2B1QA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with trehalose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
molecule keywords hypothetical protein slr0953
total genus 92
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b1qA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2b1qA02
5AK3A 4XE5A 2WF7A 3AR5A 3B9BA 3IJ5A 3OTQA 3WK7A 5AM2A 3QGMA 3D6JA 5AI8A 1X42A 4BNDB 1Z4PX 5AW7A 3L8EA 4PNHA 3U26A 3WK5A 3DV9A 1YMQA 5AI9A 3QUTA 2JARA 2R8EA 2VKQA 3QU2A 4EX6A 3GYGA 4KN8A 2OBBA 1J8DA 4RETA 4Y2VA 3N07A 5AKGA 2P9JA 1Z88A 3MPOA 3MC1A 1QQ7A 5AI0A 1Z4LA 1RMYA 4EX7A 4GIBA 2FI1A 4NWIA 2RAVA 3PDWA 1RKVA 5AKZA 2GO7A 2FPWA 4L6AA 4HGNA 3L5KA 3HYCA 3N1UA 2HEGA 3MN1A 1CR6A 4YCLA 5AKEA 2FUCA 1RQLA 1Z4QA 2W43A 2ZBDA 2HDOA 5ALRA 3U7GA 4Y2XA 3EF1A 5AK6A 5AKHA 2QYHA 3NUQA 5AIAA 5AW8A 5AM3A 3UMGA 5ALZA 2BDUA 4I9GA 3PCTA 2WF5A 1QYIA 3AR9A 3CZ4A 1U2SA 4ZEXA 2G07A 2WM8A 4UMEA 2YJ5A 4CE6A 2YMLA 5ALMA 1N8NA 3L8FA 1TJ4A 3E81A 5AVWA 4OD0A 3WKBA 2C8KA 2B82A 2B8JA 2IOHA 4DW8A 3BWVA 1Z4KA 5ALWA 3ET5A 3SHQA 1O08A 3FZQA 4IFTA 3QUCA 1Y8AA 1Z5UA 4EEKA 3SKXA 2ZG6A 5ALHA 1PW5A 5AVSA 5AI5A 4OCZA 5AK5A 3AR2A 4FE3A 1XPJA 2G1AA 3QNMA 5AM0A 2EATA 3U13A 4UMVA 1VFPA 5AKKA 3SKYA 4Y2QA 4YH1A 1O03A 3NAMA 4CNQA 2IA5A 5AHXA 2YN4A 2EARA 3AR3A 3SF0A 1RC8A 3I76A 1YV9A 2B0CA 3IB6A 1J97A 2HHLA 3WKAA 1L7OA 2DQSA 5ALUA 4BBJA 1AQ6A 2D2VA 5ALLA 4AP9A 2YMQA 3R09A 1FEZA 4BEVA 4AS3A 5AVTA 1S2OA 4J2TA 5AKYA 5AESA 1WPGA 3W5BA 2X4DA 4XOUA 3A1DA 3ZWDA 4C4TA 5ALXA 3FPSA 3KOOA 5ALJA 2AH5A 2CFSA 3CNHA 4DCCA 4UARA 2B8EA 3QX7A 2PQ0A 3IRUA 5ALFA 2WFAA 4HGQA 4CF5A 1T5TA 4L57A 4AS2A 5AW1A 3W5AA 3NASA 2B1QA 1KYTA 2NYVA 4KYTA 1U7PA 4BEWA 2CFRA 1L6RA 1SU4A 4B6JA 5A3SA 1QQ5A 3SLRA 4ZEVA 2C88A 5IS2A 3KC2A 3N28A 3KZXA 5ALSA 2YMPA 4MWOA 4YGYA 3WK9A 2NO5A 3NIWA 3KD3A 2FEAA 4NV0A 4MUMA 1RRCA 3N8GA 5AI4A 1S8OA 2IYEA 4C4SA 1VJ5A 3HLTA 4YCNA 1WVIA 1SWWA 3DAOA 2G0AA 3FM9A 4KNWA 4UASA 3B9RA 5AKIA 3OCVA 1Z4IA 4HGRA 4OFZA 4CF4A 4BX0A 5ALYA 2CFTA 2HOQA 5ALGA 1LVHA 3EF0A 3OCXA 4UAVA 4UU0A 5AKJA 3QXGA 4DFDA 3R4CA 3WKDA 1L7NA 1ZD5A 2HF2A 4HYTA 2Q5EA 1LTQA 4FFDA 5A3RA 2PKEA 2ZXEA 3L8HA 3S6JA 1EK2A 2ODAA 5AW3A 3DNPA 2G80A 4IG4A 2G09A 3J7TA 5AK4A 4XQ0A 1TJ3A 2NO4A 5ALVA 3QU9A 2FPRA 5E0OA 1RLOA 1ZD3A 4C4RA 4KX5A 3E8MA 4I9FA 2O9JA 3VAYA 2R8YA 3KDPA 3SMVA 3FGOA 1Z4OA 2C4NA 3QU5A 2BDEA 4UAUA 1QH9A 5AVUA 1RQNA 1WR8A 3PGLA 5AM5A 5A3QA 3L0YA 2JGAA 1Z5GA 3E84A 3RF6A 2IOFA 2R8ZA 5AW5A 1RKUA 4FYPA 3KBBA 3K1ZA 2ZBGA 3I1YA 1Q91A 2JAWA 1YDFA 4QQFA 3AR7A 2YY6A 4DWOA 2AGVA 3L0BA 2PR7A 3PGVA 1XVIA 3A1CA 3ZW7A 3NRJA 3ZTWA 3QUQA 1L7MA 3U7HB 1RPZA 4F71A 2YFYA 3ZVNA 1Z4MA 2C8LA 3ZVLA 3OPXA 3UMCA 2AUTA 4YCMA 2FPSA 4YIHA 4UW9A 4G63A 2MU1A 2AMYA 5ALQA 2HX1A 1IWOA 2HO4A 4BKMA 2HI0A 2I55A 1K1EA 1ZOLA 1N9KA 4UMDA 4UU1A 2CN1A 1VJRA 3EWIA 1L7PA 1T5SA 5ALPA 3M1YA 3RFUA 3P96A 4BX2A 3QU7A 2B30A 3AR6A 2IOFK 3L1UA 5ALTA 2B1RA 2MSNA 2FPUA 3WK6A 2WF6A 2GHTA 1NNLA 4Y2YA 3WKCA 2FPXA 3DDHA 4UM5A 4BX3A 3WK8A 3L7YA 3A3YA 3U7EB 4EZEA 2GMWA 1QQ6A 5AVVA 2YJ4A 4NABA 1ZD4A 3OCYA 2FUEA 2P11A 1YS9A 3B8EA 5AW6A 2ZBEA 5AVZA 4F72A 3ZTYA 2I33A 3TLMA 5AW4A 1ZRMA 4EENA 2FDRA 3QYPA 1L8LA 1RMTA 2I54A 3U19A 2ZBFA 2RB5A 4G9BA 1RLTA 5ALDA 1L8OA 4GXTA 2YJ6A 2WHEA 5T41A 4UATA 2YJ3A 2YMMA 2WF8A 2HCFA 1U02A 4NAVA 3WKEA 1TJ5A 3UM9A 3OCUA 4KNVA 1RMQA 4ZEWA 1ZS9A 3WGUA 5IT0A 3NANA 2RARA 3NALA 1CQZA 4Y2SA 4BYGA 2OA0A 4JDPA 5ALNA 1TE2A 3ZU6A 2C9MA 2P27A 1U7OA 3AR8A 3QUBA 5AW9A 5IT4A 3OCWA 3WGVA 2I34A 1T9ZA 1YJ5A 4NFLA 3ESRA 1MH9A 3EPRA 5AKXA 2QLTA 2I7DA 2W4MA 2Q4TA 1EK1A 5AVQA 5AM4A 5AVYA 1XP5A 3FVVA 4OHFA 1RKQA 2OM6A 4KX3A 5ALEA 4CF3A 5FP0A 1RDFA 2P69A 3F9RA 1TA0A 4Y3UA 1YNSA 3E58A 3AR4A 4XPZA 1NF2A 3W5DA 3ZUPA 5AVRA 3MMZA 2R8XA 3A1EA 4UM7A 3W5CA 5ALIA 4Y2RA 5AW0A 3ED5A 4HGPA 2ZOSA 5AICA 3L1VA 4QJBA 1JUDA 1SWVA 2JAUA 2GHQA 3N5KA 4Y2PA 5AVXA 1ZJJA 5AW2A 3QU4A 3ZWKA 3BA6A 4Y2TA 1WZCA 3L0CA 1ZRNA 3I6BA 2JAOA 5ALOA 3ET4A 2G06A 2EAUA 3R9KA 3M9LA 3UMBA 3ONNA 4BNDA 3ZVMA 2HF7A 4Y2JA 2O2XA 5AM1A 2BY4A 4RESA 2RBKA 4HGOA 2W11A 3ZX5A 1Q92A 1F5SA 4Y2UA 3WK4A 4J03A 1ZD2P 2G08A 1RLMA 3QLEA 3ZI4A 2GFHA 1Z4JA 3ESQA 2YBDA 4YIKA 1NRWA 2OYCA 4EELA 3SD7A 2I6XA 4E88A 2WF9A 3FPBA 4HAIA 3I28A 3L8GA 3ZX4A 5AIBA 5ALKA 4L6CA 5AI6A 3U7FB 2HSZA 4H1WA 5AKLA 4O8CA 4JB3A 4UMFA 1U2TA 5JJBA 1Z4NA 3OCZA 2Q4RA
chains in the Genus database with same CATH superfamily
