2B1QA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with trehalose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
molecule tags Hydrolase
source organism Synechocystis sp.
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
total genus 92
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b1qA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2b1qA02
4C4RA 4BNDB 3W5CA 3QGMA 4RESA 4AS3A 3OCVA 5ALZA 2C88A 2GO7A 3R4CA 2G06A 5ALNA 5FP0A 3DDHA 1RQNA 3FM9A 3I28A 5AVSA 1WPGA 3OCWA 4EELA 4YGYA 3UMCA 1RPZA 3QNMA 4I9GA 4IFTA 3L5KA 4UMEA 4BEVA 2R8YA 4FFDA 5AI6A 3L7YA 3EF0A 3P96A 1CQZA 2G08A 3ZWKA 4EENA 1RQLA 2JAWA 3ESQA 3QU7A 3QX7A 3FPBA 1YNSA 3PDWA 4BKMA 1N9KA 1WVIA 2YBDA 3FGOA 5A3RA 1MH9A 4BNDA 4BX2A 4NAVA 5AIAA 4J03A 2EAUA 4MUMA 4O8CA 3SD7A 3PCTA 3R09A 4BYGA 1RC8A 1O03A 4J2TA 5ALOA 3ESRA 2AUTA 4NV0A 2YMLA 2B0CA 4ZEXA 1QQ6A 1U2SA 5AK4A 5AK3A 3WGUA 5ALMA 2MU1A 3QU2A 5A3QA 1RKQA 4UU0A 3AR7A 3L1VA 1AQ6A 5JJBA 4FE3A 5AKLA 1ZD2P 4OFZA 4DCCA 2ZBDA 5AKZA 1FEZA 1ZS9A 4YH1A 1RLTA 3OPXA 4XQ0A 1NRWA 4FYPA 4Y2YA 3A1EA 4UW9A 1RMYA 2HEGA 1N8NA 1Z4PX 2JARA 3N5KA 1RLMA 5ALJA 2G1AA 2FDRA 3WK8A 5AK6A 1ZOLA 2G09A 2YMQA 2IOFA 2HO4A 1YJ5A 2B82A 2FUCA 2FEAA 2WFAA 3ZTYA 2W4MA 4HAIA 5IS2A 3M1YA 3L8EA 1IWOA 1Z5GA 2WF5A 3N28A 5IT0A 3PGVA 2HSZA 3W5BA 3MMZA 1CR6A 2ZG6A 4DWOA 1TA0A 1TJ4A 1Z4NA 4XPZA 3DV9A 4DW8A 3W5DA 4YCMA 3WGVA 3L0BA 1U7PA 3FPSA 4YCLA 3QYPA 3U7FB 1SWWA 1L7PA 4QJBA 5AM2A 4EX7A 2Q5EA 3AR4A 5ALUA 4B6JA 4OD0A 2PQ0A 4UM7A 5AW2A 2HOQA 3DNPA 4UASA 5ALXA 4C4SA 5ALFA 3EPRA 4OCZA 4HYTA 3ZVNA 2AMYA 2JAUA 1NF2A 3WK5A 3ZX5A 2Q4RA 3AR6A 3NANA 2WM8A 5ALEA 5ALGA 4UARA 5AVVA 3I76A 5ALWA 3EF1A 2EARA 2YN4A 4KYTA 2C4NA 5AIBA 2I33A 3NAMA 2YJ4A 2G0AA 4CNQA 1T9ZA 1RMTA 2DQSA 3WKEA 2HX1A 3B8EA 4OHFA 1L7NA 3KOOA 4UU1A 4Y2QA 3QU9A 4EEKA 2B8JA 1RDFA 3QLEA 5AVTA 3QUTA 5AI5A 2YMMA 2OYCA 3AR2A 5AW4A 1LVHA 2BDEA 3K1ZA 1VJRA 4UMDA 1VFPA 1RMQA 1XPJA 3M9LA 1Z4QA 2B1RA 1T5TA 1Z4OA 3L8FA 5ALYA 3CZ4A 3E84A 3IJ5A 2R8EA 5ALPA 1SWVA 2GFHA 4YIKA 3SMVA 2HF7A 2HHLA 4KX3A 3NALA 5AM4A 4G63A 3GYGA 1TJ5A 1O08A 5AKXA 4CF4A 5ALLA 4H1WA 2RARA 3E58A 3MPOA 2AH5A 1L7OA 4L6CA 2QYHA 2Q4TA 1S8OA 2I6XA 4BX0A 1SU4A 5AKYA 3MC1A 1L7MA 3ZX4A 3SHQA 4JDPA 5AM3A 5AKIA 3QU4A 1L6RA 2YFYA 2OBBA 1QH9A 2I7DA 2MSNA 3AR8A 4UMVA 4KX5A 2IOFK 1ZJJA 3ZWDA 5AW0A 4YCNA 4Y2VA 5AI0A 1YMQA 5AW3A 2WF6A 3OCZA 2ODAA 3I6BA 5AESA 2NO5A 3ZVLA 2RAVA 2P11A 5AI9A 2W43A 2YJ5A 2ZOSA 1XVIA 4XE5A 4GIBA 2BDUA 2P9JA 3A1DA 1JUDA 2X4DA 2YJ3A 4NABA 4CF5A 2FPXA 3HYCA 5AM5A 5AKKA 2RB5A 3NUQA 2JGAA 3ZTWA 4KNVA 5AI4A 4XOUA 3ONNA 4UATA 3S6JA 2PKEA 2G07A 5AKEA 5AKJA 2YJ6A 2O9JA 5ALHA 3AR3A 3SKXA 5AICA 1QQ5A 2D2VA 3B9BA 3R9KA 1YS9A 1Z4KA 3B9RA 4UAUA 5E0OA 4DFDA 4Y2JA 3A1CA 1RKVA 3U7GA 5AVQA 5T41A 2JAOA 3QUQA 3UMBA 1YV9A 4L6AA 2PR7A 3MN1A 1EK1A 5AVYA 5AVUA 1ZD5A 5ALQA 3UM9A 5AW6A 3ET5A 2ZBGA 1WZCA 3SKYA 2OA0A 4C4TA 3ZI4A 4ZEVA 3BA6A 4CE6A 3HLTA 1QYIA 3OCYA 4UM5A 1Q91A 1RRCA 1S2OA 2I34A 4KNWA 4HGNA 4KN8A 2ZXEA 3WK6A 2HF2A 3ZUPA 5A3SA 1Z4LA 4HGQA 2HCFA 4G9BA 4NWIA 4HGOA 2C9MA 2W11A 3QUCA 5AM1A 1Z5UA 5AM0A 1PW5A 3PGLA 2GMWA 2CFRA 2FI1A 4L57A 3N8GA 2WF7A 1L8OA 2WHEA 5AK5A 4RETA 2OM6A 3EWIA 5AW7A 5ALKA 1T5SA 3RF6A 2P27A 3WK4A 5ALIA 3TLMA 3WK7A 3I1YA 2YY6A 1NNLA 3SF0A 3ED5A 2G80A 3DAOA 5AW8A 2O2XA 1ZRNA 3U13A 4YIHA 3RFUA 5AVZA 2B8EA 2BY4A 3QXGA 2IYEA 3U7HB 3E8MA 1XP5A 4Y2XA 5IT4A 2ZBFA 2B1QA 3N07A 3ET4A 1TE2A 3ZVMA 2IA5A 4HGRA 4F71A 5AKHA 2P69A 1Z88A 3U19A 2C8LA 3KD3A 2FUEA 4UMFA 2NYVA 4Y2RA 2HDOA 2NO4A 4Y2TA 2FPSA 2R8XA 2I54A 3WK9A 3CNHA 3KDPA 5ALDA 3UMGA 4EZEA 4EX6A 1Z4MA 1F5SA 3QU5A 1J8DA 3KC2A 4I9FA 3NRJA 1K1EA 4PNHA 1ZD4A 5AKGA 2ZBEA 3J7TA 3U26A 3AR9A 4Y2UA 4BEWA 1Z4JA 3NASA 2EATA 3KBBA 1J97A 2GHTA 3D6JA 1U2TA 2AGVA 2HI0A 3ZW7A 4E88A 5AVWA 1WR8A 3N1UA 3OTQA 4QQFA 1U7OA 3ZU6A 3F9RA 4IG4A 4ZEWA 2FPWA 2WF9A 2CFTA 4AS2A 5ALSA 3VAYA 4HGPA 3NIWA 5AW9A 2QLTA 2CN1A 3WKAA 4UAVA 5AW5A 1Y8AA 4BX3A 4AP9A 2RBKA 2YMPA 4Y3UA 3WKCA 2VKQA 3SLRA 5ALVA 1U02A 2I55A 1ZD3A 3KZXA 3BWVA 2GHQA 3FZQA 3WKDA 1Z4IA 3L1UA 5AW1A 3W5AA 5AHXA 3AR5A 4Y2SA 3IB6A 1EK2A 1L8LA 3A3YA 4F72A 2B30A 5AVXA 1LTQA 4CF3A 2C8KA 3WKBA 3L8GA 2IOHA 3IRUA 2WF8A 3QUBA 1Q92A 3OCUA 3FVVA 1ZRMA 2R8ZA 2CFSA 3L0CA 4Y2PA 5AVRA 3E81A 5ALTA 2FPRA 4MWOA 3L8HA 1KYTA 1RLOA 1X42A 4GXTA 1YDFA 4JB3A 1RKUA 3OCXA 3U7EB 5AI8A 4NFLA 5ALRA 2FPUA 3L0YA 1TJ3A 4BBJA 1VJ5A 1QQ7A
chains in the Genus database with same CATH superfamily
