2B1QA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with trehalose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 92
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b1qA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2b1qA02
1SWVA 5AVVA 5AW1A 4PNHA 3L0CA 5ALUA 4J03A 3U7GA 3ZWKA 2ZBDA 5AVZA 2IOHA 4UMFA 5ALJA 1L7MA 3L0BA 4G9BA 3OCYA 3ZX4A 3SKYA 1TE2A 5A3QA 3E81A 4OCZA 2WHEA 1EK2A 2DQSA 4YIKA 3L1VA 3RF6A 4BNDA 3QYPA 2GFHA 1IWOA 2Q5EA 5ALWA 5AM3A 1S8OA 3L5KA 2P9JA 3NANA 2G07A 4Y2UA 2WF9A 3EF1A 1Z88A 2BY4A 3ZW7A 5AI5A 1XPJA 2P27A 2QLTA 5IT4A 4HAIA 3QXGA 1TJ4A 3OCWA 2ZXEA 4OD0A 1ZRNA 2I7DA 1Z4NA 3QU7A 1L8LA 2G08A 2FPSA 1QQ5A 2O9JA 4UASA 2AUTA 3L7YA 1ZRMA 3UMGA 5ALEA 3KDPA 5AK6A 2B82A 1QH9A 4NWIA 5ALHA 3OCUA 1T5TA 4BEVA 2D2VA 4YCMA 4L6CA 2I6XA 4GIBA 3QX7A 4UMVA 1Z4JA 4MUMA 4BNDB 5AI0A 4ZEXA 1RQLA 3SKXA 1J97A 4CE6A 4RESA 1N9KA 2G09A 2FEAA 3QU4A 3ZVNA 5AVWA 1RKVA 3UMCA 4DFDA 2YJ3A 1U7OA 2R8XA 3J7TA 4QQFA 3M1YA 1Q91A 3K1ZA 3NIWA 2MU1A 2AH5A 3N28A 2FUEA 1QQ7A 4BX2A 3U13A 2C9MA 1ZOLA 2WM8A 4BEWA 1YV9A 2B1QA 3SMVA 4Y2RA 5AW4A 1YJ5A 3N1UA 4BYGA 5AKJA 3RFUA 4Y2SA 3WGVA 4EELA 3OCXA 4C4TA 1CQZA 3MC1A 5ALQA 1L7PA 2CN1A 3L8HA 4BBJA 2R8EA 5AW0A 3U7FB 4Y2XA 1QYIA 2I34A 5ALZA 3B9BA 3EF0A 2CFSA 2O2XA 2NO5A 3U19A 2I33A 3AR3A 3CZ4A 3OPXA 4E88A 4CF3A 4BKMA 4Y2TA 3CNHA 4ZEWA 4YIHA 3QUBA 2EAUA 4OFZA 3ET4A 3R4CA 1O03A 3QUTA 2HO4A 5AW3A 5ALMA 2W43A 2I54A 2FI1A 4XQ0A 1Q92A 5IS2A 2EARA 1J8DA 3HLTA 4NV0A 3NUQA 3AR6A 4C4RA 2MSNA 2GO7A 2HX1A 3AR5A 3SD7A 3L0YA 5IT0A 1U2SA 2FPRA 2YJ4A 1Y8AA 3KD3A 5AI8A 3FZQA 3W5AA 4HGPA 4QJBA 2JAOA 2PKEA 4G63A 4AS2A 5AW9A 3NALA 5AW8A 1YNSA 5AESA 2RB5A 4HGOA 2OYCA 5AIAA 3NRJA 4UU0A 3DAOA 3ZUPA 3QU9A 2HDOA 4UARA 1ZD3A 1RDFA 3KC2A 4FFDA 3KOOA 1KYTA 3PCTA 3QLEA 5ALNA 2ZBFA 3QGMA 2FUCA 2Q4TA 3EPRA 3OTQA 4CNQA 2WFAA 2OA0A 3PGVA 2WF6A 1RKQA 3B8EA 1LVHA 2HOQA 1PW5A 2Q4RA 2R8ZA 2ZG6A 2G1AA 3U7HB 3WKAA 4KYTA 4FE3A 2C8LA 1L7OA 1RMQA 5ALXA 4GXTA 2YJ5A 4EX7A 1K1EA 3PGLA 2B30A 5JJBA 3IRUA 4DCCA 2YBDA 2WF7A 2I55A 3ED5A 5AVTA 5AKLA 3L8EA 2QYHA 3NAMA 4MWOA 1TA0A 2FDRA 3BWVA 4EENA 1AQ6A 4NFLA 4EZEA 2ZBGA 3N5KA 2GHTA 5ALSA 1Z4MA 2JGAA 1LTQA 2G80A 2HF7A 1MH9A 2WF8A 3QUCA 5AW5A 3PDWA 5AW7A 4H1WA 1RQNA 2C4NA 4RETA 5ALDA 5AM5A 3ZVMA 2RBKA 2W4MA 2YJ6A 4Y2JA 3WKEA 1ZD5A 3DDHA 3AR7A 4KNWA 4YCNA 5AM0A 2WF5A 5FP0A 4UW9A 5A3RA 3P96A 3QNMA 5AKEA 1ZS9A 2YFYA 3WKCA 2YN4A 3OCVA 1RRCA 1WZCA 4I9FA 2IOFK 4Y2YA 3R9KA 5AKGA 4UATA 3S6JA 4UM7A 1N8NA 2YMPA 3WK7A 3ZTYA 1QQ6A 3D6JA 1SU4A 1T5SA 3FGOA 3FM9A 4AP9A 3F9RA 3IB6A 2FPUA 3NASA 3WK6A 3ZTWA 1RLTA 2JARA 2G0AA 5AKKA 3BA6A 4OHFA 4XE5A 3AR2A 4UAVA 5AIBA 1L8OA 2GMWA 2ODAA 1TJ5A 3I28A 3WK8A 3OCZA 4HGQA 3W5BA 2G06A 3UMBA 2X4DA 5ALOA 1RLMA 3GYGA 3TLMA 3HYCA 1NF2A 3ZVLA 1VJRA 4UMEA 2B8EA 3ZWDA 4XOUA 5AW6A 1RMTA 3A1EA 2CFRA 1WPGA 5AKYA 1X42A 4IFTA 1EK1A 2GHQA 4I9GA 1L7NA 3SF0A 1YS9A 4CF4A 5AKHA 2JAWA 5ALVA 5ALGA 4Y2QA 3ZU6A 2OM6A 3SHQA 1ZD4A 1Z4QA 3WK5A 2CFTA 3WKBA 3QU5A 4CF5A 2AMYA 3MMZA 2YMLA 1VFPA 3IJ5A 2ZBEA 2HEGA 4NAVA 2HSZA 3KZXA 3L1UA 2IYEA 5ALFA 3ESQA 5AM4A 5ALRA 4YH1A 4XPZA 4JB3A 2W11A 2PQ0A 3ONNA 3L8GA 1JUDA 1YMQA 1WR8A 2YMMA 5AI4A 3ET5A 4UU1A 4Y2VA 2C8KA 3AR9A 4BX0A 2P69A 3M9LA 1XP5A 5AKIA 2RAVA 1VJ5A 2PR7A 5AVXA 4HGNA 2AGVA 2HF2A 2B0CA 5T41A 2BDUA 4Y2PA 2YY6A 3I1YA 1XVIA 1U2TA 4NABA 3WK9A 1Z4LA 2ZOSA 3WKDA 4F71A 3ZI4A 1RKUA 5AVSA 3DNPA 4FYPA 3QUQA 4L57A 4Y3UA 2VKQA 3R09A 1NNLA 2EATA 2JAUA 3E8MA 2HHLA 1O08A 4DW8A 1FEZA 3E58A 5AVQA 3W5DA 4L6AA 3MPOA 1RC8A 5AK5A 3ZX5A 3FPBA 3ESRA 1U02A 3A1DA 3E84A 4EX6A 1T9ZA 3A3YA 4IG4A 1YDFA 2HCFA 5AVYA 1ZD2P 5AVUA 5AK3A 5ALKA 1CR6A 4B6JA 4UMDA 3UM9A 3B9RA 4EEKA 1U7PA 1ZJJA 3SLRA 2OBBA 4KX5A 5AM1A 3EWIA 4KNVA 5AKZA 4AS3A 3N07A 4ZEVA 4JDPA 3A1CA 3FVVA 2NO4A 2B1RA 1NRWA 3L8FA 2C88A 3KBBA 1L6RA 1Z4KA 3N8GA 5AICA 1TJ3A 5E0OA 1WVIA 5ALPA 4DWOA 5AK4A 2BDEA 2IOFA 2B8JA 4O8CA 2HI0A 2NYVA 5AKXA 5ALIA 3QU2A 2FPXA 4YGYA 3VAYA 1SWWA 5AVRA 4HYTA 2YMQA 1RPZA 1Z4OA 3U7EB 4BX3A 2R8YA 4KN8A 5ALLA 5AM2A 1Z4PX 4YCLA 4KX3A 3I6BA 2IA5A 1RMYA 5AHXA 5ALYA 3U26A 4C4SA 2FPWA 3WK4A 1Z4IA 4HGRA 3AR4A 5AW2A 4UAUA 1RLOA 4F72A 3AR8A 3FPSA 4UM5A 1Z5UA 2RARA 3WGUA 3MN1A 5AI6A 3I76A 4J2TA 5AI9A 3DV9A 1F5SA 5A3SA 5ALTA 2P11A 1S2OA 3W5CA 1Z5GA
chains in the Genus database with same CATH superfamily