3P2JA 4I3GA 1BRTA 4CEHA 4R8SA 3ZHXA 3M1IA 1HK7A 3K15A 3IJ5A 1XXHE 5EQTA 1RHKA 1W59A 1SBQA 2FG5A 3DF9A 2XB9A 3D6JA 3UNXA 5CJPA 2Q41A 3AHJA 1KWKA 4OTZA 4PYQA 4FOTA 4RDCA 5AW7A 4EOGA 1KI9A 4Q24A 3U26A 7GPBA 3WV5A 4XXHA 5ESWA 3KLNA 4AB1A 4JUDX 1KBQA 1G16A 1PJBA 3HLYA 3TMAA 3D3WB 4OU4A 5BWCA 1PNTA 4KO1S 3BQMB 2IXTA 1A9XB 3QU2A 3AI3A 3TOVA 4CN8A 1YONA 3F0TA 2OBBA 1PEKE 1BVYF 4L4YA 3WIVA 1R0WA 2WI8A 4CV0A 3PGA1 1DOAA 1D0IA 5TNXA 2Z04A 2C92A 1W0CA 1W0JD 3ZHRA 4XJXA 4MUXA 5IW8A 1GTMA 1AGPA 3IQHX 4PO3X 5JAMA 1L4GA 5DRYA 1GHTA 2ZYIA 1JEDA 2FPWA 4MGHA 2EFEB 2NVOA 4UTZA 2IS2A 1V8DA 1BGXT 1XAJA 2PBRA 3ASUA 3HYCA 3L5KA 2O4UX 3JALA 3SZLA 5G0UA 2QRUA 3NBAA 2B92A 4P3OA 4TZ0A 2QN7A 5FTLA 5L7WA 2V6BA 1LVGA 3INNA 1GGHA 3ILXA 4P4SA 2H9AA 3WY9A 4S24A 3WLLA 3PDJA 5AKHA 3OEEA 4E94A 5IX8A 3QKRA 1XMSA 3AZOA 2EHJA 4ZZ2A 4RORA 2C3OA 2QYHA 4PHTA 5AIAA 3CQZB 4PYKA 2E6UX 2W93A 4DNXA 1ID1A 2C7VA 2Z2ZA 2GNAA 2XCUA 4UNSA 4ZCIA 2YXDA 3I52A 3W2FA 4DQ0A 1P4AA 3HSSA 4MLPA 4WXMA 2RIPA 2WQ7A 4HNSA 3U37A 2I2AA 2VQDA 4NMLA 5JBIA 5K8VA 2AFHA 1LS6A 4V39A 4WXEA 4RHFA 4XDGA 1JU9A 4ZVVA 3I0NA 4NF2A 1RJ9B 5DMXA 1EDEA 2OP1A 2HBRA 4EKEA 4K1XA 1ISGA 5ELLA 3WL5A 5A3JA 5LXTB 2O5VA 4RFSB 1R00A 4MW0A 5TGTA 2PUTA 2OEPA 4F6CA 4LMPA 1L5HA 4YV0A 4E6PA 4R0MA 4DLNA 5KWIA 5L3SB 2ECKA 3H3XA 2ERXA 2PUWA 3CPJB 1Z26A 2MJLA 5F35A 1YJBA 2I6TA 3CRRA 2H1OA 2HIGA 1QYVA 1Q44A 1E7WA 2Q5OA 2XUIA 1OAKA 3LP8A 1E1KA 5EXTA 5ALWA 2ADOA 3ICEA 4DDHA 3IDFA 3W5IA 1O08A 1GXSA 3FJOA 3N74A 5M04A 1IXYA 3T0FA 1VKZA 4TRJA 1ZD8A 1L4LA 5ISMA 4JQSA 1MQAA 1V1MB 1XDGA 2ZG6A 3C5HA 3G0GA 2ZUDA 5A0VA 3E48A 3TW4A 2ZJFA 4IVNA 1FOEB 2PRJA 3GLFE 4KV9A 1IMOA 1MLDA 1XPJA 1WMFA 3MQ2A 1QP7A 3ENZA 4JWKA 1CZHA 1NBHA 1RJ9A 4YPOA 5T4HA 3O47A 3ZLTA 3I2KA 4IG9A 5CJ2A 1TPYA 1GYRA 1T8WA 3KKZA 3LUBA 3QFHA 2IKQA 4ZDWA 2HPAA 2NX2A 1ODJA 1DDIA 3HXOA 3UB4A 4D8XA 2ZQ5A 1EK6A 1J4AA 2WIKA 4FD3A 4JU9A 1YV9A 5FOSA 3OFSA 2PUFA 4FCWA 1TWFB 2YZMA 1RWWA 1GUBA 3LDFA 4LYHA 5E0KB 1O95D 2H51A 4JXZA 1WD7A 5KTNA 1NQ5A 1P1FA 1XZNA 3UK7A 1XA4A 3OHSX 2ZJ2A 4D3FA 3G9QA 2YOGA 2C59A 1FU4A 2JCGA 3I5AA 2YMQA 4JEIA 4NYMQ 2R1TA 4HF7A 5HF9A 4D25A 4DBLE 1T1GA 4HUJA 2R6R1 4OHOA 4BEVA 2CHFA 3LHKA 2JCVA 4KQKA 3LO8A 3LC7O 1EE2A 5CIWA 4D57A 4LX8A 1HDEA 2C9OA 3RUAA 2ACVA 1FW8A 4BL5A 4C4TA 1A8PA 1XRLA 2K4MA 2VHTA 4QVKA 5ALXA 3AK4A 2JHFA 4U7TB 1HA3A 2UUPA 3E4CA 1VA5A 3E8XA 4MQUA 3WSTA 4MP3A 1Z12A 5HFAA 1JDNA 2FVXA 3N8HA 5FORA 1NV9A 3W5VA 3VYSB 4AZ3A 1ILEA 4AF7A 1CRWG 1NGSA 3ZW8A 4B83A 1HZZC 1VPTA 1VSBA 2JBHA 1CZNA 2R6AA 1GRNA 3BBPA 5M3BA 3VM6A 1DKMA 2GVZC 3IBSA 4AU1A 4Y9TA 3HOXB 1QP0A 1FE8A 1CS0B 4AS2A 1NMZA 5DE3A 3PKJA 1T10A 3VYVA 4G5FA 4TLLB 2HBQA 2YZ7A 1O5IA 5DK6A 3RNLA 2ZI4A 1X3LA 1SG9A 4QDTA 1NZDA 1GFSA 3F98A 1KSFX 2XA9A 3R6TA 4DA8A 1E3QA 2Q50A 1R6BX 4MHTA 5E8JA 1QKKA 1KC1A 3ND9A 3N28A 4RTMA 2YMPA 1D6SA 4UBJA 4JC8A 4M36A 4NZPA 2JAQA 4WLUA 3UOAB 3EC7A 3TRKA 4D0SA 2NU8B 2QVLA 4G24A 1UIRA 4GOND 5AI4A 5K3CA 1AUQA 1KH2A 1Z8HA 1CYDA 2OFWA 3JARA 4ZRDA 5A62A 1OH5A 4EBBA 1JT9A 2N1BA 3MWEB 2PUEA 2OO5C 1M1NB 1LZKA 4QTZA 1W5FA 4JY7A 3D3WA 1L5QA 4WH0A 4BNYA 4Z9XA 1Q1EA 2AQIA 2O4CA 2Q3HA 2R751 5CXUA 5KDDA 4HNAB 1IN8A 3ONEA 3BFPA 3ZWCA 2CFTA 3C8UA 4AZ0A 1YZTA 1LPNA 1LVHA 3G7UA 4GZLA 4R9VA 3K72B 5TRTA 1ZWLA 2KLBA 3DCIA 5L6MB 2J9YB 1KIAA 2PHZA 3IEXA 3IH5A 3MUFA 5JXIA 1ECPA 1PZFA 2OWEA 1EX1A 3IBFA 3MYYA 4RH3A 4O33A 4WOCA 1L4BA 1EJBA 2J4DA 1TAHA 2G40A 5A9RA 3GLKA 1CR1A 2Z08A 2ZIUB 1U8UA 4XJTA 2V4UA 4YWHA 3FKSD 2W90A 3M49A 1DQSA 2FDCA 1G21E 4EL0A 1E5XA 1OIXA 2EF0A 1SUCA 2PYIA 2WOJA 3EBLA 4GUDA 4GYWA 4DRYA 3ODGA 2VCEA 2JGFA 3QXSA 1LPMA 2HO5A 2QL7A 2ODAA 1MX5A 2R3SA 3E9RA 4RZSA 4EJFA 1NRJB 3AUAA 4BP3A 1BWPA 1FU8A 1SOVA 4FNOA 4RENA 4MPDA 2NXEA 3QVUA 1V35A 5G02A 1L5HB 1MGOA 2GWRA 1CY7A 4FMPA 3WZ2A 1IUPA 5K6TA 2VA8A 4H7JA 2OL4A 3T54A 4N6NA 1JF8A 3S7ZA 2Q1XA 1T4MA 4HQ6A 2VYQA 2WWTA 2FFBA 3OM0A 3K8YA 4AJEA 1DBQA 1Z22A 3A6JA 3WGIA 5AUQA 1ZC3A 2FY8A 3UAZA 5LWHA 5KNCD 3UFBA 4MLDA 4XW2A 1L4KA 4NFYA 4QUEA 3CG4A 3O1LA 2VJBA 1S8AA 1X86B 2VTBB 1LA2A 5HGXA 5AR1A 3C3XA 4EHDA 1AMOA 1DQNA 4IDFA 1R9MA 5I9NA 3DJFA 1EESA 4MVWA 1SRQA 1XZIA 2J48A 1HE4A 3ANLA 3ABZA 4RS3A 1EBUA 2VHWA 4QBIA 4FZRA 3IUEA 5F51A 3YASA 1XMJA 2EC5A 2I7CA 4DDUA 2HBYA 5I01A 1NVXQ 1ZM2A 1PSZA 3HB4X 3OC0A 3WADA 1Q91A 4IIUA 4DRXB 1IN7A 3VR2D 3D64A 3JRXA 4RK0A 1C8VB 5DIZA 1O89A 2EZUA 4NYIR 5TQ2A 3O8OA 1V96A 2FKNA 3A9SA 4L5YA 2SCUB 4JQZA 5LKAA 2QTTA 2V8OA 2RMKA 3QUQA 5AJVB 3HBJA 3MB5A 3CCCA 4R8MA 1LFDB 1L7MA 3E82A 3L6EA 4B46A 1RPNA 1Z5VA 2CBXA 2ONZA 3E8SA 1SUFA 3Q0EA 3ANYB 4F71A 3UJAA 4I9NA 3UGKA 3MNFA 4U3JB 3GA5A 1THTA 2P1RA 4ZEOA 1D07A 3GRFA 1TAQA 2VYFA 2N46A 1YZFA 4Q1AA 3SXPA 1JIUA 3QOXA 3A4LA 1OZFA 1M6YA 2ZT7A 4G63A 5DLPA 3TNJA 1YA8A 5IK2D 2LCFA 4GRDA 2BR5A 3OHPA 4KXWA 1BYUA 5E4TA 1RQ2A 3GUCA 1O6FA 2OSBA 2NYUA 3SYRA 3FMGA 1HQYE 2OORC 1M2GA 3SHOA 2V5AA 5JOQA 2IBTA 5P8WA 1OBOA 2CVHA 3H6HA 1ZOLA 4PCUA 1RQGA 5CMLA 1PS0A 1RBMA 4PQFA 4ROSA 4ICIA 1VJRA 3FPAA 5L51A 4DCTA 3K6SB 3LDAA 5ALPA 2W42A 1HV8A 3AEXA 1F8YA 1L0BA 1G63A 5TX7A 3FNQA 5I7UA 1Z8FA 1HO3A 3EDCA 3FLAA 2IOFK 1XX6A 1EEHA 4JROA 1EP2B 1XNHA 1K98A 2E5FA 2F6RA 3HHPA 4QGAA 3I9JA 4WUTA 4BMXA 2V1XA 3PC7A 1RLJA 4LOAA 4LOKA 3ME5A 4Q1EA 1OYYA 2IRWA 3CWZA 4IQ8A 2PH3A 3PQ4A 4S04A 1MOSA 1Y4ZA 1GAJA 3LRPA 2ZSJA 3BXOA 3N2IA 1JEEA 3PNVA 4WI1A 4ZAZA 1KDZA 3G0BA 1PFKA 3HZZA 3I34X 3T95A 4NABA 5FRDA 1SXJB 4B2PA 3RRZA 3K70C 1TCVA 5EVJA 3O8QB 2IJGX 1LDBA 3BL5A 1U0OC 2C95A 2CL7X 3LZCA 4WN9A 4ZVTA 3Q9UA 3N2LA 4Q6BA 2FQQA 1KO4A 3C2QA 3HR7A 4QOGA 3D5EA 2KI5A 1SEVA 3HQ4O 3L0ZA 4KH0A 1UXKA 2VRNA 5EOVA 4F6LA 5I7HA 3C3JA 3O9MA 2H1SA 2ZBFA 4C3UA 3U19A 1U2EA 4GP9A 4CKBA 2PZJA 1IUNA 3CF4G 3PNKA 4YV1A 