5F2OA 3KKKA 3VZCA 3GXOA 2KS6A 1Z5PA 3A9SA 2C88A 3HB0A 4L95C 2CYAA 2W70A 2P6UA 4HP8A 4OM8A 2ZIXA 1L7VC 1UJCA 3MJTA 3DDHA 4J4HA 2TMYA 4Q4HB 5ECDA 2HIAA 4NPCA 4UEJA 2JC3A 3TBHA 4WOKA 3NIBA 5KOIA 5FR1A 3UJDA 1K9SA 1WMBA 5FHRA 1RYNA 1W96A 3OTWA 5THXA 2BFOA 4X66B 5D86A 4I36A 3OQOA 1VE6A 2W37A 4JT2A 1XTQA 3GJ5A 4K05A 3ZU3A 4B3TB 4TV9A 1Z34A 3DTVB 3BREA 1A9XA 1N0UA 2IYVA 3G13A 4LRWA 5EGSA 4F38A 4AJNA 2O2GA 4Z6KA 2G5CA 3U4CA 1V71A 1I3LA 1B6RA 2I7TA 1U0TA 2XD9A 1GKIA 3G5AA 2C2WA 2FP3A 3OC6A 4BKRA 4DXHA 2BDTA 5CVTA 4S2EA 1Q0PA 4B4UA 4BY1B 2VF2A 3ZJ4A 1I5OA 3Q5DA 1TFUA 1N9KA 1M1NB 1BD3A 2DUMA 2PO7A 5AJXA 5JDIA 3FGOA 3ICQB 2QY6A 1V1MB 2G4CA 2A0YA 3HKCB 5AIAA 4H6XA 1SUIA 2BFEB 2DT8A 3X44A 4E22A 3OTOB 3ITEA 3MTEA 4L28A 1BWRA 2FSUA 1NV8A 1E2HA 2GBLA 1JIKA 3C6KA 1HLFA 4ODIA 2CNWA 5EG5A 1T3LA 3DONA 1I7NA 1J00A 3QVGA 3A6PC 2XLBA 2X3UA 1DAIA 2YOGA 3Q9UA 5F51A 1J1UA 3NBZC 1JIVA 2WUEA 4RAQA 4KQHA 4ZFNA 4QOJA 5L3RA 3AHFA 3GQBA 1Z28A 4XX0A 4E5SA 3WRYA 2JVIA 4S12A 3L0SA 3I34X 3KUCA 5EC8A 4KK3A 1I3KA 2D4HA 1WABA 4LJSA 1BHQ1 3IPAA 4C4YA 2BTQB 2O7SA 3HL0A 5MF6A 3GYBA 4UW9A 1NJ1A 1YR3A 1THGA 4HO1X 1A8UA 2BP7B 3BGSA 2R8RA 1BMTA 1PL6A 4JR0A 3M9WA 4KAFA 4KKXB 1FFSA 4FHFA 1Y9AA 4FD2A 4YHHB 3R3ZA 3QPAA 2VLIA 3E6AA 1LXCA 3PGMA 1QZZA 1VRCA 3ILXA 3KKZA 4GWKA 2PUHA 1FBTA 3A9RA 1TUIA 2AXEA 2H9IA 3EIEA 4LDRA 4P98A 5IH3A 3ZTYA 2GN4A 2ZAYA 5CB4A 2IUEA 3GRCA 4DA4A 5B6PA 1RZRA 1ZJYA 1U9CA 3R6WA 4K6HA 5SYNA 1KMQA 4W9MC 4MKFA 1LY1A 2WKRA 4HGYA 5EUQB 4RULA 2Y99A 2JRCA 4O4IA 1SD1A 4NPAA 1N3YA 3C8UA 2VQ6A 3VTFA 1P9RA 3HDYA 4ARVA 5DN9A 4RV5A 4CV1A 5C8ZA 1E4EA 2I4RA 1U6JA 2FLWA 3A6EA 3DJYA 4G25A 3ZOKA 1X8JA 2I1WA 4UPDA 5JCJD 4BNWA 5F7XA 1PFQA 1Q1ZA 2LIPA 3WL6A 5BW5A 1MX9A 3BQMB 2QVCA 3WB9A 4UM7A 3BHJA 5KVVA 3PENA 1E2NA 3UHFA 4P35A 1IEQA 5I3CA 4H1UA 2QNRA 3IT3A 2OHVA 4LNAA 3O4RA 4DMMA 1EUDA 3ILYA 1IN8A 4UASA 4Y18A 5IKOA 1FX0A 2JHAA 4RKFA 4CTKA 3UJBA 2NP7A 4U2KA 1AU9A 1PZHA 3EE6A 5CG2A 4KWIA 4AX4A 4D3XA 2ZRKA 4OMDA 1J0CA 1Z7BA 5ALEA 4G0ZA 4QPDA 2C2GA 2P40A 4U6QA 3W2GA 3ACCA 3IUSA 1QRRA 4ZOEA 4ESHA 4EUFA 2MSWA 5LA6B 1RI5A 1K92A 4QC2A 5KTNA 2VQEB 2R1TA 4MDFA 1E61A 3AVUA 2BHTA 2YJ4A 5LQSA 5C1OA 3HCDA 2DQSA 4TUYF 1TRHA 5TDHA 2TS1A 4IIYA 3IPXA 1ORHA 4C76A 4B2YA 3V7YA 2ZSBA 3MT7A 1AZLA 3QLVC 2WU4A 2DHEA 4G09A 1SZPA 3WZLA 3KT3A 3M1AA 4C03A 1FP7A 1SXJB 3KZOA 3IIJA 1HORA 4E2WA 3CKLA 4YFYA 4Z4CA 2ATCA 3L6CA 1VA5A 5AVTA 4JL8A 3DDZX 1PFKA 2YMMA 3UF0A 1EVQA 5TQ0A 3SR4A 2CNKA 1VJRA 2BZGA 4WBNA 1RMQA 2QMYA 3D7KA 3DFIA 1S2GA 4Q82A 1N5MA 1W9HA 1K3UB 4PBSA 4RC9A 3TZLA 4EENA 2V1UA 3DM5A 4YP6A 3RLIA 4V0RA 4B8ZA 2QLFA 3FJ1A 1NYRA 1R37A 1DJOA 3CZ4A 4LY0A 4M99A 1RABA 1T3GA 1NVVQ 2FMUA 4PLWA 2LIVA 5ALPA 3SM3A 5EKSA 1H1DA 2QVGA 5DEOA 4ZAVA 5IANA 3AEKA 5C5DA 3MOSA 5EXTA 2VPZA 4PYIA 2A1IA 2OECA 3FKSA 5E1MA 4ZWNA 1JA0A 3DXFA 5H3CA 2PUEA 2WINI 5DM1A 1F3LA 1YDWA 1TJ5A 3SMQA 5I9SA 4ID9A 3CSUA 4EY6A 5BMOA 5FFFA 4ZJZA 3BYZA 2CXTA 1M0WA 2FFAA 4GYWA 4MOWA 1H5NA 4NXMB 1S8OA 5H70A 4E6EA 3EZXA 4AT1A 3OZDA 3Q6IA 5IC6A 2FSPA 1E3QA 1XZBA 4AJLA 4ETIA 5HR5A 2UUAB 4U02A 1L6RA 2VPYA 4DG5A 4EF4A 5J2TB 2WVHA 3P2EA 1CZKA 4YO7A 3AUFA 3H5AA 4BFUA 4DAOA 1HT0A 1HSOA 4ZCRA 4KXWA 2V7UA 3ND8A 1RD4A 1NFQA 3OT1B 3GLHB 4G1UC 4LHVA 4MWZA 4A8TA 4HWGA 1RPNA 3IGFA 5C9ZA 4A2WA 3FR8A 5TNXA 5DCWA 4EJ6A 2C31A 2VTKA 3VR6D 3FA2A 1O7JA 4IXWA 3COYA 3ER8A 2F64A 2G7MC 2PXXA 2JHCA 2VI5A 3D4BA 3MRXA 3PFWO 4S1NA 4KO8A 5EHQA 2IDKA 2IEAA 1E3WA 1ODIA 2YIVX 4QVGA 1G21B 3BGDA 5D84A 1RWMA 4HL6A 3VPCA 1QIEA 3ONVA 1QZXA 4ECAA 2A92A 3SIXA 1ZY2A 5HKKA 2H7XA 3CC8A 3P94A 4Q9JA 1QF7A 2BEUB 4NE9A 5K5EA 3PSHA 4K9QA 1O77A 1K0UA 1CRLA 1FZQA 2OGZA 2QE7A 4CODB 4L0MA 2J9GA 3RVRA 4QTYA 2BGWA 3WADA 4RCVA 4C7OA 3NUQA 1EAYA 2WR8A 4H0NA 2JGAA 5FI0B 4MP8A 3HJFA 1V7CA 4LAFA 2RH9B 4C3VA 3IPYA 1FFDA 2FMIA 3EHEA 1V47A 4WOPA 2IXBA 4UATA 3DR5A 5CXUA 1XTRA 1JEEA 3GAZA 1L4HA 2XSZD 3KWJA 4JJKA 2RG1A 4P4TA 2F62A 1NQAO 3C2QA 2FQXA 4GXQA 4MUEA 4WZBE 3KWMA 3ORHA 2QN7A 5AICA 3EJWA 3ZE9A 3FFBA 4FNAA 1DEAA 3RIEA 2XVAA 1R5NA 1KF0A 4GKAA 1YCGA 5KYXA 2VHZA 2ZJ2A 4QXRA 1CLEA 3OKCA 4GLLA 4AF8A 4E5PA 3UGTA 1P18A 1QF6A 4F4FA 1UL1X 2NWQA 5B2ZA 1SC1A 4FYKA 4WNIA 1Y9DA 2MSDB 2QR5A 3QUQA 2ATEA 3GP3A 3HXTA 3TDMA 2WMNB 4MI6A 2Y1WA 5G0VA 5AD1A 1G18A 1WP4A 2GAIA 5JC8A 2AYXA 2YWCA 1ZJ4A 2CMGA 1THMA 1VIYA 3RJTA 4GKKB 1UK7A 1AHIA 3A4YA 4NHOA 5KNCH 1Z0JA 3TZKA 1KARA 1C9JA 2AFIA 2B7CA 2H5LA 1H1TA 5LM3A 4Z7QB 1R74A 4MMYB 1AXRA 2GEBA 3QBDA 4FJ2A 3O1HB 2AI3A 4YDQA 4A3JB 2AC2A 4OUDB 5JPCA 1SA0B 1ULHA 3ZCRA 1YH3A 5KWIA 2JK0A 4DMCA 4K9LA 3IKLA 3HNRA 1RYFA 3HM2A 3VR6H 3T9DA 2CF6A 3AVVA 1XP8A 1BE8A 1S7GA 4IQGA 3UUEA 2J46A 3IKJA 1V4BA 4GDMA 1Y7HA 4O1HA 2J07A 1A88A 1UMBA 3IAS6 3SKVA 2JB9A 5FL7D 4DLKA 1Y5IA 4XASA 3V8RA 3A2NA 3AILA 3O8BA 2ENWA 1VJ0A 5K6AC 5KCZA 4E31A 3ABZA 3USCS 2BI4A 2E1RA 5A05A 4QUIA 4XVHA 1VPEA 1GGNA 2A84A 2ODQA 4MPJA 4B31A 4DV3B 3IMCA 1YMVA 2RHGB 1TADA 3DOFA 3GEEA 3UWPA 3PKZA 2JFOA 1LPNA 4N7BA 3NTXA 5JS2A 3TLYA 2MYNA 1GCGA 1JLLA 1PW5A 3B12A 1HEYA 3OBIA 4WK6A 3IERA 4IGFA 3NHZA 4UNIA 3KT8A 1GQOA 1NJ5A 2NYAA 4MVJE 4MYCA 5GAJA 3I4NB 4HGZA 2G1JA 2X0RA 4DADA 2OAP1 1JP7A 1OWLA 1YZLA 3V7UA 4RKYA 5H81A 4HADA 1KPHA 2CLSA 2WHEA 2PTGA 4M0MA 3BE4A 3DMDA 9ATCA 4LYYA 4CLOA 3JQGA 4I50A 5LP6B 5IWAB 4OJNA 5LVAA 3U61B 4IWNA 4QTZA 3GJSA 4J0IA 4YYZA 1ARZA 4RMIA 1PI3A 3QXXA 2ZFUA 1VG0B 3N0RA 1E5VA 3I23A 4V2IA 5DRYA 1SRQA 3ORFA 4FHEA 1UXOA 5ALIA 4PZPA 3EBLA 3VH2A 1P9LA 2GSDA 1VBFA 2QMOA 1YONA 3QRWA 1FNSA 3M9XA 5CU7A 1IBSA 3JYHA 2Z09A 2F8LA 3HJTA 4MIKA 2BFFB 4XWYA 3DAOA 3G2NA 3WSVA 1FDRA 5DGHA 4V0MA 1NUPA 5AP9A 4YQZA 4GP7A 1P8AA 4UREA 4F1JA 2JLRA 2PT5A 1PJ8A 