5JO9A 2DE0X 3GRZA 3PD7A 4MAAA 5E7IA 3SQNA 4PNHA 2YYZA 3GVXA 4MVXA 4E5YA 4B83A 5ITZA 3U7GA 4P92A 1V1RB 1RM5A 4M6WB 4CNBA 1KDVA 3LC1O 1RJGA 2GJKA 1ILEA 3I4LA 1DAFA 1KAGA 1GPWB 3GJZA 3MJ4A 2VP3A 4IJQA 2VQ6A 1VKZA 3LUGA 3P5BA 3V42A 3VO2A 2BE7A 1BW9A 4Y7DA 5ES4B 1K3UB 1SUCA 3B48A 1CDOA 3LC7O 2HPHA 2GDZA 2Y71A 1N6RA 2YVKA 2PDAA 3PITA 4QTZA 5DT2A 1QYCA 4UPVA 2JEOA 4OI1A 1M2NA 4AXXA 2Q5EA 2VUSA 1D2EA 1R5NA 2FWBA 1PT9A 2RK4A 4BVHA 4DTCA 1FIUA 1CEQA 2YC4C 4DADA 1FUIA 1Q7GA 3COSA 3ZGXA 4XKJA 3CEPB 3FOAA 4M1SA 3SU8A 2V6FA 2NZ8A 1Z29A 2HTFA 3EF1A 3WWCA 5HUJA 4GS5A 4QL3A 4DIDA 1Y6JA 2VJCA 2XF2A 4LIPD 4C87A 2LR0A 2NU7B 4HAIA 4XWWA 2ODBA 3GFGA 1FU4A 4HWRA 2XUJA 4DV2B 1A8UA 4AX4A 1CUBA 2GEVA 2CJWA 1G64A 5TXGA 3WL7A 4XW2A 1IK6A 2IS1A 3RWOA 1QQTA 1SC3A 2PT5A 1AUXA 1Q20A 1ISJA 1L5LA 2Q2OA 1QS0B 4PRYA 3L7YA 4C05A 3RYHA 4YT2A 3TF5A 3GGJA 1HG1A 5DEOA 3GH3A 2AXPA 3NBKA 2IPXA 5LMUB 1GTZA 1T0HB 1RXUA 4TYWA 3L7AA 1BWPA 1NKVA 1EU1A 4H31A 4Z9AA 4RH1A 3U4QB 3L8DA 4A3FB 2ATXA 4X8LA 1CRLA 1ZMTA 3BERA 1P7CA 1G4HA 3IDOA 5M7EA 4L6CA 4Q9JA 2Y0EA 4C0JA 1MEEA 4XQGA 1RQ2A 2QN9A 2V1XA 4PG7A 4JYCA 1ISSA 1YK1A 1FDRA 2RGDA 4Y6OA 3EFOA 1BEZA 5EJAA 5BUQA 2EFDB 2P9HA 3AJ8A 1HE8B 3HEBA 4XX1A 1UDWA 5TMBA 3HDTA 4EI2A 4TMKA 3FYDA 1IRIA 1QZZA 3G82C 1EX6A 1JKIA 1GKUB 4KIUA 4BMSA 1IRXA 2QPTA 4QJ4A 1NZDA 4QQFA 3U7QB 3U2QA 2VP6A 2GA9A 5JJ5A 3TZHA 2E2IB 2JFHA 4N0MA 4PEVA 2LW7A 4RK7A 3REOA 4KWCA 3T0FA 1QQ7A 4A0SA 1U0BB 1TC2A 5EERA 2D00A 4CM3A 3I62A 3D8UA 4LC0A 2W22A 3G7NA 4BNHA 1IQRA 4H77A 4KQMA 2PMCA 2ZUCA 3RABA 5LQDA 3OTHA 1NQ5A 1VBFA 3EQ7A 1KOGA 1H85A 2Q9AA 1OHHA 1V4BA 1OQAA 1VXRA 4K5QA 2QTTA 3SIPA 4MW0A 1GZ3A 2RGGA 2ZWIA 2J4CA 3ESYA 3GLTA 3IOCA 1XDBA 4JVSB 1T0UA 3MTQA 1ZVMA 2CN1A 3LIIA 3NHPA 4R0VA 2W9XA 4YJ2F 3ZY4A 3FXAA 2R8EA 3WNZA 2V0GA 1VIVA 1DJOA 1JW9B 3R9XB 3MAJA 3GLFE 3UBMA 5CIYA 3NP9A 2V6JA 4XYLA 1H9CA 3N6VA 1Y3DE 3MRXA 4PY2A 1KJ9A 5BVHA 1UBHS 5JNUA 3FDJA 4ROTA 5CJPA 4NP6A 3OT1B 2C2HA 3GJ8A 4CF3A 1X1QA 3R7BA 5BV8A 3ZGVA 2XE7A 1I0LA 2QBYA 1EWQA 3NAGA 5KNBA 2MSKA 4E5MA 2REOA 3CUUA 3JYNA 1L4MA 1K4KA 5FDFA 3OFNA 1UBOS 4Z86A 4AIIA 4C43A 5DYTA 1ZN9A 4KQFA 2CNOA 3MMNA 3TSYA 3OIYA 1QC5A 2Z43A 4GLBA 4NMWA 3ZWQA 2XWJI 2V5VA 5ILOA 4FT4A 4TL6A 1ZNXA 4H7IA 3TPFA 5IS2A 3AUYA 2QNBA 2WIJA 4ESEA 3M4OB 1NPTO 2WFZA 4R2JA 4HBZA 3ZHVA 3OPYB 4DA9A 4Z1MD 3DOOA 1UZLA 4DG9A 2HQRA 2OWDA 5HKBA 2NTJA 3T1VA 1AMNA 5L4LA 2JHCA 2PL1A 3F6YA 1VZ3A 4YO8A 3K8YA 4QAQA 2D5BA 2FW9A 5K8IA 3C5EA 2RGRA 4CG0A 1R5BA 3KD3A 4L9WA 5HZHA 4YQYA 1TLFA 1ULTA 2JZCA 3LW8A 5TJHA 1VL8A 1WZNA 2BGTA 2JK1A 4R4JA 1Q57A 2JAOA 1U6JA 4YP5A 4ZYYA 1MENA 1WTAA 3FAKA 3B6JA 3F8SA 3R23A 2C31A 2J5XA 1NG9A 4JOQA 3I4NB 3O8LA 1NQUA 2HK9A 1M34E 1QRAA 4LC9A 1QFXA 4W1RA 4JLWA 1TM2A 2WD7A 1G8FA 1SZJG 4Z3DA 3GLGA 4MULA 2BGWA 1UXIA 2QRVB 3S2IA 3FI0A 4KDEA 2HZBA 4AXBA 5C5CA 5HK9A 5BWMA 1EDBA 2CHGA 3U5TA 2EYUA 4MVJM 4LDZA 1KRWA 1HY3A 1RHRA 4A3DB 1W0KD 1M8GA 3KLNA 4F8EA 5K4AA 2QXUA 5ITVA 1E2DA 1GPMA 2R8OA 2EZ8A 2OHJA 2XJ9A 2YYSA 3Q5GA 4XWAA 2Q6IA 3ACDA 5K3OA 4DQKA 1NYTA 1N57A 1NMEA 4MW9A 3VXKA 1ZGCA 2OMEA 1U0EA 3CBGA 4JLAA 1LVUA 2RHWA 1F38A 1AZLA 4M38A 3T94A 3LBHA 4ZT2A 3KETA 4R98A 1T9GR 4EZBA 1C8KA 1X94A 2X3YA 1TUEA 4O4JB 4YRPA 4BMNA 1DUVG 1K1EA 2R7LA 1K5HA 3DEHA 1T6YA 1UBJS 1XCOA 4YP1A 4YUWA 5D85A 3GJ4A 4IL5A 3LO8A 2I4LA 4JJFA 1QO7A 3T3HA 5LJLA 5B12A 2CVQA 4PLTA 3ICEA 2NN3C 3S55A 3JD1A 1I6LA 3SZMA 4E3ZA 2NQTA 2ZTUA 3ED5A 3UMYA 1II0A 1J33A 1A5TA 4UNPA 2IUSA 3MCAA 2FN4A 1Y1LA 2LDBA 4P7FA 3Q11A 1LV7A 3HWX1 4RMNA 4HR7A 2O4CA 3N9IA 3L84A 2YTZA 4FDMA 2VF4X 4KGZA 7REQB 4BNYA 1FYDA 3NIBA 3NT4A 1X7GA 1ISGA 1C7IA 4K7JA 4KFRA 1NHGA 3GGGA 3QWHA 2F59A 4OATA 5HRCA 4M4SA 3MFQA 1ZISA 3ZDEA 1JHDA 4YP7A 3RS4A 4BFZA 3LPNA 5D6NA 4DY4A 3HFSA 3Q3JB 3K6SB 3V6MA 2HW8A 2VYFA 4UEOA 2YASA 4ZQIA 3INRA 2WJJA 4KRYA 4D6YA 3M34A 1U2ZA 4MO9A 3QF7A 3ABOB 3Q85A 1RRVA 1WL8A 2ZQYA 4IJ6A 3TNDA 3ZWYA 2D7DA 3S8EA 1J00A 1WABA 2GZRA 4KNWA 1XTPA 2QL6A 1P1BA 1ZUHA 3DHNA 4JC0A 4O4IF 5FL3A 1ND5A 3TVDA 4B33A 4WNAA 4ZHQA 3CO5A 1Z6QA 5AQ1A 3EVBA 2NU9B 4EKIA 2HA3A 3RADC 1XX6A 3FCOA 1XPOA 3ZDQA 1E0SA 3FOEC 1ADCA 1UEIA 3NVKI 3S1QB 1EKXA 1OJLA 2CXUA 3OF3A 4UHBA 3ROFA 1EK5A 5EJ4A 1LK5A 3HJUA 4CM1A 2PGJA 3MM4A 5EHXA 2HSGA 5TPWB 3RC2A 4C78A 4M2LA 3ZEIA 3D7MA 1XVVA 1VHDA 3R9KA 1SCDA 1I1QB 4GQIA 3QJ5A 4ZOBA 1E2BA 2XITA 3D8TA 3PUYA 2VATA 1Z5VA 1UJNA 5AO9A 2WFLB 1YKGA 4JU8A 3RVOA 1LLDA 4CGZA 1DC7A 3H6GA 3I0NA 3UC9A 4Z49A 3GYBA 5CFQA 1QGOA 4TRNA 1EFLA 2G0AA 1B26A 3PIDA 3IE1A 3RVDA 1M7HA 3MPUA 2GERA 4V0LA 4EI9A 4MPPA 3I5MA 3SOPA 4HLQB 4DRZA 1F1BA 1RBMA 3KXKA 3OM1A 4HAXA 1PHRA 4U2FA 3GLFB 4U0KA 1OBVA 3FYHA 1D2NA 2QU8A 4MQ5A 5DNAA 3W5BA 4IF4A 3S14B 1UJ4A 2VHQA 4K2AA 4FFLA 4PHTA 3RFVA 1EE2A 1P5RA 2CK3D 3G0OA 3I4MB 3FHOA 3LAWA 1SBHA 2VDNB 4DLLA 2CFIA 2L17A 4FN4A 2JIRA 1CNMA 3TLCA 4A93B 4HYQA 4LY9A 3NKVA 2RIPA 1WPGA 1N2XA 2AOXA 2DFVA 1X42A 3QG5A 4IFTA 5AKYA 2VHEA 1RZUA 1TCUA 1P4GA 3PPIA 4RVGA 4FD2A 4WN3A 5KDLA 4KYUA 4CEJB 3PQ4A 2Q3LA 3O38A 2ZQZA 4PANA 5FTNA 4BO7A 1HTWA 2QLFA 1TI7A 1B1AA 1E0JA 5JH7A 3IIJA 1G55A 2WE7A 3STUA 5BRNA 1B2RA 2ZJ3A 1XZIA 3M5DA 4LNUB 1Y1TA 2UZ0A 5J4VA 4JZYA 1E77A 2C29D 4E03A 3LHFA 4J0HA 5E3IA 1SXJC 4J0DA 1W4RA 1TEVA 4OHPA 1U9IA 3AG6A 3BULA 3IJ5A 1AQUA 2D0PB 2YV4A 3U44B 3RTBA 4H4EA 2ZJBA 4HAWA 3FZNA 1CUVA 1II9A 4IIJF 4RZUA 1E62A 1N2EA 4ZCTA 4GBJA 2GUWA 4C3OB 2A8YA 1GAJA 1U0LA 2ZR8A 3GLVA 3HADA 1BWSA 1E3IA 2B5OA 4FDVA 3T3OA 4JLOA 1CQJA 2HMSA 1JBQA 3LQ2A 5SZKB 4NYIQ 1KMCA 1M34B 1MAUA 1OXUA 2LNDA 2C9DA 4N6OA 3VSDA 5HP4A 4Y2VA 4W9MC 3SFVA 2AWNA 2NVBA 4QFBA 4KQHA 4N18A 5M04A 1XP5A 1D6MA 1O6ZA 2VDKB 1J7KA 2ZE8A 4UM9D 3RSLA 1O9BA 3B5EA 4F21A 1P1IA 2GPYA 3WLHA 2P9BA 5F7XA 1VG9B 1F6BA 3D2BA 4HDRB 2YY6A 3MJVA 1XYGA 4XD7A 