3LPLA 1Y3HA 1ZEMA 3IE0A 4TGLA 2YJ6A 2A9PA 3NBZC 3VVLA 1X13A 5KNDH 2H31A 1KO5A 5KHAA 4N48A 2XZOA 4C7OA 2GO1A 3DT8A 4DG9A 3ML1A 1VCHA 5DLDA 4DEXA 5BWLA 2H4XA 2DWCA 3IODA 4I3FA 4BMVA 1UBTS 1YKFA 2D74A 3LBYA 1CUSA 3I9MA 2OGWA 2BPOA 3IP7A 4FI3F 3CONA 4JDPA 5E8RA 5BV0A 1FNMA 1PD1A 1Z7EA 4YAWA 3OSUA 1BKSB 4M37A 3ZXYA 4CTMA 2GKOA 1VOTA 1QZZA 4IQ4A 1NUUA 1Y7LA 1T1EA 4GLLA 3PE4A 4K26A 4ZAYA 3DF7A 4MAFA 2F1RA 1V5IA 3EASA 4U2KA 3B1YA 2JJ1D 3OCWA 2FP4B 3EVZA 3HJFA 1HX7A 4F1KA 3C3AA 3WGVA 3W6UA 4MIKA 1T9ZA 1XMIA 2WHPB 4CLOB 2YW2A 3BSSA 3U2QA 4FYVA 3RC2A 3JQPA 3OX1A 4AECA 4ER6A 4NE2A 4ZQFA 5EKXA 1XZLA 3BGIA 1X8JA 5FFNA 3F9IA 4GC5A 1TZCA 1DP4A 1ODSA 3M3PA 3T7TA 3I5XA 1V5GA 2SKCA 3DL7A 1IYZA 3F6RA 4B48A 1OMOA 4LIPD 4EAAA 1RVDA 2V97A 4YMUA 3JTMA 4L76A 4N0QA 4FC6A 3A7EA 4P38A 4B6OA 4CM4A 2CKDA 1BWSA 2C9YA 3MLBA 1NF2A 1W2WB 3X1ZA 3RAPR 1J2EA 1P2GA 4P6VF 4RGBA 1E1CA 3KSMA 2IL1A 2P1DA 2XLCA 3QEOA 4MQEB 4KQMA 4Y2RA 3MTBA 5KNBH 1SH7A 2O54A 1M6HA 1E2JA 3DDSA 3S5UA 1HKHA 3PLRA 4M7OA 3W6NA 1XVLA 1E2QA 4OXIA 2FF7A 4R31A 3SFVA 4ZWNA 1J6UA 3D0RA 5A6SA 1A4UA 2P78A 2AXEA 1CR4A 1R0XA 3D7RA 2BEJA 3WA7A 1J7KA 2ORVA 5JS1A 3KJFA 3ZLVA 1NA5A 2JAOA 1U2GC 3CNLA 4PSAA 2DEUA 1RS0A 2ZJBA 3MJFA 2GKGA 4KXUA 3DTVD 2BKAA 2YXNA 1A1SA 3ZEAA 3QX3A 5K0ZA 1OFUX 3GCWA 2DUUA 3ZVMA 2RFLA 2PS0A 2CCJA 2VDRB 2VRCA 4FS3A 4AJKA 5B55A 3HVRA 1RD4A 4KU4A 2OCIA 4B85A 4JYZA 3I42A 2L17A 3SFTA 4BQOA 4PQRA 1CJKC 3QFTA 4HBZA 4HBGA 2VUUA 3GFVA 4R0NA 4DQVA 3N7UA 2VJMA 4D3SA 2F2TA 4ZAFA 3KKEA 4D4KA 2A88A 2QIOA 4G6ZA 2QE7D 4ILKA 3PC3A 2G8LA 1YKSA 1Q92A 5I9MA 3CLKA 1ZD1A 3G0CA 5CDYA 2R4UA 3HK2A 4RZ2A 1ZD2P 1QGDA 1XFDA 1CRLA 2G08A 3C1TA 3THYB 5C4XB 2W6NA 3WLHA 1EB8A 1N1GA 3I23A 5LDGA 2CB0A 2BMWA 2CHUA 2NZYA 2PUAA 3NDRA 2ZI3A 1CBUA 1QVVA 4JBIA 1NKSA 1P1BA 4JOSA 4D9EA 3PTLA 3RJTA 1BW9B 3OE7D 1XRNA 3O1JC 4MKRA 3WHLA 1A9QA 1TNDA 4MJXA 3T3IA 3KO8A 4R2WA 5DNWA 2BM1A 4D3YA 1SQGA 3EE6A 2W48A 1ZOIA 4GMDA 2OE2A 3UW3A 1JXQA 3NEJA 2JLYA 5BQOA 4DV7B 4H08A 5B1YA 1C14A 2ATEA 1TOAA 4DA4A 3C24A 3LC0A 1Y7PA 5JWHA 5L3RA 4NP6A 4XUCA 1WHTB 4ZDIA 3GELA 5ALKA 5AI6A 1IBLB 1C2YA 3HOZB 4EATA 2BFDB 3WHKA 1TC2A 4CLDA 4ZYYA 3RANA 4X7BA 2HQOA 3HB5X 2HMYB 2Q5LA 3CVWA 3R9XB 4G0XA 5AKLA 1SZJG 2XHZA 2VUIB 1NWCA 3MS4A 5TS2A 3OT4A 3UK6A 4PLWA 3NH6A 1GLNA 2B7LA 3DH0A 4EM6A 5JRDS 2X3UA 2VOJA 2HIMA 3K0FB 3S40A 5JJBA 5DULA 4TYQA 3GCZA 4N6GA 3VU9B 3PHHA 4HWSA 4U02A 1BOOA 1ORWA 4ZDKA 3VYWA 3C41J 3FYSA 3M4XA 3TQFA 3ZE8A 3BHJA 2ZJ5A 3HZHA 1IOWA 2IYQA 4AZ3B 4YUXA 4N9QA 4QUAA 1UOPA 2CZCA 4DLTA 3HP7A 5HKBA 1O4WA 2E21A 4NDAA 5I7RA 3PITA 2WT8A 3TW6A 3KT0A 5I3CA 1H5NA 1PX2A 5BURA 2FSVA 4KIGA 3FKSA 4O6VA 3VKGA 3ZZTA 2XMDA 1K3TA 1GPAA 1ZBQA 3KR2A 3UJDA 3TAUA 4PO9A 2R8EA 4XA8A 1TGYA 4JIGA 3LIPA 1URPA 4KTVE 1E9RA 1DQYA 3EAGA 2Y76A 1ZA1A 3UHPA 2ZRLA 4CMGA 1FP6A 3FSEA 5IMBA 3X3HA 1H2EA 4PC3A 4JGGA 5MGNA 1OWMA 2Q29A 3EHEA 3VU9A 1IB0A 1IM5A 1F0NA 2R62A 1PWZA 2DU8A 3SG0A 4KPUB 5E4JA 3OIUA 4DV4B 4RVSA 1F7VA 3UHJA 3A27A 2NU8A 2PIAA 3PX7A 1II8B 3EGIA 3MOSA 3CLRC 4X60A 1NBIA 3AI2A 4OLHA 4C01A 4DLVA 4F60A 4K9NA 2QYOA 4UHCA 4Z99A 1QB8A 5I4IA 3ZCQA 4UCWA 1M34A 5BUZA 3HBNA 1SKAA 2ASEA 4FFMA 4JQOA 4WJLA 3Q8MA 2XMQA 1O2DA 4LHSA 4X8LA 3DO6A 3RFTA 4EUNA 2PGDA 4ZYLA 2OFXA 4C2MB 4DB2A 4B3GA 2PMCA 3STUA 4DMGA 1BX1A 3HABA 4FINA 4BNMA 1E2LA 1GZDA 2GD0A 4Q3CA 1FDSA 1O4VA 1XYYA 3ETNA 1RTTA 1KEZA 2AEFA 2EL7A 2FHSA 3NQ41 5AM3A 1OBFO 1P33A 4D5EA 3KZCA 3HCBA 3PQ8A 1XJCA 1KVUA 1IVNA 1KPGA 3K16A 4IHJF 3CZ4A 4KR0A 4IJVA 1IQ0A 5G2OA 1V8OA 2DWUA 4MUKA 3EIHA 4ZZ3A 3NPAA 2C2GA 3D5QA 2QXYA 1R9NA 1P4HA 2WJ4A 4Y30A 1UBLS 1II9A 3RUFA 2YOFA 1N5RA 4NCJA 1A4RA 3UUFA 2CXQA 1JJIA 3URKA 1KFJB 3MCVA 3EY9A 4XIIA 5GJCA 3H8SA 4D4IA 2HWKA 5BXYA 3NXKA 4A0SA 2IPOA 3FRIA 4P54A 5CYOA 4B4KA 2VAMA 2WIBA 1O54A 4FLFA 3CCBA 3CXUA 3OF5A 4H1UA 4I5FA 5IJXA 2HM7A 3L7NA 4V2IA 3ROEA 3LAWA 2P9ZA 4K9SA 1NR1A 4RHTA 1I32A 4ZD6A 5LU9A 2RGNA 5D00A 1MA0A 2P8SA 1XTBA 2CLIB 3IUMA 4LNAA 1B76A 2W6IA 3H6KA 5ITZB 2UYCA 2YJTD 4LNUA 1HNZB 3GU3A 3AUSA 2QV0A 2Y27A 1ZCAA 2PU7A 3QWFA 1KVRA 3N2NA 1HFJA 3NVMB 4Q19A 4YECA 5AK5A 4ZC1A 1XLWA 1UC4B 1XC7A 2QLMA 2VAXA 3O95A 4GAEA 4KRXA 4UMVA 3PXDA 2RAFA 5AKKA 3DOCA 3DNFA 2PGAA 1MB3A 5EJIA 1SKUA 1C0KA 3K5WA 4CNQA 3A4VA 2IA5A 2G1JA 1GGEA 4YCCA 1I2BA 1PFWA 1PBNA 1IE3A 4XGRA 3WBFA 4PHHA 4L51A 2BMEA 4HQOA 3BUSA 4N0PA 4GSKA 3OQHA 2JANA 3JZMA 2PZGA 3ZJVA 3KP1A 5DNUA 3ELYA 1OHHA 1XD2A 3GJYA 5ALUA 3CB2A 3HEAA 3N2EA 2ZYTX 4PZZA 2D2EA 3HB7A 1BE8A 2AHRA 2VHZA 3IX7A 2QLLA 2YWBA 4LVUA 5EY5B 4LXGA 4PZYA 5EESA 5LR6A 1YL7A 5BQXA 4KXFB 3TS1A 5KVVA 1RC1A 3J81A 2CCGA 4LJRA 2XV1A 3KUCA 2HA2A 4RHYA 2X8JB 1JLHA 2ZXFA 1NQXA 1LBTA 2GK7A 1L5ZA 3FDIA 2GPTA 3KCQA 1ABEA 3GJ6A 3DMHA 3SLGA 5JNWA 1XKXA 1QZTA 2CFSA 2JFZA 1OZAA 3AWIA 3BRQA 3JV7A 4HDRA 2CGEA 4AUNA 4ACAA 4HWKA 5IKOA 3BHMA 5IJWA 4ZYVA 3QF7A 2JI9A 2PMDA 1GA6A 3R9IA 1A2OA 1WSWA 3JASB 2QL9A 1J9GA 1E1LA 1V1RB 2GVNA 3B52X 4FFRA 4CQMD 4QDXA 1CQIA 1JQDA 3DP7A 2RE8A 1IJEA 3W5AA 2WD8A 1R27A 2HQ1A 4E03A 3KSDO 4JLWA 3T9CA 2NG1A 4RVGA 4MQ5A 1GM5A 