3M5WA 5K8VA 5LMZA 2ZGVA 3WMEA 4P4LA 4ZCTA 3VSCA 2B6NA 4A6EA 3P27A 4U2CA 5CPFA 2CCGA 3KQVA 3IEKA 3IV7A 4FGKA 1CDEA 3U9SA 1DMSA 1I7QB 1ML3A 5CBPA 1QH0A 1K7XB 1NC3A 3CRRA 2L2QA 3GNQA 3LDUA 5KQSA 1ZWKA 5BSGA 1AVTA 1TYZA 1ZVKA 1H2FA 1JKJB 2ZIAA 1GG5A 3KJFA 4FBLA 5DI9A 3FGNA 5LMNB 1X38A 4OGWA 2NVBA 5LDGA 3HG7A 5CYOA 5DOVA 1FVHA 3RROA 2VZ0A 5EJEA 4BVFA 2GTHA 3P71T 1XKTA 2G28A 5ALDA 2XQIA 3AUXA 4QASA 1I2MA 4OQDA 3KG2A 3L04A 4PFJA 4QULA 4ENVA 3ES9A 3UT0A 3KC2A 4DIOA 3NRJA 4Q00A 3W4JA 1MW8X 3PKIA 1Q6ZA 2DJIA 1ZD4A 1ZD8A 1PBTA 2GZHA 5JS6A 2H48A 4JQYA 3OZWA 3KHKA 4LQCA 3T34A 1GN8A 3C48A 4YMLA 4GP6A 3VZQA 2ZROA 2TECE 4KL8S 4Y2UA 3A1UA 5DXAA 5LIRA 5A9SA 1DKQA 1PVDA 5K8LA 5KYWA 1QUFA 2C2YA 5FA8A 2AN1A 3GGJA 4QZVA 1Q0UA 3P2OA 3K2BA 1T4MA 2JKZA 4LI0A 1I2AA 3OMWA 4J43A 5ARDA 5ELLA 5GZ6A 3TW4A 1J23A 2XUPA 3HPRA 1TM7E 4XJTA 5FI3A 1WR8A 4A6PA 4JYAB 3WO1A 2DETA 4LHYA 5DHUA 1EVEA 2SKEA 3BC1A 1GPUA 1U7OA 1EFRA 3RHZA 2R6DA 3DC7A 3TI7A 3HU2A 1JR3E 2BHLA 4E2FA 4ARZB 2YZGA 4FS8A 4US0R 4MW7A 1G8GA 4QOEA 5IJXA 3V3KA 5FTNA 1Z75A 1BTOA 1N2HA 1XDZA 3KQOA 4LOAA 1BXRB 4Y7CA 3R7WA 2H1LA 2OQ2A 2YQZA 1M2OA 3O31A 5BNIA 1QIJA 4F5DA 1CF9A 4LF6B 2GPSA 1RKBA 5BYBA 3VPFA 4F2GA 2QWXA 1MB4A 5TQ2B 2NOAA 2P8SA 1KK0A 5DNDA 5G3ZA 3TW0A 1NKTA 1B8VA 1Q1QA 2RBKA 3FUWA 5FLXA 3KSMA 1AGNA 2BC9A 4C20A 3T7KA 3S2EA 4OKSA 2ZRPA 5FBHA 2IYNA 4EPTA 5BOSA 3H97A 4MJ3A 4Q21A 2HMTA 2OGSA 2QX4A 4CDNA 3C3PA 2H2IA 4ZTUB 2F1JA 4DN6A 2M32A 1T26A 2Q3FA 3JQ9C 3JYQA 2EGHA 1GZ4A 3VC3A 1CERA 1VSBA 3B3JA 3KXDA 3PR1A 1G0OA 1QTNA 3P0IA 4DM3A 5ADVA 5MGNA 1T0IA 5TS2A 3PNBA 1XKXA 1IY8A 3T9CA 1DFGA 4CIAA 4MMXB 4OQZA 3RRXA 2A35A 3E4DA 3RC1A 5AVXA 4GW3A 2OHJA 2H31A 1WUIS 2O8CA 5IN5A 1D2EA 2KPOA 3GL9A 2RIRA 5HILA 1ZXBA 2NYUA 3JQBC 2WSYB 2YC4C 4J3FA 3BZWA 4UXIA 2AOTB 2O57A 5K45A 1G41A 4HB3A 1PNQA 3UA4A 4B3XA 1CIPA 3O4IA 4L50A 2NZYA 3FW1A 3QPDA 4DYDA 5G3YA 3PUWA 2QIOA 4TMYA 2FRDC 3WY9A 4EJ0A 2O5CA 3H05A 4ENWA 4N1AA 4PINA 5E1DA 2FSSA 3RUHA 4S05A 4K1LA 3I9NA 2H59A 4QNRA 4GXTA 4DVJA 1DEXA 1M33A 4KFUA 3VM6A 1VE9A 2JFXA 3UO8B 1XRLA 1YBVA 2XX3A 5LQUA 3EX7C 1KDVA 3H4MA 5K0BA 1L7DA 2FPUA 5BVHA 1E7SA 2HJRA 3E1GA 1WZUA 2VPIA 3H5RA 4BNDB 4LF9B 3NTOA 3G6WA 2JEOA 3LZCA 3QGMA 3PTZA 4KAXA 1ECLA 4DCUA 5ALZA 1ZR2A 4PG4A 3Q10A 1TM4E 2MINB 2WJ3A 3ND5A 4FSXA 5ED0A 5M7EA 2IJGX 4FFOA 4Z1OA 2DPYA 2AMFA 5JADA 1KJZA 1PR1A 4XUDA 1XU4A 2VHUA 3WQBA 1A9ZA 4OYRA 4DLVA 1ZESA 2ZYVX 1ST2A 4HV4A 4A10A 2ZTSA 4CKCB 1WSWA 3PXUA 3TUIC 1VGRA 1YS1X 1ZI9A 3HUFA 4IFTA 1IHPA 3DBRA 1NULA 4JLSA 1BXZA 1KIMA 2CD7A 3SBXA 3L8YA 4NDAA 5FL7A 2E6KA 3UPDA 1H2XA 4KQKA 3N2IA 1MENA 1BAPA 1BYUA 1RYDA 3DMRA 5GONF 3PRKE 1SKQA 3KVYA 3B53X 3DXYA 3HI4A 4MYTA 1O58A 2VJMB 4XEUA 3NHPA 2GPBA 3K8YA 1XJCA 1J2UA 3QU7A 3ZS9A 3VHQA 3A06A 3R5HA 3ZDXB 1R8SA 3PYLA 5TARA 3FPJA 3DP7A 1JKFA 3P4UA 3WGNA 2QVBA 3JCZA 5SYAA 4FTWA 1OHHD 4WCFB 1Z38A 4KO2S 5FWXB 5L3SB 1ATIA 5HFJA 4A91A 1R0KA 4QGFA 1TKAA 1ISPA 3DC2A 5GP1A 5ICCA 3R7SA 4DR5B 1P0CA 2NP6A 4QDTA 5A0VA 4CG0A 3ETNA 1JT2A 4O4LA 1TNDA 5IAGA 1E2FA 1TZCA 4MLPA 3RBVA 1Z29A 3BL8A 3PI7A 3W7BA 3RFFA 5E8RA 4M46A 2OHFA 4ZVQA 3WVNA 3DEKA 3K6JA 4I7EA 2IU0A 5F21A 4KDCA 1P5JA 1GEEA 2R8PA 4P7KA 2P2CA 4WZ6A 1T35A 5D3MB 1V5FA 4PFQA 3V4ZA 4TWJA 3ZCPA 3ZNPA 4B80A 1YIOA 1SUCA 3UWSA 5KUTA 5JJBA 5IAOA 1UEJA 1SY7A 3CJQA 4YJFA 3OIYA 2XA2A 3B1XA 1EQAA 1RAAA 2WA1A 5A06A 1E1MA 4DF3A 1IU9A 1N6IA 4FYPA 5JV5A 5H5JA 3ETCA 4U2BA 2JNWA 1RMYA 2HEGA 1RFLA 1Y3AA 1ZM7A 2DX7A 2FDRA 3C3CA 3N7UA 2C3YA 2QLBA 4BV3A 1YRHA 3RT9A 3T5PA 3IQEA 4FEYA 2C61A 4F12A 4YMHA 1ACMA 1AK1A 1A9QA 1LDYA 1PAUA 2IRWA 3RWOA 2CSXA 2EKQA 4DJTA 1LK5A 3V4RA 4I4LA 3UUFA 3Q8LA 5EUCA 3AVOA 1XZMA 3VPGA 2ZWVA 4IH1A 1XLVA 3LP6A 4RKWA 3ZN2A 2B20A 4BASA 1KU0A 4H18A 1QMPA 4H6VA 3K35A 3O84A 2A59A 4OQEA 3ZW8A 3MTIA 2DWOA 1EXVA 3UT5B 2ZVDA 1J4AA 2DFKB 4XCQA 4I3HA 4ZVTA 4BVAA 3B5IA 1KRXA 4ZI7A 1MO5A 3DCIA 1Z8DA 5T67A 1T0UA 2Q5EA 2D1TA 4X94A 4EGCB 2WIAA 3AMVA 1Y4DE 4NZNA 4OSOA 5GOZA 1T4GA 1F2DA 5JH7B 2CZCA 1DXOA 1VBNA 1Y6ZA 4UQPA 1LSUA 2XRMA 3RARA 2D1FA 3I4MB 3IJRA 1N25A 3HB5X 1SC6A 5KIAA 2JCVA 1ESDA 3ZWOA 4N8EA 3ZCQA 1LB1B 1HL7A 1DG3A 1KI9A 2QPTA 3L0OA 4FCTA 3WK5A 4D26A 4FFLA 3P45A 2BZ1A 3FNIA 5T64A 4YPVA 4Q1CA 4D6XA 3LVQE 4TTPA 3MGCA 1QIMA 4LE1A 2JW5A 3ZS8A 3UHJA 1EDEA 1BKYA 1G8PA 1V7ZA 5IYZF 4H3VA 3K5HA 1HLDA 1N9GA 1Z83A 2AC7A 2V8OA 2XZPA 4JUCA 4G97A 2CL0X 1MRNA 4JU9A 4QPPA 4B7ZA 2OFPA 1RMTA 4BVBA 3A4IA 4FYXA 1Q7CA 3C5EA 1ID1A 3DE3X 2XBUA 2XR1A 3GTKB 1NLUA 2W4IA 3JTMA 1XMIA 3GLSA 5CURA 5KYVA 2I7CA 3SZRA 4B85A 2PN1A 2IXGA 2CXQA 2I2WA 3T1NA 3UGQA 4AY6A 1FS5A 3IHWA 5HIKA 4C2AA 3EDMA 2IHBA 3EA4A 1S7CA 1C8KA 2VK8A 4KN6A 1OZGA 3I01A 2IUUA 5THKA 3HEBA 3BJZA 4QU9A 5I5EA 3M6VA 2GKOA 4HTFA 3R0ZA 4NYJR 4U5QA 2KBFA 1L7XA 4UUOA 4AJEA 2W6IA 3F7MA 5BNFA 1AKNA 3WQQA 4DYVA 2OV2A 5EZYB 5E6SB 1VFPA 1AN9A 3DEIA 3FTCA 3ABSB 3KSDO 4DLZA 2KM1A 3E22A 3HJAA 1KEEB 4ENUA 1JDSA 1Y3FE 1AKTA 2C8VA 2FG5A 2KB0A 4PG5A 1NBMA 1HYHA 1GU0A 5HWSA 3ROXA 5U9CA 3X2FA 3DBIA 5EP3A 2IXAA 4TSRA 1M6HA 4BUCA 3BCHA 2Q2WA 1VKHA 3QEJA 3TIVA 