA 5C00A 2KOKA 3N5OA 1GTIA 1XWKA 5GSTA 3W8SA 1XOBA 4HU7A 4NV5A 2OE1A 2VOCA 5J9BA 2VD1A 4EL1A 4HDEA 2H0HA 4NV2A 4LL4B 2IMKA 5ECHB 5IMVA 1MDKA 3F4TA 3IA1A 3F3QA 2VL9A 1Y6EA 4DSQA 1ERVA 5CAXA 3U6VA 4K6XA 2LRNA 3TJGA 3C8EA 2CA8A 2GVPA 4XCSA 2C0DA 3IOSA 1DBYA 2LJKA 1XWCA 3D6IA 4LMVA 4IELA 1ZGNA 2QSIA 3ERWA 3IK9A 2CV4A 2NVLA 3IHQA 3GYKA 4IN0A 3MSZA 2HZEB 4KA0A 4OFMA 4TVEA 1SD9A 1OE7A 2CVDA 1XXUA 2X8HA 1G7EA 1AQXA 1ERTA 1LBKA 1GTAA 4ZB6A 4NXIA 3TKRA 2OA7A 3APSA 2JACA 2VD0A 2BMXA 2YP6A 2GQLA 2GSQA 3ZLPA 4MZCA 2GSRA 3CSIA 3QMXA 16GSA 1W4VA 3F4SA 1TRSA 3L9SA 4ACSA 3HKRA 2DMMA 4G19A 3IDVA 2D2ZA 3C73A 1G6WA 2I9HA 2JZTA 1WRYA 4PURA 5DAKB 1MEKA 5DDLA 3QFBC 1EP7A 5JWQB 2DMLA 2ZCTA 1BJXA 2PVOC 3HVXA 5DQYA 3RPNA 1VF1A 3JCML 3D21A 4PUAA 1SD8A 3GUSA 2L57A 1JFUA 2K9FA 4X1UA 1JZOA 2MZCA 2R2JA 1A2MA 4I97A 2MBSA 1R7HA 1DSBA 3UOMA 4V2NA 4XRDA 4WR4A 5ELAA 1YF1A 1X5DA 1M9AA 1WWJA 2NPBA 5HFGA 3WD6A 2O8VB 5J5NA 2M80A 9GSSA 5IMDA 4XTSA 5D9TA 1TU8A 2XPEA 4IP6A 1EGOA 4MJBA 3TKSC 4QQ7A 2H0IA 5EY6A 4GXZA 2PPTA 2CAQA 2KUCA 6GSYA 4N10A 1THOA 3IC4A 1R26A 3CTFA 3GKKA 5J41A 2YJ7A 4LLRA 4J2FA 5ECLB 3F6FA 3ERGA 4L5LA 3VI5A 1F37A 1AUCA 4YQMA 1SKRB 4GCIA 3FY7A 3ZVJD 4EDZA 3RHBA 2I3YA 2FCHA 2DJ3A 2IMEA 4WBRD 4X0XA 3D0ZA 3IK7A 3FR6A 5B6NA 2JL4A 2YPMA 1FO5A 1T4YA 1PA3A 2B5EA 1O6JA 2I1UA 4IP1A 3HJPA 5IM9A 1M2BA 1A2JA 1XVWA 1HQOA 3LWAA 3LQ7A 3KEBA 2R6KA 3EMXA 3L9VA 1JHBA 3G7IA 4K7IA 4GF0A 2N5AA 1EP8A 3J7Yb 2YWOA 1XCCA 1DUGA 3FEUA 4O92A 1ON4A 2IJYA 3HJOA 1MD3A 5H5RA 5F06A 5IO0A 1MTCA 4WKWA 1K0AA 1XWAA 2XPDA 4IJ3A 3WYWA 4ECBA 3H8QA 1QUWA 2IMIA 3HHVA 4PNGA 1FB0A 1T7PB 4X43A 2H6YA 2X64A 4KGIA 3TUEA 3DIEA 1MDIA 1PGTA 3KP9A 2B5XA 4ZXGA 1GUKA 1SL2B 2EIOA 3R2QA 3GKNA 5HQPA 4NPBA 3EE2A 5D8IA 4EUYA 5AN1A 2F51A 3EWLA 3HJMA 2VUPA 2ES7A 2DJKA 4KW6A 1G0TA 2A4VA 5GZZB 1PKZA 2OJLA 3QR6A 4N0VA 3N9JA 4ZILA 2C4JA 1YQ1A 3CMIA 5JCGA 1AAZA 3FZ5A 2JSYA 4MMMA 4L0UA 4N30A 3DVXA 4HU9A 2DSAA 1UC7A 2E0QA 2M72A 3ME7A 4NHZA 1UA5A 2L5OA 2JZSA 4O5RA 3F3RA 2KLXA 1SJIA 2YN1A 3P8WA 3IAS2 1ABAA 1GSDA 1TRVA 4POBA 4TKYA 3EVIA 1PRXA 5IMAA 5FWGA 5B8BA 2AJQB 4POKA 2LJRA 5DVBA 5L71A 2OBKA 1PSQA 1M99A 4OD7A 1U88A 5HFIA 3C71A 1SJZA 4DSSA 3GKXA 1XBSA 3UBLA 1A0RP 3QPMA 4XIHA 1FVJA 22GSA 5HR1A 5IPGA 3M1GA 3FZ4A 1A24A 2BJXA 4GQFA 1QQ2A 4K2DA 1M0UA 4JEDA 5ENUA 1AQVA 4MF5A 5ECIB 3TB2A 3WGEA 3WGDA 4ECCA 4YAPA 3C7MA 2N5BA 3IE3A 4CHSA 3ZMKA 5B8AA 1GTBA 5H5SA 3I9V2 1NW2A 1J9BA 2A2RA 4TR1B 2L59A 1GSUA 4WF4A 4JR6A 3VPQA 4KAEA 4WBJA 4NHWA 2WZ9A 2K6VA 2FLSA 2HZEA 1X9MB 2FWHA 3RPPA 3K8NA 3PR8A 2G0FA 4KNDA 4KDXA 3HYPA 2B7JA 5DBQA 1EZKA 2X99A 2C3QA 2H75A 5EL8A 1HNAA 1PX7A 2YWMA 4EE0A 3ME8A 2VL3A 1E6BA 5DJLA 2C0GA 1GSQA 2HT9A 4XS6A 2LKUA 1T3BA 2YV7A 5HR2A 2WJUA 1SKSB 1K0DA 2A2SA 5IOWA 3DKSA 4LL1B 12GSA 2HLSA 1Z6MA 5IMFA 3FRCA 4XS4A 1B8XA 1TOFA 2LTKA 3IV4A 6GSTA 3S9FA 5GAND 1GRXA 3KMNA 3D4TA 5CRDA 2FWFA 4NWYA 4NAXA 2AHEA 3Q6OA 3QCPA 3VWVA 1GSSA 2F8AA 4OMVA 2K8SA 1PD21 3C1RA 2H66A 2MMOA 2GQKA 1SYXA 4OFTA 3A2WA 2CAIA 3LGCA 2ZUPA 4ECJA 2RM6A 5G1LA 3TKSE 2HRFA 3L0HA 5G5FA 2B7KA 2Z9SA 3GX8A 3M9KA 1Z6NA 2LNSA 5INYA 2GS3A 2OBIA 1GNEA 1ILOA 3F63A 4RQXA 3IAM2 1NSWA 1ACVA 4DEJA 1TXXA 3GHAA 5F8BA 1GL8A 2CVBA 4GWRA 2FY6A 2H0GA 3FW2A 1M7TA 5ECQB 5B6MA 3NOFA 1G6YA 3I69A 3EC3A 3QDNA 6GSXA 4Z7XA 2CZ3A 2PMTA 2F8FA 1VF2A 4KSMA 4TXOA 2R37A 4V2LA 13GSA 2P5RA 1Z5YE 2TIRA 4EKZA 2HSHA 3PH9A 5FT3A 1AQWA 2I4AA 3AY8A 3E3EA 1GH2A 2DJJA 5EVOA 3ZIJA 2GTUA 1B4QA 2DBCA 1OVNA 3RDWA 2MYGA 2OACA 3F0IA 1WPIA 4IW9A 4ZL8A 4WR5A 1K3OA 1DE2A 2HNLA 4ZBDA 1OC3A 2X8GA 1T00A 2M46A 4HZ2A 5A4WA 2LQOA 3GURA 1PQNA 5HFKA 5J4UA 2L6DA 2AV4A 3RBTA 4OO5A 4F82A 4TR3A 4AJ7A 1TKDB 1RK4A 4NMUA 5CNWA 1N8JA 3EU3A 3TKQA 3EU4A 1KBNA 1K0BA 3P7XA 4HI7A 1OC9A 5D9XA 2DIYA 4PQHA 1FVKA 5DCHA 2GGTA 4I5QA 1CQHA 3CBUA 4Q5FA 3TDGA 1V98A 4AJ8A 2H1GA 2O89A 2OKAA 5JCUA 6GSUA 4KUNA 4TRXA 3VWWA 4I8BA 1QFNA 3SBCA 1JZWA 2H76A 3A2VA 1TRUA 1TK0B 4PXOA 2DJ2A 2F9SA 5B7CA 2ON5A 2O85A 5D73A 5A4UA 1Z9HA 1PX6A 1RQMA 3NZNA 17GSA 3O76A 2O87A 5IQYA 3ED3A 4H86A 3HZ4A 3W8JA 3FZAA 1M9BA 2C0EA 1AXDA 2HRNA 1EEMA 3BCKA 1PKWA 18GSA 3LYPA 4FH8A 2FA8A 1URMA 2GQMA 1CQGA 1GLQA 4L8EA 1SKWB 2CX4A 2AUVA 3DYRA 3Q74A 4ML1A 2PBJA 4F0CA 3TJFA 1A8YA 4G9HA 4MA9A 3D4MA 2H70A 1GSFA 4IHUA 3HD5A 4V1Ap 3KXOA 1YJ6A 4MK3A 4D73B 3LG6A 4EC0A 1BEDA 1YF0A 3FR3A 3IR4A 3MNGA 1M2DA 3CRUA 3GL3A 4FYCA 3TOUA 2FWGA 5F07A 3J7Yk 2H6XA 4F2IA 5JCWA 2VM1A 1O8WA 4MH3A 2GZYA 3GKMA 1V2AA 4MJCA 3ISOA 5LCZA 2YWNA 5G2ZA 2WULA 4V2MA 2P5QA 4GRFA 1U3IA 4BVXA 2B1LA 4L0WA 2RUFA 4MF7A 4ZBBA 3LFLA 2H8LA 2HI7A 1XW9A 3KTLA 2IIYA 2VLUA 4BWSA 4MJEA 3DVWA 4XS1A 3BBYA 2KHPA 3GTUB 2JU5A 5CRGA 3CXGA 2JZRA 1SK0A 1A0FA 1XVQA 3CRTA 1QK8A 4IKHA 4MH2A 2EC4A 2PVQA 4TN8A 3QFAC 1GNWA 4PX1A 4MPGA 1THXA 3Q19A 2TRXA 2H6ZA 2V32A 5HR0A 3GFKA 1PMTA 3UJ1A 1YEPA 3KM6A 2LQQA 1OE8A 4IJIA 2DC5A 3DRNA 4KDUA 3H1NA 4TXVA 5GAPD 1GWCA 4BVYA 2YZUA 1R4WA 4L5OA 1WJKA 2PU9C 3DWVA 2IFQB 2R4VA 4HUAA 2IMFA 3FR9A 1GSYA 1TP9A 4MLYA 1Y25A 3MWHA 1V58A 4MDCA 4ECIA 4E8HA 2FGXA 5DALA 3IPZA 1A2LA 4ISDA 1VRSD 2WS2A 3APQA 3F8UA 1KTEA 1T8EB 1B9XC 4IQAA 3US3A 1GLPA 4K8MA 1TDIA 2ALBA 1OYJA 4K9ZA 6GSWA 1TK5B 5FHIA 4I2TA 4PNFA 3V1WA 3OR5A 2FA4A 3NIVA 4F0BA 4IGJA 1BAYA 1K0CA 1I9DA 1NHYA 4K0GA 2B3SA 5IOXA 3ZITA 1X5CA 3G7YA 5KN1A 2RLIA 3UARA 3KTBA 4PQ1A 1SK1A 3ZMLA 2AAWA 3KJYA 3ZFBA 3ZIVA 2YCDA 1SK2A 2B5YA 1S3CA 1R5PA 3GMFA 1VGLA 4J56E 3FK8A 2RM5A 4J57E 1WP0A 1H4OA 2XHFA 1E2YA 3VLNA 1JZDA 5E4WA 1T4ZA 1K0OA 1F6MC 4HS1A 1S3DA 4TR0A 2RUEA 2YV9A 4ML6A 2HXKA 1TW9A 5ABRA 5CP1A 4P3YB 3F9UA 1SL0B 1Q98A 4YAVA 2CX3A 1XWBA 1MDJA 3O3TA 1O73A 1I5GA 1XZOA 1J0FA 2REMA 2KP1A 4ZL9A 1EOGA 5DQSA 2LNTA 2K8VA 2VCTA 4MP4A 3UEMA 1FOVA 4RQRA 2VCWA 3DMLA 1OKTA 19GSA 3IBHA 5KEJA 2JADA 3PGTA 4PQIA 1XFLA 2DJ1A 2GLRA 4Q5QA 3IRAA 4K7OA 4EVMA 5CREA 2WFCA 4ZB9A 1BQ7A 4WEYA 3LJRA 3BD2A 2E2GA 4OCEA 1GSEA 1FB6A 3KZQA 2MMZA 5DAKA 3M8NA 2H1BA 5EPFA 4LA1A 3HDCA 1VF4A 5G30A 1SL1B 4IQ1A 3TRPA 5H5QA 3VFIA 4RI6A 1SYRA 1A23A 5AIVA 1WOUA 1JLWA 3H4KA 3WT2A 3ZL5A 6GSVA 3CSJA 4MZWA 2HFDA 4HQSA 5E59A 2O7KA 5ECOB 3UVHA 2QC7A 2YJHA 3O6TA 2ON7A 3A5WA 2WGRA 5F0GA 3TRQA 1TI3A 5D9WA 5IPHA 3H93A 2L6CA 3ZZXA 1AIUA 2IN3A 3E9JB 2CZ2A 4EXJA 3L78A 3VWXA 4AJ6A 1O85A 3CTGA 5ECSA 2LUSA 4GQCA 2KP2A 5D93A 3GSTA 4F9ZA 5G5EA 4D73A 4JU5A 1B4PA 3LEFA 5A5KA 2XBQA 1ZL9A 4K0NA 2CVKA 3CSHA 5AIXA 5AISA 4BL7A 4FO5A 4DVCA 1U87A 4G2EA 3CYNA 5A4VA 3TRXA 3TKPA 1ERWA 3I43A 2BTOT 1UN2A 2V6KA 4MJAA 4OCFA 2VL2C 3P2AA 6GSSA 2VCZA 5ID2B 1U6TA 2EIQA 3EMPA 2XBIA 1YKCA 4I2UA 2PUKC 2VIMA 1FW1A 4ZIJA 1TTZA 4OFNA 1BG5A 2P31A 4IS0A 1TU7A 2GT6A 1XPVA 2J23A 1EOHA 3GTUA 4ID0A 4POLA 3HZ8A 1A8LA 2NBSA 5G1KA 4FIWA 1K3LA 4KX4A 3SWLA 2N5FA 1QXHA 4GTUA 3ZVJA 5CRHA 2PN8A 3PINA 5GSSA 2H1AA 4ILFA 3FHKA 2LJAA 3TJKA 1Q4JA 4IBPA 1ZMAA 2H73A 3MAKA 4XS4B 1F3BA 3QD9A 4N0ZA 2C8UA 2PERA 2JSZA 1JLVA 2AYTA 4DSRA 3LORA 4MPFA 2IMDA 2OE0A 4JR4A 1KNGA 2X8CA 14GSA 3A3TA 1FAAA 1IYIA 8GSSA 2R5GA 2FD3A 3GNJA 3HXSA 2IFQA 2GT5A 2C1YA 1FHEA 3KIJA 2VM2A 1G7OA 4EF0A 1FG4A 3L4NA 1OC8A 2WCIA 1TI1A 1K3YA 4GLTA 2C80A 1V9WA 1K0MA 1O8XA 5DCGA 2MMAA 2VAFA 3KH7A 4BA7A 2DLXA 2LRCA 3ZRDA 5D9VA 2C3NA 1GTUA 4QL7A 2K18A 3FYGA 4XHMA 5J9CA 1PN9A 2P0GA 3GN3A 4QL9A 3HY2A 5ECMB 2CQ9A 3Q18A 3VPTA 2VLVA 4HZ4A 1X9SB 2LEGA 2ZNMA 1GUMA 5IMCA 5D96A 3HCZA 1SENA 1EGRA 4O32A 2QKEA 3H79A 1KEBA 5KN3A 1ZYEA 1TK8B 5JWOB 3GSSA 4TXOB 1PL1A 2E7PA 3KP8A 2WRTA 3TOTA 5KN2A 2EIRA 1K0NA 5CO3A 3UMAA 1TRWA 3VWUA 1XOAA 1WMJA 2XC2A 1B9YC 5G31A 1AW9A 3KD0A 1GP1A 1Z3EA 4LMWA
chains in the Genus database with same CATH superfamily
2V6OA 5ECKB 2V2GA 4ZL7A 2H72A 4BWQA 1XW5A 1WE0A 3QAGA 2I81A 3GH9A 4I6XA 3BJ5A 1X9WB 1OKDA 4RUVA 3HVVA 3GL5A 3EINA 4TR1A 1ML6A 1SJ6A 4O7HA 1ST9A 2GDRA 2H71A 2LSTA 3TCOA 1YDKA 1HNCA 5ELGA 1WIKA 4KE3A 1M2AA 5LNKe 1EEJA 3HVSA 1HYUA 1QMVA 1F2EA 2F3MA 1DE1A 4KCAA 1OAZA 2HYXA 4BPYA 4EO3A 1OC9B 1ZZYA 3LXTA 4HQZA 7GSSA 2H01A 5IO2A 2HSYA 4HEA2 4KDYA 4K1FA 3APOA 3I6AA 3M9JA 4CW9A 5ECPB 4MABA 3MDKA 2YNXA 1GUHA 3TJBA 4JZQA 3WGXA 1GULA 4Q5NA 4MCUA 11GSA 3UBKA 3LSZA 3LW9A 4MZBA 2B6MA 1S3RA 2FNOA 1C72A 3G9BA 3M0FA 4AF2A 3BCIA 20GSA 1NM3A 2X4AA 3KMOA 2VCVA 3VURA 2A2PA 1BX9A 1B48A 1V40A 4CDOA 5ECNB 4E8EA 3TJJA 2H19A 2H74A 2L5LA 4EIPA 1UVZA 3LYKA 1YY7A 1EWXA 1F9MA 5CRWA 1ZOFA 3MYDA 4KB3A 2DJ0A 2J9HA 5JWRB 1IYHA 1AC1A 4YQVA 2HRAA 1YKAA 1Z7RA 3F4RA 4PUFC 5ECRB 2YANA 5C04A 3E0UA 3UAPA 2L4CA 3W6GA 3BOAA 3M3MA 4WF5A 4XRAA 2E2MA 2V41A 3F6DA 3U5RE 10GSA 3ZREA 2MBTA 1VF3A 5DJMA 1Z7PA 2LV3A 1XW6A 4WETA 2L4QA 1O7UA 2QGVA 2HE3A 2VL2A 2FUG2 4G0KA 3FKFA 1JZRA 1F3AA 4K7NA 2WB9A 2H1DA 1RW1A 5F05A 1NHOA 2FHEA 3GH6A 1J08A 2B1KA 3DXBA 2G2QA 1YZXA 3GIXA 5AGYA 3D22A 3QAVA 2GZZA 2NTOA 4WXTA 4JE1A 4HJMA 2OE3A 5COHA 4HJ2A 4TOPA 4N11A 1XWGA 4Z2UA 5HR3A 4ZB8A 3WT1A 3IXRA 2LS5A 2WDUA 4JBBA 4FYUA 2MMNA 2YWIA 3DD3A 3UVTA 4YKGA 1YEXA 3KH9A 2VLTA 2GZPA 4KSOA 2IL3A 4PGTA 1USBA 3L9UA 3P90A 4YQUA 3KGKA 1EV9A 4BVXB 1BYEA 3ERFA 1ZYQB 1ZYNA 2YOIA 3C1SA 5J3RA 4MF6A 1PL2A 