1RIIA 4DAEA 1POXA 4CCYB 3W4IA 2PYDA 1XTKA 4B6JA 5KYWB 5A3SA 4TTIA 4KFTA 4L8LA 1AE1A 2WWGA 3FKIB 5EUCA 1Q14A 4WECA 3U80A 4BXOB 3NNDA 4M49A 1S8NA 5BYBA 3RWMB 2Y0EA 4ZK6A 1JH9A 2D13A 1UT5A 4ZCPA 4ALJA 1Y3BE 4C4AA 1G20A 2A2ZA 2R6JA 4AO8A 3BDAA 3T4XA 4FFNA 4D9GA 3A6HA 3I73A 1EAMA 1U8CB 3KM0A 3WYFA 3TTWA 1J0EA 1QRAA 3NUZA 1M2JA 3LUHA 1QE5A 2HV9A 3H9EO 4MV4A 1JAHA 3TLBA 1VB5A 2J7KA 3RFCA 2WABA 3PYXA 1WD5A 4FUQA 4B3DA 3TQTA 2A0WA 5C3MA 1TLTA 1VHDA 1NWHA 2WJ6A 2WHXA 4KHZA 3VX3A 2CJFA 3PG5A 4OFZA 3SQDA 4E08A 4LE0A 3PQ3A 4KWCA 4KMRA 1G7CA 3CRMA 4PSUA 4UJ3A 3CUVA 3NGXA 1H2WA 2CVQA 3EF0A 4IDEA 4J4BA 3OCXA 4X6XA 3JD0A 2FYTA 4DM7A 1J5XA 1WZUA 3N8KA 4EG8A 4QIHA 3NU1A 3QV2A 3GQVA 1AURA 3NRBA 3EISA 4MA0A 4YMWA 1MZVA 1ZD5A 2JJ2D 4KPUA 4QRDA 4J0DA 4CL0A 3BH7A 4HYTA 3M83A 2Q5EA 1ZK3A 2P2LA 3VPAA 4OXYA 4AZWA 1KA9H 1PIWA 4QQRA 2IZ1A 1NN5A 4I8IA 4CKCA 4Z2YA 3BERA 2RBEA 2PKXA 3ODPA 1QGAA 2WZBA 3EVFA 3V2IA 2I8CA 1HY3A 4M1WA 3OQPA 1EFRD 4GOJA 9GPBA 2ID9A 2C29D 3SIWA 1QG4A 5JZMA 4IX9A 5CFLA 4QHYA 2PMWB 2Y1XA 1WPQA 4R54A 2Y0BA 5HILA 2XDYA 5ESXA 4LV8B 1G98A 3I92A 4L5CA 4LTMA 4LI0A 1FQKA 2B4QA 2C2YA 2V7BA 4N8EA 5BVGA 3O26A 4X3PA 2QX6A 1C5KA 1AQUA 3M1LA 3U9TA 2QP9X 1OX5A 3E5HA 1SBCA 1MAUA 1U8TA 3PNMA 4NS4A 2A86A 4UAUA 5ARBA 1H2AS 5ITZA 2R5FA 1B41A 3EXG1 4B33A 3V7WA 3GJQA 3W04A 1FUIA 2E82A 3E84A 2J6HA 4XH9B 3D1JA 4TTRA 4L7VA 2V0CA 4R1QA 4PHGA 4UFNA 4CVNA 3MJRA 4G37A 5I51A 1I4OA 2C8VA 3T12A 2DFLA 2INGX 1A7JA 1KI6B 3AY7A 4LF8B 4AY4A 4YGXB 4AK9A 1PLLA 3P5SA 2BHNA 3SBOA 3FOWA 5D1HA 4CG3A 2JFWA 3EVGA 1VJ1A 1L7AA 4F97A 4B79A 1QIEA 5K20A 3ZTWA 2OOSA 2IDKA 2PNFA 2XT6A 3SXJA 1MO5A 1Z35A 2DGDA 3JVIA 3VNRA 2CUZA 1EE9A 4FNMA 4YT5A 1OFTA 5BN1A 1SPXA 1BN7A 4LNUB 4W9RA 4YRJA 2IYSA 2BHRA 1ZHHA 4D81A 4HVCA 4O1IA 3LUGA 4R3UC 3TUJC 3CPSA 4WSOA 5FBZA 3HRKA 3ZGLA 1AKWA 1NUQA 1KEVA 1ORHA 3WB0A 4E21A 5JATA 5NLLA 2GGSA 4HEHA 2CLCX 4JR1A 3V1LA 2ZIXB 3IHLA 4YIHA 3R8XA 3HV0A 4POOA 2Z2IA 5LDHA 3A4TA 1V26A 1QF7A 1E9VA 5TPZA 3F3KA 5LP6B 4E3ZA 3AT1A 4CZ2A 1THMA 5FWAA 2V3VA 1OXMA 1THGA 2ORYA 3PIIA 4E30A 4KR3A 3CURA 2ZTUA 4P31A 2VJYA 4JQCA 3ORFA 2NSDA 3PQ2A 4CM6A 1PJ8A 2IHJA 2XKAA 1TUBA 2SBTA 1K06A 1W25A 2SHKA 3VZBA 5FPQA 3RHFA 1PCXA 2W9XA 4UEOA 4B1FA 3RFUA 1NF3A 3ITKA 3QU7A 2W2LA 1YK0A 2PEYA 4YDRA 1RKXA 3SF8A 3U61B 1HYEA 3P97A 2YBEA 5EIAA 2R00A 4KQHA 3WI7A 4OKNA 1PZXA 2FN4A 3WK6A 4CCSA 1XT6A 3KQHA 2C4UA 2CC2A 4L8VA 3A8TA 2XADA 1MEEA 3DDHA 2D2IA 1Q6YA 4UEWA 3X43A 4RQAA 2ZSHA 5H81A 3ZZMA 1CCWA 2QAIA 1LLUA 3ZWYA 1NHWA 3EDQA 3UAWA 2I1LA 1PUIA 3G0IA 3UUEA 4DWVA 1E3TA 1CUGA 1ZW6A 3PF8A 4B3TB 2NAFA 1X1AA 3NT5A 4CQLA 3A3OA 5DBIA 3TLMA 2D5AA 4JJIA 4LRSB 4DQKA 1VECA 2IC5A 3AHDA 1NF9A 4DY6A 1HSOA 1D6NA 5THXA 3QYPA 1UAGA 2QI9C 2UZIR 3PI7A 4IYJA 1U0SY 4MVJI 4XYGA 3EA5A 1CQPA 3TM4A 5JY6A 2Z6AA 3IT2A 1YVUA 3O94A 1FJHA 2E4ZA 4LOIA 5DFAA 3OQ1A 4F5EA 3J81k 4IR7A 2VDWA 4J0QA 4ZU3A 2H2IA 2DWQA 2GHRA 5KWSA 4P4LA 4EYEA 4EKYA 2Q99A 3HNPA 4QG7A 1Z45A 1NG1A 2MINA 2P35A 4YDSA 3PGJA 1C0IA 2OCBA 2PWYA 4Q9NA 6AT1A 1TJ5A 2J5KA 1LI7A 1XJ5A 5TJ9A 3HBAA 5F1KA 3NT4A 3UAOA 1EH5A 3WGUA 3NALA 1F20A 1ES9A 2FWBA 2RARA 3QVXA 2CJWA 1RZRD 5SICE 3LLUA 2OA0A 3ZE1B 3HUFA 3OOSA 5K8IA 4MI3A 1LBEA 4LFAB 2H59A 2ROQA 2P2SA 4OF4A 1Q1NA 1WV0A 2RGRA 1WS6A 3IMKA 4MPPA 3HCNA 4XQGA 1H3FA 4DZTA 1TCBA 3W3ZB 4DV3B 1T2FA 1DJNA 1JHMA 3EOZA 3FR7A 3KTAA 3O8QA 3PL1A 5FJIA 3STHA 2V3CC 1VPLA 1GUZA 5LZ9A 3RC9A 5FBHA 3CPEA 3QMWA 2EF1A 4J75A 3PXXA 4LDJA 1RJEA 3PX2A 3AIMA 3QLJA 4I46A 2QLTA 2G1KA 3QOWA 3WQQA 4RPCA 3TD2A 2I7DA 4EW2A 3NETA 3JU3A 1FX1A 3FVVA 1RAEA 2A92A 5FLYA 3VR4H 4DBLC 1A8IA 3WC4A 4WBNA 2OCXA 4G56A 5FP0A 3ROGA 1H2BA 3ZE6A 4UBIA 5FNVA 2DR2A 2EFGA 5T8KC 4F7WA 4Z86A 1IN6A 3CZAA 5HR5A 2H52A 3ROMA 3U4GA 4FOSA 1Y3IA 2XHEA 4NJEB 3W5CA 3E7XA 5ALIA 4LC9A 5BV8A 5A6VA 5M5XB 2HRRA 4MI6A 2O2DA 1GV0A 3AY6A 1QKIA 3E5NA 4LK2A 3WGZA 4PQYA 2R79A 4MDFA 1UMCA 1V16A 1OXUA 1P1HA 2VK8A 2IITA 3U7JA 4F2HA 4PPNA 2COUA 2BRUA 2QMYA 3P20A 2VEOA 1L7BA 2CT8A 1F8GA 2DWPA 3FHOA 3HKBA 2Q1WA 3O2NA 3DKVA 3QPDA 1NRIA 4GL4A 3N05A 1Q3KA 4ENVA 1AKNA 1ESZA 1BDJA 2NW6A 3EH2A 3W1VA 3HSYA 2OOKA 4DMFA 2IFTA 1GU1A 3ET4A 1GSOA 1TK2A 3FPKA 3TN7A 3DBHB 2QS9A 4B6GA 1KKUA 3R9KA 3ONNA 4IZHA 2GBIA 4TRMA 5LB2A 4HV4A 1KZ4A 5IEJA 1ZAKA 2KMLA 2VCHA 1TIBA 3BVPA 1OYVA 3C6ZA 2YJZA 2QE7A 1Q84A 3EXEA 3WAKA 1R8SA 2VYVD 2BY4A 1ZITA 1TF2A 4BUJA 2J3KA 2GNPA 4HYEA 4OGFA 4CHGA 2XNDD 1KETA 3I30X 2F3QA 2R9VA 4O0MA 2NTVA 3BCRA 1NUAA 3MGGA 1Y8ZA 2WJWA 3ZKWA 5JVDF 1HRDA 1NJ8A 2EZTA 4OHWA 4DA7A 3O38A 4G8CA 1N33B 3O8DA 4L0MA 4E2FA 4N0MA 3HM2A 2GFHA 1P2BA 2WJAA 5BNIA 2X19A 3N2KB 1ZJYA 2LD4A 4WXYB 4RA6A 3WDKA 3NKVA 2IHUA 4U39A 4M53A 5DBFA 2OYCA 3SD7A 3UTDA 1CVIA 3V7NA 5FLKA 1IBRA 1RXEA 2HV8A 1AK1A 2GLXA 2X7HA 4NOMA 4YJ2B 1N3LA 4TWAA 5FWNA 1RW4A 1WTAA 2ZJ1A 3FPBA 2QN9A 3B8HA 4BTLA 2TYSB 3WLPA 5JZVA 2MYNA 2OPHA 1YOVA 3D2CA 2POCA 2V9CA 5CD1A 1Z29A 1G5PA 2XRMA 1VPDA 1ZGZA 5CURA 4C7BA 5KVSA 3CUEF 2ZRFA 4KV7A 4KE8A 2O8NA 4TLMB 1R6DA 4XVRA 5EZ6B 2HF9A 3C1AA 4LCEA 4WXPA 6ADHA 4YRLA 1S2MA 5TQ0B 