1A1SA 1MGOA 1DKNA 2INGX 3JXEA 4JITA 3VI3B 4ANFA 4PNEA 3T1TA 1C41A 4MSUA 1LJUA 3OMXA 5EP4A 1D2HA 5ALLA 3K9NA 4B7AA 2PLNA 3RAEC 1NQTA 5JRJA 2ZRLA 2LW7A 2DTDA 4GRAA 2FN9A 1Y1TA 4FLMA 5A5DA 5GADl 3EW7A 3W2TA 3NM6B 1T1SA 4MUFA 5JBQA 1IIBA 4IHAA 1X7YA 3K0AB 1TU0A 4NRDA 4Q9KA 3A6LA 3HRIA 4KI7A 1NI3A 2IX3A 5BWOA 4OM7A 4WERA 3NCHA 3WDLA 1TUBA 4FOLA 1QH8B 2I76A 4IIJA 4K88A 4V1CA 1OBOA 2CVHA 4P3OA 4U00A 4MDHA 1TMKA 1YFJA 1X7ZA 5CUQA 1PX2A 1R3DA 2NN3C 8ADHA 1M66A 1P4SA 2JK1A 1YMQA 1E0JA 3N2KA 4F4DA 4AM8A 2IS2A 4YT5A 3PQCA 2QIPA 3GCZA 4IXNA 2A57A 2WJZB 4HWPA 4JEMA 4UNRA 1TWCB 1W88A 2Z83A 3L92A 1A0OA 3GVIA 1YQTA 3JD2A 3KSRA 3WOHA 2AN5A 5AI9A 3ZVKA 5TMBA 3LVRE 4IIBA 1IVYA 2I4TA 2J0VA 1F2TA 4PQEA 3SX4A 4E32A 5CIWA 1W59A 2A9OA 4WL0A 4TSFA 5I4CA 1GFWA 3CNEA 3CUSA 2OC9A 4B8WA 2QAGB 2X4DA 1VGQA 4KV7A 4AP6A 4D57A 3OIWA 3R74A 3SBDA 1T3HA 1RP1A 1XWIA 1V96A 4AQ7A 4PW0A 3URKA 2JCGA 2ROQA 4KNVA 1JHZA 3JQ8B 1TTQB 1ZUNA 4KH0A 4BMSA 1EHCA 3JALB 2OG2A 2FPMA 4BX9A 4FK8A 1WULS 3E5NA 4LEIA 2FG6C 3RG8A 2R48A 4KE6A 1DWOA 4MAAA 4KRYA 4WZZA 4DV1B 3PUKA 4CDMA 3B9BA 2A0UA 1OLOA 2VQFB 1OSNA 4LVUA 3QVUA 2JI6A 1U4NA 1S2NA 4GFDA 2C7BA 1FTYA 2C7RA 4JUBA 4AJIA 4OHCA 2AR7A 4EKEA 3EVCA 4DR7B 3NR2A 3BQNB 2A9QA 1L7EA 5AJWA 2V7QD 4YTEA 2FN7A 3HABA 5BT9A 3WWOA 5LOVA 3WTBA 4J94A 2NO0A 4G67A 5JBNA 2B5VA 1K8RA 1T10A 2R5NA 3ZHVA 4P81A 1X8XA 2LR0A 3BIOA 4N5IX 4B34A 3ZGNA 4CQLB 3I62A 4CF7A 2QD3A 4M89A 4KXUA 5E6RA 4F46A 5BPHA 3Q8WA 4ABTA 1DBVO 1KZYC 1Y37A 3L1KA 2G9ZA 2IQ5A 5IK2D 5MGBA 2G9UA 1HDZA 1XAGA 3GWGA 3FNHA 3GT7A 3O47A 4HJXA 3OCJA 1P8JA 1ISMA 2WNHA 4RS3A 4XWKA 5BORA 4RVHA 4ZOQI 2Z1NA 4X1IB 2VWQA 4DPKA 5B4TA 2EW2A 5TMDA 1YFKA 3JD4A 5IVDA 3JAMA 4FWIB 3LBYA 3K72B 3LBIA 1NMZA 3ADDA 4TRRA 4WLFA 4JP3A 2XQJA 1OI3A 2AG1A 3BCSA 2PUBA 4TT8A 1W75A 2HF2A 5T4FA 1V2HE 3GJ8A 5A3SA 4EQ6B 5ITSA 2NUPA 3FUVA 2MJLA 4PSKA 3B6MA 1LGYA 2RHLA 3HVJA 1SGWA 1FDVA 3VO8A 3JRXA 3KQHA 1IZ7A 5E7IA 4NE7A 3S68A 1GAWA 1Z5UA 2AFHA 2VVTA 1WX1A 2HMVA 3NX4A 3I58A 5KJ6A 4FNOA 1KH1A 1E60A 2JAPA 1L9XA 3PF8A 5FQOA 1YXMA 2K7FA 4GPIB 4ZYXA 1KQPA 3G68A 2PCLA 1FC0A 3KQTA 5DGXA 5FNVF 2IYPA 1U5AA 3IQGX 1L5ZA 1NBAA 1XU7A 4KQJA 3BWMA 1XNJA 3DMHA 4DANA 2A1TS 4WGGA 3A7DA 1BU8A 1ESZA 4BAZA 4P86A 5CNJA 1DO2A 3P5SA 2FW7A 1GPNA 2P5UA 2QUHA 3L6OO 4DOMA 1O95C 1PFVA 3SVLA 3FWPA 4ZHQA 4AVYA 4G4IA 3FKSD 3H3JA 2PD4A 4YAUA 4J49A 4BO5A 5DHRA 3COWA 1QZ3A 4OHXA 2GXAA 3R3YA 3RVBA 2BGNA 4Z0HO 3MSCA 3A7EA 3TNYA 2RAFA 3HFGA 3R5SA 1QONA 4IVQA 4RIIA 4Z4IA 2QVXX 2IYEA 4Y6QA 4LXXA 2VAWA 3STXA 1XP5A 2XCTB 2ZT8A 4HTFB 4GAEA 5DIZA 1THZA 4KXNA 1A8IA 3KSZO 1TE2A 2R97A 2ID8A 1V9LA 4IO0A 1UWCA 5C81A 2RC5A 3K5IA 3V3TA 4OFBA 3LC2O 2UZIR 2CHVA 1T8RA 4MUHA 4RENA 4Y98A 2JGEA 2J08A 4Z51A 4OMCA 1G8HA 1ONSA 3L77A 3KTOA 2IF0A 5IKMA 1U8FO 4JLVA 1AUOA 4TMFA 3VKFA 1U90A 2COUA 2XGMA 4J3JA 3SPXA 2PKWA 5BQFA 2X8JA 3R3HA 1XO1A 4C7BA 1T5IA 2AJ8A 4LE0A 1UK9A 1OMOA 1Y7IA 3KQPA 4HH0A 1WLYA 3WJ1A 5B3LA 1U0BB 3S1RB 3OTIA 5A5FA 3HJRA 3VTKA 3T5GA 3PDHA 1M1XB 3EEYA 3I9V1 4MZXA 5U4QA 2ZB2A 4GPEA 1EDBA 1A04A 4LBYA 3G7SA 4E5KA 2DFDA 2D5IA 3KZKA 5DNVA 5LBIA 1AKQA 3NEYA 1BGXT 5CT8A 3HBAA 1EFCA 1R5OA 2VF4X 4I6EA 2VQ3A 1N1GA 1PJZA 5LYJA 4LZAA 2WWVD 5C37A 2E2JB 3SNKA 3RCBA 4QEZA 3NASA 3HWRA 3TE6A 1KHHA 1FE8A 4OQMA 3DA8A 3OQJA 3VBCA 1O94C 2JA2A 1BX0A 1YZ3A 3GK3A 4MV4A 4KIWA 4ZVVA 4OXNA 5ICGA 1JIJA 3A4VA 1RHJA 2FSIA 2WMDA 4HX9A 3TB6A 4FM9A 2JA8B 2CL6X 4FX2A 2D13A 1BS2A 5H83A 2O3QA 2GEUA 2CLEB 3NWPA 3R0IA 1QGED 4Q12A 4ZHQB 2JATA 4IUYA 2OLEA 4PTYA 3X1ZA 1SN7A 3RVMA 4CF6A 2FSGA 2FVXA 1D4OA 3B78A 3CX7A 1W35A 5IJAA 3DHEA 4HB4A 4NZPA 5E4JA 2PSDA 1YJXA 4FDAA 1NWHA 1NUAA 2WM3A 4NG5A 1E1QD 5L6MB 4KSYA 3WOVA 2OXCA 3T0FA 2AEEA 2OM2A 1MRZA 2QYSA 3H8VA 3K96A 5J1TB 1VMIA 2BGJA 3QIAA 5IJ9B 2K7ZA 1HTWA 4YUYA 1K8XB 1AGYA 2C5SA 2EG9A 2PVSA 3T41A 1QHSA 5I9TA 2C59A 3YASA 5ELMA 1TWAB 4DUGD 2EBHX 2HJHA 5EFZA 2A88A 3ZOZA 4KN5A 3FVRA 2COKA 1RZRD 3AUKA 4KYIB 4KR9A 1NN1A 1M2GA 2GDZA 1EYZA 2Y0PA 1VIVA 4CMKA 3PC3A 4IR7A 2EHJA 1DCKA 2HL6A 1A7AA 2L0XA 4RFSB 3TDKA 4CIXA 3TLJA 4COKA 5KPJA 2V98A 4NH0A 4EO7A 3T7DA 4P1ZA 5KX5F 1NBWB 3LX4A 1LK0A 4PGGA 3VV3A 2GX6A 4FMDF 2WJWA 4A82A 4O4JA 1SELA 1W76A 2OSVA 1QGAA 2ZYWX 3UK2A 3OFJA 1P19A 4DQXA 3C0KA 2WWFA 3SF8B 3LX6A 3PL1A 4QUGA 1GAXA 2P9GA 3ZZUA 3OJ0A 3ZHSA 3FYSA 4YMIA 3JQAB 3GQVA 3PEFA 5DULA 5BN5B 4ZVPA 1EFPA 1IHOA 4INJA 3SS9X 3UXEA 1B6GA 4QFDA 5CDGA 3PNPA 3MYYA 3NM5A 1P2BA 4M0PA 5CM8B 1VP3A 2AKYA 2QRJA 4PC7A 1NVFA 1E62A 4RORA 3TECE 2CE2X 4H0CA 4AIRA 5JT1A 1A4RA 1Y1QA 4H31A 4IS3A 5HS4A 1E9RA 2A0FA 1BQ4A 3HKCA 5JZVA 3PX7A 1SBQA 2J5RA 3MUEA 1SCUA 5ALRA 2C3MA 3C3KA 2UXBB 4FFDA 3R9KA 2OCKA 4XRRA 2O0LA 3SS7X 1GL9B 2G17A 2J3JA 4GRDA 4I5FA 1JYFA 2Z5GA 3U4IA 4QG3A 4ZVRA 2JGDB 3TUJC 1I9CA 4WLUA 3OF2A 1GSIA 2F9MA 2CLOB 2EZ9A 3EVEA 2IEYA 3GCGA 3PCXA 1IXKA 1T5DX 2FF5A 5BNWA 6LDHA 3Q3EA 1TMYA 4U7JA 2GYYA 4QO7A 1K2VN 1FFCA 2NXNA 5EJGA 5CR9A 2G5GX 4ZDJA 1KKUA 4QEDA 5KNDA 3LHDA 3HCPA 3CR8A 1N3BA 1RHRA 3LC0A 2YZKA 5E4TA 2JJ2A 2Q7XA 3SC2B 4Z4EA 3PUIA 5TGTA 4UMEA 1N2CA 2NSJA 