3DEXA 1ZCPA 1T1VA 4KCEA 4POMA 5ID2A 4Z2TA 1W89A 2VO4A 2DIZA 4YH2A 2VCQA 3ZTLA 2NDOA 2PGTA 5IMZA 2IWTA 4OO4A 4EDYA 3ZFLA 2AB6A 3D5JA 3KCMA 1V57A 2HZFA 2RIIA 4FYBA 5LD0A 1QGVA 2LRTA 3HA9A 4JRRA 4GSSA 3ZYWA 4GSNA 3LXZA 3A2XA 4V1Ag 3GA4A 3QAWA 1O81A 2FWEA 2H30A 3QOUA 2V1MA 4AGSA 2C0FA 3DGQA 1TJDA 1EV4A 3TKSA 3UL3A 1LU4A 2C3TA 2GSTA 4HOJA 1S3AA 1U3AA 1H75A 1XIYA 4OWYA 4TW5A 5DALB 5KN0A 3UIWA 2R3XA 2OADA 3RHCA 2GSSA 4KH7A 3GX0A 2CT6A 5IIZA 1N2AA 3GRXA 2VCXA 4TR4A 1HD2A 1ERUA 4GSTA 3G7JA 1X0RA 4ZBAA 3VK9A 3EYTA 4IVFA 5CYYA 1X5EA 4F03A 3VI7A 4RI7A 3TGZA 2YZHA 3GV1A 3RAZA 1SU9A 2IPAA 2PWJA 1MD4A 1R5AA 4G10A 4Q5RA 3FZ9A 3EURA 2TRCP 1HNBA 1LJRA 4DSSB 4ULXA 5C00A 2KOKA 3N5OA 1GTIA 1XWKA 5GSTA 3W8SA 1XOBA 4HU7A 4NV5A 2OE1A 2VOCA 5J9BA 2VD1A 4EL1A 4HDEA 2H0HA 4NV2A 4LL4B 2IMKA 5ECHB 5IMVA 1MDKA 3F4TA 3IA1A 3F3QA 2VL9A 1Y6EA 4DSQA 1ERVA 5CAXA 3U6VA 4K6XA 2LRNA 3TJGA 3C8EA 2CA8A 2GVPA 4XCSA 2C0DA 3IOSA 1DBYA 2LJKA 1XWCA 3D6IA 4LMVA 4IELA 1ZGNA 2QSIA 3ERWA 3IK9A 2CV4A 2NVLA 3IHQA 3GYKA 4IN0A 3MSZA 2HZEB 4KA0A 4OFMA 4TVEA 1SD9A 1OE7A 2CVDA 1XXUA 2X8HA 1G7EA 1AQXA 1ERTA 1LBKA 1GTAA 4ZB6A 4NXIA 3IHGA 3TKRA 2OA7A 3APSA 2JACA 2VD0A 2BMXA 2YP6A 2GQLA 2GSQA 3ZLPA 4MZCA 2GSRA 3CSIA 3QMXA 16GSA 1W4VA 3F4SA 1TRSA 3L9SA 4ACSA 3HKRA 2DMMA 4G19A 3IDVA 2D2ZA 3C73A 1G6WA 2I9HA 2JZTA 1WRYA 4PURA 5DAKB 1MEKA 5DDLA 3QFBC 1EP7A 5JWQB 2DMLA 2ZCTA 1BJXA 2PVOC 2A4HA 3HVXA 5DQYA 3RPNA 1VF1A 3JCML 3D21A 4PUAA 1SD8A 3GUSA 2L57A 4CY8A 2QA1A 1JFUA 2K9FA 4X1UA 1JZOA 2MZCA 2R2JA 1A2MA 4I97A 2MBSA 1R7HA 1DSBA 3UOMA 4V2NA 4XRDA 4WR4A 5ELAA 1YF1A 1X5DA 4O5QA 1M9AA 1WWJA 2NPBA 5HFGA 3WD6A 2O8VB 5J5NA 2M80A 9GSSA 5IMDA 4XTSA 1TU8A 2XPEA 4IP6A 5D9TA 1EGOA 4MJBA 3TKSC 4QQ7A 2H0IA 5EY6A 4GXZA 2PPTA 2CAQA 2KUCA 6GSYA 4N10A 1THOA 3IC4A 1R26A 3CTFA 3GKKA 4USSA 5J41A 2YJ7A 4LLRA 4J2FA 5ECLB 3F6FA 3ERGA 4L5LA 3VI5A 1F37A 1AUCA 4YQMA 1SKRB 4GCIA 4BL7B 3FY7A 3ZVJD 4EDZA 3RHBA 2I3YA 2FCHA 2DJ3A 2IMEA 4WBRD 4X0XA 3D0ZA 3IK7A 3FR6A 5B6NA 2JL4A 2YPMA 1FO5A 1T4YA 1PA3A 4X4JA 2B5EA 4ICYA 1O6JA 2I1UA 4IP1A 3HJPA 5IM9A 1M2BA 1A2JA 1XVWA 1HQOA 3LWAA 3LQ7A 3KEBA 2R6KA 3EMXA 1FOHA 3L9VA 1JHBA 3G7IA 4K7IA 4GF0A 2N5AA 1EP8A 3J7Yb 2YWOA 1XCCA 1DUGA 3FEUA 4O92A 1ON4A 2IJYA 3HJOA 1MD3A 5H5RA 5F06A 5IO0A 1MTCA 4WKWA 1K0AA 1XWAA 2XPDA 4IJ3A 3WYWA 4ECBA 3H8QA 1QUWA 2IMIA 3HHVA 4PNGA 1FB0A 1T7PB 4X43A 2H6YA 2X64A 4KGIA 3TUEA 3DIEA 1MDIA 1PGTA 3KP9A 2B5XA 4ZXGA 1GUKA 1SL2B 2EIOA 3R2QA 3GKNA 5HQPA 4NPBA 3EE2A 4YKFA 5D8IA 2HSMA 4EUYA 5AN1A 2F51A 3EWLA 3HJMA 2VUPA 2ES7A 2DJKA 4KW6A 1G0TA 2A4VA 5GZZB 1PKZA 2OJLA 3QR6A 4N0VA 3N9JA 4ZILA 2C4JA 1YQ1A 3CMIA 5JCGA 1AAZA 3FZ5A 2JSYA 4MMMA 4L0UA 4N30A 3DVXA 4HU9A 2DSAA 1UC7A 2E0QA 2M72A 3ME7A 4NHZA 1UA5A 2L5OA 2JZSA 4O5RA 3F3RA 2KLXA 1SJIA 2YN1A 3P8WA 3IAS2 1ABAA 1GSDA 4FQUA 1TRVA 4POBA 4TKYA 3EVIA 1PRXA 5IMAA 5FWGA 5B8BA 2AJQB 4POKA 2LJRA 5DVBA 5L71A 2OBKA 1PSQA 1M99A 4G0IA 4OD7A 1U88A 5HFIA 3C71A 1SJZA 4DSSA 3GKXA 1XBSA 3UBLA 1A0RP 3QPMA 4XIHA 1FVJA 22GSA 5HR1A 5IPGA 3M1GA 3FZ4A 1A24A 2BJXA 4GQFA 1QQ2A 4K2DA 1M0UA 4JEDA 5ENUA 1AQVA 4MF5A 5ECIB 3TB2A 3WGEA 3WGDA 4ECCA 4YAPA 3C7MA 2N5BA 3IE3A 1ZYPA 4CHSA 3ZMKA 5B8AA 1GTBA 5H5SA 3I9V2 1NW2A 1J9BA 2A2RA 4TR1B 2L59A 1GSUA 4WF4A 4JR6A 3VPQA 4KAEA 4WBJA 4NHWA 2WZ9A 2K6VA 2FLSA 2HZEA 1X9MB 2FWHA 3RPPA 3K8NA 3PR8A 4BIKA 2G0FA 4KNDA 4KDXA 3HYPA 2B7JA 5DBQA 1EZKA 2X99A 2C3QA 2H75A 5EL8A 1HNAA 1PX7A 2YWMA 4EE0A 3ME8A 2VL3A 1E6BA 5DJLA 2C0GA 1GSQA 2HT9A 4XS6A 2LKUA 1T3BA 2YV7A 5HR2A 2WJUA 1SKSB 1K0DA 2A2SA 5IOWA 3DKSA 4LL1B 12GSA 2HLSA 4BVYB 1Z6MA 5IMFA 3FRCA 4XS4A 1B8XA 1TOFA 2LTKA 3IV4A 6GSTA 2R0PA 3S9FA 5GAND 1GRXA 3KMNA 3D4TA 5CRDA 2FWFA 4NWYA 4NAXA 2AHEA 3Q6OA 3QCPA 3VWVA 1GSSA 2F8AA 4OMVA 2K8SA 1PD21 3C1RA 2H66A 2MMOA 2GQKA 1SYXA 4OFTA 3A2WA 2CAIA 3LGCA 2ZUPA 4ECJA 2RM6A 5G1LA 3TKSE 2HRFA 3L0HA 5G5FA 2B7KA 2Z9SA 3GX8A 3M9KA 1Z6NA 2LNSA 3MIXA 5INYA 2GS3A 2OBIA 1GNEA 1ILOA 3R3EA 3F63A 4RQXA 3IAM2 1NSWA 1ACVA 4DEJA 1TXXA 3GHAA 5F8BA 1GL8A 2CVBA 4GWRA 2FY6A 2H0GA 3FW2A 1M7TA 5ECQB 5B6MA 3NOFA 1G6YA 3I69A 3EC3A 3QDNA 6GSXA 4Z7XA 2CZ3A 2PMTA 2F8FA 1VF2A 4KSMA 4TXOA 2R37A 4V2LA 13GSA 2P5RA 1Z5YE 2TIRA 4EKZA 2HSHA 3PH9A 5FT3A 1AQWA 2I4AA 3AY8A 3E3EA 1GH2A 2DJJA 5EVOA 3ZIJA 2GTUA 1B4QA 2DBCA 2R0GA 1OVNA 3RDWA 2MYGA 2OACA 3F0IA 1WPIA 4IW9A 2DKIA 4ZL8A 4WR5A 1K3OA 1DE2A 2HNLA 4ZBDA 1OC3A 4KF9A 2X8GA 1T00A 2M46A 4HZ2A 5A4WA 2LQOA 3GURA 1PQNA 5HFKA 5J4UA 2L6DA 2AV4A 3RBTA 4OO5A 4F82A 4TR3A 4AJ7A 1TKDB 1RK4A 4NMUA 5CNWA 1N8JA 3EU3A 3TKQA 3EU4A 1KBNA 2X49A 1K0BA 3P7XA 4HI7A 1OC9A 5D9XA 2DIYA 4PQHA 1FVKA 5DCHA 2GGTA 4I5QA 1CQHA 3CBUA 4Q5FA 3TDGA 1V98A 4AJ8A 2H1GA 2O89A 2OKAA 5JCUA 6GSUA 4KUNA 4TRXA 3VWWA 4I8BA 1QFNA 3SBCA 1JZWA 2H76A 3A2VA 1TRUA 1TK0B 4PXOA 2DJ2A 1PFOA 2F9SA 5B7CA 2ON5A 2O85A 5D73A 5A4UA 1Z9HA 1PX6A 3FMWA 1RQMA 3NZNA 17GSA 3O76A 2O87A 5IQYA 3ED3A 2R0CA 4H86A 3HZ4A 3W8JA 3FZAA 1M9BA 2C0EA 1AXDA 2HRNA 1EEMA 3BCKA 1PKWA 18GSA 3LYPA 4FH8A 2FA8A 1URMA 2GQMA 4A5PA 1CQGA 1GLQA 4L8EA 1SKWB 2CX4A 2AUVA 4EIQA 5KOXA 3DYRA 3Q74A 4ML1A 2PBJA 4F0CA 3TJFA 1A8YA 4G9HA 4MA9A 3D4MA 2H70A 1GSFA 4IHUA 3HD5A 4V1Ap 3KXOA 1YJ6A 4MK3A 4D73B 3LG6A 4EC0A 1BEDA 1YF0A 3FR3A 2HRKA 3IR4A 3MNGA 1M2DA 3CRUA 4HSCX 3GL3A 4FYCA 3TOUA 2FWGA 5F07A 3J7Yk 2H6XA 4F2IA 5JCWA 2VM1A 1O8WA 4MH3A 2GZYA 3GKMA 1V2AA 4MJCA 3ISOA 5LCZA 2YWNA 5G2ZA 2WULA 4V2MA 2P5QA 4GRFA 1U3IA 4BVXA 2B1LA 4L0WA 2RUFA 4MF7A 4ZBBA 3LFLA 2H8LA 2HI7A 1XW9A 3KTLA 2IIYA 2VLUA 4BWSA 4MJEA 4K5RA 3DVWA 4XS1A 3BBYA 2KHPA 3GTUB 2JU5A 4MNNA 5CRGA 3CXGA 2JZRA 1SK0A 1A0FA 1XVQA 3CRTA 1QK8A 4IKHA 5BRTA 4MH2A 2EC4A 2PVQA 4TN8A 3QFAC 1GNWA 4PX1A 4MPGA 1THXA 3Q19A 2TRXA 2H6ZA 2V32A 4PTSA 5HR0A 3GFKA 1PMTA 3UJ1A 1YEPA 3KM6A 2LQQA 1OE8A 4IJIA 2DC5A 3DRNA 4KDUA 3H1NA 4TXVA 5GAPD 1GWCA 4BVYA 2YZUA 1R4WA 4L5OA 1WJKA 2PU9C 3DWVA 2IFQB 2R4VA 4HUAA 2IMFA 3FR9A 1GSYA 1TP9A 4MLYA 1Y25A 3MWHA 1V58A 4MDCA 4ECIA 4E8HA 2FGXA 5DALA 3IPZA 1A2LA 4ISDA 1VRSD 2WS2A 1M3IA 3APQA 3F8UA 1KTEA 1T8EB 1B9XC 4IQAA 3US3A 1GLPA 4K8MA 1TDIA 2ALBA 1OYJA 4K9ZA 6GSWA 1TK5B 5FHIA 4I2TA 4PNFA 3V1WA 3OR5A 2FA4A 3NIVA 4F0BA 4IGJA 1BAYA 1K0CA 2DKHA 1I9DA 4G0LA 1NHYA 4K0GA 2B3SA 5BMUA 5IOXA 3ZITA 1X5CA 3G7YA 5KN1A 2RLIA 3UARA 3KTBA 4PQ1A 1SK1A 3ZMLA 2AAWA 3KJYA 3ZFBA 3ZIVA 1M3JA 2YCDA 1SK2A 2B5YA 1S3CA 1R5PA 3GMFA 1VGLA 4J56E 3FK8A 2RM5A 4J57E 1WP0A 1H4OA 2XHFA 1E2YA 3VLNA 1JZDA 5E4WA 1T4ZA 1K0OA 1F6MC 4HS1A 1S3DA 4TR0A 2RUEA 2YV9A 4ML6A 2HXKA 1TW9A 5ABRA 5CP1A 4P3YB 3F9UA 1SL0B 1Q98A 4YAVA 2CX3A 1XWBA 1MDJA 3O3TA 1O73A 1I5GA 1XZOA 1J0FA 2REMA 2KP1A 4ZL9A 1EOGA 5DQSA 2LNTA 2K8VA 2VCTA 4MP4A 3UEMA 1FOVA 4RQRA 2VCWA 3DMLA 3CQFA 1OKTA 19GSA 4O5UA 3IBHA 5KEJA 2JADA 3PGTA 4PQIA 1XFLA 2DJ1A 2GLRA 4Q5QA 3IRAA 4K7OA 4EVMA 5CREA 2WFCA 4ZB9A 1BQ7A 2QA2A 4WEYA 3LJRA 3BD2A 2E2GA 4Z2RA 4OCEA 1GSEA 1FB6A 3KZQA 2MMZA 5DAKA 3M8NA 2H1BA 5EPFA 4LA1A 3HDCA 1VF4A 5G30A 1SL1B 4IQ1A 3TRPA 5H5QA 3VFIA 4RI6A 1SYRA 1A23A 5AIVA 1WOUA 4CY6A 1JLWA 3H4KA 3WT2A 3ZL5A 6GSVA 3CSJA 4MZWA 2HFDA 4HQSA 5E59A 2O7KA 5ECOB 3UVHA 2QC7A 2YJHA 3O6TA 2ON7A 3A5WA 2WGRA 5F0GA 3TRQA 2UZ8A 1TI3A 5D9WA 5IPHA 3H93A 2L6CA 3ZZXA 3IC8A 1AIUA 2IN3A 3E9JB 2CZ2A 4EXJA 3L78A 3VWXA 4AJ6A 1O85A 3CTGA 1PN0A 5ECSA 2LUSA 4GQCA 2KP2A 5D93A 3GSTA 4F9ZA 5G5EA 3PPUA 4D73A 4JU5A 1B4PA 3LEFA 5A5KA 2XBQA 1ZL9A 4K0NA 2CVKA 3CSHA 5AIXA 5AISA 4BL7A 4FO5A 4DVCA 1U87A 4G2EA 3CYNA 5A4VA 3TRXA 3TKPA 1XG8A 1ERWA 3I43A 2BTOT 1UN2A 2V6KA 4MJAA 4OCFA 2VL2C 3P2AA 6GSSA 2VCZA 5ID2B 1U6TA 2EIQA 3EMPA 2XBIA 1YKCA 4I2UA 2PUKC 2VIMA 1FW1A 4ZIJA 1TTZA 4OFNA 1BG5A 2P31A 3HVNA 4IS0A 1TU7A 2GT6A 1XPVA 2J23A 1EOHA 3GTUA 4ID0A 4POLA 3HZ8A 1A8LA 2NBSA 5G1KA 4FIWA 1K3LA 4KX4A 3SWLA 3A5IA 2N5FA 1QXHA 4GTUA 3ZVJA 5CRHA 2PN8A 3PINA 5GSSA 2H1AA 4ILFA 3FHKA 2LJAA 3TJKA 1Q4JA 4IBPA 1ZMAA 2H73A 3MAKA 4XS4B 1F3BA 3QD9A 4N0ZA 2C8UA 2PERA 2JSZA 1JLVA 2AYTA 4DSRA 3LORA 4MPFA 2IMDA 2OE0A 4JR4A 1KNGA 2X8CA 14GSA 3A3TA 1FAAA 1IYIA 8GSSA 2R5GA 2FD3A 3GNJA 3HXSA 2IFQA 2GT5A 2C1YA 1FHEA 3KIJA 2VM2A 1G7OA 4EF0A 1FG4A 3L4NA 1OC8A 2WCIA 1TI1A 1K3YA 4GLTA 2C80A 1V9WA 1K0MA 1O8XA 5DCGA 2MMAA 2VAFA 3KH7A 4BA7A 2DLXA 2LRCA 3ZRDA 5D9VA 2C3NA 1GTUA 4QL7A 2K18A 3FYGA 4XHMA 5J9CA 5KOWA 1PN9A 2P0GA 3GN3A 4QL9A 3HY2A 5ECMB 3EPTA 2CQ9A 3Q18A 3VPTA 2VLVA 4HZ4A 1X9SB 2LEGA 2ZNMA 1GUMA 5IMCA 5D96A 3HCZA 1SENA 1EGRA 4O32A 2QKEA 3H79A 1KEBA 5KN3A 1ZYEA 1TK8B 5JWOB 3GSSA 4TXOB 1PL1A 2E7PA 4K2XA 3KP8A 2WRTA 3TOTA 5KN2A 2EIRA 1K0NA 5CO3A 3UMAA 1TRWA 3VWUA 1XOAA 1WMJA 2XC2A 1B9YC 5G31A 1AW9A 3KD0A 4K5SA 1GP1A 1Z3EA 4LMWA
chains in the Genus database with same CATH topology