3SXUA 4JVNA 2VRBA 2VVTA 2O3UA 4IS2A 1BMQA 2XZTA 1J0AA 1H8EA 3CLRD 5BR4A 2JIOA 2Q4RA 4XGQA 3RAJA 4FVTA 5DU2A 2I7XA 4HL6A 1C3XA 1DC5A 4KUHA 4M21A 2P4QA 1W47A 2ODWA 3GNTA 3QGMA 1O9BA 4RWZA 1COWD 4BUZA 4FNAA 5HCNA 5AI8A 1EIWA 1ZOOA 4RMJA 2OHJA 1ZVJA 4C20A 4J43A 2PD6A 2D7JA 3AMVA 2JGDA 4LMRA 2OILA 3K0AB 2FSGA 4UTNA 3K70D 1TTHA 4BKOA 3BICA 2GN0A 1EK0A 3QVTA 4A27A 2EQ5A 5IFKA 2WPDD 3B1WA 1OXSC 1QB7A 1M33A 3MIZA 4BMOB 2NVYB 1EFPB 1T3LA 2PXXA 2ZIZA 3A4YA 4N41A 2C2OA 2Q1UA 3S1NB 2CNBA 3V2HA 4DIOA 3L7IA 2PFSA 3ZH9B 4ZQHA 1TEZA 3T8YA 4C0LA 1WY5A 3ISJA 2BKUA 3K9BA 4UUMA 1TA9A 3S1MB 1PWEA 3H16A 3QPAA 1GYPA 2OECA 2Z5LA 3BRCA 3P2MA 1CEQA 4K6FA 3V6MA 4CIBA 4Y2GA 1QMPA 4KK4A 3RYFA 5HF8A 3P94A 4MO9A 4NZMA 3ED1A 2FZKA 4OYLA 1AKUA 2PO7A 2JD1A 1XYVA 3EMVA 4HN4B 3RS5A 5LM3A 5CIQA 3R40A 4KSBA 3UJCA 1FVOA 2JC3A 1H4VB 5TF4A 4DRXA 1Q17A 2J3IA 4QGHA 4C4YA 1S89A 3IUYA 5DIFA 3WWPA 2GLTA 2WNHA 5FTMA 4CM8B 1G4UR 1I4WA 1Z75A 1CIVA 4RD3A 4XLLA 5LOVB 2JA2A 3WOHA 4DARA 4EJMA 2O8VA 4Y2XA 3CT6A 2V7WA 4R6WA 1T5LA 1UPUA 1ZBDA 3MTDA 1NUPA 2VF8A 2X0NA 2ZSIA 1U5BA 4XR9A 4BE9A 4B47A 2CMDA 2IXFA 4MKZA 4RNCA 1ZVMA 1PTKA 3NB0A 4JJZA 3ZIDA 3IS3A 1UJ6A 2FFAA 3REQA 1GPKA 3AUUA 1CDEA 2H1LA 4FXPA 1UFQA 1JBQA 5E3JA 1IUOA 2CFIA 2WR8A 3QVLA 1BH6A 4QICA 2UZ1B 2CJYA 3JVVA 4J2HA 3FIJA 1E0SA 3WNVA 3NGMA 2SECE 1O1YA 3DCYA 4M1QA 1SEPA 2J3JA 2VT2A 3A0UA 3CXRA 2A1TR 3LYUA 3VU0A 2FJ0A 1FC0A 3RUEA 3LVFO 3HN6A 1JHDA 5MN6A 4BBZA 2R1VA 1DXQA 1LNSA 3BHIA 1IHUA 4B4WA 2V8BA 2WYWA 1NLUA 1RNLA 4PYJA 1X1TA 4P4TA 1OAOC 3UJ7A 1N6IA 3LY7A 2XZPA 1SCBA 1LD3A 4OD0A 5I9SA 1ZCBA 4HZUA 5ILOA 5GIPE 2ZKLA 4JL6A 4YP7A 5HMLA 4BUCA 1GTL1 5HYVA 1ZNYA 3C3KA 3DTYA 4NBRA 4XSVA 1H9BA 3GFTA 4HGZA 3DO5A 3RIHA 3NTUA 3O82A 4PAWA 5LLDA 4L0DA 4BFUA 3G2MA 2B1GA 4BFVA 3R9XA 5I8ZA 1YRYE 2AFHE 5B58C 3FUWA 1X7ZB 3QNMA 5JIBA 2AYZA 1F0KA 1E3WB 2F64A 1Q0PA 3PXBA 4MV8A 2ORIA 1CUDA 2W2LD 2ZRJA 4URHA 5AO9A 3AFNA 3HKEB 2GCGA 2QWXA 3Q5EA 3I01A 1F14A 1N0VC 4RSRA 3ICQB 5AJWA 3SYMA 4KPYA 4OX9Y 3DPUA 3DB2A 4NMMA 4F5DA 1J97A 5CH3A 5CAEB 2AMJA 3KWMA 4YT4A 4GS5A 1CNFA 3PC8A 2M98A 3I8OA 3WKAA 1HDIA 1QC5A 5EMKA 5HQTA 1D1QA 3TRFA 3F8SA 3MG9A 4TYPA 3X1KA 2ZRNA 1WIWA 4RZUA 5FO1A 2Q3BA 4BB9A 1QX3A 1KJ9A 1E3SA 1HYBA 1N8KA 5DSTA 5CD9A 4NVRA 3NOQA 4R3WA 4L9WA 4AS3A 3A3PA 1VGRA 3O4JA 4UBOA 1EUQA 3EFEA 2MYTA 3FR8A 1I6WA 3IQWA 3W1WA 5CHYA 4DYHA 4C7OB 1WLYA 1YI8A 1E18A 1E2DA 2N0SA 2TMDA 3ZWDA 1Z8NA 3LUJA 4HWTA 1GGVA 3BSWA 3DTTA 5AJUA 5ALJA 3COJA 2I62A 3N2YA 4IUBS 1UF9A 4RKFA 4AX4A 2J32A 5JEEA 2IYVA 4QQNA 1MPTA 4DJFC 5KDOA 3ZDEA 3B9PA 3ZIUA 1IG0A 5JD3A 2J4FA 3AIIA 2KX7A 3TKYA 1G19A 4QDJA 3B9QA 4CUKA 2V0GA 4ARIA 3UGTA 3O7MA 4HS4A 3UW1A 1P5ZB 2GM3A 1V7PC 2EU8A 1BN6A 1QFSA 2IPXA 3D4PA 3GLHB 4M4SA 4CNBA 1WXFA 3JW8A 1RI1A 4KRGA 1KYTA 2CXPA 3D1LA 3HN2A 3IR7A 4HNRA 4PAQA 4ETNA 3ER8A 1Q0QA 2UXBB 4MVJH 3IT1A 1Y5IA 4R41A 5ENVA 2QRHA 4DWJA 3LLCA 3R6GA 4LF4B 4ND7A 3QPWA 5JZ9A 3PGXA 1A50B 1OLUA 3OT1B 5IS2A 2B78A 4LZOA 1C9JA 1CZOA 1KZGB 4MIYA 5JSHA 1F9AA 4NV0A 3HC7A 2ZBQA 2R84A 3E2IA 5DNVA 2WG2A 3CEAA 2BF7A 3EQ2A 2DLCX 4U2BA 3NNSA 1HBJA 1S2DA 2Q21A 5BSFA 3AHCA 4N12A 2I80A 3IC5A 3ACCA 1U94A 1E0KA 2B5WA 2BFMA 2YCBA 3IMEA 3OLVA 3QBEA 4I08A 1U3DA 2ZGVA 4MWCA 3MFQA 4LJ9A 5CM9C 4UASA 5HF5A 1WRBA 2CJXA 4G5SA 4MULA 3MK31 5AKIA 3OPQA 5EJ2A 1IN5A 1OWOA 2X6RA 2DLNA 3OCVA 4IIJB 4M0EA 4R2HA 5COBA 4AP6A 4ZZ1A 4NXNB 4ZKDA 5K99A 2XH8A 3MLAA 4FB5A 4IP0A 4KUEA 3E3MA 1DFHA 4RFLA 2EEZA 3R4CA 3W9BA 1LJ8A 3V5NA 2HF2A 2B4KA 3RZOB 2WAYA 1YDMA 4KODA 4DYDA 3GFSA 4ZRMA 2ZSAA 3UB2A 2FW9A 2QD2A 5UKDA 2WD7A 3HZRA 4M1KA 1VMAA 1UM8A 4JP1A 1U2PA 4K28A 4KIWA 4UTXA 1XWIA 1NV8A 1ZK4A 1VL5A 1EX6A 4IH9A 3Q7IA 5DXFA 1Q77A 3DMRA 3L8HA 1Z2CA 3ZOKA 5KX5F 3DE1X 2JKZA 4MV6A 3DTVB 3ZHBA 1ZJ6A 1YI0A 5E3IA 3JS5A 4F6RA 3DVSX 5EVCA 2I3DA 2IZ7A 1RJDA 2OAEA 1XU7A 2PWPA 3AHFA 5C8YA 3ZE7A 1CY2A 2VRCD 3E8MA 5HKKD 1J22A 2L82A 3PWKA 1FFXB 1SD1A 1Y9DA 3UFXA 4GWKA 2O9JA 1SCNE 2H63A 2WD9A 4HZGA 4O2AA 1ZDMA 3KDPA 3QTTA 5H8WA 2GETA 3KSAC 4XFJA 1BMFD 1Z4OA 2C4NA 3DBOB 1EXDA 1E2NA 2FWAA 1GADO 3PEYA 1NU6A 1QAMA 1X3SA 5AWFC 1TDJA 4R1TA 3RF6A 1PR2A 1XMPA 3C8ZA 3OZVA 2L19A 3FAZA 1X2BA 1A96A 1RCFA 2QMHA 4PLGA 3P2IA 1A9RA 1MQSA 3K09A 3GQBA 4M9QA 1KU6A 1QXSA 3V8MA 4J7XA 2ZDHA 2W8BB 2QUIA 3QLVA 1DJPA 4MUAA 2B5VA 1SOMA 4YQZA 5BWBA 4Q1BA 1JLMA 1LSJA 2DBVO 3GMSA 3WGHA 3ZW7A 3QE2A 2XGMA 1SQ5A 1L7QA 3BDIA 4LQ4A 4IPTA 4R8VA 3UOWA 2JAPA 3KG2A 3NEPX 3PFNA 4MUYA 5JQWA 3LYHA 3WGQA 4QX6A 2GF2A 3RTCA 2WB4A 3MINB 2PFGA 4OUDB 2QAGB 3B2EA 3VJMA 1DHRA 3ZI7A 3RTGA 4C07A 5K0CA 4KPFC 2CMGA 1GKIA 5KQLA 4MS4A 5HNKA 5CIYA 2EZ4A 3RARA 2EYUA 3TX2A 3ZVLA 1KEEB 5J4KA 2OZPA 4EA8A 4KPGA 1TK3A 1J8MF 2ZR8A 1HXHA 3AJ8A 2E2WA 1YHNA 4CFSA 1XAHA 2GN6A 1ZRHA 3COWA 3GGJA 3JQFC 3NHMA 4KSYA 5DASA 3T9AA 2ZU0C 4BV9A 4B6SA 3FOEC 2JDID 4RK1A 2FWIA 2XE7A 2WPDA 4DZRA 1JLLB 2F43B 1JA1A 4FWTA 2C7GA 2MYPA 3D6UA 3PBKA 3TLKA 2I55A 4NJEA 1WVGA 2CUTA 2ATIA 5JY1A 3KUXA 4W5OA 4HRAA 3H3FA 1I7DA 1PGOA 1YMUA 2CYCA 2F8MA 2JIQA 3GYBA 1KI2A 1V3UA 2D1YA 1TU0A 4GYJA 3R3JA 