1DRJA 1MH1A 3IUNA 3OQMA 2ZR0A 2FK8A 4FPXA 4JELA 3ZIAA 1W93A 5DM70 4MAMA 1G6Q1 5AUOB 2YVUA 2OXEA 2VJBA 1ESMA 3NZEA 3D43A 1LLUA 4D9MA 3CUUA 3ODGA 1CQZA 2V54A 3GELA 3I0NA 3I5MA 3TD9A 3I45A 3ZWKA 5EWLB 5AXBA 3THWB 2NXEA 3G5UA 4R3WA 1I3CA 3FPBA 2VRCD 1KNXA 1JHRA 3COVA 1E92A 1ZL0A 2ERCA 3D2CA 5E7QA 1GVNB 4KVZA 1W36C 3EXHC 3S1MB 2V4ZA 3A3OA 2BL4A 4UUPA 5B3KA 2EAUA 4ID3A 3C3AA 5CTAA 1JQ5A 4LI3X 1CY6A 2GO1A 2WFLB 3UB3A 1XA0A 4ECEA 1RC8A 3OEEA 4PFSA 3I5YA 2IH2A 3TZBA 1W5SA 3U2QA 1X7ZB 4G26A 2O5RA 4OQQA 4URWR 3T4PA 4PLVA 5JVDF 2QHXA 3U6BA 4E4TA 5GINE 1QX4A 4NV0A 3H17A 4HQ6A 4CCWA 5B6JA 2E85A 2OPHA 3T99A 1CU1A 5AK3A 1VPWA 2B92A 2GAOA 3PJRA 3R2JA 4X20A 4XGQA 1NP7A 3FNQA 3KXIA 1WTCA 1LF0A 3CPSA 3C45A 5FAXA 5LD2B 3DBHB 1G1MA 3BMCB 2H54A 3V6MA 2Q8NA 3IKVA 2PRYA 1A82A 5CW1A 3MGKA 2Z6UA 1FDWA 1NXXA 1RLTA 4MVJA 2YW2A 3JTEA 5L9AA 1LBEA 2IEIA 5AHOA 3ADCA 2LDXA 2OBNA 1UANA 2JGNA 4EB0A 1GQQA 1OQAA 8GPBA 2VP2A 4D4JA 1A4UA 2FPGB 1GQ2A 1K3FA 1ZAKA 2QPLA 2V6GA 2P0AA 2JFHA 2ASEA 1Z0UA 3PRHA 4Q66C 3R23A 5EIXA 2GNAA 3GVHA 4ACAA 2R65A 5IBRA 1M6NA 1CFZA 3EBPA 2HO4A 4BB0A 4OYLA 4NBUA 4MGIR 2BBTA 2DBYA 1J25A 3WB1A 3HOVB 5CBKA 1V4NA 2QPAA 2W4MA 4L15A 2BKAA 4W5TA 1D8AA 1RHMA 1JZQA 2B0JA 2XJ9A 3OETA 5DISB 4BP1A 1IJKA 1U0HC 2OWDA 2FEWB 1ADBA 3KNZA 3LY5A 1WW3A 1DXQA 1RACA 1XEAA 1E20A 2CZQA 3NBQA 3QYJA 4FIZA 1BSVA 3H7AA 4NL4H 4Y6GB 4I8DA 1I7DA 1U1DA 4M1KA 2P6RA 3ANXA 1JEDA 1PZGA 4QSMA 2ZDGA 3R7WB 5HJ2A 1BA3A 3HO1A 1YRQA 4B8YA 5FWDA 5I8WA 1MPXA 4I1OA 5BV8A 3JQ7A 3KEGA 3V2UA 1RXUA 4ZO4A 2GK3A 3ZDRA 5I3ZA 2PKQO 2YXEA 3BSFA 3FPFA 1Q74A 3IE0A 3PD7A 4Y0AA 5FLKA 2G0TA 1OZ0A 2C8JA 3V1YA 4PQRA 3FNBA 2WSLA 1KFCB 4L57A 3DD5A 4MYHA 4TMXA 4BNKA 5LQDA 4AY2A 2BUBA 3BN3A 3I9MA 4G89A 1QLHA 2HZ7A 4F2PA 3QEOA 3FDZB 3S1SA 4IV5A 3VR4A 2X9LA 3MJHA 2WYHA 1KGSA 3T5CA 3JD0A 4B48A 2HBQA 4E1AA 3BGVA 4E2XA 3HA2A 1VL6A 3NANA 1VJTA 1TWFB 4F0JA 4C88A 5M5YB 4LFBB 3S70A 3T3EA 4RCZA 1NW5A 3HBJA 4TTSA 2C7QA 221PA 3IUEA 3UQYS 1CNEA 3DUFB 7MDHA 3TVYA 1JU9A 4PZEA 2C4NA 2JI7A 2C7OA 3KPJA 1HE8B 4EY7A 1SJ9A 1G64A 3VNUA 1JFLA 1Q3KA 3UW3A 3PJEA 2SHKA 3BDIA 1R6XA 3LGSA 1ESNA 3IX7A 2ASVA 4DUGA 2DJ5A 1DPGA 2PL3A 4BLOA 3M2TA 2C2ZA 1UUFA 4YJ2A 2YASA 1K98A 4PZYA 1CT9A 3TSYA 3W2EA 4B6OA 5DW0A 4G0NA 4BJHB 3KO8A 4R1TA 3AEUB 4EG0A 4FI3C 1X92A 3QLEA 2JFUA 3G2KA 4B3CA 2BHNA 2G83A 5HRCA 1X7WB 5CLLA 1TECE 1WQ1R 2O8BA 1Q7EA 1L5OA 1Q3TA 3DGEC 4M0KA 2A8YA 1EUYA 2WWYA 1VHQA 2BDEA 1CZOA 1UDAA 4RACA 3DMYA 2WWGA 2DUUA 3HUEA 1TVKB 2KBEA 5EXDA 2MYUA 3BH6A 3PXBA 2HGZA 3DBOB 2VF5X 3WLSA 1JG1A 3IAAA 2ORYA 1DC3A 1YB2A 5CAEB 3WLQA 1DDGA 2UUPA 2WQZA 2CXHA 1Z4QA 3L7NA 1D6JA 2ZRFA 4HAOA 4NEQA 1YQ9A 4B3BA 4C4XA 2PMFA 2E5FA 2G82A 2J9XB 4NF2A 4IJKA 4LUCA 2NNWB 1G7SA 3M6FA 3DTNA 1V3QE 3OLCX 3CF4A 3NHLA 3O6VA 3PQ4A 3Q3JB 3DDCA 1Y42X 4I6GA 3UAOA 2P67A 4ZZ3A 1RCUA 1M2KA 1ZI8A 3HJCA 1YAHA 4G63A 1CUSA 3ZIUA 4YRIA 4RW0A 5K8JB 3KR2A 1VHJA 1U3CA 4MUAA 2XMDA 4MUKA 1HRDA 3ZD7A 3OU7A 1CVIA 2AH5A 1JHQA 2E3JA 4CDRA 3U81A 4XB2A 1AM4D 2WZQA 1PR6A 2B21A 4YJFB 1JF8A 5FNVA 3H04A 3BS4A 2IXTA 4PNPA 1K5PA 3E3AA 2XUZA 3HSYA 5FOWA 5J40A 1EZ1A 2R6R1 3HA5A 1JS1X 2AT1A 7REQA 2C78A 2WLTA 1XTKA 1RI4A 1R0RE 3KKEA 4WFJA 2E55A 1JU3A 2PBLA 1SG9A 5EJ5A 2Z2KA 2R85A 2VDPB 3SICE 4I1VA 3F6PA 4IJQA 4U63A 3CF6R 1T15A 1DIRA 1CJCA 1YGYA 5HDQA 4J90A 1ISSA 1H94A 1PNOA 1Q2XA 1X13A 4X7RA 4YLGA 4DB2A 3WLPA 3QK7A 5AW3A 1VPVA 2R751 3K0BA 3HU1A 4MKHA 3I6BA 1DPFA 3I9KA 4NICA 1N5JA 2JIMA 4EHHA 4GMKA 5E9JA 5H4GA 1JIXA 3I9OA 1QG0A 3DZGA 3Q7IA 4ND8B 1GSAA 3TOSA 1XVIA 1OZFA 4G0PA 5I8ZA 1XLUA 4FC6A 1MW9X 4XE5A 1XDBA 2Q5JA 1ORDA 4TSFD 2D7JA 3IT0A 1GTRA 1JQKA 4EMBA 4HDSA 1UQUA 3PC6A 2O3SA 3JQAA 5GMOA 3BRWD 4TYMA 3UH0A 3GCDA 4M1OA 5AM5A 5SZJA 5J58A 1FP1D 1J22A 1O9HA 1VZ2A 4A8JB 4CCYA 1WKVA 4FWBA 4Q7LA 4ER6A 3K6SA 2J5XA 4ZXFA 4DEXA 4AJKA 1T36B 4RA9B 1SCQA 3HVKA 4QNNA 3ZE7A 3P9QA 1V8OA 2R84A 5CM9C 3S6JA 3H1FA 4HH1A 2QD2A 2B8TA 3IVGA 1JE0A 3VC2A 1DDIA 1TWGB 1CS0A 1QQ5A 3AY3A 4FDLA 4JASB 4RJLA 3UXHA 4BZPA 2WLSA 3BJMA 3I12A 4IDBA 4ZEMA 3UOGA 4TTVA 4E7OA 1QGYA 4RVUA 1M7HA 4BVGA 2FF7A 3WAKA 1V1JA 5DNEA 1IXRC 1W47A 2WTNA 1AO0A 1LVGA 3KOWA 3HV2A 4XJSA 1GOTA 4JS0A 3PNVA 4YJHB 1O9BA 2ONKA 2CLKB 1OXBB 1JSXA 1V5GA 2PDAA 3G23A 1BCSB 2XBLA 5KQLA 2GTIA 3OPNA 1GTJ1 3TNDA 3GRFA 1EK1A 2H7VA 3HBNA 3MQFA 1YOBA 4MR8B 4AMGA 1ZU4A 5AVUA 1N9ZA 2CMDA 1TAUA 2FPOA 2X23A 1R6UA 5DN6D 4D81A 1K8ZB 5FULA 3FCXA 4PYRA 3OURA 1DV2A 1EK6A 1ISFA 2VNIA 2Y2VA 1EAMA 4LXYA 4HEA6 2Q3LA 3EEFA 2W6OA 2JGIA 4YALA 3SQXA 4A0HA 3ABOB 1HE4A 1HDXA 3A28A 1Q2UA 8OHMA 1J8QA 1SU8A 2HKIA 5H59A 2SBTA 1RVDA 4ZANA 4FKMA 3HLTA 5JJLA 2ZIZA 4CXMA 1MR3F 1YL6A 3F3SA 3OCYA 4EW3A 3L7IA 4FFWA 3IHKA 1S2OA 4QVKA 1PV4A 3E22B 5E3HA 1E6LA 2BKEA 3QA9A 4RQAA 1KKMA 3N0XA 2X5OA 1JG2A 4JB8A 1WLSA 3EQ9A 4IS2A 1IOVA 2H5JA 5CLFA 2FN8A 2WHPB 3R7DA 1UP6A 1W44A 1XQ1A 2D2XA 4HDSB 1EINA 2FZVA 4Q1DA 4ERNA 2B9VA 5J2TA 4XZ3A 5JALA 3Q72A 1ABEA 1F38A 1YWGO 1YUBA 1PR9A 1B2RA 2QN2A 3ZZTA 1JEAA 3QE0A 5CXSA 3A27A 2NGRA 3L7CA 2RE8A 4Q3AA 4O1IA 2E48A 1HT3A 3VR3A 4MCIA 1KETA 