2V6OA 5ECKB 2V2GA 4ZL7A 2H72A 4BWQA 1XW5A 1WE0A 3QAGA 2I81A 3GH9A 4I6XA 3BJ5A 1X9WB 1OKDA 4RUVA 3HVVA 3GL5A 3EINA 4TR1A 1ML6A 1SJ6A 4O7HA 1ST9A 2GDRA 2H71A 2LSTA 3TCOA 1YDKA 1HNCA 5ELGA 1WIKA 4KE3A 1M2AA 5LNKe 1EEJA 3HVSA 1HYUA 1QMVA 1F2EA 2F3MA 1DE1A 4KCAA 1OAZA 2HYXA 4BPYA 4EO3A 1OC9B 1ZZYA 3LXTA 4HQZA 7GSSA 2H01A 5IO2A 2HSYA 4HEA2 4KDYA 4K1FA 3APOA 3I6AA 3M9JA 4CW9A 5ECPB 4MABA 3MDKA 2YNXA 1GUHA 3TJBA 4JZQA 3WGXA 1GULA 4Q5NA 4MCUA 11GSA 3UBKA 3LSZA 3LW9A 4MZBA 2B6MA 2FNOA 1C72A 3G9BA 3M0FA 4AF2A 3BCIA 20GSA 1NM3A 2X4AA 3KMOA 2VCVA 3VURA 2A2PA 1BX9A 1B48A 1V40A 4CDOA 5ECNB 4E8EA 3TJJA 2H19A 2H74A 2L5LA 4EIPA 1UVZA 3LYKA 1YY7A 1EWXA 1F9MA 5CRWA 1ZOFA 3MYDA 4KB3A 2DJ0A 2J9HA 5JWRB 1IYHA 1AC1A 4YQVA 2HRAA 1YKAA 1Z7RA 3F4RA 4PUFC 5ECRB 2YANA 5C04A 3E0UA 3UAPA 2L4CA 3W6GA 3BOAA 3M3MA 4WF5A 4XRAA 2E2MA 2V41A 3F6DA 3U5RE 10GSA 3ZREA 2MBTA 1VF3A 5DJMA 1Z7PA 2LV3A 1XW6A 4WETA 2L4QA 1O7UA 2QGVA 2HE3A 2VL2A 2FUG2 4G0KA 3FKFA 1JZRA 1F3AA 4K7NA 2WB9A 2H1DA 1RW1A 5F05A 1NHOA 2FHEA 3GH6A 1J08A 2B1KA 3DXBA 2G2QA 1YZXA 3GIXA 5AGYA 3D22A 3QAVA 2GZZA 2NTOA 4WXTA 4JE1A 4HJMA 2OE3A 5COHA 4HJ2A 4TOPA 4N11A 1XWGA 4Z2UA 5HR3A 4ZB8A 3WT1A 3IXRA 2LS5A 2WDUA 4JBBA 4FYUA 2MMNA 2YWIA 3DD3A 3UVTA 4YKGA 1YEXA 3KH9A 2VLTA 2GZPA 4KSOA 2IL3A 4PGTA 1USBA 3L9UA 3P90A 4YQUA 3KGKA 1EV9A 4BVXB 1BYEA 3ERFA 1ZYQB 1ZYNA 2YOIA 3C1SA 5J3RA 4MF6A 1PL2A 3DEXA 1ZCPA 1T1VA 4KCEA 4POMA 5ID2A 4Z2TA 1W89A 2VO4A 2DIZA 4YH2A 2VCQA 3ZTLA 2NDOA 2PGTA 5IMZA 2IWTA 4OO4A 4EDYA 3ZFLA 2AB6A 3D5JA 3KCMA 1V57A 2HZFA 2RIIA 4FYBA 5LD0A 1QGVA 2LRTA 3HA9A 4JRRA 4GSSA 3ZYWA 4GSNA 3LXZA 3A2XA 4V1Ag 3GA4A 3QAWA 1O81A 2FWEA 2H30A 3QOUA 2V1MA 4AGSA 2C0FA 3DGQA 1TJDA 1EV4A 3TKSA 3UL3A 1LU4A 2C3TA 2GSTA 4HOJA 1S3AA 1U3AA 1H75A 1XIYA 4OWYA 4TW5A 5DALB 5KN0A 3UIWA 2R3XA 2OADA 3RHCA 2GSSA 4KH7A 3GX0A 2CT6A 5IIZA 1N2AA 3GRXA 2VCXA 4TR4A 1HD2A 1ERUA 4GSTA 3G7JA 1X0RA 4ZBAA 3VK9A 3EYTA 4IVFA 5CYYA 1X5EA 4F03A 3VI7A 4RI7A 3TGZA 2YZHA 3GV1A 3RAZA 1SU9A 2IPAA 2PWJA 1MD4A 1R5AA 4G10A 4Q5RA 3FZ9A 3EURA 2TRCP 1HNBA 1LJRA 4DSSB 4ULXA 5C00A 2KOKA 3N5OA 1GTIA 1XWKA 5GSTA 3W8SA 1XOBA 4HU7A 4NV5A 2OE1A 2VOCA 5J9BA 2VD1A 4EL1A 4HDEA 2H0HA 4NV2A 4LL4B 2IMKA 5ECHB 5IMVA 1MDKA 3F4TA 3IA1A 3F3QA 2VL9A 1Y6EA 4DSQA 1ERVA 5CAXA 3U6VA 4K6XA 2LRNA 3TJGA 3C8EA 2CA8A 2GVPA 4XCSA 2C0DA 3IOSA 1DBYA 2LJKA 1XWCA 3D6IA 4LMVA 4IELA 1ZGNA 2QSIA 3ERWA 3IK9A 2CV4A 2NVLA 3IHQA 3GYKA 4IN0A 3MSZA 2HZEB 4KA0A 4OFMA 4TVEA 1SD9A 1OE7A 2CVDA 1XXUA 2X8HA 1G7EA 1AQXA 1ERTA 1LBKA 1GTAA 4ZB6A 4NXIA 3IHGA 3TKRA 2OA7A 3APSA 2JACA 2VD0A 2BMXA 2YP6A 2GQLA 2GSQA 3ZLPA 4MZCA 2GSRA 3CSIA 3QMXA 16GSA 1W4VA 3F4SA 1TRSA 3L9SA 4ACSA 3HKRA 2DMMA 4G19A 3IDVA 2D2ZA 3C73A 1G6WA 2I9HA 2JZTA 1WRYA 4PURA 5DAKB 1MEKA 5DDLA 3QFBC 1EP7A 5JWQB 2DMLA 2ZCTA 1BJXA 2PVOC 2A4HA 3HVXA 5DQYA 3RPNA 1VF1A 3JCML 3D21A 4PUAA 1SD8A 3GUSA 2L57A 4CY8A 2QA1A 1JFUA 2K9FA 4X1UA 1JZOA 2MZCA 2R2JA 1A2MA 4I97A 2MBSA 1R7HA 1DSBA 3UOMA 4V2NA 4XRDA 4WR4A 5ELAA 1YF1A 1X5DA 4O5QA 1M9AA 1WWJA 2NPBA 5HFGA 3WD6A 2O8VB 5J5NA 2M80A 9GSSA 5IMDA 4XTSA 1TU8A 2XPEA 4IP6A 5D9TA 1EGOA 4MJBA 3TKSC 4QQ7A 2H0IA 5EY6A 4GXZA 2PPTA 2CAQA 2KUCA 6GSYA 4N10A 1THOA 3IC4A 1R26A 3CTFA 3GKKA 4USSA 5J41A 2YJ7A 4LLRA 4J2FA 5ECLB 3F6FA 3ERGA 4L5LA 3VI5A 1F37A 1AUCA 4YQMA 1SKRB 4GCIA 4BL7B 3FY7A 3ZVJD 4EDZA 3RHBA 2I3YA 2FCHA 2DJ3A 2IMEA 4WBRD 4X0XA 3D0ZA 3IK7A 3FR6A 5B6NA 2JL4A 2YPMA 1FO5A 1T4YA 1PA3A 4X4JA 2B5EA 4ICYA 1O6JA 2I1UA 4IP1A 3HJPA 5IM9A 1M2BA 1A2JA 1XVWA 1HQOA 3LWAA 3LQ7A 3KEBA 2R6KA 3EMXA 1FOHA 3L9VA 1JHBA 3G7IA 4K7IA 4GF0A 2N5AA 1EP8A 3J7Yb 2YWOA 1XCCA 1DUGA 3FEUA 4O92A 1ON4A 2IJYA 3HJOA 1MD3A 5H5RA 5F06A 5IO0A 1MTCA 4WKWA 1K0AA 1XWAA 2XPDA 4IJ3A 3WYWA 4ECBA 3H8QA 1QUWA 2IMIA 3HHVA 4PNGA 1FB0A 1T7PB 4X43A 2H6YA 2X64A 4KGIA 3TUEA 3DIEA 1MDIA 1PGTA 3KP9A 2B5XA 4ZXGA 1GUKA 1SL2B 2EIOA 3R2QA 3GKNA 5HQPA 4NPBA 3EE2A 4YKFA 5D8IA 2HSMA 4EUYA 5AN1A 2F51A 3EWLA 3HJMA 2VUPA 2ES7A 2DJKA 4KW6A 1G0TA 2A4VA 5GZZB 1PKZA 2OJLA 3QR6A 4N0VA 3N9JA 4ZILA 2C4JA 1YQ1A 3CMIA 5JCGA 1AAZA 3FZ5A 2JSYA 4MMMA 4L0UA 4N30A 3DVXA 4HU9A 2DSAA 1UC7A 2E0QA 2M72A 3ME7A 4NHZA 1UA5A 2L5OA 2JZSA 4O5RA 3F3RA 2KLXA 1SJIA 2YN1A 3P8WA 3IAS2 1ABAA 1GSDA 4FQUA 1TRVA 4POBA 4TKYA 3EVIA 1PRXA 5IMAA 5FWGA 5B8BA 2AJQB 4POKA 2LJRA 5DVBA 5L71A 2OBKA 1PSQA 1M99A 4G0IA 4OD7A 1U88A 5HFIA 3C71A 1SJZA 4DSSA 3GKXA 1XBSA 3UBLA 1A0RP 3QPMA 4XIHA 1FVJA 22GSA 5HR1A 5IPGA 3M1GA 3FZ4A 1A24A 2BJXA 4GQFA 1QQ2A 4K2DA 1M0UA 4JEDA 5ENUA 1AQVA 4MF5A 5ECIB 3TB2A 3WGEA 3WGDA 4ECCA 4YAPA 3C7MA 2N5BA 3IE3A 1ZYPA 4CHSA 3ZMKA 5B8AA 1GTBA 5H5SA 3I9V2 1NW2A 1J9BA 2A2RA 4TR1B 2L59A 1GSUA 4WF4A 4JR6A 3VPQA 4KAEA 4WBJA 4NHWA 2WZ9A 2K6VA 2FLSA 2HZEA 1X9MB 2FWHA 3RPPA 3K8NA 3PR8A 2G0FA 4KNDA 4KDXA 3HYPA 2B7JA 5DBQA 1EZKA 2X99A 2C3QA 2H75A 5EL8A 1HNAA 1PX7A 2YWMA 4EE0A 3ME8A 2VL3A 1E6BA 5DJLA 2C0GA 1GSQA 2HT9A 4XS6A 2LKUA 1T3BA 2YV7A 5HR2A 2WJUA 1SKSB 1K0DA 2A2SA 5IOWA 3DKSA 4LL1B 12GSA 2HLSA 4BVYB 1Z6MA 5IMFA 3FRCA 4XS4A 1B8XA 1TOFA 2LTKA 3IV4A 6GSTA 2R0PA 3S9FA 5GAND 1GRXA 3KMNA 3D4TA 5CRDA 2FWFA 4NWYA 4NAXA 2AHEA 3Q6OA 3QCPA 3VWVA 1GSSA 2F8AA 4OMVA 2K8SA 1PD21 3C1RA 2H66A 2MMOA 2GQKA 1SYXA 4OFTA 3A2WA 2CAIA 3LGCA 2ZUPA 4ECJA 2RM6A 5G1LA 3TKSE 2HRFA 3L0HA 5G5FA 2B7KA 2Z9SA 3GX8A 3M9KA 1Z6NA 2LNSA 3MIXA 5INYA 2GS3A 2OBIA 1GNEA 1ILOA 3R3EA 3F63A 4RQXA 3IAM2 1NSWA 1ACVA 4DEJA 1TXXA 3GHAA 5F8BA 1GL8A 2CVBA 4GWRA 2FY6A 2H0GA 3FW2A 1M7TA 5ECQB 5B6MA 3NOFA 1G6YA 3I69A 3EC3A 3QDNA 6GSXA 4Z7XA 2CZ3A 2PMTA 2F8FA 1VF2A 4KSMA 4TXOA 2R37A 4V2LA 13GSA 2P5RA 1Z5YE 2TIRA 4EKZA 2HSHA 3PH9A 5FT3A 1AQWA 2I4AA 3AY8A 3E3EA 1GH2A 2DJJA 5EVOA 3ZIJA 2GTUA 1B4QA 2DBCA 2R0GA 1OVNA 3RDWA 2MYGA 2OACA 3F0IA 1WPIA 4IW9A 2DKIA 4ZL8A 4WR5A 1K3OA 1DE2A 2HNLA 4ZBDA 1OC3A 4KF9A 2X8GA 1T00A 2M46A 4HZ2A 5A4WA 2LQOA 3GURA 1PQNA 5HFKA 5J4UA 2L6DA 2AV4A 3RBTA 4OO5A 4F82A 4TR3A 4AJ7A 1TKDB 1RK4A 4NMUA 5CNWA 1N8JA 3EU3A 3TKQA 3EU4A 1KBNA 2X49A 1K0BA 3P7XA 4HI7A 1OC9A 5D9XA 2DIYA 4PQHA 1FVKA 5DCHA 2GGTA 4I5QA 1CQHA 3CBUA 4Q5FA 3TDGA 1V98A 4AJ8A 2H1GA 2O89A 2OKAA 5JCUA 6GSUA 4KUNA 4TRXA 3VWWA 4I8BA 1QFNA 3SBCA 1JZWA 2H76A 3A2VA 1TRUA 1TK0B 4PXOA 2DJ2A 2F9SA 5B7CA 2ON5A 2O85A 5D73A 5A4UA 1Z9HA 1PX6A 3FMWA 1RQMA 3NZNA 17GSA 3O76A 2O87A 5IQYA 3ED3A 2R0CA 4H86A 3HZ4A 3W8JA 3FZAA 1M9BA 2C0EA 1AXDA 2HRNA 1EEMA 3BCKA 1PKWA 18GSA 3LYPA 4FH8A 2FA8A 1URMA 2GQMA 4A5PA 1CQGA 1GLQA 4L8EA 1SKWB 2CX4A 2AUVA 4EIQA 5KOXA 3DYRA 3Q74A 4ML1A 2PBJA 4F0CA 3TJFA 1A8YA 4G9HA 4MA9A 3D4MA 2H70A 1GSFA 4IHUA 3HD5A 4V1Ap 3KXOA 1YJ6A 4MK3A 4D73B 3LG6A 4EC0A 1BEDA 1YF0A 3FR3A 2HRKA 3IR4A 3MNGA 1M2DA 3CRUA 3GL3A 4FYCA 3TOUA 2FWGA 5F07A 3J7Yk 2H6XA 4F2IA 5JCWA 2VM1A 1O8WA 4MH3A 2GZYA 3GKMA 1V2AA 4MJCA 3ISOA 5LCZA 2YWNA 5G2ZA 2WULA 4V2MA 2P5QA 4GRFA 1U3IA 4BVXA 2B1LA 4L0WA 2RUFA 4MF7A 4ZBBA 3LFLA 2H8LA 2HI7A 1XW9A 3KTLA 2IIYA 2VLUA 4BWSA 4MJEA 4K5RA 3DVWA 4XS1A 3BBYA 2KHPA 3GTUB 2JU5A 4MNNA 5CRGA 3CXGA 2JZRA 1SK0A 1A0FA 1XVQA 3CRTA 1QK8A 4IKHA 5BRTA 4MH2A 2EC4A 2PVQA 4TN8A 3QFAC 1GNWA 4PX1A 4MPGA 1THXA 3Q19A 2TRXA 2H6ZA 2V32A 4PTSA 5HR0A 3GFKA 1PMTA 3UJ1A 1YEPA 3KM6A 2LQQA 1OE8A 4IJIA 2DC5A 3DRNA 4KDUA 3H1NA 4TXVA 5GAPD 1GWCA 4BVYA 2YZUA 1R4WA 4L5OA 1WJKA 2PU9C 3DWVA 2IFQB 2R4VA 4HUAA 2IMFA 3FR9A 1GSYA 1TP9A 4MLYA 1Y25A 3MWHA 1V58A 4MDCA 4ECIA 4E8HA 2FGXA 5DALA 3IPZA 1A2LA 4ISDA 1VRSD 2WS2A 3APQA 3F8UA 1KTEA 1T8EB 1B9XC 4IQAA 3US3A 1GLPA 4K8MA 1TDIA 2ALBA 1OYJA 4K9ZA 6GSWA 1TK5B 5FHIA 4I2TA 4PNFA 3V1WA 3OR5A 2FA4A 3NIVA 4F0BA 4IGJA 1BAYA 1K0CA 2DKHA 1I9DA 4G0LA 1NHYA 4K0GA 2B3SA 5BMUA 5IOXA 3ZITA 1X5CA 3G7YA 5KN1A 2RLIA 3UARA 3KTBA 4PQ1A 1SK1A 3ZMLA 2AAWA 3KJYA 3ZFBA 3ZIVA 2YCDA 1SK2A 2B5YA 1S3CA 1R5PA 3GMFA 1VGLA 4J56E 3FK8A 2RM5A 4J57E 1WP0A 1H4OA 2XHFA 1E2YA 3VLNA 1JZDA 5E4WA 1T4ZA 1K0OA 1F6MC 4HS1A 1S3DA 4TR0A 2RUEA 2YV9A 4ML6A 2HXKA 1TW9A 5ABRA 5CP1A 4P3YB 3F9UA 1SL0B 1Q98A 4YAVA 2CX3A 1XWBA 1MDJA 3O3TA 1O73A 1I5GA 1XZOA 1J0FA 2REMA 2KP1A 4ZL9A 1EOGA 5DQSA 2LNTA 2K8VA 2VCTA 4MP4A 3UEMA 1FOVA 4RQRA 2VCWA 3DMLA 1OKTA 19GSA 4O5UA 3IBHA 5KEJA 2JADA 3PGTA 4PQIA 1XFLA 2DJ1A 2GLRA 4Q5QA 3IRAA 4K7OA 4EVMA 5CREA 2WFCA 4ZB9A 1BQ7A 2QA2A 4WEYA 3LJRA 3BD2A 2E2GA 4Z2RA 4OCEA 1GSEA 1FB6A 3KZQA 2MMZA 5DAKA 3M8NA 2H1BA 5EPFA 4LA1A 3HDCA 1VF4A 5G30A 1SL1B 4IQ1A 3TRPA 5H5QA 3VFIA 4RI6A 1SYRA 1A23A 5AIVA 1WOUA 4CY6A 1JLWA 3H4KA 3WT2A 3ZL5A 6GSVA 3CSJA 4MZWA 2HFDA 4HQSA 5E59A 2O7KA 5ECOB 3UVHA 2QC7A 2YJHA 3O6TA 2ON7A 3A5WA 2WGRA 5F0GA 3TRQA 2UZ8A 1TI3A 5D9WA 5IPHA 3H93A 2L6CA 3ZZXA 3IC8A 1AIUA 2IN3A 3E9JB 2CZ2A 4EXJA 3L78A 3VWXA 4AJ6A 1O85A 3CTGA 1PN0A 5ECSA 2LUSA 4GQCA 2KP2A 5D93A 3GSTA 4F9ZA 5G5EA 3PPUA 4D73A 4JU5A 1B4PA 3LEFA 5A5KA 2XBQA 1ZL9A 4K0NA 2CVKA 3CSHA 5AIXA 5AISA 4BL7A 4FO5A 4DVCA 1U87A 4G2EA 3CYNA 5A4VA 3TRXA 3TKPA 1ERWA 3I43A 2BTOT 1UN2A 2V6KA 4MJAA 4OCFA 2VL2C 3P2AA 6GSSA 2VCZA 5ID2B 1U6TA 2EIQA 3EMPA 2XBIA 1YKCA 4I2UA 2PUKC 2VIMA 1FW1A 4ZIJA 1TTZA 4OFNA 1BG5A 2P31A 4IS0A 1TU7A 2GT6A 1XPVA 2J23A 1EOHA 3GTUA 4ID0A 4POLA 3HZ8A 1A8LA 2NBSA 5G1KA 4FIWA 1K3LA 4KX4A 3SWLA 3A5IA 2N5FA 1QXHA 4GTUA 3ZVJA 5CRHA 2PN8A 3PINA 5GSSA 2H1AA 4ILFA 3FHKA 2LJAA 3TJKA 1Q4JA 4IBPA 1ZMAA 2H73A 3MAKA 4XS4B 1F3BA 3QD9A 4N0ZA 2C8UA 2PERA 2JSZA 1JLVA 2AYTA 4DSRA 3LORA 4MPFA 2IMDA 2OE0A 4JR4A 1KNGA 2X8CA 14GSA 3A3TA 1FAAA 1IYIA 8GSSA 2R5GA 2FD3A 3GNJA 3HXSA 2IFQA 