2H7XA 2WTNA 1ECJA 4MGEA 3A9WA 4QOSA 3KR9A 3Q2IA 5HKLA 4KGXA 2UDPA 4QLBA 5KWEA 2Z3ZA 4XZ3A 3WJ2A 5LVAA 2I4OA 3FTPA 2OB1A 3VZCA 1ZMTA 4GW3A 3AO0B 1T4CA 1P1RA 1GPMA 1RACA 1MUUA 4RTJA 1GR1A 3E23A 1AO3A 3M5WA 4LQCA 3ETLA 1KQNA 4DABA 4AP5A 2CFCA 2QLBA 4QECA 3WL7A 3C1OA 1YI1A 2OCYC 2ODNA 5SZJA 1Q12A 3WNQA 4R01A 1SOUA 1LEHA 2JLAA 4TYYA 4QYTA 3KWJA 3U3JA 4B6PA 1QQBA 1E3LA 5CYPA 3LLMA 1OB2A 2IEYA 5LMZA 1LPBB 2V58A 1VCNA 3F6YA 4Q3OA 2XWPA 3ZZ1A 1C1YA 4B3FX 2PGLA 4QPJC 2HAEA 2YWHA 1TT5A 4WX2B 2FDXA 3ZGVA 4G9BA 1T5HX 4JIMA 2PX4A 4ZARA 3PHBE 1L5KA 4MWGA 3DWGA 5FPTA 1UH5A 1R0ZA 1XDDA 3LT4A 4MGYR 5DISB 3ZW9A 1RWQA 3FLBA 1LRLA 3BD8A 2VZ8A 3KAPA 3KAKA 5EP1A 3MOIA 1TMOA 1GZUA 1DPFA 1D0VA 2VYNA 4HAZA 4B4VA 3BM5A 5B1DA 2XQFA 2CLDX 1YS2X 3IVGA 3OTIA 1CQZA 5FEMA 2BTQA 5FOUA 3ANMA 4ZOLF 4F46A 1FFCA 2QBYA 4YJ2A 1P2SA 3QYAA 4AX8A 821PA 4KL8S 1L5GB 1YS1X 2WSBA 3MRXA 1CG6A 2QX7A 2DP4E 1VYTA 2VBCA 2NZ8A 2FPKA 3PUHA 3AEUB 4HRXA 3RC1A 4IUYA 4JBYA 2WG0A 3AR8A 2GYUA 1NY5A 4FTWA 1OZ0A 3EWAA 4N8SA 4XX0B 5KQGA 3NH9A 1AKMA 3F74A 2EKDA 4ILEA 3WIUA 1A9ZA 3P9CA 4NFLA 3AF0A 5A05A 2Z57A 1X7YA 4HUQB 5C2JB 3I5MA 4FOOA 2JLXA 2BFOA 3EBPA 1H6AA 3F6BX 3K3PA 2GRAA 2CNWA 2GPNA 4ZEMA 5LQDA 1FMJA 2XCLA 4TVSA 5AM4A 4JJ7A 4LE1A 1V39A 3WMWA 5CEEA 1BO6A 1LX7A 2Y1EA 3MGKA 5ALEA 1YCHA 3RVKA 1FJXA 3LWBA 1X92A 3F9RA 4YB8A 1P8JA 3TCKA 1E96A 5EGNA 3KS9A 3ZJ5A 3ZUPA 4C05A 3VAZA 1I51A 1O0SA 2DZDA 3W5UA 1SBNE 2OHGA 2D0OB 4CEJA 3MELA 1VLVA 4NNOA 3U5TA 1D5WA 3ZU4A 4NNPA 4HD8A 4EG1A 2O48X 4HXFB 2JNWA 3JQ9C 5K7SA 3QEKA 4KQJA 3HI4A 3BH6A 3NWBA 4YUWA 4MUBA 2Q6LA 2VJQA 3ITNA 4MEAA 3UAYA 4I2VA 1AQYA 2IVZA 5FO0A 4I4LA 1RZ3A 4JQYA 3NS7A 5FKJA 3THWA 1SCAA 4B3SB 1I3QB 5F64A 4DNQA 5BN3A 1AGNA 1OU4A 3I6BA 3R5XA 4ZQEA 5I9LA 5J2UF 2Q07A 5LLSA 3GTKB 1E77A 4B3RB 4R16A 3VOTA 1GEEA 1EVYA 1V5EA 3P32A 1EUYA 3H4MA 2A5YB 3AKEA 4E7PA 2OY0A 2CHQA 4BNXA 4U8HA 4HZUB 3IVMA 1M2KA 3ZJUA 1G1AA 1F2TB 1E69A 1JHQA 3OZRA 1QTQA 5EHNA 1DZ3A 3P9IA 4X65B 3WWYA 3TE7A 3DW1X 2ODPA 2ZE7A 4S3MA 3DDNA 3G9ZA 4M1EA 3G5TA 2J0EA 4B35A 2IYWA 2VPXA 5JNUA 2VSQA 4M7PA 5FL7A 1J2YA 1TJPB 4CV1A 5KKNB 4AO7A 3R20A 3ZWMA 2JGMA 1R15A 2GF9A 3M6XA 4BNHA 3W7VA 3OMLA 5EHQA 4PLPA 5FI1B 4BBAA 5BMVF 2BKLA 4QSMA 5D84A 4BLTA 1QO0A 3GZJA 1DC8A 5CB4A 3LPDA 3BOSA 4R4JA 3WLJA 2O05A 2BVNA 2C97A 3QJ5A 3GFRA 4IINA 3B3AA 1JX6A 1F8UA 2RGEA 3ZE9A 2QNBA 4JYAB 1OBCA 1E1NA 2IXDA 2VQSA 3GJ8A 4FDMA 4G3XA 3T7CA 4TS9A 3K5HA 2B37A 4Q7MB 4FHFA 3HB0A 3L4JA 4TTPA 3FHCB 1CLEA 3EHDA 4MZDA 5AIBA 3KYJB 1NYLA 3WGYA 1ZN7A 4L74A 3I4MB 2J0SA 3W3AH 2QSUA 5DOZA 3WMFA 2FN7A 5YASA 4D43A 1Y6FA 4DSZA 1WLSA 3QFFA 1F1JA 4TPKA 4V03A 4AQDA 1A8QA 3EGDA 2WLSA 3BHNA 3DHVA 4LYAA 1KSJA 4TL8A 4JUIA 1FYXA 4ZHQF 1SQ0A 3LY8A 1X74A 3F7MA 1CJMA 3A1WA 3NKFA 4XE5A 1DAHA 4FFSA 2GN9A 4JUAA 1ZVVA 1CVRA 4A93B 2DSTA 1DRKA 1MRZA 1UP4A 2WHQA 5AM2A 5KUTA 4A3MB 3SZRA 1EGAA 4E09A 3ROKA 1R0LA 3DR3A 2PFKA 1TW2A 1NXSA 4MROA 3IAUA 1Z4PX 1IJFA 4LZLA 2BBSA 2Z1NA 4H4DA 1N1EA 1TLLA 1YS4A 3GJ0A 3LXRA 3OWHA 4BO8A 1M1XB 1QBGA 5JSKA 4W5NA 5KMGB 5F2EA 2FUG6 3JQAA 4OH1A 3ZHVA 1NMYA 1KR2A 2P90A 2ZATA 3ESYA 3JALB 3INGA 3HPRA 3SCZA 5JSQA 2W6MA 3ZQ4A 1CQXA 4LVCA 1FQOA 1UWCA 4UU7A 3A1TA 2VNKA 1Q6ZA 3M2TA 3F3YA 1P17A 4L4SA 1G8HA 3WLEA 2P9JA 1EVJA 2YZ2A 5T8KA 4ZO7A 4R2JA 1NY6A 3HCWA 4P35A 1RI2A 4OLJA 4TXJA 3Q3VA 3RT9A 3UV7A 4XARA 4BO5A 1JHAA 4JZYA 3WYGA 3VOBA 5JC8A 4EBFA 2GO7A 3E7FA 1G64A 3FMFA 4XWYA 3C7AA 4BNNA 2H1CA 5FOWA 5JQGB 4JI8B 3DFKA 5GINE 5IZCC 2KWIA 1YB2A 2XUAA 5ECGC 1K8RA 1FNDA 3WB9A 1G8YA 4GC9A 1W5EA 1ISJA 4ND8A 2Q27A 4P3YA 1NYTA 1NQTA 3GJZA 1R6VA 1QG2A 2CHVA 3O75A 3I9OA 3T1NA 3VX4A 3U7GA 1ZM3A 5G4KB 3VV3A 4AY3A 1S9DA 4RWEA 3UBTA 3H4IA 4J94A 1SJ9A 1D4OA 4QBHA 3GGSA 3WG9A 3WIOA 3QX8A 1PR3A 1ZN2A 2VHUA 4YRKA 1AVTA 3LGSA 4OQMA 1Z0SA 1D4AA 3HOVB 3DHNA 3GRAA 2FW7A 3VC2A 1C4KA 3UQZA 1UK6A 2J5QA 1XQYA 3AEQA 4ZEXA 4RKWA 1H2FA 3D8NA 3NHJA 4U2GA 3ZG6A 2WM8A 3CE6A 5CX4A 1UZMA 2CUNA 5FUQA 1J2UA 3V4FA 3DBVO 3EVTA 1K2VN 3WNDA 2ZZMA 4Y6SA 1JQAA 5AHRA 5LJIA 3TQOA 4I8DA 4KE6A 1C9KA 3B1JA 1L5VA 4OQFA 2IOQA 1ZSVA 4EG3A 2CE2X 4CKEA 1I0IA 2AC7A 4OXXA 3WKBA 5EJEA 3BWVA 3DE2X 1AF4A 1XA0A 2I1WA 4IWYA 4AKSA 1QGZA 1WZIA 2JI4A 3ET5A 4HH1A 4PVCA 4QEKA 3T5GA 4ABYA 4RDXA 1YCGA 4I9UA 5FUWA 5BWMA 1CDZA 1UMKA 4MWTA 2Y1WA 4WESA 1ZONA 1VPVA 3PHGA 1IM8A 1G8GA 2GTIA 3P2YA 4QYXA 2HPHA 5EN4A 3CLVA 1ENYA 1XROA 2XE4A 3LHDA 4BVAA 4N6OA 2DFTA 5HW0A 1BVHA 4I50F 2E85A 2MSEB 2OXFA 1YB4A 1N6PA 4QUJA 5LDDC 2V7TA 3EDYA 4DZZA 2C5SA 4ZTZB 2R4QA 3MWYW 4AMUA 1P44A 3AFOA 3D9QX 3PIRA 1KARA 1NPYA 1W581 5EGSA 4PAMA 3CMCO 4PFJA 3RO7A 4Z49A 4TTVA 5HJ7A 4AY6A 5GGYA 4LXXA 1C81A 1W4ZA 5EWLB 1E9CA 5BR7A 1B8UA 2B7CA 2FW1A 2H2FA 1I3OA 4TV8A 1W6RA 3GNSA 1E89A 3G9XA 4IL5A 1ST3A 4MKXA 2VP5A 4FIZA 3GPBA 4JS0A 4NBNA 3T5DA 1HOXA 1GUAA 3HXTA 4HFRA 2WQ6A 4QM6A 1B74A 3P0HA 1MJGM 1P39A 1TMGE 1MJ5A 3DR5A 3KYBA 2ZU6A 4I0WB 3R09A 4YJFA 1JTEA 3EZ9A 4Z7OB 1Z2DA 1EBBA 1T43A 3ORRA 5G1OA 3NVDA 2YIVX 2B25A 3GUUA 3N9IA 1SQSA 3L5OA 4HDKB 5HIJA 2YIDA 3OD5A 4XOUA 1E9AA 1KO1A 5ECDA 4E12A 