2V4UA 4WY5A 2AXEA 2M6KA 2BFBA 2R5NA 2ZETA 3COYA 3LUBA 4CMCA 2VWPA 2DP4E 3BXEA 4DA0A 4DDWA 2RGUA 4S12A 2R6DA 1T3LA 3E9YA 2RI6A 3HYRA 4Q7MB 3C1OA 1NW5A 2V55B 4RZHA 4BE4A 4P6VF 1TAUA 1I3CA 3KT8A 2YHBA 1PDWA 2AYYA 3G3EA 2HA5A 4ZK6A 5T8KC 1C80A 4A8JB 1SJ9A 4CLOB 4UFPA 2ZS8A 3SHOA 2CVPA 3ETEA 3IUEA 4AD8A 1Z2OX 1ZI8A 1RM0A 1Y7PA 3W5DA 4WH0A 1JI0A 3DZDA 2IKQA 1DKQA 1N2GA 1Y5MA 4L6AA 5T4FA 3RVSA 3GTLB 1B3BA 3Q72A 1P9NA 1CNFA 3V46A 4NFSA 1C1DB 1Q1EA 2WSIA 2ZXFA 3RRJA 6ABPA 3P45A 3LDAA 5EQTA 5HQ3B 2PU7A 5CD9A 5C32A 2E89A 1DHRA 1Y6QA 4QE3A 2QN3A 2Z8YA 5ALKA 4A0FA 3U16A 1A27A 4P86A 3HGMA 2VYVA 4ZEOA 1D0SA 1CR6A 1U80A 2ZVPX 1SCAA 4P5DA 3VHXA 3VZSA 3WWOA 4OI2A 5E1OA 4Q1FA 5L95A 5C5DA 3WTCA 3GFSA 4O0LA 5BOVA 5LP1A 2ZRHA 4KR6A 3VPXA 1N32B 3EA0A 2X77A 4DCMA 2X41A 5DCYA 1MO6A 4JDPA 1OXBB 1QGED 4PV7A 4A5SA 5BR7A 1S02A 2J07A 1EFPB 3BTUA 3KBBA 4YRTA 4L0MA 4TL9A 2PH5A 1PJZA 2W8ZA 4IX1A 3A3KA 5B3JC 1Z4KA 1NN3A 4WLOA 3HVRA 1A4RA 4EI7A 1YOVA 3WWDA 1GN8A 4EARA 1DIAA 3O83A 1FYWA 4QEKA 3AETA 2AZDA 4I66A 3L0DA 3OICA 3N2LA 3EHEA 2HI0A 4TTQA 2JF0A 5FWXA 3PJDA 4MKHA 3SGLA 1BD3A 1NVXQ 4P3KA 3VKUA 4LCBA 2FGJA 4YI5A 3WYGA 1M2HA 1WB6A 1FXWA 1QQBA 1O8BA 1QCZA 1YR2A 2BFDA 5FCDA 2HHCA 5IAKA 3FJOA 5K1ZA 3OZDA 4KN8A 4W82A 3U0BA 1ZVVA 4PPYA 3WQHA 3A9TA 4PLFA 1D2CA 1WF6A 4EJSC 1FNBA 2IEYA 3I6BA 1N2BA 5M3FB 1Z0UA 2NUPA 4GVPA 1S5PA 1JHUA 1P44A 2WIKA 3WMEA 1W0CA 2MHCA 3DAPA 4HBGA 3KUCA 3QE9Y 1XDGA 5GTDA 3NTQA 1GITA 3AR4A 5DM70 1RLOA 4UBOA 4X6YA 1B43A 2C4VA 3AR8A 4MYCA 1BYIA 1EUQA 1FVFA 3TPCA 1I0IA 5DP1A 3R3XA 3TGWA 4R51A 1ZH2A 1OE0A 1PLKA 1VE7A 3R0JA 3ROMA 5JYEA 5A0FA 4FWIB 5C51B 3G68A 3RFTA 3RDPA 2FW0A 4WLNA 2AFIE 2NXCA 3IBSA 3C24A 4EY4A 5E0KB 1UF9A 1U2RA 4LY0A 3E1SA 2W6IA 2J3LA 1X19A 4HLNA 5D86A 2GJ9A 3TUIC 1E2PA 1H42A 2VVTA 3BJEA 1P73A 3FCSB 1K7CA 3KR0A 3Q7SA 1HYGA 1NMXA 2DY1A 2PRYA 4LKRA 1LBQA 4CLEA 4EUEA 3EG5A 2C5HA 1IHUA 4KWIA 4CT5A 1KU6A 3B51X 1VJ1A 3LD9A 1IB6A 1AZWA 1ONNA 4YRMA 2H1IA 1R66A 2VT3A 3L1VA 3RF6A 3EZNA 4RY8A 1U3VA 1JG1A 1ICIA 1Z22A 3JD2A 4NJMB 4HUTA 1FP1D 5JJCA 4YMIA 3VA7A 1N9GB 1XF1A 2ZB3A 4G5GA 1R9JA 4PZ9A 2XMGA 4U0JA 1Y80A 4Y2UA 1UBCA 4E7PA 3GD7A 3Q2KA 5A1TA 4M1QA 1FNMA 2RAUA 3IV6A 2PUJA 3UN1A 4HNRA 5AI5A 2F8SA 1D7OA 2FWAA 1D3AA 1NMSA 2F9FA 3B82A 4FGSA 2FZ4A 4REOA 3R77A 3O8QB 1V3VA 4JKYA 4JXKA 5GM2A 4C6SA 3LX4A 1AK1A 1G1AA 1GL7A 2WUVA 1SUBA 3BTSA 5EINA 5SYMA 4BNMA 1ZESA 1WD5A 3I04A 3UUGA 4M7OA 5KYWB 3F4LA 2IXDA 2WUDA 2VEOA 2P9GA 4E6EA 4GPEA 4IFEA 2JIMA 3QVSA 3W6OA 1VSUA 3M6LA 2X42A 3BHNA 4G1FA 4LX8A 5KNBD 2BM8A 3G9QA 1GDHA 1NI4A 3H9UA 4E70A 2Z6QA 1SXPA 1O6BA 2OHOA 2QMUA 3GUHA 3PT9A 4OYYA 3ZWCA 1QH9A 1Z7GA 3WO0A 4IZHA 4U3JA 2UYCA 3OCUA 3BWDD 5IZCC 3OLQA 3ON5A 4FHDA 4D8YA 5CX1B 3UATA 4NEQA 2A94A 3BSWA 2GD1O 4B2PA 3KOWA 5L8VA 1ODCA 1KYQA 2ZIFA 1ZXXA 2VTDA 3IL2A 3C43A 1T2CA 4AJIA 1H1LA 1YZKA 2P67A 3VC1A 821PA 1XEXB 1OYWA 2A86A 3HG7A 1ENOA 1OT5A 1SCBA 3TJZA 3QQ5A 1UQTA 2F3TA 4IVQA 3EXEA 1HEIA 4YRLA 3B9PA 3UV7A 1W7AA 2Q07A 4GECA 4Y6RA 3H1GA 3E4CA 3UJ9A 2CEKA 1JFTA 1QDUA 1N5IA 1XZGA 3W1EA 4MA4A 4Y1RB 2G7MC 1FS5A 1M2OB 1Y4UA 2P68A 3PJFA 4IXMA 4PFQA 3DTVB 2AOTA 2N47A 4ZMRA 1VYUA 3K1AA 4L8YA 4QECA 3B52X 2VEDA 1G8MA 2WWRA 1IN4A 2OT3B 3NDJA 5JR3A 4MR7B 2QAGA 3SBOA 4O3FA 4BVBA 4YXFA 4EO7A 1JEJA 1NJ2A 4R1OA 4LSZA 1DLIA 2O3RA 3C5CA 2IV7A 1E18A 2GKSA 2VLIA 3GBVA 3JWHA 1E66A 3SMQA 1EM6A 4YAFA 4PSAA 3I2YX 4YV0A 1YQDA 4BS9A 3T9AA 5H4GA 1NUAA 5AKJA 3LP8A 4HADA 1XGKA 3U61B 2IIVA 1X7WB 3DOFA 5FWNA 5JSZA 4MWGA 3JV7A 4WLFA 2BR5A 5FOXA 1U4SA 4RK4A 3UHAA 3CUWA 1TU0A 1R74A 3FZGA 2XTMA 4GMKA 1KI9A 1V8DA 2ICAA 2J59A 1ZQ1A 5I47A 4R3WA 4S1OA 3K0HA 4HDSA 3DMFA 3FOCA 3R6DA 4G1EB 5SICE 2ZBPA 4AO6A 1G8GA 4X91A 3UH1A 4QLBA 4W4TA 1CUFA 2ST1A 3K20A 4ZZIA 4OQYA 5IABA 2JH3A 4BO9A 1RKBA 1G5TA 3PL5A 3BDAA 3NBQA 3ADDA 1U4OA 1J24A 2AN1A 2UYOA 1SG6A 1SHLA 2GWRA 2HUPA 2F1OA 4CV0A 1W36B 1MJNA 2YXLA 3HLYA 3UWKA 1NXQA 2GF2A 3DGEC 3FPJA 5FUWA 3CNHA 1H4TA 1B41A 2A14A 4IDGA 4P8RA 4A36A 3C7KA 1Z6YA 4MUBA 5CYFA 4TYNA 3IFSA 3I2IA 2KYRA 1SAYA 2EYQA 3AFNA 4HCJA 3FE2A 3CKMA 4BU1A 1DELA 1Y1RA 3FNHA 1EINA 5A9SB 4AZVA 3EVDA 3IUSA 4EFKA 5E4YA 4YBZA 4KP7A 2D3WA 2FWJA 1T1RA 2O48X 16PKA 1MG5A 3LXMA 1TZCA 3B7PA 1EPUA 3H1PA 3E9CA 4ZCMA 3HCOA 3NG1A 3UICA 4NMMA 4G65A 2DWUA 1S1MA 2LVBA 2PJDA 3E8XA 2M6LA 2BIFA 3AR5A 1C0KA 1B73A 2K5UA 3L49A 5DHFA 1A5ZA 3W7AA 1KI4A 3F6PA 3L0YA 4E12A 4EGQA 2OAQ1 4LSWA 3IIKA 1Y5LA 2PRZA 5L3SA 2G83A 1FRQA 3ETCA 2I4OA 2Q3BA 1YQQA 2WJWA 3GLQA 4P5PA 1DEXA 4BV8A 4Z3KA 1LRKA 2QYTA 2LZ0A 3HSSA 2AFIB 4NAUA 4ZV7A 3FPAA 1I10A 2OO5C 2JFXA 4L22A 4YONB 2HY7A 3PX3A 1E8MA 3LX5A 2OD2A 5EIHA 2V03A 4X1KA 5GONA 4DT1A 4M9SA 1O94C 1L9XA 4XM0A 3NDBB 9MHTA 1CJUC 2ZSEA 3G6WA 4KV9A 4ZV9A 2X9GA 3A6LA 4BO6A 5KREA 3AEUB 4CQLA 5G0WA 3W8DA 1BWRA 1RWOA 4AZ0A 3COPA 4NENB 3F78A 2PZEA 4F45A 1HE5A 1R64A 1A0OA 4C30A 3LG2A 4CQMB 2BKUA 3M4NA 4XGRA 1CU1A 2QRKA 2QSZA 5EESA 5TQ2A 5IYZA 3UV6A 3ABQB 1IYZA 2RGNC 2ZTLA 1PW5A 1GA6A 4J7UA 1CZUA 5HUQA 3JQAB 1ZIOA 4JYZA 4GSYA 3UOWA 3E4DA 3CKYA 3L41A 3WFJA 