2GT5A 2C1YA 1FHEA 3KIJA 2VM2A 1G7OA 4EF0A 1FG4A 3L4NA 1OC8A 2WCIA 1TI1A 1K3YA 4GLTA 2C80A 1V9WA 1K0MA 1O8XA 5DCGA 2MMAA 2VAFA 3KH7A 4BA7A 2DLXA 2LRCA 3ZRDA 5D9VA 2C3NA 1GTUA 4QL7A 2K18A 3FYGA 4XHMA 5J9CA 5KOWA 1PN9A 2P0GA 3GN3A 4QL9A 3HY2A 5ECMB 3EPTA 2CQ9A 3Q18A 3VPTA 2VLVA 4HZ4A 1X9SB 2LEGA 2ZNMA 1GUMA 5IMCA 5D96A 3HCZA 1SENA 1EGRA 4O32A 2QKEA 3H79A 1KEBA 5KN3A 1ZYEA 1TK8B 5JWOB 3GSSA 4TXOB 1PL1A 2E7PA 4K2XA 3KP8A 2WRTA 3TOTA 5KN2A 2EIRA 1K0NA 5CO3A 3UMAA 1TRWA 3VWUA 1XOAA 1WMJA 2XC2A 1B9YC 5G31A 1AW9A 3KD0A 4K5SA 1GP1A 1Z3EA 4LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6O A;  5ECK B;  2V2G A;  4ZL7 A;  2H72 A;  4BWQ A;  1XW5 A;  1WE0 A;  3QAG A;  2I81 A;  3GH9 A;  4I6X A;  3BJ5 A;  1X9W B;  1OKD A;  4RUV A;  3HVV A;  3GL5 A;  3EIN A;  4TR1 A;  1ML6 A;  1SJ6 A;  4O7H A;  1ST9 A;  2GDR A;  2H71 A;  2LST A;  3TCO A;  1YDK A;  1HNC A;  5ELG A;  1WIK A;  4KE3 A;  1M2A A;  5LNK e;  1EEJ A;  3HVS A;  1HYU A;  1QMV A;  1F2E A;  2F3M A;  1DE1 A;  4KCA A;  1OAZ A;  2HYX A;  4BPY A;  4EO3 A;  1OC9 B;  1ZZY A;  3LXT A;  4HQZ A;  7GSS A;  2H01 A;  5IO2 A;  2HSY A;  4HEA 2;  4KDY A;  4K1F A;  3APO A;  3I6A A;  3M9J A;  4CW9 A;  5ECP B;  4MAB A;  3MDK A;  2YNX A;  1GUH A;  3TJB A;  4JZQ A;  3WGX A;  1GUL A;  4Q5N A;  4MCU A;  11GS A;  3UBK A;  3LSZ A;  4MZB A;  2B6M A;  2FNO A;  1C72 A;  3G9B A;  3M0F A;  4AF2 A;  3BCI A;  20GS A;  1NM3 A;  3KMO A;  2VCV A;  3VUR A;  1BX9 A;  1B48 A;  1V40 A;  4CDO A;  5ECN B;  4E8E A;  3TJJ A;  2H19 A;  2H74 A;  2L5L A;  1UVZ A;  3LYK A;  1YY7 A;  1EWX A;  1F9M A;  5CRW A;  1ZOF A;  4KB3 A;  2DJ0 A;  2J9H A;  5JWR B;  1IYH A;  1AC1 A;  4YQV A;  1YKA A;  1Z7R A;  3F4R A;  4PUF C;  5ECR B;  2YAN A;  5C04 A;  3E0U A;  3UAP A;  2L4C A;  3W6G A;  3BOA A;  3M3M A;  4WF5 A;  4XRA A;  2E2M A;  2V41 A;  3F6D A;  3U5R E;  10GS A;  3ZRE A;  2MBT A;  1VF3 A;  5DJM A;  1Z7P A;  2LV3 A;  1XW6 A;  4WET A;  2L4Q A;  1O7U A;  2QGV A;  2HE3 A;  2VL2 A;  2FUG 2;  3FKF A;  1JZR A;  1F3A A;  4K7N A;  2WB9 A;  2H1D A;  1RW1 A;  5F05 A;  1NHO A;  2FHE A;  3GH6 A;  1J08 A;  2B1K A;  3DXB A;  2G2Q A;  1YZX A;  3GIX A;  5AGY A;  3D22 A;  3QAV A;  2GZZ A;  2NTO A;  4WXT A;  4JE1 A;  4HJM A;  2OE3 A;  5COH A;  4HJ2 A;  4TOP A;  4N11 A;  1XWG A;  5HR3 A;  4ZB8 A;  3WT1 A;  3IXR A;  2LS5 A;  2WDU A;  4JBB A;  4FYU A;  2MMN A;  2YWI A;  3DD3 A;  3UVT A;  1YEX A;  3KH9 A;  2VLT A;  2GZP A;  4KSO A;  2IL3 A;  4PGT A;  1USB A;  3L9U A;  3P90 A;  4YQU A;  3KGK A;  1EV9 A;  1BYE A;  3ERF A;  1ZYQ B;  2YOI A;  3C1S A;  5J3R A;  4MF6 A;  1PL2 A;  3DEX A;  1ZCP A;  1T1V A;  4KCE A;  4POM A;  5ID2 A;  1W89 A;  2VO4 A;  2DIZ A;  4YH2 A;  2VCQ A;  3ZTL A;  2NDO A;  2PGT A;  5IMZ A;  2IWT A;  4OO4 A;  4EDY A;  3ZFL A;  2AB6 A;  3D5J A;  3KCM A;  1V57 A;  2HZF A;  2RII A;  4FYB A;  5LD0 A;  1QGV A;  2LRT A;  3HA9 A;  4JRR A;  4GSS A;  3ZYW A;  4GSN A;  3LXZ A;  3A2X A;  4V1A g;  3GA4 A;  3QAW A;  1O81 A;  2FWE A;  2H30 A;  3QOU A;  2V1M A;  4AGS A;  2C0F A;  3DGQ A;  1TJD A;  1EV4 A;  3TKS A;  3UL3 A;  1LU4 A;  2C3T A;  2GST A;  4HOJ A;  1S3A A;  1U3A A;  1H75 A;  1XIY A;  4OWY A;  4TW5 A;  5DAL B;  5KN0 A;  3UIW A;  2R3X A;  2OAD A;  3RHC A;  2GSS A;  4KH7 A;  3GX0 A;  2CT6 A;  5IIZ A;  1N2A A;  3GRX A;  2VCX A;  4TR4 A;  1HD2 A;  1ERU A;  4GST A;  3G7J A;  1X0R A;  4ZBA A;  3VK9 A;  3EYT A;  4IVF A;  5CYY A;  1X5E A;  4F03 A;  3VI7 A;  4RI7 A;  3TGZ A;  2YZH A;  3GV1 A;  3RAZ A;  1SU9 A;  2IPA A;  2PWJ A;  1MD4 A;  1R5A A;  4G10 A;  4Q5R A;  3FZ9 A;  3EUR A;  2TRC P;  1HNB A;  1LJR A;  4DSS B;  4ULX A;  5C00 A;  2KOK A;  3N5O A;  1GTI A;  1XWK A;  5GST A;  3W8S A;  1XOB A;  4HU7 A;  4NV5 A;  2OE1 A;  2VOC A;  5J9B A;  2VD1 A;  4EL1 A;  4HDE A;  2H0H A;  4NV2 A;  4LL4 B;  2IMK A;  5ECH B;  5IMV A;  1MDK A;  3F4T A;  3IA1 A;  3F3Q A;  2VL9 A;  1Y6E A;  4DSQ A;  1ERV A;  5CAX A;  3U6V A;  4K6X A;  2LRN A;  3TJG A;  3C8E A;  2CA8 A;  2GVP A;  4XCS A;  2C0D A;  3IOS A;  1DBY A;  2LJK A;  1XWC A;  3D6I A;  4LMV A;  4IEL A;  1ZGN A;  2QSI A;  3ERW A;  3IK9 A;  2CV4 A;  2NVL A;  3IHQ A;  3GYK A;  4IN0 A;  3MSZ A;  2HZE B;  4KA0 A;  4OFM A;  4TVE A;  1SD9 A;  1OE7 A;  2CVD A;  1XXU A;  2X8H A;  1G7E A;  1AQX A;  1ERT A;  1LBK A;  1GTA A;  4ZB6 A;  4NXI A;  3TKR A;  2OA7 A;  3APS A;  2JAC A;  2VD0 A;  2BMX A;  2YP6 A;  2GQL A;  2GSQ A;  3ZLP A;  4MZC A;  2GSR A;  3CSI A;  3QMX A;  16GS A;  1W4V A;  3F4S A;  1TRS A;  3L9S A;  4ACS A;  3HKR A;  2DMM A;  4G19 A;  3IDV A;  2D2Z A;  3C73 A;  1G6W A;  2I9H A;  2JZT A;  1WRY A;  4PUR A;  5DAK B;  1MEK A;  5DDL A;  3QFB C;  1EP7 A;  5JWQ B;  2DML A;  2ZCT A;  1BJX A;  2PVO C;  3HVX A;  5DQY A;  3RPN A;  1VF1 A;  3JCM L;  3D21 A;  4PUA A;  1SD8 A;  3GUS A;  2L57 A;  1JFU A;  2K9F A;  4X1U A;  1JZO A;  2MZC A;  2R2J A;  1A2M A;  4I97 A;  2MBS A;  1R7H A;  1DSB A;  3UOM A;  4V2N A;  4XRD A;  4WR4 A;  5ELA A;  1YF1 A;  1X5D A;  1M9A A;  1WWJ A;  2NPB A;  5HFG A;  3WD6 A;  2O8V B;  5J5N A;  2M80 A;  9GSS A;  5IMD A;  4XTS A;  5D9T A;  1TU8 A;  2XPE A;  4IP6 A;  1EGO A;  4MJB A;  3TKS C;  4QQ7 A;  2H0I A;  5EY6 A;  4GXZ A;  2PPT A;  2CAQ A;  2KUC A;  6GSY A;  4N10 A;  1THO A;  3IC4 A;  1R26 A;  3CTF A;  3GKK A;  5J41 A;  2YJ7 A;  4LLR A;  4J2F A;  5ECL B;  3F6F A;  3ERG A;  4L5L A;  3VI5 A;  1F37 A;  1AUC A;  4YQM A;  1SKR B;  4GCI A;  3FY7 A;  3ZVJ D;  4EDZ A;  3RHB A;  2I3Y A;  2FCH A;  2DJ3 A;  2IME A;  4WBR D;  4X0X A;  3D0Z A;  3IK7 A;  3FR6 A;  5B6N A;  2JL4 A;  2YPM A;  1FO5 A;  1T4Y A;  1PA3 A;  2B5E A;  1O6J A;  2I1U A;  4IP1 A;  3HJP A;  5IM9 A;  1M2B A;  1A2J A;  1XVW A;  1HQO A;  3LWA A;  3LQ7 A;  3KEB A;  2R6K A;  3EMX A;  3L9V A;  1JHB A;  3G7I A;  4K7I A;  4GF0 A;  2N5A A;  1EP8 A;  3J7Y b;  2YWO A;  1XCC A;  1DUG A;  3FEU A;  4O92 A;  1ON4 A;  2IJY A;  3HJO A;  1MD3 A;  5H5R A;  5F06 A;  5IO0 A;  1MTC A;  4WKW A;  1K0A A;  1XWA A;  2XPD A;  4IJ3 A;  3WYW A;  4ECB A;  3H8Q A;  1QUW A;  2IMI A;  3HHV A;  4PNG A;  1FB0 A;  1T7P B;  4X43 A;  2H6Y A;  2X64 A;  4KGI A;  3TUE A;  3DIE A;  1MDI A;  1PGT A;  3KP9 A;  2B5X A;  4ZXG A;  1GUK A;  1SL2 B;  2EIO A;  3R2Q A;  3GKN A;  5HQP A;  4NPB A;  3EE2 A;  5D8I A;  4EUY A;  5AN1 A;  2F51 A;  3EWL A;  3HJM A;  2VUP A;  2ES7 A;  2DJK A;  4KW6 A;  1G0T A;  2A4V A;  5GZZ B;  1PKZ A;  2OJL A;  3QR6 A;  4N0V A;  3N9J A;  4ZIL A;  2C4J A;  1YQ1 A;  3CMI A;  5JCG A;  1AAZ A;  3FZ5 A;  2JSY A;  4MMM A;  4L0U A;  4N30 A;  3DVX A;  4HU9 A;  2DSA A;  1UC7 A;  2E0Q A;  2M72 A;  3ME7 A;  4NHZ A;  1UA5 A;  2L5O A;  2JZS A;  4O5R A;  3F3R A;  2KLX A;  1SJI A;  2YN1 A;  3P8W A;  3IAS 2;  1ABA A;  1GSD A;  1TRV A;  4POB A;  4TKY A;  3EVI A;  1PRX A;  5IMA A;  5FWG A;  5B8B A;  2AJQ B;  4POK A;  2LJR A;  5DVB A;  5L71 A;  2OBK A;  1PSQ A;  1M99 A;  4OD7 A;  1U88 A;  5HFI A;  3C71 A;  1SJZ A;  4DSS A;  3GKX A;  1XBS A;  3UBL A;  1A0R P;  3QPM A;  4XIH A;  1FVJ A;  22GS A;  5HR1 A;  5IPG A;  3M1G A;  3FZ4 A;  1A24 A;  2BJX A;  4GQF A;  1QQ2 A;  4K2D A;  1M0U A;  4JED A;  5ENU A;  1AQV A;  4MF5 A;  5ECI B;  3TB2 A;  3WGE A;  3WGD A;  4ECC A;  4YAP A;  3C7M A;  2N5B A;  3IE3 A;  4CHS A;  3ZMK A;  5B8A A;  1GTB A;  5H5S A;  3I9V 2;  1NW2 A;  1J9B A;  2A2R A;  4TR1 B;  2L59 A;  1GSU A;  4WF4 A;  4JR6 A;  3VPQ A;  4KAE A;  4WBJ A;  4NHW A;  2WZ9 A;  2K6V A;  2FLS A;  2HZE A;  1X9M B;  2FWH A;  3RPP A;  3K8N A;  3PR8 A;  2G0F A;  4KND A;  4KDX A;  3HYP A;  2B7J A;  5DBQ A;  1EZK A;  2X99 A;  2C3Q A;  2H75 A;  5EL8 A;  1HNA A;  1PX7 A;  2YWM A;  4EE0 A;  3ME8 A;  2VL3 A;  1E6B A;  5DJL A;  2C0G A;  1GSQ A;  2HT9 A;  4XS6 A;  2LKU A;  1T3B A;  2YV7 A;  5HR2 A;  2WJU A;  1SKS B;  1K0D A;  2A2S A;  5IOW A;  3DKS A;  4LL1 B;  12GS A;  2HLS A;  1Z6M A;  5IMF A;  3FRC A;  4XS4 A;  1B8X A;  1TOF A;  2LTK A;  3IV4 A;  6GST A;  3S9F A;  5GAN D;  1GRX A;  3KMN A;  3D4T A;  5CRD A;  2FWF A;  4NWY A;  4NAX A;  2AHE A;  3Q6O A;  3QCP A;  3VWV A;  1GSS A;  2F8A A;  4OMV A;  2K8S A;  1PD2 1;  3C1R A;  2H66 A;  2MMO A;  2GQK A;  1SYX A;  4OFT A;  3A2W A;  2CAI A;  3LGC A;  2ZUP A;  4ECJ A;  2RM6 A;  5G1L A;  3TKS E;  2HRF A;  3L0H A;  5G5F A;  2B7K A;  2Z9S A;  3GX8 A;  3M9K A;  1Z6N A;  2LNS A;  5INY A;  2GS3 A;  2OBI A;  1GNE A;  1ILO A;  3F63 A;  4RQX A;  3IAM 2;  1NSW A;  1ACV A;  4DEJ A;  1TXX A;  3GHA A;  5F8B A;  1GL8 A;  2CVB A;  4GWR A;  2FY6 A;  2H0G A;  3FW2 A;  1M7T A;  5ECQ B;  5B6M A;  3NOF A;  1G6Y A;  3I69 A;  3EC3 A;  3QDN A;  6GSX A;  4Z7X A;  2CZ3 A;  2PMT A;  2F8F A;  1VF2 A;  4KSM A;  4TXO A;  2R37 A;  4V2L A;  13GS A;  2P5R A;  1Z5Y E;  2TIR A;  4EKZ A;  2HSH A;  3PH9 A;  5FT3 A;  1AQW A;  2I4A A;  3AY8 A;  3E3E A;  1GH2 A;  2DJJ A;  5EVO A;  3ZIJ A;  2GTU A;  1B4Q A;  2DBC A;  1OVN A;  3RDW A;  2MYG A;  2OAC A;  3F0I A;  1WPI A;  4IW9 A;  4ZL8 A;  4WR5 A;  1K3O A;  1DE2 A;  2HNL A;  4ZBD A;  1OC3 A;  2X8G A;  