5AXAA 1DIOB 1GZHB 2FI1A 4IUDS 3S7ZA 2EZTA 5CDUA 3NP7A 1V3TA 1SBHA 2C9OA 3D4PA 1LW7A 1LPMA 5A6VA 5L6LB 3GEMA 3QITA 4RGQA 3UCFA 2QZ9A 3CZ5A 1Y98A 3G1WA 5F4ZA 4G2NA 3E9QA 4ZT3A 4D45A 3K0CC 2E4VA 3TJMA 4C0KA 3L7OA 3QOWA 2A5YB 4KRFA 4ZZ1A 4A3BB 4Y0NA 3PX2A 1HT1E 3T9AA 5T3YA 1P74A 1FXSA 3PRYA 3WK4A 2HDNB 3TLMA 3WLOA 1IZ0A 1CY0A 1NNLA 4TN1A 2A0XA 4P4UA 5I51A 1AMUA 4PCAA 2HUNA 2VJYA 3K7AB 3UWMA 2C2OA 1QE3A 5ISMA 5C32A 4LMPA 4GWLA 1PK8A 4XR9A 2X0NA 1YK1A 2JA7B 2B1IA 3E9EA 3QXGA 4K87A 1NVBA 3M4OB 4IOKA 1NSTA 2Q3HA 4H35A 2XTNA 1V39A 1W5TA 4V1CI 5DVZA 3BRCA 4A0QA 2AMVA 1O89A 1XUOA 1SB8A 4IV0A 2NO7A 4F71A 4ETNA 1WCV1 5ECYA 1P5RA 2IVZA 2P69A 3NW9A 2BJWA 2P2YA 3F1LA 5AUNB 2X5XA 4TMVA 1TM3E 1A7UA 2A4KA 4NENB 3W7AA 3E35A 2PYZA 4GMGA 4CKBB 4OJKA 5IPFA 3P9XA 4I66A 5C53B 1XJWA 2PNJA 4YMUA 3G9UA 4LXGA 1WB6A 2G9NA 3ANSA 4OTZA 3AIKA 1F48A 1MOPA 3L6EA 3T0GA 4DGQA 4JLPA 4UVIA 4HXGA 1SCNE 1Z4MA 3DLAA 3KR9A 4KQCA 4ND2A 5CDFA 2XCQA 4ZAFA 1QH8A 1DQZA 1UP7A 4RVSA 3RUPA 4G36A 4ZT2A 2AOWA 2MTBA 4PX9A 2PY6A 2Z2ZA 3L8CA 1T6NA 3CRMA 1CQPA 5E4YA 3DOJA 521PA 2JGLA 4M0LA 3A3KA 4JVOA 2IEGA 5JO9A 1IC6A 3W4KA 1K6IA 3MS7A 5BURA 4MS3B 3WBFA 1VI2A 3KJEA 2P1DA 1VBMA 3H18A 4G1FA 3QA3E 3UNXA 4MUGA 1N5DA 1SVWA 2Q5QA 4JDUA 3A31A 2XE7A 1X94A 2PFSA 2SCUA 3OM0A 4OLBA 4AYTA 3GEPA 2AIRA 4LV8B 4YAOA 5EHNA 4CL3A 4TWAA 2ZRQA 2HWYA 3STYA 2JKVA 1JBQA 4MV0A 2F00A 2IX9A 4WLOA 1QHHB 2XW6A 4ZQEA 5U4XA 5JSKA 1JHYA 4HAYA 3VDNB 3DZDA 5FQNA 3A25A 2R7ZB 4RH3A 2XGSA 1XTSA 1UBKS 3F46A 4NC9A 1N5RA 4BFZA 1GNTA 2PZAA 2C4MA 2H6EA 2YVQA 1UK6A 5A2QA 1L7BA 4LJAA 4OAQA 3Q3VA 4AP9A 5I45A 5CNIA 4PHFA 1T3ZA 2UZ3A 3KFXA 2RG7A 3ADPA 2ZCUA 3EGCA 5KREA 1RJ9B 4KP7A 2G5PA 1G9TA 1JPNA 1LPBB 2CLCX 3N7AA 4U6SA 3KKPA 1Z5OA 2PRKA 1NT4A 3BXFA 3GMTA 3I9LA 3W8NA 2O1SA 4DZRA 1Z4IA 5JLJA 5ELXA 4F97A 1CV2A 3K6KA 3RVJA 3TTSA 5L53A 3RLFA 4IWXA 1Y3DE 3QFHA 4PO3X 1AUVA 1N1MA 3UJCA 1UMKA 1QTQA 3ML1A 3W90A 1XKLA 4KWTA 4ARSA 3JWIA 3RC8A 4MVJM 2G25A 3BE5A 1U7XA 2FK7A 3HKEB 3GLTA 2QL9A 2RI6A 2DKNA 5JPIA 5EVCA 2J9YB 2XSZA 4MB2A 3UICA 10MHA 1F8FA 5CG1A 1HWYA 3UT5A 1Q92A 2G8NA 3EQZA 3LLMA 2QYOA 3U3JA 2WIDA 3WLRA 4PLHA 2OCBA 3RFXA 3JSAA 1ZRMA 3F78A 4BLUA 1N0VC 2BZ0A 1G17A 5F7ZA 1QHHA 3U60B 4ND4A 1W30A 1MEJA 2G9RA 1N5KA 4M0DA 5ALTA 5FOTA 4MWOA 2HEIA 1ZH8A 1VLLA 4IWYA 5REQB 2ZRGA 3L6RA 1Y5LA 3AVXA 2JFBA 3V4SA 1HXHA 1GCUA 1P2FA 1QNFA 1U9ZA 3D8SA 3PGJA 4N18A 4RGYA 3INTA 2Z4SA 4OGLA 4XGRA 5CX1B 5EZSA 3SI7A 1WV1A 3SZMA 4BKMA 1ONBA 3G88A 1E18A 4RSRA 1DGQA 1EZZA 3SDZA 1V1MA 1ATZA 1EEHA 1OYYA 3RTDA 3HKBB 4A2QA 1R4NB 1K7EB 2XB2A 3AY6A 3THYB 3HYTA 3RHSA 3TH5A 1T34A 3VYVA 4AZWA 1AQJA 1SO8A 1RXWA 4MQFB 1W5AA 4WCDA 4D98A 2EHDA 4WWHA 4R0MA 4YGYA 2JJ2D 1KS2A 1JV2B 1LC0A 4MEJA 1Y8QA 1U0GA 3HB7A 2QTVA 3U0VA 4HQ0A 5NULA 4BMOB 2AZXA 1J2JA 4KNYA 1XQXA 1ZH0A 4WE3A 4C7OB 4H7PA 4Z7NB 3E9MA 1X2BA 1D1SA 1OXMA 3BG5A 3L7YA 4G1MB 1J99A 3HDJA 3HSSA 4HMOA 1HQDA 4MW5A 2QRPA 5FLEX 3ID6C 3PXGA 4D8YA 2IHKA 3GXBA 5B53A 1JXOA 2W2TA 1ODJA 4OQ4A 2EJCA 1R27A 4RK7A 3R41A 1K4KA 2V97A 2J6HA 2W2PA 1N2OA 3IELA 4X44A 2WAQB 5JAUA 5DIFA 1NKSA 2O5EA 1V8ZA 1E3WB 4RSGA 4RPCA 2QMEA 4WCFC 3G5MA 3MGBA 3C41J 4HDOB 3GRVA 4ZVMA 3S27A 2IOYA 1X1EA 3NEPX 3KVRA 3SD7A 3AF2A 1M2WA 3AFMA 3H9JA 4QDKA 1SVIA 3ZD8A 2YX1A 4EGJA 4EG6A 3TZEA 5C51B 5F5NA 1NIJA 2QL7A 4Q9DA 3JVVA 4O2BB 3D4OA 4Y1FA 1HYQA 2WU0A 4JFAA 3HYSA 4RGBA 3GRUA 5EQDA 1AO3A 5FPYA 5EIEA 2OBXA 4QXMA 4PCVA 1N6OA 4AKSA 2VDMB 3SXPA 3E70C 5ALMA 2GJ8A 4REQB 4MGYR 1EFVA 3G0GA 3DWIA 3HP4A 1JLKA 3O8NA 1J1ZA 1GNQA 4K9KA 3GRRA 1AQ6A 4W6ZA 3VOBA 2AQ8A 3GBPA 3HH8A 3W6UA 2HA2A 2IU3A 3NHFA 3WMRA 2BUCA 4BNXA 1F8YA 2QX6A 1BS1A 4J9UE 4BCBA 1KOJA 4QYTA 1WF6A 4HD8A 3AFOA 4F4JA 1KEWA 1KFKB 1MEEA 3HBLA 1E2QA 4QJ4A 2OFFA 1EGMB 4H2DA 1E3IA 3GGSA 3DS8A 4UBLA 2Q41A 3PA8A 1VB5A 1QRAA 1E3EA 5A4JA 1X1CA 2J1LA 1X6VA 3HR8A 1ZOLA 1KIFA 3MRTA 1WMAA 2XE4A 3IVXA 2I3AA 2BFMA 2J41A 2OYSA 3DT9A 1LC3A 4QYIA 4RJTA 2JIOA 2MYPA 4C5BA 4UNNA 1AXEA 3HCNA 4O4HB 2PFKA 2QM3A 1UKBA 3KM0A 4J16C 3V5NA 4EG7A 4LBWA 4CIVA 4EUHA 4LJ8A 1BW9B 3DVQX 3WYNA 2AVDA 2PRIA 4MCJA 1AQIA 1ZX1A 4H77A 1FTNA 2QT9A 1SXHA 2HSZA 2JH9A 3NS7A 4KVGA 4N6OA 2WG0A 4X60A 1YTUA 4RQTA 3NTVA 3OZRA 5G1PA 2BWJA 2AF3C 1Y6GA 3QKTA 1O97C 3F3KA 3ZDQA 3VPHA 3T4EA 3FBGA 1CFJA 4DZZA 1UMBB 1UZLA 3AJ8A 1FLNA 3BJRA 5FPHA 1O54A 2B34A 1P4AA 2GJKA 1U7PA 4AY5A 1J8VA 2B2XA 2XV1A 3ORRA 2WHXA 3JZFA 1LDNA 3ETEA 2VPQA 3QI2A 4B79A 3LS2A 3KLNA 4ESEA 3DB2A 4GSKA 2ZYUX 2ZRMA 3WS7A 5LWQA 1RQRA 4BO9A 5JRZA 4DCNA 1D9ZA 1HMPA 4RIHA 1C8LA 3DCJA 4HOYA 2G67A 1UJ4A 2MWMA 1G20B 2UYOA 3ROZA 1JJVA 6AT1A 1A2KC 1ZBDA 5FBQB 1VL5A 4O0LA 5SZHB 1BROA 3ZX5A 2AUNA 2HGSA 4A3SA 3E9YA 2J45A 4D99A 4GVXA 4MV5A 3H9UA 5KWEA 4CEHB 1NR7A 4UHHA 5TLSA 4DV2B 2BR3A 1F7VA 2XYRA 2V59A 1G4UR 3SC6A 3IDZA 1T43A 2CNWD 5TQ2A 4AX8A 5AQEA 3KEOA 4OI4A 4GMFA 2CT8A 1B23P 1FQJA 1X9IA 2AW3A 3ESDA 2G0AA 1Z7YA 1DAHA 4OQPA 2AWOA 4RA9A 5EE0A 2XZOA 4IZ6A 3SDBA 5CA0A 1DBSA 1O96A 4OFWA 3BB4A 3RBXA 5BMVA 2BGRA 2FOXA 2QJOA 4L9AA 4UU1A 2DSTA 4GICA 4JYPA 1L0BA 3VI4B 1E5DA 2GR9A 