1FUKA 2E49A 3E9EA 2ZIXB 4IWXA 1XTSA 4RFSA 2APJA 4N7RA 1Q0LA 3NV9A 2J0UA 4OJTA 4PAWA 5F51A 1JDZA 2B30A 1N2ZA 5CT5A 1WKVA 1WQ1R 2XH8A 1OXXK 1UOQA 4D3XA 2NG1A 5C1OA 1Z0JA 1AD2A 3AUAA 1AHHA 1EQAA 3R0XA 1MQ9A 5AOCA 3D4IA 5BR8B 1EIWA 3H2KA 4K9PA 1JQ3A 1BA3A 3DDOA 4A8HA 1E9VA 3LJKA 2JFWA 4ZU1X 3I8OA 3FNFA 4MWOA 6NULA 3A3PA 4RE5A 3CQZB 4JVOA 1KHHA 4ZALA 3THXA 3M6MD 2V7EA 1QYXA 1R5JA 2GRJA 3DBHA 3L2OB 2WHPA 1PG2A 2YWCA 1SXJD 1E0KA 2BEKA 2KJQA 1MDBA 2G80A 2JGAA 4UBIA 3PGJA 2P1DA 3QKIA 5F1YA 4A10A 3RKRA 2WF8A 3EBOA 3QUCA 4A6EA 4IMJB 4K88A 1J0EA 1CJMA 1SA0B 2HRZA 3QMMA 4TVKA 1CUGA 3HB9A 4UHFA 2NSDA 1C7JA 3ORSA 5FOVA 5JS6A 2C59A 2B7CA 2QTFA 4RK5A 1ZM7A 4HLDA 5HQJA 1YZ3A 1JMYA 1IHOA 1KI1A 2AG6A 3CW9A 5AJZA 1YONA 2XUOA 4LFAB 5FTLA 3QE0A 2BUAA 4TWAA 2YS7A 4AB1A 4GI3A 4HS9A 4IV8A 4BB5A 2H2AA 3B2QA 3FB4A 1PL6A 3FDZA 3KWJA 1G21B 2WA1A 4JEMA 2KMLA 2QM3A 2ENUA 2O8EA 4Q3NA 2QW1A 1W35A 3KQNA 2CUTA 3OZSA 1S8NA 3CH5A 4JEHA 3SE7A 4WJKB 2V7QA 3KUKA 2BR3A 4CKBB 1N8NA 3K0FB 2ZYGA 2WTUA 1RYNA 3KJZA 3OJWA 1B6GA 3D6JA 4CWAA 4XD7D 2FPGA 3IMCA 4LZZA 5K0LA 2BEUA 3CRZA 3SQXA 2O8FA 2QL7A 3O9VA 1CHDA 4S1VA 5DW0A 1GNLA 4R41A 3RSFA 5H3CA 2Y1KA 3U7IA 3UAGA 3BGOS 3CB4A 2NXEA 4GBGA 1VMEA 1G7SA 5TS3A 4UAVA 1D8TA 4UHKA 3SJCA 4G97A 3LGSA 3I92A 4GRAA 5DX0A 3B8HA 2RFLA 3U9SA 2HBRA 2XTZA 1G5FA 2EEPA 2PSEA 2XQGA 1B15A 3BDIA 3CUTA 2A9KA 5DYNA 5LXTF 3ROEA 4CVNA 5KWIA 2ORVA 1HLPA 1T26A 2CE7A 1Z0SA 5ALOA 1V9LA 4EA9A 2QVZX 1NF2A 3HU2A 2W58A 3GUCA 1D2GA 2ZJAA 1CZLA 2DKFA 4G23A 3Q5DA 3Q6IA 1LPMA 1X7DA 1RI4A 2PV7A 3EWSA 4RD4A 4AP5A 4LQLA 5K0NA 1S9HA 1VYHA 2YZMA 1M6NA 3EQ8A 2XVYA 3I6QA 4YJHA 4ZODA 4FM9A 3D4OA 4E07A 1PNRA 2B9VA 1Y34E 2QPOA 3SF0A 3R8FA 3TX6A 2IH4A 4EKGA 1NDHA 1O77A 3TFWA 1NIPA 3EH2A 1MKYA 1V1MA 1XZFA 4GOKA 1N75A 5ALGA 5DZSA 4OQPA 2ZYDA 7MHTA 2W2LD 2QORA 3O1HB 3VR5H 4XUEA 2X8AA 4REQA 1ZNQO 2COEA 4EJ6A 1OFHA 3MMZA 4HO1X 1SC1A 4OUDA 1VFPA 1WPXA 4J1TA 4FYHA 3HYSA 3DMRA 3NKFA 3MCTA 1Q3KA 1G6HA 2YWDA 3QPAA 3CLTC 2IYEA 1FFEA 2ZS7A 3MSCA 3RH0A 1UPAA 1OH8A 1Z28A 1F2TA 5CDFE 3DPIA 2YIVX 1Q0ZA 4XARA 3CNOA 1FFDA 2HL6A 4E30A 1U28A 2VK1A 4OQLA 4WOKA 3RFFA 3TSWA 5BWCA 5KYGA 3R7AA 2E55A 4YRJA 4AJPA 3ZQ4A 1OC2A 3IPXA 1EG7A 3WLEA 3LVQE 3FKJA 4LBZA 1INLA 3WJ1A 2PJRA 4YTEA 3PUIA 4B75A 2WR8A 3A9WA 1YZTA 4MROA 4BP3A 5DTMA 1F12A 3PVZA 1WO8A 2H4JA 4HEQA 1WXDA 2XX3A 3FWHA 4ZOAA 4HMOA 5FBRB 2H1FA 4B2IA 3AKCA 3VDNB 1QSGA 1BVUA 2SKDA 1C4WA 2IS6A 4M0LA 3WK9A 1M2FA 4MQEA 3DP9A 2OO3A 1N5RA 1ZGBA 4DCSA 5K3FB 3VC2A 5THQA 3H1TA 3CRW1 4C7OA 1OAAA 4XYMA 5ED4A 4ETMA 4KBGA 1IXYA 1NR7A 3UWPA 4RLHA 1KAOA 4Y3UA 4ZI5A 2W90A 1UBNA 5C4IA 2XUPA 4XTRA 1VJGA 5JNTA 3KSAC 2WDZA 3UJ3X 5HRAA 1FJXA 2PGAA 2FHSA 1OGIA 3HKDA 2FNAA 2PFGA 5K8UA 5KMGA 2R1VB 3STVA 3ZBQA 4XJXA 2WPDD 1X39A 1EVEA 1UBLS 3MPOA 5GOTA 2RONA 3KEFA 2JEYA 5AK5A 2F3RA 2R68A 5G1OA 2P1ZA 4F85A 1GA4A 4Z4EA 2EW2A 3KKKA 4HTFA 1EUCB 4OGLA 3PHBE 4YUXA 5CB0A 4ER3A 2HCFA 4DOMA 4ZDJA 1PJBA 2BFNA 3C8MA 3IP1A 1OWOA 1ZD8A 4D5EA 1MRNA 3P0FA 2ACEA 2FPOA 4F4IA 1GVHA 4JEUA 1QO9A 4WINA 4IJKA 4G1MB 4C3ZA 5L3QA 2X9LA 3FF4A 4G4GA 1IY8A 1BWQA 2PNFA 3DSRA 1LPPA 2XIQA 2VH2A 3H1FA 4KX5A 3UAZA 2UYGA 4DIFA 3H75A 2C2BA 1G41A 1MR3F 2C4MA 4TWZA 3WHPA 3HR4A 4C14A 5D01A 1Q44A 3I2GA 4ZEVA 2AR0A 2Z5GA 3DTTA 1AQNA 4XIGS 3AHFA 3D6MA 3OPMA 2ZJ8A 1YGYA 2C2ZA 3IJRA 5FI0B 1DIOB 2B99A 4FCTA 3TJMA 4PXAA 3SQMA 3JQFA 3HXMA 3K9BA 1N6OA 1TZMA 1XB2A 3KWLA 3O2NA 4NCHA 1I32A 1C8BA 1SQFA 1TJ3A 4XI9A 3TTSA 3ZNPA 5JMOA 1OIXA 3R7DA 3PFIA 3EGXB 1GDTA 1KL7A 1Q50A 1C9EA 1JRLA 1S8AA 2H1SA 1DRWA 3KALA 2AWOA 3UJDA 3WLIA 5TVKA 4JJZA 4RSHA 2D1TA 1XQ1A 5I9BA 4JI3B 1GT91 4HVCA 5ITWA 3WX0A 4QGAA 5HIIA 4BNTA 5BNWA 3AH8A 4MAFA 4TLAA 2NYRA 4ZIRA 1SOUA 3QF4B 4GX5A 4G84A 3ZNOA 4J07A 4DR7B 3O47A 1PK8A 5J63A 4MRMA 2FOXA 3JPWA 1V7QA 2FZCA 2ZPUA 3QM1A 1U04A 4YB8A 4DIBA 3PQ5A 3UXHA 5CXXA 4AYTA 1A8QA 2O59A 4YCLA 1KP3A 1QKIA 5HM8A 1QR2A 3QXXA 2H2DA 1W0JD 4E4RA 5KTPA 2LP4Y 4NCNA 1HYEA 2JJYA 2YXNA 1NW7A 3KYBA 4NOJA 1U8FO 2HHHB 5LFAA 4P22A 2VXYA 1UC4B 2PZKA 5AW2A 3ES9A 1Q17A 3D9QX 3BJRA 4JNKA 4I9NA 4ZU3A 3AY3A 3VDQA 1QFSA 1E6MA 1P0IA 1SKMA 2IWRA 3LXXA 2PA0A 4YLEA 5JS2A 4F6LA 4A3KB 4QLAA 4XGIA 1E7SA 1JTEA 1KDOA 2XDAA 1OTHA 1TJYA 2Q4OA 2QG6A 4G1VA 3VNAA 5BV0A 5K2OA 1FOEB 2ZBDA 2YWFA 4OGGA 4XOIA 4ZVVA 4QOEA 4D9CA 2ERYA 1P81A 4KQ1A 3LFHA 3R8XA 1NMZA 2PT7A 2VTVA 3FSGD 3OCYA 4FCCA 4MUIA 5E2BA 1L4UA 4MV9A 4DSZA 5JYDA 4B3XA 1GGFA 1QH0A 2KSQA 3OY2A 4MEBA 3RTEA 3NAZA 4W5TA 1ZHHA 2AN3A 3HWWA 2C5EA 1T9BA 3R7NA 3ZE9A 5C5EA 4BL5A 1FRVA 1GQSA 1RCUA 1XZKA 2JDID 4L2IB 3TFQA 3KOXA 3MRTA 4RJJA 1KPHA 2KI5A 5CK5A 2AHRA 2C54A 1KYYA 2J9XB 2ZSHA 3FNBA 4FIDA 4MYSA 4X6UA 1Z88A 2Q0HA 3RT7A 3W2HA 1YD7A 2XI4A 2D6FA 3U3DA 2GPTA 1U0SY 5CK4A 1T9AA 1DE0A 4HQFA 4C7VA 2QLTA 3D1LA 5JBNA 5FNVB 1X7XA 4L95C 4Q37A 3UC5A 4BP9A 1KZ4A 1P61B 2UZ1B 3E23A 3D3QA 3OU2A 2WTXA 3UV3A 4DLZA 1O58A 4KO8A 5SYNA 2ZXEA 5DSTA 4BQPA 4X93A 2Y1WA 3O2JA 2QMEA 4KOEC 4P2GA 3PA6A 4QO7A 1CDEA 2PPLA 3WIBA 1KOJA 3RRBA 5C8XA 4AKHA 3HYTA 3Q9LA 4A4DA 3GZJA 5CFMA 