4EFDA 5AUNB 3HO1A 4ECEA 3CNEA 1YZYA 2JRCA 3H1BA 3A4MA 3HH8A 4YV7A 2I1VB 3BXPA 1XKQA 4O2RA 3L6OO 4QPZA 5E4FA 1TJYA 2MSLA 5ICGA 3KHUA 4EUEA 1ZIYA 4HO1X 1AH2A 2B8EA 4EPXA 5C1DA 2Q9AA 3PJGA 5L3VA 1F2UA 4PFKA 2V1UA 3AG6A 3O3OB 3BSYA 4WZ6A 2WFAA 4A73A 1VXOA 2QRJA 1GSHA 4L57A 3VQTA 3LBNA 4ZU1X 1OWNA 2VWPA 4A9AA 2UAGA 1R2QA 2AJTA 5GGXA 4GLBA 2BJWA 3HGMA 1E5DA 5SZKB 5CCXA 2I6SA 2WZCA 2Q1YA 1YR6A 8GPBA 5IWCA 3F73A 4IXWA 1PV4A 3I0ZA 5DTJA 5E38A 1LS1A 1FYEA 4WVFA 5GM2A 5KBYA 3TW0A 3SDSA 3KRTA 2C88A 2OC9A 5CYFA 4F4IA 3E3LA 1HFWA 1E2PA 2H57A 3FWNA 4YGYA 3TLYA 1W88A 3NIWA 3ONVA 4ZJZA 1NBMA 4CUJA 2IPMA 1JYEA 3OEHA 5DW3A 3N8GA 1YA6A 2ZVJA 4QUDA 4HDNA 1TQ4A 3KZMA 5K0LA 1L4UA 1KZ9A 1INLA 1PJ2A 4EVIA 3LCCA 3EEBA 4RA6B 2BZ0A 4M9CA 4DCMA 3LT1A 2P75A 1QWSA 4X0EA 4RAQA 4CF6A 4J76A 3WVNA 2FW6A 1BKYA 1WUIS 4Q3LA 4QL3A 3K9QO 3QP9A 3A1SA 1Y1QA 1DSSG 3P9XA 4K6GA 4P1ZA 4B7AA 1XRQA 4JLBA 5AXBA 5JCJA 4MSUA 1DNPA 1E1RA 3HA2A 1TZMA 3GMDA 3HKDA 1MVOA 2DT5A 2B2NA 1T25A 2HOQA 4QHSA 3LOPA 5LFAA 3EFOA 3K2QA 5TV2A 2HCJB 2VK1A 2GBPA 1TXGA 3ETGA 2BI7A 2NACA 2OD9A 3AF3A 4PY2A 4UVEA 2H16A 1HSZA 3X0DA 2V5VA 1MAWA 4KLRA 2WUWE 4RGVA 1F0PA 3RBVA 2G0TA 2V7QD 2GZRA 4CG0A 5ICFA 1JIVA 4WL0A 3RWBA 4ZXFA 2AW5A 3S1SA 3CR7A 1M75A 4XGKA 5I9TA 4YQEA 2WFZA 3AETB 5COAA 2ZRKA 4AS1A 5KQPA 4IW3B 2V3WA 1M2OA 1Y5RA 3M6WA 3ONDA 3FXAA 1NVDA 5FOQA 5EC8A 2QZ4A 4G5GA 4X45A 2G09A 3MTJA 3RS4A 4PZCA 4OGLA 2X8AA 4AJ1A 1T2CA 4DQLA 4FEYA 5ALVA 3HKDB 2MR6A 2FPRA 1ZD3A 2I67A 1IIBA 2XCQA 3SJCA 2B4TO 3VPFA 3UA4A 4C3OB 4F7DA 5KYXA 1PK9A 2RK3A 3K6RA 1ACLA 3R7FA 2GK4A 1DG9A 2ZB2A 4IS3A 1PKXA 3H8VA 3U3RA 2WM9B 3LNCA 4JYBA 2J46A 1RWVA 4D4LA 1NM5C 1T4GA 1J06A 4D0NA 3JR3A 3G5MA 1QDLB 3HHEA 2VR1A 2PKCA 5E6SA 3P9KA 5FA5A 3SS7X 4L4ZA 2O7VA 1JR6A 3UJ8A 4XD7A 1EA5A 1T1JA 4LVOA 1RE1A 1MJFA 2ZUSA 5D01A 1CUBA 1QYCA 1QFXA 1HDCA 4JYPA 4S1VA 4XWTA 2NZVG 4CLRB 2I99A 2NUTB 1R0BA 3O4IA 3TBHA 1NI4B 3Q2OA 3OBBA 3RK0A 1IRXA 1G21A 1XNGA 2A9OA 2G77B 3R7WB 2F62A 3TZKA 3SIPA 1UBKS 2XZDA 1YR9A 4I8XA 4XWWA 4QARA 4QDZA 1MDFA 1IBMB 3OZTA 1I7QB 1DX6A 2QRGA 1XQ9A 3O83A 3RT1A 3SE0A 2X2EA 2XCSB 1ISPA 4G4GA 1ZM9A 2C4VA 3C14C 2PBFA 4A8JC 1X0XA 4J0FA 4D92A 4EHAA 1UBRS 1UFKA 5TSDA 5EKDA 1DEOA 1HZJA 3CRZA 1ISMA 1T4BA 5ETJA 3U1TA 1SUAA 2RG7A 2RH4A 2ZYGA 1HDYA 1DIOB 1O9GA 1VHJA 2FPSA 4OQEA 3W8NA 4E46A 4UOZA 3AEKA 3NC0C 3CF6R 3HXPA 1ARZA 2DPLA 1EGQA 4MGIR 1ZLYA 4W8HA 5BOVA 4BNVA 2IOYA 2OBMA 1XV5A 1NAIA 1P0QA 1DT3A 1RQXA 4YMGA 1JU3A 5B12A 4XYEA 4DLXA 1WMBA 4M76B 1DCMA 1Y8QA 1U0BB 3CYFA 3D7NA 3GPDG 1XZPA 1YTUA 3QITA 1YL6A 4G1VA 1L7PA 2FX3A 1K2WA 5HFNA 3UJ9A 1WAMA 4AVYA 3SQXA 4UFOA 3PO2B 4PGAA 1CERA 2EJTA 2GD2A 3OZEA 3L43A 5HDQA 3TO5A 1U7XA 5JS7A 3R3WA 3BGOS 3L1UA 3IAHA 3MPUA 3EUFA 1FS4A 4RCVA 2HLPA 2CMFA 2I0FA 4HDQB 5FF9A 4ZJUA 4FI3C 4U5XA 2MSNA 3PHCA 4U7PB 2FETA 3NOXA 4QE3A 4RHXA 4DPMA 2HJ9A 2O20A 4PBRA 2CKMA 1U7TA 1BGWA 2HKIA 2RKBA 2WKWA 3QI2A 4YROA 4B3CA 4DR2B 4M9XA 1W87A 5K3DA 5FBWB 4LDQA 1S2GA 1CB7A 4LHWA 4UM9D 3UVEA 3JZDA 1ZD4A 2RGNC 1RYEA 1FCJA 2KE5A 2I29A 4FOLA 4DCGA 4DSTA 3U16A 1QIGA 1YS9A 2YVKA 5E9AA 3AP1A 5CTJA 5KTKA 2ANCA 2DUJA 4CTNA 3OQOA 1XAGA 1ZJ4A 2D1SA 2PU5A 3GIWA 1ONBA 2WUEA 3VC7A 4EITA 4JITA 5FUBA 4G07A 2WTXA 4FMDB 2H07A 3T7JA 2ZYAA 3H1FA 5IC6A 4QFCA 1SVLA 3OU7A 4OSPA 4CRWB 1RYNA 2EDCA 5CFPA 5KVAA 5FQNA 3IBGA 1TFUA 2YJ3A 4F9GA 2J0UB 1HR0B 1SURA 4DLWA 5CFZA 2WKSA 1FTQA 1Q1AA 2C20A 2IYPA 4MR7A 1KH1A 3P4UA 4MV5A 4IOLA 2OMEA 3KUDA 4M6WA 1ZQ9A 4UREA 5HTKA 2IHTA 4KRFA 3EN0A 3MGCA 1YIOA 2O6HA 3KXIA 3T3PB 5ULLA 4BYGA 1SCQA 1XRMA 5LA6A 5FDFA 3P45A 3IKLA 5DHPA 2YZGA 4KK3A 1XSEA 5IABA 1VHWA 3B6EA 4LOHA 1AKVA 4HP8A 3R7AA 3PI6A 2QDXA 1FYDA 3ZOZA 2HYIC 4PG8A 2WUVA 4AG5A 2VCYA 2Q5JA 4CMJA 4A3FB 5JYCA 5HP4A 2HWXA 2XNDA 1B1CA 1T1SA 5FYDA 4C29A 4MI1A 1PTJA 1JE0A 2DTDA 2HB6A 2WMYA 3FZYA 1H3EA 3BJIC 4Q18A 3JZIA 2HR1A 3ECAA 2VF5X 1KOJA 3P7MA 1E3EA 3GHYA 2DERA 4JFAA 4AXBA 3RQSA 1JLKA 1Q95A 1T26A 1T1IA 3PPXA 1BNCA 1HE2A 1LBIA 1V1JA 1NXOA 2EG9A 4JUBA 2YHSA 1MAVA 3SM9A 4Y3UA 3U4QB 3IQGX 1TCAA 2GQ0A 3ZZ0A 3DE3X 3FCXA 4L9AA 3L93A 5DNDA 5LMUB 1J00A 2Z9DA 1GAWA 1KO7A 4DANA 3OU6A 3UKJA 1DAEA 1NFRA 1TFRA 3A1EA 3RKUA 4B84A 1VI6A 3ED5A 1BSVA 1EAYA 2HQSA 4H2DA 4RVHA 3AF4A 3TOXA 2TSYB 2EP7A 3ESZA 3JXEA 5EWMA 3W77A 2C7QA 5KQRA 3L1VA 4D9JA 4HNUA 3JQGB 4TWIA 1J99A 3IIKA 3HBFA 3OM9A 4ITVA 1ZPDA 3G79A 2O2HA 2Q3JA 1G5RA 1TEXA 4U4AA 5AVXA 4NMXB 1NBAA 2O3SA 2BDTA 2XTAA 3AEQB 2HWWA 4GR4A 3KB1A 5ER9A 3X1XA 4BGVA 3CEMA 4OPMA 3MT7A 2SKDA 3IAS6 3ADPA 4IV8A 3K0HA 2R6ZA 4XGIA 5ALOA 1T9CA 2H6EA 4ZAXA 4HPXB 4DPKA 1RZRA 2EAUA 1OX4B 3UMBA 1COWA 2QRVA 3Q0TA 3B6IA 1U3WA 5JAQA 1UQUA 2O2XA 4U00A 4X41A 2PN1A 3MD0A 2WDZA 4L07A 2X7XA 1K5PA 2ONCA 4FKBA 1UKCA 3MWJA 4M8KA 3IESA 1OILA 3MOGA 3IBCA 4L6IA 1EWQA 4EQ6B 2QRPA 3ZLUA 3MILA 3I0MA 3KZKA 3O6VA 4A92A 1UBFA 1CR2A 3TVDA 4CUZA 3P4YA 1II0A 3NT2A 3W34A 1MF7A 5I5EA 1K5HA 2EJWA 4B81A 5A7HA 1JB9A 4O4HB 3UWDA 3LPNA 5K05A 3KIPA 1XCMA 4K9MA 2YV1A 3DAHA 3UTCA 1UUFA 1ABFA 1UBOS 4RZQA 4CMAA 2F4VB 1B8OA 1RXIA 4FFWA 2I6XA 