4FMPA 4XEHA 1XQYA 1MXHA 2L42A 4G86A 3ETLA 3ROTA 3VNBA 5LSAA 1Z56C 2BF7A 4J91A 1PL7A 3B48A 3QUTA 3OJCA 4GI1A 4TWIA 5TVKA 5L7YA 4PZ0A 1M8JA 2FGKA 1NW6A 4IF4A 4L02A 1VSVA 2XUDA 4J3NA 4CUJA 4P34A 1JB1A 1CP2A 1S2MA 4CWAA 3WR5A 4ISBA 5FNZA 3OQNA 1E79A 1XPJA 1T29A 4EECA 1JSZA 2NTYC 4UUQA 3QE3A 1TYBE 2QTCA 1W34A 1RP7A 3AQIA 3EEQA 5ITWA 1VM6A 2OKGA 4OJTA 2VDQB 4MR9A 2CJXA 3C7CB 5F76A 4BXOB 2BJHA 5KYKA 2EL7A 2HF7A 4G0QA 2D8MA 2HHLA 4KX3A 3N2EA 2C99A 2RIPA 4EL5A 3DAGA 1K86A 2WAYA 5P8WA 4NS1A 1QC5A 3QYFA 3WA7A 4WKPA 5HCIA 4HNHA 2OP1A 3HKEA 1U0SY 3EUFA 3OUUA 1OV6A 4CEJA 1TUBB 3ZHCA 2RB4A 4DUYB 4QGHA 5FUMA 4F84A 2IV3A 3FUUA 5DYNA 3JYOA 2I3BA 4K2AA 4PANA 2OK7A 1Y6JA 4Q19A 5IAJA 4L73A 1TL7C 2ZI6A 4TLMB 2HYIC 1THTA 3I2KA 1DKMA 1RJ9A 1SKAA 2QGNA 4UHKA 4BMZA 4C2UA 1FMFA 4ZVLA 4TKMA 3FYCA 1QDEA 2XUHA 4QFMA 2VJLA 3IPCA 1GPLA 1NVTA 5C80A 3B13B 4DILA 3RC3A 4GL4A 4YRFA 1JH9A 2J33A 4ICIA 4YXWD 4HN4B 1CYEA 2W6CX 1KHTA 2CK3A 2GVDC 4BUZA 4F6RB 3P20A 1KK1A 3QMMA 3TMYA 2XKJE 3C4VA 2UAGA 1G5QA 2ZUWA 1WJGA 1G5IA 2JJ1A 1C8VB 3AFHA 2X22A 3F7OA 3KTDA 1BC5A 4K46A 1XIVA 1U98A 4DA8A 4RKEA 4F06A 5JG7A 3JALA 1NUTA 4GIBA 2X2PA 3N2GA 4YROA 1I50B 1EXWA 2E2IB 2JBAA 3WIOA 1ZN2A 1WVMA 4LGVA 4CF5A 3NYRA 3T3MB 1DLIA 3JW8A 3DEZA 3U6KA 1I5EA 1A98A 5D6OA 3ILVA 1SBNE 1YU9A 2I2XB 2LDBA 3SZOA 2VR1A 2VBGA 1I4TD 1E1KA 1X1QA 3ZV3A 2GK7A 3PWTA 6PFKA 1JMKC 3EQ7A 3SK0A 5I7SA 4G0OA 2GXSA 3CLUD 1WXXA 3JPWA 4IHQA 4UOEA 3CNNA 2ZM5A 2QY9A 1JTEA 4J0EA 3GJ4A 2Q27A 5LYYA 1KOFA 5CVDA 3U9LA 4Z3OA 2DSNA 1R6DA 2X8JB 2WIBA 3QEKA 4FGJA 4B3GA 3I01M 3I2FA 3SSMA 5I7EA 4WEQA 2VN8A 3IQZA 4DFDA 1LUAA 2E2HB 4Y2JA 1R16A 3ZY5A 1LW6E 5D51S 1AN0A 1T2EA 3BK2A 4ALLA 4AULA 1UAYA 3EDYA 2ZXFA 3VNAA 4L08A 3P8ZA 4PS1A 4RYDA 2WE8A 4BCDA 1KSGA 3D54D 1MOZA 1E0KA 1T0PA 1Q0QA 3LCCA 3QTTA 4KUHA 1EWYA 1M2NA 3UM9A 3S99A 3LNTA 1ZMBA 3BGOS 2H7YA 4ZQHA 1JU4A 1CQXA 1MNAA 1Z5NA 2M98A 4F9TA 5G4KB 5C8YA 1Z9BA 1FP4A 2CXUA 3L8MA 1AIPA 1TJYA 1BYIA 2BELA 2QL5A 5KKCA 1ZA2A 1TT5A 2YWXA 3EB9A 4KI0A 1BJKA 4DDKA 3JWPA 1RLUA 4LMRA 2K4MA 2XMBA 3H1BA 3D64A 4BMDA 4BNJA 1DIHA 4YRSA 4NCJA 1CKEA 1ZEMA 3SYLA 4TM7A 4KTVE 2J0QA 5E8JA 1X80A 4H3SA 4JP2A 3UAGA 3ZLUA 1BDBA 3A2KA 2QVYX 2O1XA 3ZQKA 2VJMA 1BA2A 1Z07A 3C74A 2R5FA 1AA6A 3HEMA 4CMJA 4YRLA 3WISA 1T6BY 1JAHA 2C2HA 1YGPA 4Q6BA 4HT3B 4DNFA 4OI2A 2HIMA 3I1FA 2O7VA 2XB9A 4R16A 4W8HA 5ITZB 4WVLA 3RJ9A 4LDPA 5KTTA 1PNVA 1D6NA 4L5BA 5IC4A 1JJ7A 1KEVA 5AJZA 3ASZA 3I30X 2XCOA 2RKBA 5HXAA 3R20A 2P4UA 3N8GA 3N2KB 4YAWA 4RD0A 3W77A 3VKGA 3AEXA 4FHCA 2O20A 2VNKA 5IAEA 3TL6A 4RTQA 2P0EA 3JATA 1Z2PX 3T3OA 3FMIA 4BBAA 4D2IA 4E4YA 2QT0A 2BTQA 5FB3A 3HADA 3QH4A 4A0GA 1Z0IA 1T8SA 3PR3A 2XMPA 1KVQA 4GMXA 5JZMA 3GFOA 2YYYA 3AC0A 3AUYA 3DO6A 1MAUA 3TQIA 1SAYA 1GPDG 4LJLA 1GO2A 2ON6A 2ZS7A 3M81A 2G80A 2WAMA 5BUQA 3GLHA 3BXEA 4C7XA 4FB5A 4FNGA 4J1TA 2R47A 1ZM3A 2BY4A 4V24A 1HYGA 2IPXA 2WD8A 5JFGA 3U7HB 5J23A 1GL6A 2ZQYA 5LOVF 4MVJG 2DFNA 2FR8A 3KWLA 2ZDQA 3SLKA 3ET4A 3V8PA 3ZVMA 4CM8A 4MW2A 1QSGA 1FXUA 3R0QA 3D3QA 2QDKA 2ABWA 5D5HA 3AUSA 2E37A 3I5XA 2LWIA 4ACBA 2KYRA 1L5NA 2J6BA 3S40A 1W8IA 4TL9A 1C4KA 5ALSA 5ER6A 4DB4A 1ZHHA 4KCGA 1PSWA 2FWAA 2GA8A 3JYLA 4GLBA 2XNDA 5E7MA 1Z26A 4DDUA 2ZRJA 5EP1A 1Y7LA 3IT2A 1SU6A 1NGSA 1OXSC 2RHOA 5G1NA 4F6LA 5J4HA 5BQOA 3HY6A 1OROA 3SU8A 4R71A 4YY3B 1CTQA 4WK2B 3IIIA 4I9FA 5CD1A 3HP7A 2O6HA 1ODLA 1VQ1A 2I6SA 4BZXA 5KOJB 2JFYA 2HRBA 2XYGA 3DDSA 4RMHA 3UEOA 3UT6A 3ZCVA 2WKQA 1U1CA 1CUDA 3U80A 3DB1A 4F8JA 1XVAA 1FSSA 3U26A 5LLDA 2PWYA 2RK4A 1KY4A 1UXIA 1M34E 2WPDD 3IALA 5C1DA 1EVIA 1V9SA 2ZUTA 2AWNA 2JBHA 3EIOA 4PX5A 1FNMA 1TO2E 1VE5A 3GTJB 3TQQA 1L1RA 1SUPA 4P5EA 1L6IA 1E7MA 1U2TA 1W5BA 2XUJA 4YP7A 4HATA 2G0NA 2JD2A 2JIDA 2W2KB 5CK5A 5EKXA 1T25A 5D7BA 3UAZA 3EVDA 3NTRA 3ELYA 1QYRA 1RTTA 3ZJYA 1GCIA 3QLJA 3REGA 3THOA 2QRUA 2WKPA 1PN3A 1UPAA 4J2OA 3GQBB 3W79A 1J39A 5ERGB 4OEHA 4E08A 5JXHA 3P9IA 1UZUA 2JFVA 1U0RA 3H87A 3E5HA 3SQDA 5JATA 1W0KD 3NDPA 3W78A 5CVJA 2P90A 4WN9A 5IK2A 1QRTA 2PMBA 2ZSEA 4JXZA 4IIXA 1MJGA 1KQNA 2HCTA 1ZVVA 4YAFA 4RBNA 3I9FA 1KXJA 3LM8A 2QXUA 5CIYA 4QIWB 2PKXA 2VYQA 3RVLA 5TGZA 4C01A 1V41E 4TKLA 1U7ZA 2FVYA 1ADYA 1J07A 4XQEA 4YCBA 1ENZA 2HFJA 1YOVA 3ESAA 1FFXB 3TVDA 4CG1A 3N59A 4CMGA 1PS0A 3AR5A 3S1QB 9GPBA 3SX2A 1V26A 2OC4A 2HWKA 1GNSA 1F9AA 1WY5A 3ESXA 4TQAA 3QXCA 3ZUGA 4EZBA 1Q0HA 2HRDA 2JRLA 3EJ6A 5FEMA 3RODA 3P9PA 3V8EA 3FCOA 1U5CA 1RWWA 1XTUA 2BM0A 3EK2A 4FZ5A 4CF3A 1XYVA 1OH8A 3OQPA 4IG9A 4B3HA 1T4BA 4Q4AA 2XRZA 2IOHA 4HH4A 2FN3A 2AK2A 4QBTA 4PE5B 3OX4A 2YU9B 4WT7A 3IDSA 4QUHA 1L5YA 1AQLA 1EP2B 3VRHA 2AN9A 2OY0A 3NV9A 4DMRA 4JQZA 1KEEA 3KLPX 3PUYA 2XCIA 4UOQA 5MFPA 1KAEA 2J5QA 4J75A 1NSYA 1BXKA 1KBZA 1ZGJA 2WI8A 3F47A 4P22A 4EDFA 3EVBA 4YT2A 2XMRA 3L8HA 2WB2A 1Y8ZA 2ZWAA 3OY7A 1BKDR 2QDXA 4L7QA 3U7EB 2QEQA 1F5NA 4BCCA 4BY7B 5HX7A 3Q9NA 2BFFA 4HNAB 1W2HA 3WGLA 3THSA 2I3GA 3SC4A 2VHYA 4X24A 1NLYA 1P80A 1XTJA 4W99A 3OPYA 3F5QA 4OYYA 2HA6A 3OZXA 3X2EA 1DFHA 4QGAA 4E4RA 1NVEA 3BRSA 3I6IA 1M76A 2H3HA 5REQA 5CA0F 4KSBA 2FZ4A 2B3DA 1OFVA 3FUCA 