4JJEA 4XSVA 3JAWB 2FXIA 1G2OA 1L8QA 4MKFA 4TWRA 2OWEA 3F5FA 1ZP6A 3CLHA 5IK2A 3N8NA 2R1UA 2FZEA 2NQ8A 4MS1A 1AK9A 4WOJA 1V43A 4DYDA 1QJ4A 3O84A 2QGFA 4YPVA 1ZCBA 1WX1A 2D2VA 2DBRA 4HQRA 3WGKA 3ZY3A 3SVLA 3RRZA 5FOTA 4G5OA 3HB5X 1X13A 5BMVA 4DCGA 5KINB 3LLVA 1VPTA 5LLSA 3A9UA 5T67A 4L9AA 2VK8A 4XAQA 5AI0A 4XZ3A 4BNDB 4OXIA 3TLZA 4Q21A 2P90A 1PZFA 2XZTA 3M6VA 4K05A 5DIZA 4QUBA 1ZH8A 1JILA 2G09A 1XG5A 3G59A 4N7JA 4UXJA 2FWRA 4KR9A 1MNAA 4R8RA 1KH1A 1QIFA 2WTMA 3JVIA 3NOOA 4P31A 3DE0X 3TG2A 4DV6B 5B30A 2NUAB 4F9FA 4ARCA 2VRBA 3J7TA 2ERXA 1XZLA 1DQZA 3M1YA 1SUDA 4RAOA 1O94D 4CMKA 3PDCA 1T5IA 4ONEA 2QQGA 1B76A 5CHEA 2IZZA 4MIKA 4K3UA 3ENQA 4DQVA 5CA1B 5HJ2A 4F92B 3NMUF 4Z4QA 3HWRA 3THOA 2FUEA 4PNPA 1KH3A 1M1ZA 4PM4A 4Q00A 1TECE 1WMSA 1A88A 3I01M 1KI7A 1N4AA 1TF5A 2A7QA 1X7YA 1TM7E 3G23A 1U2PA 3ACCA 2TMKA 3OE4A 3KEOA 5EFZA 1YV9A 5CB4B 4HG2A 1SKUA 1MOQA 4Y2RA 5ITSA 2VJNA 1P9LA 4C1NA 1DUSA 1LPOA 2Y1FA 4FSDA 3EIEA 4MAMA 1IG3A 4Q1VA 3WL3A 5LKRA 5HJ7A 2CHVA 3E9NA 2F1IA 2A30A 1KFKB 2R7NA 3OCXA 3IP6A 2GD0A 4IQ0A 4PLHA 3BD6A 5G0VA 3T8YA 5DNUA 1H2RS 5L6LB 3NKLA 4PYJA 4DMLA 1G2IA 4JBIA 5KJFA 2XIJA 1I6HB 5IM5A 2FUNB 2VKTA 3NQ41 1A7AA 3JQ7B 4FEEA 5ECGC 2CHUA 3NIFB 2ZYSA 3TIVA 3I1JA 3N53A 4EHKA 1YDMA 1T34A 3X1ZA 2VH1A 1H2WA 1U5BB 2HQSA 3CZ4A 1C41A 4FHEA 2L42A 4BJ5A 2B36A 4MOWA 4WZBE 5F7OA 1XCJA 1QDLB 3LDFA 4DANA 3FSJX 2GCEA 5KO2A 1AJEA 4Z53A 2GEBA 3Q8WA 4PX5A 2OILA 3GZNB 3HKEB 1KO4A 4H0CA 1VZ2A 3CXUA 4CDGA 5LU8A 1M67A 3KB2A 4KI0A 1A9TA 1V8BA 2A57A 2SICE 3R8CA 5GVRA 5T6MA 1QKKA 3GFFA 4XGNA 2B35A 2GN0A 2J30A 1XQ6A 2VHCA 3EF3A 3WGOA 4MCAA 4CT4B 2Q4DA 3ZDDA 3TO5A 1JIUA 3ZWBA 2A9PA 3FVWA 2I1LA 2I2WA 3E9ZA 4MJ3A 4MW2A 3HZHA 3NUQA 4K1XA 4B4DA 5LB4A 2YZNA 3KS9A 1ZYUA 2YIDA 3BB1A 3TOSA 2V96A 3H0GB 5FUBA 3MJCA 3S28A 5CITA 4WCDA 1DJNA 2REQA 3H2BA 4PYLA 3LQYA 5LYJB 2J6IA 1NC1A 1Y8AA 3C5VA 4LJ4A 1LVGA 2ZXUA 3F9CA 2LTAA 1USUA 4QJBA 4EKDA 4OMDA 4G86A 1OI7A 3F7MA 3KVOA 2ID7A 3Q0EA 5AW9A 3WRXC 4BIMA 4EPWA 5BNTA 1X2BA 2O5VA 3BF8A 3C6ZA 2GVDC 4RTOA 3GTGB 5G0TA 1EB9A 5JJLA 4HH4A 3UK2A 3AL0C 1MB2A 2OHXA 2XJ4A 4CODB 2IUYA 2QOEA 1E64A 3NGXA 4LAFA 4XCXA 3RYIA 5BWLA 1RDFA 3A7DA 3MF4A 1KI2A 3KOOA 3PNKA 4G5QA 1J06A 3LT2A 3X43A 1QGDA 3ZNNA 4L02A 4BQOA 3K8ZA 4I4TA 5IKOA 3I6IA 4XX0A 1FDTA 4F4FA 3QVGB 3TYXA 2V97A 1SRQA 5IFLA 4MHSA 4Q3EA 2V1UA 3DOIA 4GZLA 4AKGA 1PDOA 3N70A 1YR6A 4YMGA 1Q11A 2P2CA 3ENKA 5EHQA 4K6HA 1JPUA 2IFTA 4FE3A 4COOA 1FJHA 5C8YF 4R8SA 4RUKA 1KXJA 3NBMA 1ZC3A 3GUVA 2XYHA 1QLHA 4EB6B 4KE8A 4LMBA 2P9FA 4ZI7F 5E9WA 3HNPA 3TR0A 3DBLA 4FR0A 1NNEA 3TL3A 4QXQA 2VS1A 3PK0A 1EJ0A 4DCJA 2P3OA 5IDWA 4IDFA 1PP4A 1COWA 4DLPA 2QYHA 1RQ7A 4IGAA 4GI2A 5DB4A 1W4AA 3WXMA 3BWVA 4JVLA 1WU7A 4DRXA 3DNFA 2BKXA 4PWZA 5EE1A 4RPCA 1KQPA 3W34A 1DKRA 4CXMA 2GQ0A 2B2XA 3LFUA 4MS3A 2UUAB 1H8EA 3O74A 4JIMA 3A10A 2WSSA 2F9MA 3T7TA 4XASA 3HOYB 2DVMA 1HBJA 2FFQA 2IL1A 3QXJA 4HH0A 4MLPA 3HVKA 4FMCF 4RKEA 5C0OE 2CFOA 2C7VA 1ECCA 3B3AA 2IYVA 2RBKA 2RGYA 2AE2A 1C9YA 3SC2B 4R0NA 4BKPA 3TW8A 2A33A 2VDWB 4PZCA 4B7XA 1UXJA 4PGMA 4HNGA 1N2CE 1R0YA 1QVAA 3D8NA 3E9RA 2IYTA 3IPRA 4KMOA 4E4TA 2XNDD 5K01A 1XYVA 2IYAA 3UMJA 4HXYA 3RROA 3GDFA 3GCDA 3QH4A 4DZZA 2BN4A 2RGAA 5FX2A 4XDYA 2UXBB 3D3KA 4IHJF 2UUOA 3RS5A 4B7CA 4ALLA 4RLFA 4AAYA 4B79A 1U8UA 3LRXA 2N1MA 4V0KA 1CCWA 1PSZA 5BQXA 4BJHB 3WMGA 2ACVA 1GAEO 4LOLA 1LKZA 1ZW6A 3UF0A 5KJCA 3TM5A 3CLUD 2OY0A 4HVAA 1MF7A 2XB9A 3QITA 3TNLA 4QYWA 3AHGA 2CB9A 2QD1A 5HDQA 2FCAA 5JZSA 1U8EA 1VL5A 5NLLA 2O8BA 4B80A 3DCYA 2OGZA 5LYYA 2W70A 5DHAA 3JZFA 1KJ8A 1SFRA 3ELUA 4JLKA 3EXAA 4KLCA 4TV9F 5JTUA 2JCBA 2XWPA 1H9AA 3KCNA 3UB4A 3GAMA 3WIDA 4NCAA 3CX3A 4R40A 3IVMA 2F17A 4O63O 1FYEA 3A6DA 3AB8A 4LRQA 4PS0A 4EYGA 3NJRA 1QF7A 3C0KA 3ITNA 3KZKA 1FRZA 4EW3A 4B82A 5F73A 3IQZA 3G0DA 1RLMA 4BASA 4WZBB 1NKTA 1AZTA 1PFKA 1Q7EA 1RWMA 2IYXA 1RYYA 2YIJA 5E9QA 4BFSA 1U4NA 2YVUA 1WUHS 3A1SA 1RMTA 3BRQA 2QRJA 3HCNA 5E7QA 3U9LA 1LI5A 1IM5A 3LY8A 1WVMA 2YJTD 3K05A 1IHYA 3UT5B 2EFCB 3IALA 3W8EA 3FKIB 3S7ZA 4CUZA 4L0CA 1NTOA 3M9XA 3OAAA 3HM2A 4YQEA 3QPVA 2O6HA 5K8TA 4TMVA 1YS9A 1PZMA 1RIFA 1ZGJA 1NFQA 2PZAA 3LVBA 3QMVA 2C4TA 4OSPA 3SK0A 4AMYA 3C14C 4HB2A 2CL5A 3GRKA 4GPZA 2G7ZA 3SPXA 3SIRA 2CMKA 3INGA 1T35A 4R8LA 2Q7OE 4LC1A 2CFTA 2X2EA 2HNBA 1PR5A 4UCQA 1J0XO 3F6SA 4CF5A 4CU5A 4MLZA 4JI4B 1PBTA 3VHQA 2JW5A 3AM3A 3U3XA 5HKKA 3ND6A 2NNLD 3PFHA 2B83A 5HIMA 3HI4A 4NAVA 2QTMA 3I2FA 2JIPA 2X0JA 3RVPA 3S2EA 3VNSA 2WY2D 1H6CA 1T9CA 3JQGB 3KZMA 4KPUB 1N1DA 3M6FA 2EJUA 4YH1A 3KWFA 4LG1A 3QKRB 1DIHA 2W2PA 2ZAYA 3P94A 4F60A 3ISJA 1IVYA 3LBNA 3MSXA 2DECA 4NDZA 1NM5C 4QYIB 1HYBA 5COBA 3AHHA 1R0BA 4C5CA 5JQWA 2ON6A 3B5JA 4I19A 2P69A 2PLRA 3E3OA 3GTJB 4RD2A 2X0RA 1R27A 2B5WA 3WJAA 1N77A 3LXRA 1CFJA 3GJYA 3PS9A 4B45A 1J0DA 3WLQA 1CLUA 2E4XA 3KSDO 5LOVA 3R6WA 4RXTA 4WBNB 4ZN6A 4BNVA 3IR7A 3GDGA 2YW9A 5JYCA 2AQKA 1WULS 4GPD1 1L4LA 1CEYA 1TZ2A 1Y9EA 2HB6A 2BI4A 1ZBQA 2D2XA 3VO8A 4F7DA 4A2CA 2OVBA 3W2EA 3WKDA 4FOSA 1A9ZA 4E3WA 3H4MA 3PFFA 4PIVA 4U02A 3OQIB 3QKSA 1RXEA 3PO3B 