1VLHA 1QIMA 3GDFA 3QVOA 3ITEA 4KAXA 2OYRA 4BNWA 4DC1A 2C42A 5HDBB 2FR0A 2WF9A 2P5YA 3MTGA 4RM2A 5ILQA 3PV0A 3PNQA 5K8TA 4XRGA 1I33A 4PRKA 5IHXA 5KYKA 4ZN6A 4ZDJA 3GRZA 1FDTA 3ETHA 1U2ZA 1C3JA 4HDOB 2RGYA 4J4TA 4RCYA 5KHLB 2OT3B 3QLTA 2WIGA 4H1WA 1V95A 4D26A 3GLTA 3DGEC 5EJ9A 2HGSA 4YLEA 3RJ5A 3R8FA 4U8GA 5DBEX 4MQMA 4MS3B 4Z9BA 5I7WA 1U2TA 2QU7A 1BE1A 4M99A 1JFVA 3PC8C 2FSHA 5AK3A 1XN1A 2FSVC 1JVNA 4FQ5A 2DHDA 1O6CA 3PICA 5LZ5A 1K4MA 1D4ZA 1V25A 3AQ4A 2VHVA 3MUNA 4K88A 1SCUB 4G2TA 4KJXA 2QA5A 1BMTA 3ZHTA 4IDDA 2GK3A 3KYIB 3IUSA 4WD3A 1CUCA 2BFBB 4DYVA 1DO2A 4KZKA 2W71A 5CPBA 4F6RB 4NYJR 3R6DA 1SQFA 1J42A 2FEPA 4NCHA 2BZGA 4GMXA 1YC5A 4YXWD 2Y0CA 4JLAA 1WCWA 4MUIA 3RTBA 3KSUA 2PXCA 2DE0X 1T24A 4I55B 2WJPA 1XTJA 3B5IA 4YJHB 5I5GA 1T0UA 2H3HA 2JA8B 3STTA 1YULA 2FH5B 2X5JO 1ITZA 3HVKA 3I3SR 2GEJA 4HX2A 4TT8A 4ABTA 2NU6B 4UHKA 2M6SA 2VDPB 3FNRA 3MPOA 1L5SA 1BEUB 4MI9A 4PYLA 4EX7A 2QM0A 4I14A 3QOYA 3HYLA 3CH7A 3PFCA 2B6HA 2DY1A 2W2MA 1XRJA 1MJGA 2YICA 4A1FA 2R2GA 2V59A 3AF5A 2ALJA 5F4BA 5J4HA 1QHIA 3W4KA 3LW8A 4FGWA 1U0NA 4UHJA 1I1HA 1NX6A 2E4YA 3AF6A 3PSAA 3E9QA 5KQSA 1O9HA 1ZFNA 2X9LA 4QOFA 3T1YB 1FMFA 4OJMX 3O4VA 2XOEA 3FYTA 3DOJA 4FBLA 4WPGA 3C97A 3ZNQA 1MO2A 3ONWA 1DIGA 1P5RA 2FRVA 2IUYA 2JA1A 2Q3FA 3RU7A 2QD3A 3WDSA 4EDFA 3THOA 3GLHA 4ZHQB 5J3JA 5AW8A 3CEPB 2RC5A 3QMMA 4AXXA 3VNQA 1Q57A 4FN5A 1KZ6A 4GPTA 1Z38A 1O8CA 2ZWAA 3IE2A 4MLZA 1GCIA 3AVQA 4O1MA 2I2FA 4PQEA 4ZO8A 1KMMA 2C2BA 3DLPX 1RC0A 4DA9A 4DLLA 3Q9SA 4BQPA 1VI2A 5JMTA 2AVDA 4P4NA 3VXKA 2YJ5A 3PQ7A 4IFBA 1IZ9A 3E7WA 4TMTA 4OGGA 5IAOA 3UGJA 3EIUA 4KN9S 4GPZA 1SKQA 4C7VA 3K20A 5ALMA 3M33A 1G41A 1KI1A 3MAGA 2NUAB 2XGGA 4FYWA 5CNJA 5FBVB 2Y4OA 4ID9A 1JBKA 4JB0A 5G0WA 5M29A 1R0YA 5AVWA 5JCOA 2B8NA 1RFLA 2JFNA 4JMPA 1GN9A 3OETA 4TUYF 2RB4A 3ADDA 3UY4A 5JH7A 1P0MA 3QNWA 5DVZA 2C1ZA 3I9V6 3OY7A 5AHWA 1W75A 3KPYA 2DKNA 4XGNA 5T6BA 1XPUA 1BG6A 1FY2A 3RTDA 3VR5H 1XZMA 2HJRA 4OP1A 2PAFA 1EFRA 2H4WA 5I9IA 1RWOA 1P6UA 2AHOA 4KQEA 4EP1A 3UCEA 3GF4A 5JCXA 5JD4A 2GZ2A 2CWWA 4L4RA 4Q7KA 2Y71A 1VFPA 4WOBA 1K8ZB 1GOTA 3RYIA 3SQMA 5JH7F 5LUAA 1GLGA 4N3NA 2FZGA 2OXTA 1FNCA 4UCXA 4H1TA 4BQEA 4KLCA 3TSYA 2QTWB 2EBHX 1S1MA 1AN9A 1SAYA 2C3YA 3FYHA 1NI4A 2NXCA 4UDNA 1JGTA 2R87A 3GG9A 2E1RA 5KTSA 1QFZA 1TQ6A 2W2KA 4FNGA 3SHTA 5JH7B 2OXIA 3C3DA 3TEJA 2BGMA 2O8BB 2I2BA 4ZVQA 1ZKMA 1A2BA 2FUNB 3EZGA 1NW6A 4NR0A 2QTLA 1OIVA 3P52A 3VISA 3ICWA 5ALLA 1XPOA 3GUVA 4N7RA 3U6BA 2ZYVX 5KYXB 1VRWA 1W4AA 5EI5A 5AKYA 3HXKA 2GAOA 3EG9B 1UWKA 1WCIB 3KLMX 4X84A 3ZGNA 3AHEA 4E4RA 5KINB 2R93B 4BY1B 1V6CA 4YA6A 4D8YA 3AHIA 1T15A 1ADYA 3AKYA 5TMPA 3O84A 4P32A 1IH8A 4UVIA 1VKJA 4JHXA 3V8BA 5BRAA 1NW7A 4UHDA 3GVCA 1ZH8A 2ADMA 4X6YA 4MYCA 3GJXC 3FH0A 3VBCA 1VRCA 1GZ6A 2GJ9A 1PAUA 2IVFA 2GASA 2A57A 1DTEA 1FX0A 4MIOA 3KZ1E 1YB5A 5B6JA 4IJQA 5JROA 1CY1A 1G7RA 4JLMA 4BGEA 5K5EA 2VI5A 3NMUF 3ROFA 4RJ2A 3I2HA 1U7PA 3VKUA 4MB2A 1I3CA 1LGYA 2Z95A 4FZ5A 4F56A 2GCEA 4ENUA 1H42A 5EUMA 1P2VA 4AF6A 1U99A 2Q6OA 5C34B 1VE7A 4PONA 3O8OB 3T0IA 2XKKA 3DMTA 3H75A 2H7YA 4IMJB 3JYOA 1ZJZA 4Y6PA 5EFZA 1SXJC 5LXTA 4DM4A 4C9BA 2QF7A 2FEAA 2FQ1A 2AOVA 2VXCA 2XVXA 5BYJA 4YHBA 2G83A 1TM4E 3H2KA 1U0FA 4C4SA 4FFVA 2CNWD 1JN0A 2AEMA 3LXMA 2I4MA 1SWWA 2PX5A 3DAOA 4J2OA 5BSUA 3IBTA 4YCNA 1JAIA 4U3JA 1VGQA 1OTXA 2GYVA 5EE1A 2ZR7A 3EWSA 1BVRA 3M5PA 3C6MA 5B37A 5B7GA 1T6YA 4OLFA 1W52X 3D3KA 3H7AA 4FKMA 4M1TA 4RTLA 2JI8A 2ZUCA 7ADHA 2C82A 1G18A 1U31A 4TVBA 3CRNA 3TRHA 2QX9A 3U40A 1WZNA 5KYUA 4CWAA 1X1RA 3CTPA 2Z6QA 3GL9A 5ALGA 5EHIA 2BSXA 2HIAA 3VPHA 2DCMA 1MB4A 3ZI0A 1IM2A 2R97A 3LPMA 5DGTA 1XRSB 4BE4A 2AEJA 2R47A 4REQA 2ID8A 5SYNA 3WE7A 1LZLA 4CMIA 2GLUA 3BMOA 3HOWB 3WKDA 1CJTC 1H0KA 3PK0A 1ZVKA 3HJGA 3PRJA 3DLBA 1XO1A 3PLNA 1D2MA 4UVHA 4ZQGA 4ZYUA 3EIQA 5M5WB 1XQWA 5E6RB 4XUDA 3UV3A 1XZ8A 2FPOA 3B7PA 2PA3A 4FGJA 4PLCA 2BHLA 3OTGA 1N1DA 4GPD1 3B85A 1YFJA 3M89A 3QK7A 4YAJA 4W9NA 1TUIA 3MCUA 4F2DA 1UBGA 2X0JA 3ESXA 5IZ4A 1Q0UA 1V9SA 1YHYA 1YRHA 2NO4A 3HKZB 1ST2A 3G8YA 1I0LA 4MAMA 2PRIA 4ALIA 5KB3A 4TL6A 3VGPA 2HU5A 4ZYWA 4MV9A 3QPVA 4K87A 4HX9A 4D9FA 3TZLA 1YZGA 3IT3A 1VE5A 1GCAA 4EPRA 3FOFC 2E7ZA 3SMVA 5JPCA 2A67A 4BO4A 2BDEA 4XCVA 2PD3A 2CBZA 5T5QA 3ND6A 2LIVA 1ZD9A 3M6MD 5EIOA 4AIIA 4B0PA 2JGAA 3QKSA 5A0TA 1J49A 1U8ZA 3Q12A 4X7PA 5B1EA 2H4YA 2AK3A 2G9UA 2P79A 2YZKA 2C31A 3ABSB 3TXXA 3VSCA 3IAM1 3M2PA 4O4JB 4W5HA 3ZTTA 2QG6A 4ACBA 3NTVA 2WIJA 4R6XA 4H15A 4OBEA 3P2OA 1PDVA 2B8TA 4OHMA 3TWOA 4DWOA 1I1NA 2XTMA 3PKIA 3TK1A 3I4NB 1UR5A 2I9PA 3FX2A 3TXYA 1K6IA 2D2XA 3WLMA 4D02A 5JQGA 3KQKA 4KCGA 2JBWA 1PUJA 2H4FA 3D7KA 2A3RA 4X8MA 2EJBA 2RGUA 4MR9B 4B75A 5KJCA 2XY4A 2P0AA 2ZJ8A 1MC8A 3ORQA 1M2VB 4X64B 3KXDA 4F3CA 2MOKA 3BULA 5J23A 4Z8YA 3RT7A 4LF7B 4F2GA 1J09A 1UDBA 4ZAWA 4AD8A 3RJ9A 2SICE 2IHNA 3I37X 1D9XA 4ANFA 2DQZA 3OG9A 3FPHA 3T41A 4OMDA 2KPOA 3II6X 1TUBB 1EVLA 4G85A 4RABA 3VVCA 1OXKB 4BO6A 5HUQA 2H48A 3D31A 1NMQA 2CNNA 3QVGB 3WIBA 2JFBA 2I7VA 2J59A 4F06A 4JGIA 4IIYA 4JH0A 1TTQB 3A9RA 4V3BA 2RG1A 3F6SA 4IJMA 4LRXA 2HX1A 4XTRA