1T00 A;  2M46 A;  4HZ2 A;  5A4W A;  2LQO A;  3GUR A;  1PQN A;  5HFK A;  5J4U A;  2L6D A;  2AV4 A;  3RBT A;  4OO5 A;  4F82 A;  4TR3 A;  4AJ7 A;  1TKD B;  1RK4 A;  4NMU A;  5CNW A;  1N8J A;  3EU3 A;  3TKQ A;  3EU4 A;  1KBN A;  1K0B A;  3P7X A;  4HI7 A;  1OC9 A;  5D9X A;  2DIY A;  4PQH A;  1FVK A;  5DCH A;  2GGT A;  4I5Q A;  1CQH A;  3CBU A;  4Q5F A;  3TDG A;  1V98 A;  4AJ8 A;  2H1G A;  2O89 A;  2OKA A;  5JCU A;  6GSU A;  4KUN A;  4TRX A;  3VWW A;  4I8B A;  1QFN A;  3SBC A;  1JZW A;  2H76 A;  3A2V A;  1TRU A;  1TK0 B;  4PXO A;  2DJ2 A;  2F9S A;  5B7C A;  2ON5 A;  2O85 A;  5D73 A;  5A4U A;  1Z9H A;  1PX6 A;  1RQM A;  3NZN A;  17GS A;  3O76 A;  2O87 A;  5IQY A;  3ED3 A;  4H86 A;  3HZ4 A;  3W8J A;  3FZA A;  1M9B A;  2C0E A;  1AXD A;  2HRN A;  1EEM A;  3BCK A;  1PKW A;  18GS A;  3LYP A;  4FH8 A;  2FA8 A;  1URM A;  2GQM A;  1CQG A;  1GLQ A;  4L8E A;  1SKW B;  2CX4 A;  2AUV A;  3DYR A;  3Q74 A;  4ML1 A;  2PBJ A;  4F0C A;  3TJF A;  1A8Y A;  4G9H A;  4MA9 A;  3D4M A;  2H70 A;  1GSF A;  4IHU A;  3HD5 A;  4V1A p;  3KXO A;  1YJ6 A;  4MK3 A;  4D73 B;  3LG6 A;  4EC0 A;  1BED A;  1YF0 A;  3FR3 A;  3IR4 A;  3MNG A;  1M2D A;  3CRU A;  3GL3 A;  4FYC A;  3TOU A;  2FWG A;  5F07 A;  3J7Y k;  2H6X A;  4F2I A;  5JCW A;  2VM1 A;  1O8W A;  4MH3 A;  2GZY A;  3GKM A;  1V2A A;  4MJC A;  3ISO A;  5LCZ A;  2YWN A;  5G2Z A;  2WUL A;  4V2M A;  2P5Q A;  4GRF A;  1U3I A;  4BVX A;  2B1L A;  4L0W A;  2RUF A;  4MF7 A;  4ZBB A;  3LFL A;  2H8L A;  2HI7 A;  1XW9 A;  3KTL A;  2IIY A;  2VLU A;  4BWS A;  4MJE A;  3DVW A;  4XS1 A;  3BBY A;  2KHP A;  3GTU B;  2JU5 A;  5CRG A;  3CXG A;  2JZR A;  1SK0 A;  1A0F A;  1XVQ A;  3CRT A;  1QK8 A;  4IKH A;  4MH2 A;  2EC4 A;  2PVQ A;  4TN8 A;  3QFA C;  1GNW A;  4PX1 A;  4MPG A;  1THX A;  3Q19 A;  2TRX A;  2H6Z A;  2V32 A;  5HR0 A;  3GFK A;  1PMT A;  3UJ1 A;  1YEP A;  3KM6 A;  2LQQ A;  1OE8 A;  4IJI A;  2DC5 A;  3DRN A;  4KDU A;  3H1N A;  4TXV A;  5GAP D;  1GWC A;  4BVY A;  2YZU A;  1R4W A;  4L5O A;  1WJK A;  2PU9 C;  3DWV A;  2IFQ B;  2R4V A;  4HUA A;  2IMF A;  3FR9 A;  1GSY A;  1TP9 A;  4MLY A;  1Y25 A;  3MWH A;  1V58 A;  4MDC A;  4ECI A;  4E8H A;  2FGX A;  5DAL A;  3IPZ A;  1A2L A;  4ISD A;  1VRS D;  2WS2 A;  3APQ A;  3F8U A;  1KTE A;  1T8E B;  1B9X C;  4IQA A;  3US3 A;  1GLP A;  4K8M A;  1TDI A;  2ALB A;  1OYJ A;  4K9Z A;  6GSW A;  1TK5 B;  5FHI A;  4I2T A;  4PNF A;  3V1W A;  3OR5 A;  2FA4 A;  3NIV A;  4F0B A;  4IGJ A;  1BAY A;  1K0C A;  1I9D A;  1NHY A;  4K0G A;  2B3S A;  5IOX A;  3ZIT A;  1X5C A;  3G7Y A;  5KN1 A;  2RLI A;  3UAR A;  3KTB A;  4PQ1 A;  1SK1 A;  3ZML A;  2AAW A;  3KJY A;  3ZFB A;  3ZIV A;  2YCD A;  1SK2 A;  2B5Y A;  1S3C A;  1R5P A;  3GMF A;  1VGL A;  4J56 E;  3FK8 A;  2RM5 A;  4J57 E;  1WP0 A;  1H4O A;  2XHF A;  1E2Y A;  3VLN A;  1JZD A;  5E4W A;  1T4Z A;  1K0O A;  1F6M C;  4HS1 A;  1S3D A;  4TR0 A;  2RUE A;  2YV9 A;  4ML6 A;  2HXK A;  1TW9 A;  5ABR A;  5CP1 A;  4P3Y B;  3F9U A;  1SL0 B;  1Q98 A;  4YAV A;  2CX3 A;  1XWB A;  1MDJ A;  3O3T A;  1O73 A;  1I5G A;  1XZO A;  1J0F A;  2REM A;  2KP1 A;  4ZL9 A;  1EOG A;  5DQS A;  2LNT A;  2K8V A;  2VCT A;  4MP4 A;  3UEM A;  1FOV A;  4RQR A;  2VCW A;  3DML A;  1OKT A;  19GS A;  3IBH A;  5KEJ A;  2JAD A;  3PGT A;  4PQI A;  1XFL A;  2DJ1 A;  2GLR A;  4Q5Q A;  3IRA A;  4K7O A;  4EVM A;  5CRE A;  2WFC A;  4ZB9 A;  1BQ7 A;  4WEY A;  3LJR A;  3BD2 A;  2E2G A;  4OCE A;  1GSE A;  1FB6 A;  3KZQ A;  2MMZ A;  5DAK A;  3M8N A;  2H1B A;  5EPF A;  4LA1 A;  3HDC A;  1VF4 A;  5G30 A;  1SL1 B;  4IQ1 A;  3TRP A;  5H5Q A;  3VFI A;  4RI6 A;  1SYR A;  1A23 A;  5AIV A;  1WOU A;  1JLW A;  3H4K A;  3WT2 A;  3ZL5 A;  6GSV A;  3CSJ A;  4MZW A;  2HFD A;  4HQS A;  5E59 A;  2O7K A;  5ECO B;  3UVH A;  2QC7 A;  2YJH A;  3O6T A;  2ON7 A;  3A5W A;  2WGR A;  5F0G A;  3TRQ A;  1TI3 A;  5D9W A;  5IPH A;  3H93 A;  2L6C A;  3ZZX A;  1AIU A;  2IN3 A;  3E9J B;  2CZ2 A;  4EXJ A;  3L78 A;  3VWX A;  4AJ6 A;  1O85 A;  3CTG A;  5ECS A;  2LUS A;  4GQC A;  2KP2 A;  5D93 A;  3GST A;  4F9Z A;  5G5E A;  4D73 A;  4JU5 A;  1B4P A;  3LEF A;  5A5K A;  2XBQ A;  1ZL9 A;  4K0N A;  2CVK A;  3CSH A;  5AIX A;  5AIS A;  4BL7 A;  4FO5 A;  4DVC A;  1U87 A;  4G2E A;  3CYN A;  5A4V A;  3TRX A;  3TKP A;  1ERW A;  3I43 A;  2BTO T;  1UN2 A;  2V6K A;  4MJA A;  4OCF A;  2VL2 C;  3P2A A;  6GSS A;  2VCZ A;  5ID2 B;  1U6T A;  2EIQ A;  3EMP A;  2XBI A;  1YKC A;  4I2U A;  2PUK C;  2VIM A;  1FW1 A;  4ZIJ A;  1TTZ A;  4OFN A;  1BG5 A;  2P31 A;  4IS0 A;  1TU7 A;  2GT6 A;  1XPV A;  2J23 A;  1EOH A;  3GTU A;  4ID0 A;  4POL A;  3HZ8 A;  1A8L A;  2NBS A;  5G1K A;  4FIW A;  1K3L A;  4KX4 A;  3SWL A;  2N5F A;  1QXH A;  4GTU A;  3ZVJ A;  5CRH A;  2PN8 A;  3PIN A;  5GSS A;  2H1A A;  4ILF A;  3FHK A;  2LJA A;  3TJK A;  1Q4J A;  4IBP A;  1ZMA A;  2H73 A;  3MAK A;  4XS4 B;  1F3B A;  3QD9 A;  4N0Z A;  2C8U A;  2PER A;  2JSZ A;  1JLV A;  2AYT A;  4DSR A;  3LOR A;  4MPF A;  2IMD A;  2OE0 A;  4JR4 A;  1KNG A;  2X8C A;  14GS A;  3A3T A;  1FAA A;  1IYI A;  8GSS A;  2R5G A;  2FD3 A;  3GNJ A;  3HXS A;  2IFQ A;  2GT5 A;  2C1Y A;  1FHE A;  3KIJ A;  2VM2 A;  1G7O A;  4EF0 A;  1FG4 A;  3L4N A;  1OC8 A;  2WCI A;  1TI1 A;  1K3Y A;  4GLT A;  2C80 A;  1V9W A;  1K0M A;  1O8X A;  5DCG A;  2MMA A;  2VAF A;  3KH7 A;  4BA7 A;  2DLX A;  2LRC A;  3ZRD A;  5D9V A;  2C3N A;  1GTU A;  4QL7 A;  2K18 A;  3FYG A;  4XHM A;  5J9C A;  1PN9 A;  2P0G A;  3GN3 A;  4QL9 A;  3HY2 A;  5ECM B;  2CQ9 A;  3Q18 A;  3VPT A;  2VLV A;  4HZ4 A;  1X9S B;  2LEG A;  2ZNM A;  1GUM A;  5IMC A;  5D96 A;  3HCZ A;  1SEN A;  1EGR A;  4O32 A;  2QKE A;  3H79 A;  1KEB A;  5KN3 A;  1ZYE A;  1TK8 B;  5JWO B;  3GSS A;  4TXO B;  1PL1 A;  2E7P A;  3KP8 A;  2WRT A;  3TOT A;  5KN2 A;  2EIR A;  1K0N A;  5CO3 A;  3UMA A;  1TRW A;  3VWU A;  1XOA A;  1WMJ A;  2XC2 A;  1B9Y C;  5G31 A;  1AW9 A;  3KD0 A;  1GP1 A;  1Z3E A;  4LMW A; 
#chains in the Genus database with same CATH topology
 2V6O A;  5ECK B;  2V2G A;  4ZL7 A;  2H72 A;  4BWQ A;  1XW5 A;  1WE0 A;  3QAG A;  2I81 A;  3GH9 A;  4I6X A;  3BJ5 A;  1X9W B;  1OKD A;  4RUV A;  3HVV A;  3GL5 A;  3EIN A;  4TR1 A;  1ML6 A;  1SJ6 A;  4O7H A;  1ST9 A;  2GDR A;  2H71 A;  2LST A;  3TCO A;  1YDK A;  1HNC A;  5ELG A;  1WIK A;  4KE3 A;  1M2A A;  5LNK e;  1EEJ A;  3HVS A;  1HYU A;  1QMV A;  1F2E A;  2F3M A;  1DE1 A;  4KCA A;  1OAZ A;  2HYX A;  4BPY A;  4EO3 A;  1OC9 B;  1ZZY A;  3LXT A;  4HQZ A;  7GSS A;  2H01 A;  5IO2 A;  2HSY A;  4HEA 2;  4KDY A;  4K1F A;  3APO A;  3I6A A;  3M9J A;  4CW9 A;  5ECP B;  4MAB A;  3MDK A;  2YNX A;  1GUH A;  3TJB A;  4JZQ A;  3WGX A;  1GUL A;  4Q5N A;  4MCU A;  11GS A;  3UBK A;  3LSZ A;  3LW9 A;  4MZB A;  2B6M A;  1S3R A;  2FNO A;  1C72 A;  3G9B A;  3M0F A;  4AF2 A;  3BCI A;  20GS A;  1NM3 A;  2X4A A;  3KMO A;  2VCV A;  3VUR A;  2A2P A;  1BX9 A;  1B48 A;  1V40 A;  4CDO A;  5ECN B;  4E8E A;  3TJJ A;  2H19 A;  2H74 A;  2L5L A;  4EIP A;  1UVZ A;  3LYK A;  1YY7 A;  1EWX A;  1F9M A;  5CRW A;  1ZOF A;  3MYD A;  4KB3 A;  2DJ0 A;  2J9H A;  5JWR B;  1IYH A;  1AC1 A;  4YQV A;  2HRA A;  1YKA A;  1Z7R A;  3F4R A;  4PUF C;  5ECR B;  2YAN A;  5C04 A;  3E0U A;  3UAP A;  2L4C A;  3W6G A;  3BOA A;  3M3M A;  4WF5 A;  4XRA A;  2E2M A;  2V41 A;  3F6D A;  3U5R E;  10GS A;  3ZRE A;  2MBT A;  1VF3 A;  5DJM A;  1Z7P A;  2LV3 A;  1XW6 A;  4WET A;  2L4Q A;  1O7U A;  2QGV A;  2HE3 A;  2VL2 A;  2FUG 2;  4G0K A;  3FKF A;  1JZR A;  1F3A A;  4K7N A;  2WB9 A;  2H1D A;  1RW1 A;  5F05 A;  1NHO A;  2FHE A;  3GH6 A;  1J08 A;  2B1K A;  3DXB A;  2G2Q A;  1YZX A;  3GIX A;  5AGY A;  3D22 A;  3QAV A;  2GZZ A;  2NTO A;  4WXT A;  4JE1 A;  4HJM A;  2OE3 A;  5COH A;  4HJ2 A;  4TOP A;  4N11 A;  1XWG A;  4Z2U A;  5HR3 A;  4ZB8 A;  3WT1 A;  3IXR A;  2LS5 A;  2WDU A;  4JBB A;  4FYU A;  2MMN A;  2YWI A;  3DD3 A;  3UVT A;  4YKG A;  1YEX A;  3KH9 A;  2VLT A;  2GZP A;  4KSO A;  2IL3 A;  4PGT A;  1USB A;  3L9U A;  3P90 A;  4YQU A;  3KGK A;  1EV9 A;  4BVX B;  1BYE A;  3ERF A;  1ZYQ B;  1ZYN A;  2YOI A;  3C1S A;  5J3R A;  4MF6 A;  1PL2 A;  3DEX A;  1ZCP A;  1T1V A;  4KCE A;  4POM A;  5ID2 A;  4Z2T A;  1W89 A;  2VO4 A;  2DIZ A;  4YH2 A;  2VCQ A;  3ZTL A;  2NDO A;  2PGT A;  5IMZ A;  2IWT A;  4OO4 A;  4EDY A;  3ZFL A;  2AB6 A;  3D5J A;  3KCM A;  1V57 A;  2HZF A;  2RII A;  4FYB A;  5LD0 A;  1QGV A;  2LRT A;  3HA9 A;  4JRR A;  4GSS A;  3ZYW A;  4GSN A;  3LXZ A;  3A2X A;  4V1A g;  3GA4 A;  3QAW A;  1O81 A;  2FWE A;  2H30 A;  3QOU A;  2V1M A;  4AGS A;  2C0F A;  3DGQ A;  1TJD A;  1EV4 A;  3TKS A;  3UL3 A;  1LU4 A;  2C3T A;  2GST A;  4HOJ A;  1S3A A;  1U3A A;  1H75 A;  1XIY A;  4OWY A;  4TW5 A;  5DAL B;  5KN0 A;  3UIW A;  2R3X A;  2OAD A;  3RHC A;  2GSS A;  4KH7 A;  3GX0 A;  2CT6 A;  5IIZ A;  1N2A A;  3GRX A;  2VCX A;  4TR4 A;  1HD2 A;  1ERU A;  4GST A;  3G7J A;  1X0R A;  4ZBA A;  3VK9 A;  3EYT A;  4IVF A;  5CYY A;  1X5E A;  4F03 A;  3VI7 A;  4RI7 A;  3TGZ A;  2YZH