2EATA 1GKYA 4M3NA 4HKTA 5IDXA 1DIBA 1FMLA 3BH7A 2VWHA 3TTYA 4BU0A 1DT3A 5FI5A 2JBAA 4J3FA 2YV5A 3ULKA 4TGLA 4D45A 4V1CB 3TRJA 2AS0A 4OM7A 5TDHA 3LA8A 4WUVA 4X6LA 4ETWA 3EH1A 3O0TA 1EWRA 2AEJA 2G77B 3VTFA 2EKPA 4D97A 2H7VA 2G4VA 4J8PA 4TSFD 2IF2A 4TV8F 3N5CA 4D56A 4DCNA 1ZD2P 4TKUA 5EUQB 2C8JA 1V25A 3I45A 2TMYA 1LI4A 2HIMA 3WGHA 5C2JB 3RC7A 3HXPA 4PLZA 2IEGA 2RI0A 3SHFA 4DLAA 1V41E 2AYZA 2OLKA 3R0QA 3FMVA 3HBFA 4QDXA 1H5NA 3PWZA 3UM9A 1YB6A 3VPFA 3IUMA 3SJUA 4MVJF 4AF6A 3MOGA 3WQRA 2AX4A 3ICVA 4MUHA 1ZK2A 3BCSA 5LA6B 4EG5A 2QL9A 1ONOA 4Q47A 1WZ2A 1CY2A 3ANXA 4RKRA 2VDJA 2Z9CA 1F6DA 1E32A 1M8KA 4JP2A 2RHHA 2WUEA 1MOPA 2AMLA 5TX7A 2XQFA 1MDFA 2R00C 3EEYA 2EGUA 3BE5A 1E9BA 3T41A 1WS6A 4RDIA 4B6QA 2IXGA 4BGDA 2XCUA 1N2CB 2BMJA 1TEHA 4HGZA 4HN2A 4NONA 4A8TA 5AK4A 3V8NA 4ZOEA 1M6VA 4DIMA 1FTNA 2AMVA 1AQJA 3EPLA 3OMXA 5IK2D 2BGUA 4R6XA 1OAOC 1PVVA 3I23A 5BQ3A 4ZAZA 2AF4C 2JLWA 2PJUA 2D74A 4QIHA 3OBBA 4C4XA 1BE1A 1XEWY 1D7AA 4HYTA 5CT9A 4ZO8A 5IDVA 4DA8A 3U7EB 3UA3A 1UH5A 2PA3A 1HEUA 2OZVA 3G2OA 3HKCB 4I3FA 2WMDA 3TE6A 4UHHA 1OFVA 1A9QA 3P9NA 2JFGA 3AVWA 2J9RA 1FK8A 4BIIA 5FIUA 3LH5A 5J2TF 1FU7A 1Y8QB 3EBPA 2QVXX 3EODA 1XJCA 5LQNA 3T9BA 1SD5A 3C8HA 3PC6A 4B5LA 3WLPA 4JB8A 4UNIA 3MZ0A 1D4FA 4J0EA 1KY4A 1T15A 2QB5A 1A82A 6REQA 2IQ5A 2HBQA 1Y9DA 3O8OA 5C4XB 1XZEA 1XAJA 4AG5A 4O5OA 1W5SA 1EX7A 4R8KA 1ZA2A 1SKBA 4TL7A 5KSWB 1HDOA 4X6XA 4FE4A 1ZC4A 1Y1VB 4DR2B 2XKAA 1HLGA 1P7WA 1PR4A 4UC0A 4ZVKA 4DSUA 4RCVA 1MAAA 2J9ZB 3IERA 3M1AA 4J03A 4N5MA 2QJRA 1UPFA 3GJXC 3IILA 3JVDA 1HO3A 4PXSA 4BJ6A 4CKWA 5ICCA 1TDJA 4BKQA 4OM8A 4CGYA 1M72A 3TN7A 1PL0A 3FVQA 4C2AA 3ZX4A 4K6MA 3BFXA 4LGYA 2RE8A 3UPTA 2DB3A 3S2HB 3TLGB 4M0EA 4WXEA 4KXNA 4N8EA 3RT1A 2BF4A 2H4FA 2EP5A 3WNQA 1JZQA 3AJEA 2BRUC 1VYTA 3Q8XB 4JHLA 4AG6A 1ULAA 2A5JA 3H2JA 2DWPA 4A6DA 1LPSA 1L5MA 3UHPA 4QDKA 1PZHA 2XGSA 5IBPA 1A69A 1L5HA 4QM6A 4F3TA 1ANKA 4IG9A 3RKSA 1JU3A 3KYDA 3ZK9A 5BUCA 2HIHA 4MEAA 1HUQA 1L9KA 3EGDB 4M9QA 4QX6A 4WX2B 1YSCA 2I7VA 3PXAA 3HS3A 3V4SA 3QXGA 3LX6A 5IM4A 1QV9A 1TB4A 3NJ8A 4ZOCA 4IHQA 1JS1X 5IARA 3MWLA 1JP7A 4Q4JB 1Q7TA 1VPVA 3SC3A 3O31A 2AD5A 4FKZA 4JUDX 1XCMA 1FRNA 5TVGA 4BZPA 3H2GA 4L5AA 4I4LA 1YJQA 3N86A 1EBUA 4QEZA 3TK1A 1NYQA 4BPBA 2YYYA 3AERA 2AFHA 4DWWA 5IH3A 3TBKA 1HLFA 3AEZA 3PUHA 3SDBA 4FI3F 4NU6A 3T15A 3GLGE 3WY9A 2H63A 3OHMA 1VLMA 3HJNA 2WUWE 1NT2A 3M2PA 2CL7X 3PLRA 2XVMA 3O73A 3EJ6A 4YROA 4ZO6A 1GO2A 3ZXYA 2R7KA 2WKRA 1LSUA 3TUZC 1BW9B 3USES 2B1GA 4UFOA 4A73A 5B55A 4YRKA 5KZMB 2NXJA 1BXZA 2OECA 1JEEA 1N7JA 3ED1A 2FWIA 2NT3A 2QD4A 2XUHA 4F3NA 1EX1A 1I01A 2Q0SA 4X3PA 4CM9A 5JUWA 2JLVA 1XN4A 3B78A 1JHOA 1PLJA 3GQVA 1X92A 4L0QA 4ZVMA 3ZK7A 4B9EA 1E1DA 3L7DA 4EDHA 2SHKA 3KOUA 3O21A 5L7WA 2G40A 1SELA 5B5SA 4RNCA 2I3DA 1I7NA 1UCFA 1R6TA 1E63A 1BSVA 1I8TA 3M5WA 1X9HA 2CJWB 3AW8A 3QBTA 4EGCB 1GG5A 4UHJA 1RYEA 1ZX1A 1E3MA 1GPJA 4BX2A 4L8VA 3A6HA 2HZ7A 1E6KA 1ZOLA 4DCOA 1ZUNA 2XKBA 4DZRA 1M8FA 1GZSA 1OXMA 2FMIA 3HZRA 5JPIA 3INYA 4DWVA 5AW4A 2CV2A 3LO5A 3EAFA 4DR4B 1GNSA 1W4CA 3GJSA 2XVZA 4KBFA 2V45A 3G0BA 4OGKA 3GQBB 1KOFA 1HE1C 4RQUA 3V1KA 3T5AA 1NUTA 2IP1A 1R6VA 3C4VA 1Q6ZA 4Y7CA 3G02A 4HP8A 4I55A 2LCIA 3MJRA 1CQZA 3DFFA 4KACA 1JHYA 3M6WA 4F3CA 2J46A 3RBXA 3VSCA 1A2BA 1HX7A 4OL9A 2WYHA 2JL1A 1I6KA 2X8JA 3O8RA 2CFSA 1NR5A 2I2DA 3V1NA 2V59A 3EFOB 4P9NA 1GM5A 3NM5A 4V0QA 4MW4A 4D8TA 2PUEA 5FL7A 3TRKA 5AJYA 3AR3A 5HPYB 1E5XA 2Y6VA 3QVWA 2IRWA 2XSZD 2ZYHA 3C3XA 4FXPA 5H80A 4RKFA 1T2AA 1UM8A 4W8HA 3QVOA 3IAEA 2D7JA 2WJ6A 4Q7LA 2WAYA 4YIHA 4PQYA 4XWKA 3QUBA 3INTA 1JTVA 1L7VC 4I50A 5KYKA 3H16A 4XVUA 2ZCVA 2DBQA 2KWIA 3P2KA 4JIGA 2Q3CA 4AF8A 2PX8A 3QUTA 1GYPA 2CJYA 2V9PA 4BVLA 5KU7A 4CN8A 2FDXA 3DWFA 4WDRA 5ALMA 3K5PA 2O8DA 4R1NA 4BY7B 2WBLC 3A27A 3VNVA 4O1MA 3L06A 1RRKA 1U3GA 4TVOA 1P2UA 1XTIA 2CXOA 2C4UA 2BBWA 1I3MA 2ZSJA 2ZYAA 2YQ4A 4KQEA 5CCEA 1KWGA 1UK7A 5MHTA 2OV6A 4GQAA 4M1TA 2ORED 3S8MA 1YFLA 3BB3A 5TR9A 3DVLA 2GESA 1FYFA 3HP4A 5J43A 3FCAA 3HN6A 1DBWA 1TVKA 3H8VA 1RS0A 3IRVA 3IDFA 4OBEA 3FPGA 1QBGA 1DIRA 2RHMA 3JWIA 4G4JA 4M1KA 5KNLA 2VPZA 4IGKA 1QIHA 5L7YA 3M5PA 4ZICA 1T1JA 1P5JA 4G63A 1N7GA 2GEJA 1VG8A 1DKPA 2QLNA 1DZIA 2X6RA 3EW7A 3IT3A 5IMBA 3G9UA 3DO6A 1YNSA 1JLRA 4JKIA 2HSDA 4MVCA 5AESA 5BVHB 2P9EA 5JCPA 2ZB2A 1W4LA 3LC0A 4HGOA 4ZT4A 1AV6A 2G71A 3FCEA 1A9SA 1OBFO 4XWYA 5IAEA 4FKBA 2F3QA 3UW1A 4YXWA 2PK3A 1VCIA 2V7GA 4TTRA 1JIQA 1UBMS 2ZM6B 4Q3BA 1WPQA 3W4IA 2VJYA 1J99A 1YUBA 2RKBA 3ACBA 1TPZA 4INZA 1YJAA 1BKDR 1P7PA 2PL3A 3GPIA 1KBOA 1WZEA 2BMWA 3HCRA 3UANA 3ZWVA 1QC5B 2LCFA 4I81A 4O4JF 4ZGGA 3OHSX 3DONA 1UFQA 2WFAA 4KO3S 4WECA 2G9QA 1VE9A 2CXRA 2IYRA 2JS7A 3UA4A 3PGVA 4MI1A 4MI6A 4LJLA 1RKQA 5B37A 3UMSA 3IESA 4RF2A 3V2UA 5KQRA 4D0NA 4KO2S 3L0SA 4XB6B 1NU6A 2HOQA 1NBWB 4YAJA 1UZUA 1CZRA 2OCYC 4J1SA 4LX0A 3ZGOA 2AG1A 1XZPA 3LCMA 1EFRA 4J6EA 4BGVA 2FMXA 2B9EA 4U2DA 1E9CA 3E7XA 2OAP1 1R0KA 2MR5A 4ECAA 1P3Y1 1ZJ4A 5EXEA 4DV7B 3HJRA 4NJEA 3VMFA 1EVIA 3MT0A 1C4OA 5JCZA 1DTWA 3SC4A 3LT4A 4J0JA 2CD7A 1GSOA 4X3CA 4JK3A 2QLLA 