1B8OA 1U8AA 2GJ4A 1OI4A 1Z18A 3LCRA 3O73A 4WKGA 5D3QA 5LQAA 1ZJWA 2H52A 5CCEA 1J1IA 4BMYA 3OCWA 3GLGA 1UBUS 3SYKA 1UM9A 3J7AC 5KSYA 1F4LA 2OZLB 2UZ1A 2YXBA 3RS7A 1NXPA 1ZWLA 4YP0A 3ZY3A 4UTRA 1QUEA 1QDUA 2EU8A 3V00A 1XCPA 2CVQA 2HXYA 1J2EA 2LBPA 2NPIA 4LYEA 1JKIA 3H2IA 4WKCA 4I14A 5EJIA 1U0OC 1FJHA 2AOTA 2HCRA 3I72A 1G59A 1CC1S 4ZALA 4EL0A 5JMOA 3PHCA 1PZEA 2G08A 3SQWA 2B83A 2DKFA 2VJOA 1XQ6A 2X3FA 3GZTB 2HSJA 5JSYA 3CX3A 3UANA 3WRWA 3LOUA 4E5MA 3BTOA 3DJFA 1XD2A 3PQFA 1BWQA 1LV8A 3CPHA 1TYAE 1OW3B 4Y9RA 4O59O 3AVTA 1F2UA 2SKDA 4YHBA 1GRVA 2WTMA 3L0PA 4ATNA 1OWNA 2OCAA 2WYOA 3WLLA 4X84A 4IBOA 5B7PA 3ZZ1A 3ZGLA 1R66A 4J2TA 3ITKA 3ENZA 4D0RA 5ER9A 3I8OA 3TQHA 1HLGA 2EWMA 1CUXA 1FA9A 5KVAA 3DGFC 1T8YA 2AUTA 1V7QA 4LMBA 1PDVA 2FRDA 1QMGA 3UKOA 4XW2A 4ZU3A 2FCAA 2YMLA 3FCEA 4MA0A 5AK4A 5TQ0B 4JI0B 4Y2GA 2VLBA 5D1HA 1ZOPA 5J47A 2VCHA 3KVVA 1CS4C 4PPYA 1O5IA 1I4OA 4YV7A 5BNTA 1OTYA 3IXMA 2BGGA 1CIVA 1OZHA 3AK4A 3I2HA 3PDIA 1ZD2P 4S1PA 2I9PA 1C3OA 1FSZA 1SG0A 2H5EA 1MPTA 2X2OA 4OFZA 3SJCA 1HNWB 5DYIA 4DSZA 4N49A 4W82A 1CUFA 5TPZD 4D0GA 1BDHA 2P75A 4IDNA 2VEDA 1VHDA 1KH3A 1GKKA 1O8BA 4JCOA 4OL0A 5EA2A 4CV3A 5HNKA 3OE5A 1MFPA 5KX5A 4WLVA 1NW4A 1U28C 4QPNA 1ABFA 1ADFA 2H2WA 4JNKA 4XUCA 5CH5A 5KNBH 2Y3IA 1JDBC 2GN2A 1KK3A 4C0QC 5ITVA 5LQCA 1E64A 2FKAA 1KJJA 2FEAA 4W9NA 4EFNA 4ZYTA 4EEZA 3RKSA 2M9MA 2R68A 2D59A 4LRYA 4KWHA 5I6DA 3ZJVA 2XEXA 1RJEA 2ZUBA 1XZHA 4N7JA 4RPLA 1ZKDA 4NEHB 4IF6A 5D3MA 5B6IA 4CKXA 2WM9B 1Z4NA 4EMUA 4J6FA 1KAQA 4DW8A 4W5NA 5BSFA 3U5TA 4PGFA 1M34A 2X0JA 4OI1A 5BN3A 2JA6B 1JSCA 5AOVA 2GLUA 1QPGA 2C00A 3EYWA 3DOEA 1ETHA 1E9AA 4JYMA 2JLQA 4C0JA 3BILA 3QYPA 4BVJA 2H07A 4ZRMA 1KH2A 3AB3A 4QJBA 4KOEC 5FJIA 3DYIA 3OHPA 2NVWA 2P41A 1T8PA 2FXVA 3BEOA 1Z2NX 5TGDA 3TX6A 3BXOA 4YDSA 1P2UA 2FUG1 2C0QA 2IZZA 3LTNC 7ADHA 1SUBA 2F3RA 1Z6XA 3LQ2A 4DNOA 3T38A 2XUGA 4HZIA 2W22A 1C8BA 1L4UA 2ID4A 2W93A 4BTVA 5GONA 1Y3IA 1ZNWA 3KB2A 1S1CA 2G1PA 3MD0A 5IC5A 3TM4A 1JLRA 1N2BA 1T2VA 4GMHA 1P0QA 1QJ4A 4UM9B 5IM4A 4BP9A 2FP4A 1GPJA 4UZFA 4IOLA 3EXFB 5TXGA 3EHDA 3I76A 5ALWA 1XZPA 4ALMA 4B3RB 2JD0A 5DWDA 3PL5A 1G2IA 4DMHA 4B3FX 1FS6A 3WLKX 4HDRA 3OX2A 1QFXA 1E96A 4N4AA 4S0XA 4XLZA 3V48A 4FJ1A 4I5DA 3WDSA 5I9MA 2HX1A 4LA4A 2OO3A 1MEOA 1QU2A 5U1PA 2IWHA 1NDQA 5BV1A 3FPEA 1B1AA 1DB3A 3INRA 4MUXA 5K4GA 1GQRA 1HI9A 1Y6RA 3FTQA 1K08A 2FP4B 2WUDA 4ILKA 3VSAA 4G0VA 2IYFA 4CR6A 2F43A 2ZJAA 4MRMB 5B5SA 2O3RA 3PZRA 5AHRA 4A4DA 1EK5A 5B7GA 1KY3A 2JGJA 4QODA 4D3YA 2R2AA 1NXWA 1YC5A 1TJPB 1Z7EA 2DGDA 3EIHA 3KJNA 3AJAA 1UK8A 2EF1A 4DZTA 4KRGA 1YA6A 3NAQA 2WYUA 1GYPA 1YQQA 3AZPA 2BKLA 2P2LA 1HQCA 5NLLA 3V4LA 2GYWA 3GVPA 4Q3EA 1GITA 2L17A 1PQWA 3EULA 3IUYA 5HK8A 2XHEA 2ZIUB 4LFAB 4FCWA 4CG3A 1P1JA 4ZARA 1OI2A 1JDUA 1SK8A 4ITVA 1ACJA 1FTQA 3CVYA 2HADA 4Q48A 2QI9C 4F2HA 4D9HA 2QV7A 1XXHE 4W5WA 2PSEA 4CCAA 2QRLA 4NARA 4P92A 5CLJA 3WJAA 4C7JA 2ORWA 2GDJA 2YN2A 3L7KA 2OBFA 3R0JA 2X0FA 2JLYA 2X40A 2FA9A 3A14A 1SOWA 4G24A 1T8TA 1LD3A 2AMLA 3AF3A 3D6VA 3C6BA 1FP6A 1I3MA 1UBHS 4IW3B 4KDRA 4UMVA 2OCPA 3ESYA 3RVNA 3VNSA 4BP8A 1LDGA 2QE7D 3WMXA 2VAVA 4LSGA 4MHTA 1TQ8A 1YB6A 1INLA 3SHQA 1VLZA 1T8WA 4I3GA 2ZE6A 5FYQA 2DQYA 2ZAMA 3D7LA 1N3LA 3H84A 4RDXA 2OBBA 5HZGA 3NDBB 4IDGA 2RHTA 2OD7A 3A2LA 1VIMA 2V3VA 3LGXA 2ZB7A 2ZTUA 3I2GA 1HR0B 1KI4A 1JJFA 1GXSA 1E9SA 3IP9A 1F20A 4LYJA 2BCJQ 2X0EA 3TNFA 1YCDA 4WKBA 1EVZA 9ABPA 1Y8QB 2I78A 5A03A 1I94B 1ZW1A 1QVVA 3VO2A 4IIDA 4K3UA 5HKBA 1C30B 3KQUA 1HETA 4PGMA 3L4KA 3BTVA 4NMHA 3KT0A 1ZO8A 2F4NA 3KU1A 4HDKB 4M6WA 3ZU5A 4ZVUA 4UDOA 4C04A 1PJ3A 4MJ7A 1W6UA 2XKAA 2ZT5A 3IQWA 1DC4A 3LY8A 3OIDA 4G0MA 1WSBA 2W43A 3CIFA 3MILA 9MHTA 1DCFA 2RHRA 1ZIYA 3RJZA 3LX5A 1I80A 1KI6A 2ZSDA 4R0VA 4BRUA 3D4NA 4M2LA 1UADA 2ZSAA 4O3MA 5JJCA 2PLAA 3DMFA 1AV7A 4BTEA 3C97A 1E4EB 5LL6P 1KAHA 2DLDA 4ZEOA 2SECE 4RK6A 1OBHA 3RH0A 2H1IA 4ARCA 2WJJA 3LP5A 8AT1A 1X3LA 3A37A 2F6RA 3W06A 4HDNA 1V1RB 5C5CA 2DWUA 3KQSA 1TUEA 1RXYA 3EDQA 3FAKA 1ZONA 1RWQA 1UC5B 3KAPA 3P4YA 4MIOA 4QYIB 1GA4A 2ZT6A 1C3JA 3DVAB 4L0DA 5K3AA 4ETMA 2FMXA 4IM7A 2YJ6A 3UKDA 2QXYA 1XRSB 2KQUA 3EG5A 4ZKEA 2OEPA 3HKDA 4DVGA 5JIBA 3RVQA 2ISSD 4C0AC 2WAOA 3CKMA 1MLDA 4J9VA 4KWEA 5D00A 5LMCA 1VPDA 1PFYA 1HEIA 1AHHA 3ZU2A 4DCSA 1Z4KA 2REQA 2VUTA 5AXDA 4BQNA 1DQPA 4HPJB 5TPZA 2FMHA 3M34A 4P36A 1RKVA 3MT8A 4XWGA 1QP7A 1WY7A 1QIHA 2NZ8A 4I0WB 4HRAA 1K4YA 1IIRA 2VK4A 3EXIA 4ISCA 4D46A 5JD4A 1I14A 2GD0A 5LXTA 2PSSA 1YV9A 1LPOA 1MDBA 5DCYA 4CVNA 2FZWA 4LRQA 1ZDMA 5DP2A 4WPGA 4D9KA 5HP4A 4D8XA 3U1VA 1D1QA 2XXJA 5KKAA 1C7JA 1DX6A 1WQ3A 2EIHA 4G5FA 2UDPA 3R8XA 1L5RA 3OEHA 5HPYB 3JR7A 3TUZC 5HJ5A 1SQFA 1KOGA 1XGKA 1YCFA 2WICA 2GESA 3PHBE 3C4QA 2B61A 4MUYA 4Q1AA 3O9MA 1KR2A 1HK7A 1M8KA 4IIJF 3ULKA 4YR7A 3IR7A 3SG0A 2CNNA 4KNWA 4F4IA 2A9PA 4RLQA 2ZXEA 4O8ZA 3A36A 3CH5A 3I0MA 5DFAA 1RBZA 2XUAA 3ZUPA 2AN3A 5F33A 2C5AA 2Y6VA 1JEOA 3MJ4A 3TAUA 3PD1A 1GHTA 1AHPA 3V8QA 5EJ6A 2R8BA 3ZXXA 4FR2A 3H0KA 4LQDA 4C3ZA 1FQOA 4MJLA 5ICEA 3D5TA 2YIMA 2YL2A 3ZJ5A 1Y80A 1R4MA 4AWXA 2VHVA 3Q3CA 3B8HA 4ZOLA 2V1XA