A;  3GV1 A;  3RAZ A;  1SU9 A;  2IPA A;  2PWJ A;  1MD4 A;  1R5A A;  4G10 A;  4Q5R A;  3FZ9 A;  3EUR A;  2TRC P;  1HNB A;  1LJR A;  4DSS B;  4ULX A;  5C00 A;  2KOK A;  3N5O A;  1GTI A;  1XWK A;  5GST A;  3W8S A;  1XOB A;  4HU7 A;  4NV5 A;  2OE1 A;  2VOC A;  5J9B A;  2VD1 A;  4EL1 A;  4HDE A;  2H0H A;  4NV2 A;  4LL4 B;  2IMK A;  5ECH B;  5IMV A;  1MDK A;  3F4T A;  3IA1 A;  3F3Q A;  2VL9 A;  1Y6E A;  4DSQ A;  1ERV A;  5CAX A;  3U6V A;  4K6X A;  2LRN A;  3TJG A;  3C8E A;  2CA8 A;  2GVP A;  4XCS A;  2C0D A;  3IOS A;  1DBY A;  2LJK A;  1XWC A;  3D6I A;  4LMV A;  4IEL A;  1ZGN A;  2QSI A;  3ERW A;  3IK9 A;  2CV4 A;  2NVL A;  3IHQ A;  3GYK A;  4IN0 A;  3MSZ A;  2HZE B;  4KA0 A;  4OFM A;  4TVE A;  1SD9 A;  1OE7 A;  2CVD A;  1XXU A;  2X8H A;  1G7E A;  1AQX A;  1ERT A;  1LBK A;  1GTA A;  4ZB6 A;  4NXI A;  3IHG A;  3TKR A;  2OA7 A;  3APS A;  2JAC A;  2VD0 A;  2BMX A;  2YP6 A;  2GQL A;  2GSQ A;  3ZLP A;  4MZC A;  2GSR A;  3CSI A;  3QMX A;  16GS A;  1W4V A;  3F4S A;  1TRS A;  3L9S A;  4ACS A;  3HKR A;  2DMM A;  4G19 A;  3IDV A;  2D2Z A;  3C73 A;  1G6W A;  2I9H A;  2JZT A;  1WRY A;  4PUR A;  5DAK B;  1MEK A;  5DDL A;  3QFB C;  1EP7 A;  5JWQ B;  2DML A;  2ZCT A;  1BJX A;  2PVO C;  2A4H A;  3HVX A;  5DQY A;  3RPN A;  1VF1 A;  3JCM L;  3D21 A;  4PUA A;  1SD8 A;  3GUS A;  2L57 A;  4CY8 A;  2QA1 A;  1JFU A;  2K9F A;  4X1U A;  1JZO A;  2MZC A;  2R2J A;  1A2M A;  4I97 A;  2MBS A;  1R7H A;  1DSB A;  3UOM A;  4V2N A;  4XRD A;  4WR4 A;  5ELA A;  1YF1 A;  1X5D A;  4O5Q A;  1M9A A;  1WWJ A;  2NPB A;  5HFG A;  3WD6 A;  2O8V B;  5J5N A;  2M80 A;  9GSS A;  5IMD A;  4XTS A;  1TU8 A;  2XPE A;  4IP6 A;  5D9T A;  1EGO A;  4MJB A;  3TKS C;  4QQ7 A;  2H0I A;  5EY6 A;  4GXZ A;  2PPT A;  2CAQ A;  2KUC A;  6GSY A;  4N10 A;  1THO A;  3IC4 A;  1R26 A;  3CTF A;  3GKK A;  4USS A;  5J41 A;  2YJ7 A;  4LLR A;  4J2F A;  5ECL B;  3F6F A;  3ERG A;  4L5L A;  3VI5 A;  1F37 A;  1AUC A;  4YQM A;  1SKR B;  4GCI A;  4BL7 B;  3FY7 A;  3ZVJ D;  4EDZ A;  3RHB A;  2I3Y A;  2FCH A;  2DJ3 A;  2IME A;  4WBR D;  4X0X A;  3D0Z A;  3IK7 A;  3FR6 A;  5B6N A;  2JL4 A;  2YPM A;  1FO5 A;  1T4Y A;  1PA3 A;  4X4J A;  2B5E A;  4ICY A;  1O6J A;  2I1U A;  4IP1 A;  3HJP A;  5IM9 A;  1M2B A;  1A2J A;  1XVW A;  1HQO A;  3LWA A;  3LQ7 A;  3KEB A;  2R6K A;  3EMX A;  1FOH A;  3L9V A;  1JHB A;  3G7I A;  4K7I A;  4GF0 A;  2N5A A;  1EP8 A;  3J7Y b;  2YWO A;  1XCC A;  1DUG A;  3FEU A;  4O92 A;  1ON4 A;  2IJY A;  3HJO A;  1MD3 A;  5H5R A;  5F06 A;  5IO0 A;  1MTC A;  4WKW A;  1K0A A;  1XWA A;  2XPD A;  4IJ3 A;  3WYW A;  4ECB A;  3H8Q A;  1QUW A;  2IMI A;  3HHV A;  4PNG A;  1FB0 A;  1T7P B;  4X43 A;  2H6Y A;  2X64 A;  4KGI A;  3TUE A;  3DIE A;  1MDI A;  1PGT A;  3KP9 A;  2B5X A;  4ZXG A;  1GUK A;  1SL2 B;  2EIO A;  3R2Q A;  3GKN A;  5HQP A;  4NPB A;  3EE2 A;  4YKF A;  5D8I A;  2HSM A;  4EUY A;  5AN1 A;  2F51 A;  3EWL A;  3HJM A;  2VUP A;  2ES7 A;  2DJK A;  4KW6 A;  1G0T A;  2A4V A;  5GZZ B;  1PKZ A;  2OJL A;  3QR6 A;  4N0V A;  3N9J A;  4ZIL A;  2C4J A;  1YQ1 A;  3CMI A;  5JCG A;  1AAZ A;  3FZ5 A;  2JSY A;  4MMM A;  4L0U A;  4N30 A;  3DVX A;  4HU9 A;  2DSA A;  1UC7 A;  2E0Q A;  2M72 A;  3ME7 A;  4NHZ A;  1UA5 A;  2L5O A;  2JZS A;  4O5R A;  3F3R A;  2KLX A;  1SJI A;  2YN1 A;  3P8W A;  3IAS 2;  1ABA A;  1GSD A;  4FQU A;  1TRV A;  4POB A;  4TKY A;  3EVI A;  1PRX A;  5IMA A;  5FWG A;  5B8B A;  2AJQ B;  4POK A;  2LJR A;  5DVB A;  5L71 A;  2OBK A;  1PSQ A;  1M99 A;  4G0I A;  4OD7 A;  1U88 A;  5HFI A;  3C71 A;  1SJZ A;  4DSS A;  3GKX A;  1XBS A;  3UBL A;  1A0R P;  3QPM A;  4XIH A;  1FVJ A;  22GS A;  5HR1 A;  5IPG A;  3M1G A;  3FZ4 A;  1A24 A;  2BJX A;  4GQF A;  1QQ2 A;  4K2D A;  1M0U A;  4JED A;  5ENU A;  1AQV A;  4MF5 A;  5ECI B;  3TB2 A;  3WGE A;  3WGD A;  4ECC A;  4YAP A;  3C7M A;  2N5B A;  3IE3 A;  1ZYP A;  4CHS A;  3ZMK A;  5B8A A;  1GTB A;  5H5S A;  3I9V 2;  1NW2 A;  1J9B A;  2A2R A;  4TR1 B;  2L59 A;  1GSU A;  4WF4 A;  4JR6 A;  3VPQ A;  4KAE A;  4WBJ A;  4NHW A;  2WZ9 A;  2K6V A;  2FLS A;  2HZE A;  1X9M B;  2FWH A;  3RPP A;  3K8N A;  3PR8 A;  4BIK A;  2G0F A;  4KND A;  4KDX A;  3HYP A;  2B7J A;  5DBQ A;  1EZK A;  2X99 A;  2C3Q A;  2H75 A;  5EL8 A;  1HNA A;  1PX7 A;  2YWM A;  4EE0 A;  3ME8 A;  2VL3 A;  1E6B A;  5DJL A;  2C0G A;  1GSQ A;  2HT9 A;  4XS6 A;  2LKU A;  1T3B A;  2YV7 A;  5HR2 A;  2WJU A;  1SKS B;  1K0D A;  2A2S A;  5IOW A;  3DKS A;  4LL1 B;  12GS A;  2HLS A;  4BVY B;  1Z6M A;  5IMF A;  3FRC A;  4XS4 A;  1B8X A;  1TOF A;  2LTK A;  3IV4 A;  6GST A;  2R0P A;  3S9F A;  5GAN D;  1GRX A;  3KMN A;  3D4T A;  5CRD A;  2FWF A;  4NWY A;  4NAX A;  2AHE A;  3Q6O A;  3QCP A;  3VWV A;  1GSS A;  2F8A A;  4OMV A;  2K8S A;  1PD2 1;  3C1R A;  2H66 A;  2MMO A;  2GQK A;  1SYX A;  4OFT A;  3A2W A;  2CAI A;  3LGC A;  2ZUP A;  4ECJ A;  2RM6 A;  5G1L A;  3TKS E;  2HRF A;  3L0H A;  5G5F A;  2B7K A;  2Z9S A;  3GX8 A;  3M9K A;  1Z6N A;  2LNS A;  3MIX A;  5INY A;  2GS3 A;  2OBI A;  1GNE A;  1ILO A;  3R3E A;  3F63 A;  4RQX A;  3IAM 2;  1NSW A;  1ACV A;  4DEJ A;  1TXX A;  3GHA A;  5F8B A;  1GL8 A;  2CVB A;  4GWR A;  2FY6 A;  2H0G A;  3FW2 A;  1M7T A;  5ECQ B;  5B6M A;  3NOF A;  1G6Y A;  3I69 A;  3EC3 A;  3QDN A;  6GSX A;  4Z7X A;  2CZ3 A;  2PMT A;  2F8F A;  1VF2 A;  4KSM A;  4TXO A;  2R37 A;  4V2L A;  13GS A;  2P5R A;  1Z5Y E;  2TIR A;  4EKZ A;  2HSH A;  3PH9 A;  5FT3 A;  1AQW A;  2I4A A;  3AY8 A;  3E3E A;  1GH2 A;  2DJJ A;  5EVO A;  3ZIJ A;  2GTU A;  1B4Q A;  2DBC A;  2R0G A;  1OVN A;  3RDW A;  2MYG A;  2OAC A;  3F0I A;  1WPI A;  4IW9 A;  2DKI A;  4ZL8 A;  4WR5 A;  1K3O A;  1DE2 A;  2HNL A;  4ZBD A;  1OC3 A;  4KF9 A;  2X8G A;  1T00 A;  2M46 A;  4HZ2 A;  5A4W A;  2LQO A;  3GUR A;  1PQN A;  5HFK A;  5J4U A;  2L6D A;  2AV4 A;  3RBT A;  4OO5 A;  4F82 A;  4TR3 A;  4AJ7 A;  1TKD B;  1RK4 A;  4NMU A;  5CNW A;  1N8J A;  3EU3 A;  3TKQ A;  3EU4 A;  1KBN A;  2X49 A;  1K0B A;  3P7X A;  4HI7 A;  1OC9 A;  5D9X A;  2DIY A;  4PQH A;  1FVK A;  5DCH A;  2GGT A;  4I5Q A;  1CQH A;  3CBU A;  4Q5F A;  3TDG A;  1V98 A;  4AJ8 A;  2H1G A;  2O89 A;  2OKA A;  5JCU A;  6GSU A;  4KUN A;  4TRX A;  3VWW A;  4I8B A;  1QFN A;  3SBC A;  1JZW A;  2H76 A;  3A2V A;  1TRU A;  1TK0 B;  4PXO A;  2DJ2 A;  1PFO A;  2F9S A;  5B7C A;  2ON5 A;  2O85 A;  5D73 A;  5A4U A;  1Z9H A;  1PX6 A;  3FMW A;  1RQM A;  3NZN A;  17GS A;  3O76 A;  2O87 A;  5IQY A;  3ED3 A;  2R0C A;  4H86 A;  3HZ4 A;  3W8J A;  3FZA A;  1M9B A;  2C0E A;  1AXD A;  2HRN A;  1EEM A;  3BCK A;  1PKW A;  18GS A;  3LYP A;  4FH8 A;  2FA8 A;  1URM A;  2GQM A;  4A5P A;  1CQG A;  1GLQ A;  4L8E A;  1SKW B;  2CX4 A;  2AUV A;  4EIQ A;  5KOX A;  3DYR A;  3Q74 A;  4ML1 A;  2PBJ A;  4F0C A;  3TJF A;  1A8Y A;  4G9H A;  4MA9 A;  3D4M A;  2H70 A;  1GSF A;  4IHU A;  3HD5 A;  4V1A p;  3KXO A;  1YJ6 A;  4MK3 A;  4D73 B;  3LG6 A;  4EC0 A;  1BED A;  1YF0 A;  3FR3 A;  2HRK A;  3IR4 A;  3MNG A;  1M2D A;  3CRU A;  4HSC X;  3GL3 A;  4FYC A;  3TOU A;  2FWG A;  5F07 A;  3J7Y k;  2H6X A;  4F2I A;  5JCW A;  2VM1 A;  1O8W A;  4MH3 A;  2GZY A;  3GKM A;  1V2A A;  4MJC A;  3ISO A;  5LCZ A;  2YWN A;  5G2Z A;  2WUL A;  4V2M A;  2P5Q A;  4GRF A;  1U3I A;  4BVX A;  2B1L A;  4L0W A;  2RUF A;  4MF7 A;  4ZBB A;  3LFL A;  2H8L A;  2HI7 A;  1XW9 A;  3KTL A;  2IIY A;  2VLU A;  4BWS A;  4MJE A;  4K5R A;  3DVW A;  4XS1 A;  3BBY A;  2KHP A;  3GTU B;  2JU5 A;  4MNN A;  5CRG A;  3CXG A;  2JZR A;  1SK0 A;  1A0F A;  1XVQ A;  3CRT A;  1QK8 A;  4IKH A;  5BRT A;  4MH2 A;  2EC4 A;  2PVQ A;  4TN8 A;  3QFA C;  1GNW A;  4PX1 A;  4MPG A;  1THX A;  3Q19 A;  2TRX A;  2H6Z A;  2V32 A;  4PTS A;  5HR0 A;  3GFK A;  1PMT A;  3UJ1 A;  1YEP A;  3KM6 A;  2LQQ A;  1OE8 A;  4IJI A;  2DC5 A;  3DRN A;  4KDU A;  3H1N A;  4TXV A;  5GAP D;  1GWC A;  4BVY A;  2YZU A;  1R4W A;  4L5O A;  1WJK A;  2PU9 C;  3DWV A;  2IFQ B;  2R4V A;  4HUA A;  2IMF A;  3FR9 A;  1GSY A;  1TP9 A;  4MLY A;  1Y25 A;  3MWH A;  1V58 A;  4MDC A;  4ECI A;  4E8H A;  2FGX A;  5DAL A;  3IPZ A;  1A2L A;  4ISD A;  1VRS D;  2WS2 A;  1M3I A;  3APQ A;  3F8U A;  1KTE A;  1T8E B;  1B9X C;  4IQA A;  3US3 A;  1GLP A;  4K8M A;  1TDI A;  2ALB A;  1OYJ A;  4K9Z A;  6GSW A;  1TK5 B;  5FHI A;  4I2T A;  4PNF A;  3V1W A;  3OR5 A;  2FA4 A;  3NIV A;  4F0B A;  4IGJ A;  1BAY A;  1K0C A;  2DKH A;  1I9D A;  4G0L A;  1NHY A;  4K0G A;  2B3S A;  5BMU A;  5IOX A;  3ZIT A;  1X5C A;  3G7Y A;  5KN1 A;  2RLI A;  3UAR A;  3KTB A;  4PQ1 A;  1SK1 A;  3ZML A;  2AAW A;  3KJY A;  3ZFB A;  3ZIV A;  1M3J A;  2YCD A;  1SK2 A;  2B5Y A;  1S3C A;  1R5P A;  3GMF A;  1VGL A;  4J56 E;  3FK8 A;  2RM5 A;  4J57 E;  1WP0 A;  1H4O A;  2XHF A;  1E2Y A;  3VLN A;  1JZD A;  5E4W A;  1T4Z A;  1K0O A;  1F6M C;  4HS1 A;  1S3D A;  4TR0 A;  2RUE A;  2YV9 A;  4ML6 A;  2HXK A;  1TW9 A;  5ABR A;  5CP1 A;  4P3Y B;  3F9U A;  1SL0 B;  1Q98 A;  4YAV A;  2CX3 A;  1XWB A;  1MDJ A;  3O3T A;  1O73 A;  1I5G A;  1XZO A;  1J0F A;  2REM