3DZIA 3PX2A 4LHXA 5JZOA 2CUZA 4F2HA 2Z4TA 1I4EB 2GTIA 4DCTA 3JQ9A 2P9CA 4PZAA 2IC5A 1XQXA 3DE5X 2GBLC 3ENWA 2C8VA 3K35A 3L8EA 4OF4A 3ZGLA 4J6FA 1XKXA 3DE2X 1CJVC 1MXHA 1YMUA 2WD7B 3BXGA 3KP1A 1RW4A 3PPXA 2J5QA 3PQ2A 4YCDA 2CVZA 2VWQA 3GLGB 1WXXA 4WKPA 1IAVA 4MDHA 1QKJA 4ZKDA 5EEHA 4GR9A 4NCJA 1L6IA 1NN0A 3A9CA 4HAYA 4B46A 2DHQA 2OFPA 5DTEA 2CLDX 4TZ6A 1J8MF 3C3EA 2ZWPA 3B12A 3UGKA 1PK9A 1N2IA 5LZ5A 1AA9A 2I03A 3ORYA 2O7NA 4RETA 2RKWA 5HKKD 2BISA 4QM7A 4L9RA 2FLKA 3KO8A 1NVKA 2DUJA 1E99A 2ZT8A 3DZHA 2OUIA 2GK4A 1T10A 1ZD5A 2W00A 3GDOA 3OIFA 1WCMB 3IB3A 1PN3A 2EKZA 3VR4H 4DLXA 4B4WA 1GZ5A 3VTAA 1UC8A 2EIXA 3ZVRA 4IIGA 4EK9A 5CDUA 3K71B 2E2HB 3P96A 4LVCA 4JU9A 2RIRA 2WVJA 3SZ3A 5BSHA 1SIWA 3B1VA 3IQFA 5DNYB 1H3EA 5B2EA 1K5GA 1BROA 5B57C 5JT1A 1Z63A 1RRCA 2Y9MB 5K6AA 3BC1A 1QVZA 1T25A 1YACA 2AW5A 3FUVA 3KFVA 4GUAA 3VYTB 4F11A 3K1YA 3FIJA 5AKGA 2XB2A 2ZP1A 3CWZA 3VPBA 4TLMB 3NLLA 3WK7A 3OOSA 3NTUA 2W98A 5KSZA 1ORRA 3S7TA 5CB8A 6YASA 4JXXA 1JB9A 3A2NA 4OIMA 4DM4A 2XGGA 4HUQB 5LL6P 5IVHA 3IB6A 3NASA 3TTWA 5BRJA 3RHZA 1M7GA 3W5HA 1BDJA 2FE1A 2JCYA 3BXXA 3C85A 5K45A 2XW6A 3O8CA 1ZZGA 1UJBA 3GGPA 4GVXA 5JD3A 1Y1QA 3S29A 1E6LA 1JA0A 2O2CA 4LCEA 2QL5A 3L1HA 5BYJA 1RHMA 1FCJA 1D6SA 3P2OA 4ZO9A 5D5QA 2JFQA 2IGTA 2Y1LA 3EEQA 4WN9A 2IITA 3IAS6 4JVMA 3OTWA 1HZJA 4X64B 2LXNA 1SQ5A 1T4GA 2ZIWB 4DPLA 2B8EA 1J56A 1JAHA 2V4ZA 5GM1A 4EI8A 2JA7B 1DFHA 3BIOA 1JVBA 4WNAB 4ZHQB 3FLBA 2H92A 4N3CA 3SWWA 5U4QA 4G6ZA 4LYFA 5JDIC 3BTOA 3VM6A 2BCJQ 2MR6A 2R44A 1W47A 2VWGA 1N6PA 3H86A 3G0IA 3IQWA 2ZRFA 4YDSA 5M3BA 4V3BA 4I1SA 3UXEA 1E5QA 1THTA 4HPJB 2JIBA 3WIOA 4Y2QA 4W5JA 1K0UA 2WJGA 3FTNA 4AN0A 4N48A 1P0QA 5JXGA 1F3LA 4LDQA 1LB1B 4D46A 3JALB 4TXJA 4YMHA 2CDRA 3IUJA 1NY6A 2ISSD 4ID3A 4RZQA 1I50B 1KY5A 5FQOA 2JLSA 2GZMA 3S2UA 4ARUA 1P6QA 2BGIA 3H6KA 3EMKA 3DB2A 3U4IA 1ZGHA 2OOSA 3HN7A 1ZVKA 4QUIA 4RXMA 2WP0A 3K09A 2JEZA 1WR8A 1EFKA 1BS2A 2X5JO 1OV6A 3FMIA 4UU1A 3M1LA 3O91A 5TSDA 3V8BA 3AR9A 7AT1A 4FFMA 3HZZA 3IPLA 1O4WA 3R44A 4FI3C 1TF2A 3F9IA 1NLYA 4NE2A 2P8SA 3QBEA 4XQ9A 1P4SA 3AEKA 5FTMA 3DEIA 2PS0A 3H5AA 3FHLA 2D2FA 4JUBA 5EL0A 1YDEA 4MUNA 1JJFA 3R3YA 2NXWA 5D8DA 4LDAA 2D8AA 1E2LA 3WNCA 4MQ6A 3BFJA 1NONA 4O5AA 4EEXA 5F7JA 1Z4LA 3B13B 2ZRGA 3IAXA 4WK2B 5JH7B 2AHOA 4FYPA 4UCXA 4A0HA 5FO1A 1G38A 5EQJB 3BCRA 2FVYA 4KMMA 3QQPA 1M83A 1I9CA 4CEHA 3IXLA 5EE3A 5KHAA 1QO0A 5ILQA 3EE6A 1Z37A 4MR8A 1OY1A 3Q7EA 2FU5C 4LW8A 1E2NA 3FTPA 1QIDA 1GARA 2W48A 4D3SA 1I24A 4HOYA 3ZXXA 4GZ6A 4TLDA 1DV1A 1NJFA 1YMVA 1Z45A 2C3MA 3SS9X 4LZNA 2XOKA 1WB5A 1E9RA 1M1NB 2ASEA 2BC9A 1DB3A 2GNOA 4MQMA 4WFIA 3P32A 4X45A 2I76A 3ZI0A 4LXXA 4BV3A 3QWBA 4KFTA 4RTNA 1IIRA 3D8BA 1AXRA 2EBWA 4O2AA 4TQAA 3I3OA 4WKGA 4XGKA 4FGKA 1KORA 4BXOB 2ODNA 1U3DA 3GRVA 3MOSA 2QZ9A 1FXUA 4C0QC 4FBGA 4H16A 4ZPJA 3K4QA 1W85A 2WQZA 4V0MA 1LY1A 4ZJPA 1EFAA 5A7FA 4Q1DA 3FOFC 1QH8A 1UM9A 3EZ9A 3I0MA 4RD6A 1URPA 2Q2WA 4PYRA 3T54A 3LZ6A 1RYDA 4F12A 3REGA 2BFBB 4D5GA 1U3TA 5H3HA 3D5TA 4FMPA 3GJ3A 5EJ6A 1WQ3A 1PJ3A 3ZLVA 3P9RA 2ZTVA 1QGUA 1S3FA 3BCHA 2PV0A 3OX2A 1QHFA 2GN2A 1DCTA 2HWYA 2C5SA 3DMDA 4EB8A 2VUIB 2MIIA 4DR6B 3N8GA 5AICA 5JLAA 4Q7QA 1PS0A 1NSTA 2FKNA 1DKLA 1TIPA 4KIWA 5F12A 1N1GA 1H2AS 1TC1A 1XAIA 1BKYA 3GLSA 4PGAA 2O2SA 1HMYA 2XMZA 2HA2A 3WGLA 3WV5A 1ZW1A 3ASUA 1T4CA 3MILA 5KOHA 1D04A 3T3PB 4AJNA 3LVRE 1U9JA 3QEOA 1GFIA 1VIMA 1WDKA 3I39X 4JT4A 2H17A 4OYRA 1OB5A 2IE8A 3ZY6A 1NP6A 3H9QA 4MJXA 1EBBA 2Y1CA 4JC4A 2ZUWA 3W4KA 3ADKA 3PVCA 2B69A 3R5TA 1J25A 1CE8A 4P33A 2PGOA 1IG0A 4TM8A 4FLEA 4KSYA 2HFJA 4JASB 1ZPDA 1ULZA 4V3CA 4YA6A 1E3DA 4LWOA 1RMYA 3GA5A 2J41A 5AHXA 1SU8A 1TMGE 1Z3IX 3PE3A 2R92B 3BMNA 2H54A 3VMMA 3Q0IA 3VHXB 3WK4A 3ENZA 1DU4A 4F72A 2I78A 1QZXA 1VLLA 3U1BA 4OQMA 3B60A 4H27A 4A1FA 2WU1A 2W4IA 2C5GA 1IPFA 4EECA 7ABPA 5ALTA 4RJKA 2GCPA 3V1YA 4JCCA 5ALLA 4MJLA 4U6NA 2PH3A 2V5UA 3D59A 2O0JA 3VR6H 2FLWA 3OOYA 1G8PA 5KTTA 1NP7A 4MZDA 1VSBA 1B2LA 1MD9A 1XCLA 3RVBA 5BR1A 4LBYA 2OG2A 3PZBA 2RHTA 1YOVB 2ID4A 2IOHA 3N3AC 3QA9A 1OREA 4N0DA 1JLSA 4BMYA 3GW8A 4QRDA 3RTAA 4X5OA 3UOAB 5LDHA 3AKZA 5E1MA 3TMAA 2Q6KA 3AETB 4E46A 2QRQA 4IO0A 4PF1A 5JXHA 4NZNA 3I1FA 5EN4A 2PFSA 3PT5A 3E81A 2HMTA 5E4JA 5FWXB 1QHHB 4LECA 5A9TA 1HT0A 4BZWA 1ZLYA 1GCUA 2VJKA 4D82A 1IMOA 3IV9A 4G0WA 2ZT5A 2QVYX 3AF6A 1Z5OA 4QUAA 1RQPA 1IXKA 3UJ8A 5LBTA 3EZFA 3CVUA 2BFDB 2IDMA 3T1TA 1O97C 1RJDA 3ECCA 4D3ZA 2IYYA 5EPUA 1SVKA 4PCAA 2I2BA 3SYNA 3CH6A 3L77A 5FNZA 3NHBA 2P27A 3GVHA 1NY5A 3SNHA 5LZ9A 5HDBB 4C4YA 3PX7A 3AXTA 2HQBA 5KKNB 4TMZA 4LYYA 3OCWA 1QHYA 3OJFA 3R5JA 4TXHA 2QUJA 2A4KA 2I7DA 4K86A 3ZQJA 1UUFA 2Q6OA 3OC6A 4OU4A 3PLNA 4MQ4A 4MWEA 5LQMA 8MHTA 2GZ1A 3FTCA 1MRSA 2IYNA 1N8SA 1OH6A 2YOHA 1R12A 4IXTA 2A9QA 3EA5A 1Z38A 5I8ZA 4JBWA 4B3FX 5LZ2A 5IVKA 3BE4A 5B1IA 1KYZA 1YAJA 2RH9B 3KDPA 2VJBA 2ACKA 4HZGA 3W1VA 1QGAA 1TIKA 3OFSA 1O8CA 4JT2A 1H65A 5EFOA 4BTEA 4EAQA 2JZNA 4ML3A 1IDOA 1JMVA 1OJ7A 3EUAA 4BNIA 2II6A 2UUCB 2WKPA 2OL4A 4YMTA 3CYFA 2TSYB 2V3WA 3EG9A 4MGYR 4TUYF 2VZ8A 4X8OA 4WBXC 3ZIAA 1DDOA 