A;  2KP1 A;  4ZL9 A;  1EOG A;  5DQS A;  2LNT A;  2K8V A;  2VCT A;  4MP4 A;  3UEM A;  1FOV A;  4RQR A;  2VCW A;  3DML A;  3CQF A;  1OKT A;  19GS A;  4O5U A;  3IBH A;  5KEJ A;  2JAD A;  3PGT A;  4PQI A;  1XFL A;  2DJ1 A;  2GLR A;  4Q5Q A;  3IRA A;  4K7O A;  4EVM A;  5CRE A;  2WFC A;  4ZB9 A;  1BQ7 A;  2QA2 A;  4WEY A;  3LJR A;  3BD2 A;  2E2G A;  4Z2R A;  4OCE A;  1GSE A;  1FB6 A;  3KZQ A;  2MMZ A;  5DAK A;  3M8N A;  2H1B A;  5EPF A;  4LA1 A;  3HDC A;  1VF4 A;  5G30 A;  1SL1 B;  4IQ1 A;  3TRP A;  5H5Q A;  3VFI A;  4RI6 A;  1SYR A;  1A23 A;  5AIV A;  1WOU A;  4CY6 A;  1JLW A;  3H4K A;  3WT2 A;  3ZL5 A;  6GSV A;  3CSJ A;  4MZW A;  2HFD A;  4HQS A;  5E59 A;  2O7K A;  5ECO B;  3UVH A;  2QC7 A;  2YJH A;  3O6T A;  2ON7 A;  3A5W A;  2WGR A;  5F0G A;  3TRQ A;  2UZ8 A;  1TI3 A;  5D9W A;  5IPH A;  3H93 A;  2L6C A;  3ZZX A;  3IC8 A;  1AIU A;  2IN3 A;  3E9J B;  2CZ2 A;  4EXJ A;  3L78 A;  3VWX A;  4AJ6 A;  1O85 A;  3CTG A;  1PN0 A;  5ECS A;  2LUS A;  4GQC A;  2KP2 A;  5D93 A;  3GST A;  4F9Z A;  5G5E A;  3PPU A;  4D73 A;  4JU5 A;  1B4P A;  3LEF A;  5A5K A;  2XBQ A;  1ZL9 A;  4K0N A;  2CVK A;  3CSH A;  5AIX A;  5AIS A;  4BL7 A;  4FO5 A;  4DVC A;  1U87 A;  4G2E A;  3CYN A;  5A4V A;  3TRX A;  3TKP A;  1XG8 A;  1ERW A;  3I43 A;  2BTO T;  1UN2 A;  2V6K A;  4MJA A;  4OCF A;  2VL2 C;  3P2A A;  6GSS A;  2VCZ A;  5ID2 B;  1U6T A;  2EIQ A;  3EMP A;  2XBI A;  1YKC A;  4I2U A;  2PUK C;  2VIM A;  1FW1 A;  4ZIJ A;  1TTZ A;  4OFN A;  1BG5 A;  2P31 A;  3HVN A;  4IS0 A;  1TU7 A;  2GT6 A;  1XPV A;  2J23 A;  1EOH A;  3GTU A;  4ID0 A;  4POL A;  3HZ8 A;  1A8L A;  2NBS A;  5G1K A;  4FIW A;  1K3L A;  4KX4 A;  3SWL A;  3A5I A;  2N5F A;  1QXH A;  4GTU A;  3ZVJ A;  5CRH A;  2PN8 A;  3PIN A;  5GSS A;  2H1A A;  4ILF A;  3FHK A;  2LJA A;  3TJK A;  1Q4J A;  4IBP A;  1ZMA A;  2H73 A;  3MAK A;  4XS4 B;  1F3B A;  3QD9 A;  4N0Z A;  2C8U A;  2PER A;  2JSZ A;  1JLV A;  2AYT A;  4DSR A;  3LOR A;  4MPF A;  2IMD A;  2OE0 A;  4JR4 A;  1KNG A;  2X8C A;  14GS A;  3A3T A;  1FAA A;  1IYI A;  8GSS A;  2R5G A;  2FD3 A;  3GNJ A;  3HXS A;  2IFQ A;  2GT5 A;  2C1Y A;  1FHE A;  3KIJ A;  2VM2 A;  1G7O A;  4EF0 A;  1FG4 A;  3L4N A;  1OC8 A;  2WCI A;  1TI1 A;  1K3Y A;  4GLT A;  2C80 A;  1V9W A;  1K0M A;  1O8X A;  5DCG A;  2MMA A;  2VAF A;  3KH7 A;  4BA7 A;  2DLX A;  2LRC A;  3ZRD A;  5D9V A;  2C3N A;  1GTU A;  4QL7 A;  2K18 A;  3FYG A;  4XHM A;  5J9C A;  5KOW A;  1PN9 A;  2P0G A;  3GN3 A;  4QL9 A;  3HY2 A;  5ECM B;  3EPT A;  2CQ9 A;  3Q18 A;  3VPT A;  2VLV A;  4HZ4 A;  1X9S B;  2LEG A;  2ZNM A;  1GUM A;  5IMC A;  5D96 A;  3HCZ A;  1SEN A;  1EGR A;  4O32 A;  2QKE A;  3H79 A;  1KEB A;  5KN3 A;  1ZYE A;  1TK8 B;  5JWO B;  3GSS A;  4TXO B;  1PL1 A;  2E7P A;  4K2X A;  3KP8 A;  2WRT A;  3TOT A;  5KN2 A;  2EIR A;  1K0N A;  5CO3 A;  3UMA A;  1TRW A;  3VWU A;  1XOA A;  1WMJ A;  2XC2 A;  1B9Y C;  5G31 A;  1AW9 A;  3KD0 A;  4K5S A;  1GP1 A;  1Z3E A;  4LMW A; 
#chains in the Genus database with same CATH homology
 2V6O A;  5ECK B;  2V2G A;  4ZL7 A;  2H72 A;  4BWQ A;  1XW5 A;  1WE0 A;  3QAG A;  2I81 A;  3GH9 A;  4I6X A;  3BJ5 A;  1X9W B;  1OKD A;  4RUV A;  3HVV A;  3GL5 A;  3EIN A;  4TR1 A;  1ML6 A;  1SJ6 A;  4O7H A;  1ST9 A;  2GDR A;  2H71 A;  2LST A;  3TCO A;  1YDK A;  1HNC A;  5ELG A;  1WIK A;  4KE3 A;  1M2A A;  5LNK e;  1EEJ A;  3HVS A;  1HYU A;  1QMV A;  1F2E A;  2F3M A;  1DE1 A;  4KCA A;  1OAZ A;  2HYX A;  4BPY A;  4EO3 A;  1OC9 B;  1ZZY A;  3LXT A;  4HQZ A;  7GSS A;  2H01 A;  5IO2 A;  2HSY A;  4HEA 2;  4KDY A;  4K1F A;  3APO A;  3I6A A;  3M9J A;  4CW9 A;  5ECP B;  4MAB A;  3MDK A;  2YNX A;  1GUH A;  3TJB A;  4JZQ A;  3WGX A;  1GUL A;  4Q5N A;  4MCU A;  11GS A;  3UBK A;  3LSZ A;  3LW9 A;  4MZB A;  2B6M A;  2FNO A;  1C72 A;  3G9B A;  3M0F A;  4AF2 A;  3BCI A;  20GS A;  1NM3 A;  2X4A A;  3KMO A;  2VCV A;  3VUR A;  2A2P A;  1BX9 A;  1B48 A;  1V40 A;  4CDO A;  5ECN B;  4E8E A;  3TJJ A;  2H19 A;  2H74 A;  2L5L A;  4EIP A;  1UVZ A;  3LYK A;  1YY7 A;  1EWX A;  1F9M A;  5CRW A;  1ZOF A;  3MYD A;  4KB3 A;  2DJ0 A;  2J9H A;  5JWR B;  1IYH A;  1AC1 A;  4YQV A;  2HRA A;  1YKA A;  1Z7R A;  3F4R A;  4PUF C;  5ECR B;  2YAN A;  5C04 A;  3E0U A;  3UAP A;  2L4C A;  3W6G A;  3BOA A;  3M3M A;  4WF5 A;  4XRA A;  2E2M A;  2V41 A;  3F6D A;  3U5R E;  10GS A;  3ZRE A;  2MBT A;  1VF3 A;  5DJM A;  1Z7P A;  2LV3 A;  1XW6 A;  4WET A;  2L4Q A;  1O7U A;  2QGV A;  2HE3 A;  2VL2 A;  2FUG 2;  4G0K A;  3FKF A;  1JZR A;  1F3A A;  4K7N A;  2WB9 A;  2H1D A;  1RW1 A;  5F05 A;  1NHO A;  2FHE A;  3GH6 A;  1J08 A;  2B1K A;  3DXB A;  2G2Q A;  1YZX A;  3GIX A;  5AGY A;  3D22 A;  3QAV A;  2GZZ A;  2NTO A;  4WXT A;  4JE1 A;  4HJM A;  2OE3 A;  5COH A;  4HJ2 A;  4TOP A;  4N11 A;  1XWG A;  4Z2U A;  5HR3 A;  4ZB8 A;  3WT1 A;  3IXR A;  2LS5 A;  2WDU A;  4JBB A;  4FYU A;  2MMN A;  2YWI A;  3DD3 A;  3UVT A;  4YKG A;  1YEX A;  3KH9 A;  2VLT A;  2GZP A;  4KSO A;  2IL3 A;  4PGT A;  1USB A;  3L9U A;  3P90 A;  4YQU A;  3KGK A;  1EV9 A;  4BVX B;  1BYE A;  3ERF A;  1ZYQ B;  1ZYN A;  2YOI A;  3C1S A;  5J3R A;  4MF6 A;  1PL2 A;  3DEX A;  1ZCP A;  1T1V A;  4KCE A;  4POM A;  5ID2 A;  4Z2T A;  1W89 A;  2VO4 A;  2DIZ A;  4YH2 A;  2VCQ A;  3ZTL A;  2NDO A;  2PGT A;  5IMZ A;  2IWT A;  4OO4 A;  4EDY A;  3ZFL A;  2AB6 A;  3D5J A;  3KCM A;  1V57 A;  2HZF A;  2RII A;  4FYB A;  5LD0 A;  1QGV A;  2LRT A;  3HA9 A;  4JRR A;  4GSS A;  3ZYW A;  4GSN A;  3LXZ A;  3A2X A;  4V1A g;  3GA4 A;  3QAW A;  1O81 A;  2FWE A;  2H30 A;  3QOU A;  2V1M A;  4AGS A;  2C0F A;  3DGQ A;  1TJD A;  1EV4 A;  3TKS A;  3UL3 A;  1LU4 A;  2C3T A;  2GST A;  4HOJ A;  1S3A A;  1U3A A;  1H75 A;  1XIY A;  4OWY A;  4TW5 A;  5DAL B;  5KN0 A;  3UIW A;  2R3X A;  2OAD A;  3RHC A;  2GSS A;  4KH7 A;  3GX0 A;  2CT6 A;  5IIZ A;  1N2A A;  3GRX A;  2VCX A;  4TR4 A;  1HD2 A;  1ERU A;  4GST A;  3G7J A;  1X0R A;  4ZBA A;  3VK9 A;  3EYT A;  4IVF A;  5CYY A;  1X5E A;  4F03 A;  3VI7 A;  4RI7 A;  3TGZ A;  2YZH A;  3GV1 A;  3RAZ A;  1SU9 A;  2IPA A;  2PWJ A;  1MD4 A;  1R5A A;  4G10 A;  4Q5R A;  3FZ9 A;  3EUR A;  2TRC P;  1HNB A;  1LJR A;  4DSS B;  4ULX A;  5C00 A;  2KOK A;  3N5O A;  1GTI A;  1XWK A;  5GST A;  3W8S A;  1XOB A;  4HU7 A;  4NV5 A;  2OE1 A;  2VOC A;  5J9B A;  2VD1 A;  4EL1 A;  4HDE A;  2H0H A;  4NV2 A;  4LL4 B;  2IMK A;  5ECH B;  5IMV A;  1MDK A;  3F4T A;  3IA1 A;  3F3Q A;  2VL9 A;  1Y6E A;  4DSQ A;  1ERV A;  5CAX A;  3U6V A;  4K6X A;  2LRN A;  3TJG A;  3C8E A;  2CA8 A;  2GVP A;  4XCS A;  2C0D A;  3IOS A;  1DBY A;  2LJK A;  1XWC A;  3D6I A;  4LMV A;  4IEL A;  1ZGN A;  2QSI A;  3ERW A;  3IK9 A;  2CV4 A;  2NVL A;  3IHQ A;  3GYK A;  4IN0 A;  3MSZ A;  2HZE B;  4KA0 A;  4OFM A;  4TVE A;  1SD9 A;  1OE7 A;  2CVD A;  1XXU A;  2X8H A;  1G7E A;  1AQX A;  1ERT A;  1LBK A;  1GTA A;  4ZB6 A;  4NXI A;  3IHG A;  3TKR A;  2OA7 A;  3APS A;  2JAC A;  2VD0 A;  2BMX A;  2YP6 A;  2GQL A;  2GSQ A;  3ZLP A;  4MZC A;  2GSR A;  3CSI A;  3QMX A;  16GS A;  1W4V A;  3F4S A;  1TRS A;  3L9S A;  4ACS A;  3HKR A;  2DMM A;  4G19 A;  3IDV A;  2D2Z A;  3C73 A;  1G6W A;  2I9H A;  2JZT A;  1WRY A;  4PUR A;  5DAK B;  1MEK A;  5DDL A;  3QFB C;  1EP7 A;  5JWQ B;  2DML A;  2ZCT A;  1BJX A;  2PVO C;  2A4H A;  3HVX A;  5DQY A;  3RPN A;  1VF1 A;  3JCM L;  3D21 A;  4PUA A;  1SD8 A;  3GUS A;  2L57 A;  4CY8 A;  2QA1 A;  1JFU A;  2K9F A;  4X1U A;  1JZO A;  2MZC A;  2R2J A;  1A2M A;  4I97 A;  2MBS A;  1R7H A;  1DSB A;  3UOM A;  4V2N A;  4XRD A;  4WR4 A;  5ELA A;  1YF1 A;  1X5D A;  4O5Q A;  1M9A A;  1WWJ A;  2NPB A;  5HFG A;  3WD6 A;  2O8V B;  5J5N A;  2M80 A;  9GSS A;  5IMD A;  4XTS A;  1TU8 A;  2XPE A;  4IP6 A;  5D9T A;  1EGO A;  4MJB A;  3TKS C;  4QQ7 A;  2H0I A;  5EY6 A;  4GXZ A;  2PPT A;  2CAQ A;  2KUC A;  6GSY A;  4N10 A;  1THO A;  3IC4 A;  1R26 A;  3CTF A;  3GKK A;  4USS A;  5J41 A;  2YJ7 A;  4LLR A;  4J2F A;  5ECL B;  3F6F A;  3ERG A;  4L5L A;  3VI5 A;  1F37 A;  1AUC A;  4YQM A;  1SKR B;  4GCI A;  4BL7 B;  3FY7 A;  3ZVJ D;  4EDZ A;  3RHB A;  2I3Y A;  2FCH A;  2DJ3 A;  2IME A;  4WBR D;  4X0X A;  3D0Z A;  3IK7 A;  3FR6 A;  5B6N A;  2JL4 A;  2YPM A;  1FO5 A;  1T4Y A;  1PA3 A;  4X4J A;  2B5E A;  4ICY A;  1O6J A;  2I1U A;  4IP1 A;  3HJP A;  5IM9 A;  1M2B A;  1A2J A;  1XVW A;  1HQO A;  3LWA A;  3LQ7 A;  3KEB A;  2R6K A;  3EMX A;  1FOH A;  3L9V A;  1JHB A;  3G7I A;  4K7I A;  4GF0 A;  2N5A A;  1EP8 A;  3J7Y b;  2YWO A;  1XCC A;  1DUG A;  3FEU A;  4O92 A;  1ON4 A;  2IJY A;  3HJO A;  1MD3 A;  5H5R A;  5F06 A;  5IO0 A;  1MTC A;  4WKW A;  1K0A A;  1XWA A;  2XPD A;  4IJ3 A;  3WYW A;  4ECB A;  3H8Q A;  1QUW A;  2IMI A;  3HHV A;  4PNG A;  1FB0 A;  1T7P B;  4X43 A;  2H6Y A;  2X64 A;  4KGI A;  3TUE A;  3DIE A;  1MDI A;  1PGT A;  3KP9 A;  2B5X A;  4ZXG A;  1GUK A;  1SL2 B;  2EIO A;  3R2Q A;  3GKN A;  5HQP A;  4NPB A;  3EE2 A;  4YKF A;  5D8I A;  2HSM A;  4EUY A;  5AN1 A;  2F51 A;  3EWL A;  3HJM A;  2VUP A;  2ES7 A;  2DJK A;  4KW6 A;  1G0T A;  2A4V A;  5GZZ B;  1PKZ A;  2OJL A;  3QR6 A;  4N0V A;  3N9J A;  4ZIL A;  2C4J A;  1YQ1 A;  3CMI A;  5JCG A;  1AAZ A;  3FZ5 A;  2JSY A;  4MMM A;  4L0U A;  4N30 A;  3DVX A;  4HU9 A;  2DSA A;  1UC7 A;  2E0Q A;  2M72 A;  3ME7 A;  4NHZ A;  1UA5 A;  2L5O A;  2JZS A;  4O5R A;  3F3R A;  2KLX A;  1SJI A;  2YN1 A;  3P8W A;  3IAS 2;  1ABA A;  1GSD A;  4FQU A;  1TRV A;  4POB A;  4TKY A;  3EVI A;  1PRX A;  5IMA A;  5FWG A;  5B8B A;  2AJQ B;  4POK A;  2LJR A;  5DVB A;  5L71 A;  2OBK A;  1PSQ A;  1M99 A;  4G0I A;  4OD7 A;  1U88 A;  5HFI A;  3C71 A;  1SJZ A;  4DSS A;  3GKX A;  1XBS A;  3UBL A;  1A0R P;  3QPM A;  4XIH A;  1FVJ A;  22GS A;  5HR1 A;  5IPG A;  3M1G A;  3FZ4 A;  1A24 A;  2BJX A;  4GQF A;  1QQ2 A;  4K2D A;  1M0U A;  4JED A;  5ENU A;  1AQV A;  4MF5 A;  5ECI B;  3TB2 A;  3WGE A;  3WGD A;  4ECC A;  4YAP A;  3C7M A;  2N5B A;  3IE3 A;  1ZYP A;  4CHS A;  3ZMK A;  5B8A A;  1GTB A;  5H5S A;  3I9V 2;  1NW2 A;  1J9B A;  2A2R A;  4TR1 B;  2L59 A;  1GSU A;  4WF4 A;  4JR6 A;  3VPQ A;  4KAE A;  4WBJ A;  4NHW A;  2WZ9 A;  2K6V A;  2FLS A;  2HZE A;  1X9M B;  2FWH A;  3RPP A;  3K8N A;  3PR8 A;  2G0F A;  4KND A;  4KDX A;  3HYP A;  2B7J A;  5DBQ A;  1EZK A;  2X99 A;  2C3Q A;  2H75 A;  5EL8 A;  1HNA A;  1PX7 A;  2YWM A;  4EE0 A;  3ME8 A;  2VL3 A;  1E6B A;  5DJL A;  2C0G A;  1GSQ A;  2HT9 A;  4XS6 A;  2LKU A;  1T3B A;  2YV7 A;  5HR2 A;  2WJU A;  1SKS B;  1K0D A;  2A2S A;  5IOW A;  3DKS A;  4LL1 B;  12GS A;  2HLS A;  4BVY B;  1Z6M A;  5IMF A;  3FRC A;  4XS4 A;  1B8X A;  1TOF A;  2LTK A;  3IV4 A;  6GST A;  2R0P A;  3S9F A;  5GAN D;  1GRX A;  3KMN A;  3D4T A;  5CRD A;  2FWF A;  4NWY A;  4NAX A;  2AHE A;  3Q6O A;  3QCP A;  3VWV A;  1GSS A;  2F8A A;  4OMV A;  2K8S A;  1PD2 1;  3C1R A;  2H66 A;  2MMO A;  2GQK A;  1SYX A;  4OFT A;  3A2W A;  2CAI A;  3LGC A;  2ZUP A;  4ECJ A;  2RM6 A;  5G1L A;  3TKS E;  2HRF A;  3L0H A;  5G5F A;  2B7K A;  2Z9S A;  3GX8 A;  3M9K A;  1Z6N A;  2LNS A;  3MIX A;  5INY A;  2GS3 A;  2OBI A;  1GNE A;  1ILO A;  3R3E A;  3F63 A;  4RQX A;  3IAM 2;  1NSW A;  1ACV A;  4DEJ A;  1TXX A;  3GHA A;  5F8B A;  1GL8 A;  2CVB A;  4GWR A;  2FY6 A;  2H0G A;  3FW2 A;  1M7T A;  5ECQ B;  5B6M A;  3NOF A;  1G6Y A;  3I69 A;  3EC3 A;  3QDN A;  6GSX A;  4Z7X A;  2CZ3 A;  2PMT A;  2F8F A;  1VF2 A;  4KSM A;  4TXO A;  2R37 A;  4V2L A;  13GS A;  2P5R A;  1Z5Y E;  2TIR A;  4EKZ A;  2HSH A;  3PH9 A;  5FT3 A;  1AQW A;  2I4A A;  3AY8 A;  3E3E A;  1GH2 A;  2DJJ A;  5EVO A;  3ZIJ A;  2GTU A;  1B4Q A;  2DBC A;  2R0G A;  1OVN A;  3RDW A;  2MYG A;  2OAC A;  3F0I A;  1WPI A;  4IW9 A;  2DKI A;  4ZL8 A;  4WR5 A;  1K3O A;  1DE2 A;  2HNL A;  4ZBD A;  1OC3 A;  4KF9 A;  2X8G A;  1T00 A;  2M46 A;  4HZ2 A;  5A4W A;  2LQO A;  3GUR A;  1PQN A;  5HFK A;  5J4U A;  2L6D A;  2AV4 A;  3RBT A;  4OO5 A;  4F82 A;  4TR3 A;  4AJ7 A;  1TKD B;  1RK4 A;  4NMU A;  5CNW A;  1N8J A;  3EU3 A;  3TKQ A;  3EU4 A;  1KBN A;  2X49 A;  1K0B A;  3P7X A;  4HI7 A;  1OC9 A;  5D9X A;  2DIY A;  4PQH A;  1FVK A;  5DCH A;  2GGT A;  4I5Q A;  1CQH A;  3CBU A;  4Q5F A;  3TDG A;  1V98 A;  4AJ8 A;  2H1G A;  2O89 A;  2OKA A;  5JCU A;  6GSU A;  4KUN A;  4TRX A;  3VWW A;  4I8B A;  1QFN A;  3SBC A;  1JZW A;  2H76 A;  3A2V A;  1TRU A;  1TK0 B;  4PXO A;  2DJ2 A;  2F9S A;  5B7C A;  2ON5 A;  2O85 A;  5D73 A;  5A4U A;  1Z9H A;  1PX6 A;  3FMW A;  1RQM A;  3NZN A;  17GS A;  3O76 A;  2O87 A;  5IQY A;  3ED3 A;  2R0C A;  4H86 A;  3HZ4 A;  3W8J A;  3FZA A;  1M9B A;  2C0E A;  1AXD A;  2HRN A;  1EEM A;  3BCK A;  1PKW A;  18GS A;  3LYP A;  4FH8 A;  2FA8 A;  1URM A;  2GQM A;  4A5P A;  1CQG A;  1GLQ A;  4L8E A;  1SKW B;  2CX4 A;  2AUV A;  4EIQ A;  5KOX A;  3DYR A;  3Q74 A;  4ML1 A;  2PBJ A;  4F0C A;  3TJF A;  1A8Y A;  4G9H A;  4MA9 A;  3D4M A;  2H70 A;  1GSF A;  4IHU A;  3HD5 A;  4V1A p;  3KXO A;  1YJ6 A;  4MK3 A;  4D73 B;  3LG6 A;  4EC0 A;  1BED A;  1YF0 A;  3FR3 A;  2HRK A;  3IR4 A;  3MNG A;  1M2D A;  3CRU A;  3GL3 A;  4FYC A;  3TOU A;  2FWG A;  5F07 A;  3J7Y k;  2H6X A;  4F2I A;  5JCW A;  2VM1 A;  1O8W A;  4MH3 A;  2GZY A;  3GKM A;  1V2A A;  4MJC A;  3ISO A;  5LCZ A;  2YWN A;  5G2Z A;  2WUL A;  4V2M A;  2P5Q A;  4GRF A;  1U3I A;  4BVX A;  2B1L A;  4L0W A;  2RUF A;  4MF7 A;  4ZBB A;  3LFL A;  2H8L A;  2HI7 A;  1XW9 A;  3KTL A;  2IIY A;  2VLU A;  4BWS A;  4MJE A;  4K5R A;  3DVW A;  4XS1 A;  3BBY A;  2KHP A;  3GTU B;  2JU5 A;  4MNN A;  5CRG A;  3CXG A;  2JZR A;  1SK0 A;  1A0F A;  1XVQ A;  3CRT A;  1QK8 A;  4IKH A;  5BRT A;  4MH2 A;  2EC4 A;  2PVQ A;  4TN8 A;  3QFA C;  1GNW A;  4PX1 A;  4MPG A;  1THX A;  3Q19 A;  2TRX A;  2H6Z A;  2V32 A;  4PTS A;  5HR0 A;  3GFK A;  1PMT A;  3UJ1 A;  1YEP A;  3KM6 A;  2LQQ A;  1OE8 A;  4IJI A;  2DC5 A;  3DRN A;  4KDU A;  3H1N A;  4TXV A;  5GAP D;  1GWC A;  4BVY A;  2YZU A;  1R4W A;  4L5O A;  1WJK A;  2PU9 C;  3DWV A;  2IFQ B;  2R4V A;  4HUA A;  2IMF A;  3FR9 A;  1GSY A;  1TP9 A;  4MLY A;  1Y25 A;  3MWH A;  1V58 A;  4MDC A;  4ECI A;  4E8H A;  2FGX A;  5DAL A;  3IPZ A;  1A2L A;  4ISD A;  1VRS D;  2WS2 A;  3APQ A;  3F8U A;  1KTE A;  1T8E B;  1B9X C;  4IQA A;  3US3 A;  1GLP A;  4K8M A;  1TDI A;  2ALB A;  1OYJ A;  4K9Z A;  6GSW A;  1TK5 B;  5FHI A;  4I2T A;  4PNF A;  3V1W A;  3OR5 A;  2FA4 A;  3NIV A;  4F0B A;  4IGJ A;  1BAY A;  1K0C A;  2DKH A;  1I9D A;  4G0L A;  1NHY A;  4K0G A;  2B3S A;  5BMU A;  5IOX A;  3ZIT A;  1X5C A;  3G7Y A;  5KN1 A;  2RLI A;  3UAR A;  3KTB A;  4PQ1 A;  1SK1 A;  3ZML A;  2AAW A;  3KJY A;  3ZFB A;  3ZIV A;  2YCD A;  1SK2 A;  2B5Y A;  1S3C A;  1R5P A;  3GMF A;  1VGL A;  4J56 E;  3FK8 A;  2RM5 A;  4J57 E;  1WP0 A;  1H4O A;  2XHF A;  1E2Y A;  3VLN A;  1JZD A;  5E4W A;  1T4Z A;  1K0O A;  1F6M C;  4HS1 A;  1S3D A;  4TR0 A;  2RUE A;  2YV9 A;  4ML6 A;  2HXK A;  1TW9 A;  5ABR A;  5CP1 A;  4P3Y B;  3F9U A;  1SL0 B;  1Q98 A;  4YAV A;  2CX3 A;  1XWB A;  1MDJ A;  3O3T A;  1O73 A;  1I5G A;  1XZO A;  1J0F A;  2REM A;  2KP1 A;  4ZL9 A;  1EOG A;  5DQS A;  2LNT A;  2K8V A;  2VCT A;  4MP4 A;  3UEM A;  1FOV A;  4RQR A;  2VCW A;  3DML A;  1OKT A;  19GS A;  4O5U A;  3IBH A;  5KEJ A;  2JAD A;  3PGT A;  4PQI A;  1XFL A;  2DJ1 A;  2GLR A;  4Q5Q A;  3IRA A;  4K7O A;  4EVM A;  5CRE A;  2WFC A;  4ZB9 A;  1BQ7 A;  2QA2 A;  4WEY A;  3LJR A;  3BD2 A;  2E2G A;  4Z2R A;  4OCE A;  1GSE A;  1FB6 A;  3KZQ A;  2MMZ A;  5DAK A;  3M8N A;  2H1B A;  5EPF A;  4LA1 A;  3HDC A;  1VF4 A;  5G30 A;  1SL1 B;  4IQ1 A;  3TRP A;  5H5Q A;  3VFI A;  4RI6 A;  1SYR A;  1A23 A;  5AIV A;  1WOU A;  4CY6 A;  1JLW A;  3H4K A;  3WT2 A;  3ZL5 A;  6GSV A;  3CSJ A;  4MZW A;  2HFD A;  4HQS A;  5E59 A;  2O7K A;  5ECO B;  3UVH A;  2QC7 A;  2YJH A;  3O6T A;  2ON7 A;  3A5W A;  2WGR A;  5F0G A;  3TRQ A;  2UZ8 A;  1TI3 A;  5D9W A;  5IPH A;  3H93 A;  2L6C A;  3ZZX A;  3IC8 A;  1AIU A;  2IN3 A;  3E9J B;  2CZ2 A;  4EXJ A;  3L78 A;  3VWX A;  4AJ6 A;  1O85 A;  3CTG A;  1PN0 A;  5ECS A;  2LUS A;  4GQC A;  2KP2 A;  5D93 A;  3GST A;  4F9Z A;  5G5E A;  3PPU A;  4D73 A;  4JU5 A;  1B4P A;  3LEF A;  5A5K A;  2XBQ A;  1ZL9 A;  4K0N A;  2CVK A;  3CSH A;  5AIX A;  5AIS A;  4BL7 A;  4FO5 A;  4DVC A;  1U87 A;  4G2E A;  3CYN A;  5A4V A;  3TRX A;  3TKP A;  1ERW A;  3I43 A;  2BTO T;  1UN2 A;  2V6K A;  4MJA A;  4OCF A;  2VL2 C;  3P2A A;  6GSS A;  2VCZ A;  5ID2 B;  1U6T A;  2EIQ A;  3EMP A;  2XBI A;  1YKC A;  4I2U A;  2PUK C;  2VIM A;  1FW1 A;  4ZIJ A;  1TTZ A;  4OFN A;  1BG5 A;  2P31 A;  4IS0 A;  1TU7 A;  2GT6 A;  1XPV A;  2J23 A;  1EOH A;  3GTU A;  4ID0 A;  4POL A;  3HZ8 A;  1A8L A;  2NBS A;  5G1K A;  4FIW A;  1K3L A;  4KX4 A;  3SWL A;  3A5I A;  2N5F A;  1QXH A;  4GTU A;  3ZVJ A;  5CRH A;  2PN8 A;  3PIN A;  5GSS A;  2H1A A;  4ILF A;  3FHK A;  2LJA A;  3TJK A;  1Q4J A;  4IBP A;  1ZMA A;  2H73 A;  3MAK A;  4XS4 B;  1F3B A;  3QD9 A;  4N0Z A;  2C8U A;  2PER A;  2JSZ A;  1JLV A;  2AYT A;  4DSR A;  3LOR A;  4MPF A;  2IMD A;  2OE0 A;  4JR4 A;  1KNG A;  2X8C A;  14GS A;  3A3T A;  1FAA A;  1IYI A;  8GSS A;  2R5G A;  2FD3 A;  3GNJ A;  3HXS A;  2IFQ A;  2GT5 A;  2C1Y A;  1FHE A;  3KIJ A;  2VM2 A;  1G7O A;  4EF0 A;  1FG4 A;  3L4N A;  1OC8 A;  2WCI A;  1TI1 A;  1K3Y A;  4GLT A;  2C80 A;  1V9W A;  1K0M A;  1O8X A;  5DCG A;  2MMA A;  2VAF A;  3KH7 A;  4BA7 A;  2DLX A;  2LRC A;  3ZRD A;  5D9V A;  2C3N A;  1GTU A;  4QL7 A;  2K18 A;  3FYG A;  4XHM A;  5J9C A;  5KOW A;  1PN9 A;  2P0G A;  3GN3 A;  4QL9 A;  3HY2 A;  5ECM B;  3EPT A;  2CQ9 A;  3Q18 A;  3VPT A;  2VLV A;  4HZ4 A;  1X9S B;  2LEG A;  2ZNM A;  1GUM A;  5IMC A;  5D96 A;  3HCZ A;  1SEN A;  1EGR A;  4O32 A;  2QKE A;  3H79 A;  1KEB A;  5KN3 A;  1ZYE A;  1TK8 B;  5JWO B;  3GSS A;  4TXO B;  1PL1 A;  2E7P A;  4K2X A;  3KP8 A;  2WRT A;  3TOT A;  5KN2 A;  2EIR A;  1K0N A;  5CO3 A;  3UMA A;  1TRW A;  3VWU A;  1XOA A;  1WMJ A;  2XC2 A;  1B9Y C;  5G31 A;  1AW9 A;  3KD0 A;  4K5S A;  1GP1 A;  1Z3E A;  4LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...