1R0XA 4ZVUA 2JFUA 1RQLA 3B85A 1FS6A 4KCGA 3V8MA 1N9KA 1GAQA 2H31A 1CC1S 1CDZA 1PT8A 2DU8A 1J1IA 3LRTA 2BTQA 3K4HA 5ER6A 5FEMA 1J4AA 2I6QA 3GFPA 4QLOA 3TQCA 5B6JA 2VBCA 1KRHA 3IKMB 5B1HA 4CKEB 3OQMA 5TQVA 4ER5A 3OLXA 4Y9RA 5KYVA 4PSVA 2JJMA 1U8TA 4D9JA 3G2LA 3SS8A 1F17A 1L5VA 2OHGA 1K7YA 2Z2XA 1K98A 1NDUA 5G02A 3NWJA 5DI3A 3SIWA 4K9MA 1K27A 5CT8A 2SECE 2I8CA 1FFXB 3SR0A 4JC5A 3G7UA 4JQYA 4YYZA 3KPVA 3B6KA 5E4TA 4IUYA 1JZTA 4HI0E 3ZH2A 4A2WA 4YRZA 4Z7NB 3LC2O 1F4LA 2FFRA 3G13A 3OP1A 5EP1A 4YV7A 3KDAA 4ZJYA 3N1UA 2EF1A 3OIGA 1NI4B 1T9KA 5AOVA 5DW3A 1O6FA 4QXOA 4PR3A 1COZA 3NBXX 4IYJA 3SSAA 4U3JB 2E6UX 3GEDA 1MJ5A 3SI7A 2E1RA 1VECA 3EMBA 5CYOA 1MMFB 1SB8A 1HYQA 1VFNA 4YHHB 3VSEA 3KJGA 4AJ2A 2YW2A 3FW1A 2AN4A 5FWAA 2C4HA 5JJIA 3WLFA 1MPXA 2H0AA 3IYLW 1DKUA 4MNTA 2YKGA 1IEWA 3DM5A 3MWYW 4ND3A 1H1LB 4V02A 3MRSA 2NO5A 1EFRD 4WHMA 5FPTA 1HA3A 1OXTA 2RHCA 3IEIA 3EXEB 5JTTA 3VKGA 1XEAA 4S24A 3ZJ5A 2PZ8A 5BRAA 2CCKA 2BFFB 3OPXA 3RTGA 5MN4A 4NE9A 3A4LA 1S2IA 1Z75A 2BWJA 2VPIA 5KQGA 5I9TA 2ZJ5A 4X95A 1E6CA 1V3UA 3WDKA 3F3MA 3QE2A 3HUTA 4BUCA 5KVCA 1SXQA 1TK3A 2AOTB 2OENG 1ZNYA 3K1AB 1CZHA 4OFZA 4WOBA 4QHTA 1EXWA 2DUMA 2PD3A 1KOLA 4JX9A 4HVLA 3TDNA 3I34X 2PUDA 1IU9A 2QAGB 2ADFA 4OLAA 5JSYA 4MVJD 4OHUA 3W05A 4C7JA 3ONDA 2VUTA 5CDGA 3NBUA 1YL7A 3C70A 5CYGA 1GG2A 3MT7A 4G8DA 2PMKA 2NV2B 5B4UA 1FP4A 5JDCC 2CJFA 1TYBE 3A05A 3V00A 2BP7B 3FOZA 3NFYA 2NVXB 1LF5A 1QLJA 2O0MA 3C48A 4O4HA 2P6RA 1I3NA 2VNHA 3PYLA 4M22A 4X85A 5JSZB 4BLRA 1E6UA 3O0DA 2HX1A 3ZXSA 2QGZA 1NSFA 3LQRA 3EPJA 4POAA 1WDLA 3ENVA 1N0VC 1V5WA 2QDKA 1U0RA 3YASA 2AFRA 4I1UA 4HDSB 5E9JA 4GPBA 4RF5A 2DPMA 4UBLA 4XLLA 3CIFA 3W3ZB 1Q1AA 2PKEA 5H81A 2CMFA 4KIFA 2WVGA 4DQUA 4ZYVA 4LF7B 2NNWB 2A0UA 4F5ZA 2IUFA 5ELLA 4EFLA 3UW3A 2B78A 3T9FA 4LVUA 1JHMA 1GZDA 2PH1A 1IZ8A 2R97A 2ZK7A 3JCZA 4CJXA 2ZFUA 5CVTA 1YQTA 1E4EB 3E03A 3WA6A 3ROPA 1XLUA 2XHEA 4Y6GB 2AR9A 1U7DA 2FVXA 3ZOZA 4ZCLA 4B84A 4FFDA 4DILA 4QJ3A 4KSCA 2E5LB 4CF7A 1XALA 3QLEA 1X1EA 3PXEA 2YCBA 2AI1A 3U3ZA 4A8JC 5HZMA 1AQLA 2CZCA 2XUKA 1TJPB 3EPRA 4NPHA 4FGUA 4O3MA 1G60A 2DAPA 2QZ4A 3BAFA 2HU2A 2V98A 4FGJA 4M86A 4CNQA 4KJZA 5M5XB 1FUUA 1IXRC 1E69A 1V5EA 3PXXA 4FR5A 3T3EA 3ICQB 5E38A 5JOQA 1NI5A 1KDYA 2X5KO 1U2GC 2F00A 3OQVA 5AJHA 4PX3A 5KB3A 2EQ5A 1ZJYA 2Q4RA 2R8ZA 4XQCA 4BP1A 2OB1A 3KD2A 2HNAA 4G01B 4LV5B 1BMTA 3IC5A 2HHAA 1XE3A 1NUUA 4OAQA 1IATA 1NL3A 4RTLA 4Z9FA 1JAYA 5D6OA 4CRWB 4WZ6A 2Z8YM 1CEXA 5L3SB 1DLJA 3FCUB 1Q74A 3PGLA 1NE7A 3CONA 4FJ2A 5IKEA 1UAGA 1RWWA 2VNKA 3NDIA 3CH7A 2XTAA 3OC0A 4IJMA 4RBNA 5MDHA 4II2A 3FKSA 3MGCA 4CLXA 4OX9Y 3FWYA 2W2NA 1RAIA 1K3TA 2I9PA 3I9KA 3KLOA 3U3MA 5KNCH 2NTNA 1GG9A 1M2GA 1PJTA 1ZCJA 4X1KB 5JHHB 1GUZA 1HDEA 4QNMA 1W2HA 3JVVA 2Y2UA 4ASUA 3ZDBA 3IE0A 3UQZA 1M3SA 4BO4A 1YQXA 3EIQA 2RCYA 3L04A 4FDUA 4IEFB 4DV4B 3BXOA 4D4JA 4CQLB 3KPYA 5IRCD 1C4KA 1X70A 2F4NA 1KI6A 2FK7A 1T1IA 1Z8HA 4AIRA 4AZ0B 2WLSA 3TD2A 2I80A 3NT2A 3K0CA 1DSSG 2WG0A 3V4RA 2VR1A 3ZE1B 4ARIA 4H0FA 1KTIA 2C4NA 2DQKA 3GTOB 4MH0R 3RYCA 4RULA 1LQUA 3OT4A 1R16A 4GWLA 4M76B 4Y2JA 5TQ2B 5IYZB 3ZK8A 2AB0A 3BWMA 3IOYA 2ONZA 1OXKB 1IQUA 1L8AA 3QJGA 3F1LA 5DTIA 4KYVA 1R50A 1ZL0A 3RGGA 1I2DA 1WUYA 3S2FA 3G0HA 1U1EA 5AFSA 1OI3A 2XBLA 3C3DA 3HOUB 3TZLA 5KAPA 2YN4A 4J76A 5TGZA 3E8SA 2J0UB 1F0PA 3GPCA 1Q0PA 4N39A 4OK6A 5ARCA 1RTTA 4Y1GA 4BLWA 4CUJA 2FFHA 4EIWA 3JY6A 3QZUA 4RCZA 1LX7A 5CBKA 1JQJC 4ENRA 1RE1A 1V9SA 2GF0A 3F6CA 3L6BA 4GM0A 4UM7A 1MQSA 5SY9A 3ONWA 2Z8XA 1D09A 1M6WA 4IO1A 3WRYC 1N8TA 2C82A 3BL8A 1YTLA 3R7LA 1Y3HA 5DKFA 3FGOA 4AY5A 1TTQB 5IBRA 1BMQA 4JYPA 3VR5A 5BNZA 5BQPA 1ZJWA 1VPWA 1ZEMA 1KC3A 3CWQA 3FGZA 4ZGBA 3PQFA 4BLUA 1YB1A 5EEGA 3LQ1A 4MIOA 2RDMA 3GV0A 1GZ4A 3KYIB 4QDJA 2WHPB 5B3AA 3TAXA 2ZZKA 1RWVA 4C21A 1G16A 1U94A 1G59A 2X9QA 2OV1A 4F7WA 1AC5A 2F1JA 2RHLA 4V0NA 4DABA 4WRRA 5IH7A 3HB1A 4K26A 5LIPA 5C4JB 1T0PA 1QCCA 5IBQA 3K70B 4NLLA 1XPRA 1Q3TA 1X6VA 2RCNA 3QLUC 5GOZA 2RH5A 3BH0A 3DL4A 4CKZA 3TKAA 3C1TA 3O4FA 3T4XA 1S7GA 2FR1A 3L8MA 1WE2A 4J0CA 3TLEA 3IDSA 1ZO8A 3UUEA 3F71A 3KQQA 3HOWB 4C3IB 3HGQA 1Z34A 4U2GA 1XC7A 1PRYA 2CFRA 4NZOA 2R62A 4MP6A 3RIXA 3C6YA 3GVPA 4IOMA 2OZPA 3A25A 3FDZB 1YR7A 5DXAA 1IB0A 2C5FA 5CEEA 2O8EB 1V9CA 4NR0A 4CMJA 1X1TA 4RDXA 4LXGA 1XFAA 5IULC 1E2EA 2HRDA 1WSAA 4AURA 2LV8A 4DSAA 5I01A 1DKMA 4RWZA 4A16A 3HCWA 2Z8ZA 3I04M 2OM6A 1DAMA 4X54A 4N5HX 2FPGB 1Z6PA 3IVXA 2ZULA 2BEUB 3UFBA 2O8FB 4ENUA 3W90A 2G0NA 1YQGA 4MUEA 1GFWA 2PRJA 2O2JA 4N0QA 3N7UA 3GEMA 4D98A 4QPZA 4L8GA 1PR6A 2A6PA 2EF0A 2XXAA 2VFAA 1Z2AA 5EZYA 5T5QA 5K7SA 2IZ0A 4PG4A 4BN5A 1YRWA 5DASA 1YA4A 5AM4A 3AVQA 4TMXA 4GW3A 5AWFC 4I6GA 1EJ6A 2B4AA 4QT4A 2RGWA 1FVOA 1SVMA 4PAGA 5FFNA 2W2XA 2A92A 1LDNA 10MHA 4OV6B 3AJAA 5DOVA 2Q5IA 2R84A 2OP1A 3PUZA 3T7JA 4S1WA 3IMFA 1A2QA 4KIGA 1L4EA 3EEBA 1SPBS 4X7MA 4LOIA 2HREA 2W37A 2YV3A 4YJHB 4Q7EA 1QOZA 3QTTA 4ZT7A 4BCCA 2J3HA 1ODFA 1K5PA 4RNDB 5HIAA 3EW9A 1GZHB 1NQWA 1XTUA 4P81A 4S3MA 4NK4A 1Y5IA 1ZMRA 3N2ZB 1DFIA 4IP0A 4KXXA 4M0KA 4NG4A 5KMGB 1KTVA 4CM4B 1IOZA 2O7RA 4E2XA