2B1RA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with cellobiose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
molecule tags Hydrolase
source organism Synechocystis sp.
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b1rA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2b1rA02
1RQLA 1VFPA 2CFTA 4NV0A 4Y2QA 3SMVA 4XPZA 2RBKA 2VKQA 1RC8A 1S8OA 2X4DA 4YIHA 2YMQA 5ALEA 4BX2A 3QU9A 3SF0A 5IT4A 4YCMA 3J7TA 5AW7A 3AR2A 1Z4MA 1JUDA 2FDRA 5ALUA 4H1WA 2YJ4A 4UARA 3SKYA 2C9MA 4Y2RA 4Y2SA 1J97A 1T5SA 3OTQA 2Q4RA 4UMVA 4MUMA 2JARA 3NUQA 3QXGA 2G80A 4CF4A 1ZD4A 5AVTA 3A1DA 3WGUA 4MWOA 1ZS9A 3R4CA 4C4TA 1WVIA 1Z5GA 1U7OA 2I7DA 3N07A 5ALJA 2YN4A 3BA6A 2PQ0A 1L8OA 3WKDA 4FFDA 3ZTYA 1O08A 5AIBA 2IA5A 3AR4A 3ONNA 2I6XA 2JGAA 3NAMA 3L7YA 4C4RA 4NABA 5AKIA 3CZ4A 1XVIA 1Z4KA 2W4MA 3PGLA 5ALDA 3QNMA 2HDOA 5AW6A 2AUTA 1QQ5A 1YMQA 5AW0A 3U19A 1ZRMA 3PGVA 3I28A 5AVQA 1N9KA 3FVVA 4ZEWA 2YBDA 3R9KA 3QU2A 5ALVA 2OA0A 2AH5A 4CNQA 2GO7A 2O9JA 4NAVA 2MU1A 4KYTA 3SKXA 3U13A 3M1YA 2Q5EA 1QQ7A 3AR3A 2HSZA 3ZWKA 1FEZA 2HO4A 4HGPA 1Q91A 4JDPA 1NRWA 1QH9A 3AR5A 2WFAA 3L1VA 4BNDA 1TJ3A 3SD7A 3L8FA 4YIKA 3L8HA 3ZVMA 5T41A 4OD0A 3BWVA 5AK6A 4NWIA 3ESRA 3FZQA 1Z4OA 3U7GA 3FPBA 4BX3A 5JJBA 1L6RA 4KNWA 3HLTA 4EZEA 2CFRA 2I33A 3WGVA 4EX7A 4F71A 1CQZA 3DAOA 5AI8A 3E81A 5AK5A 3OCXA 3FPSA 1LVHA 3KZXA 3GYGA 1Q92A 5FP0A 5ALTA 2FPXA 1XP5A 1TJ5A 1RDFA 5AW5A 4UW9A 3U7EB 5ALXA 1RRCA 1RKVA 5ALFA 5ALHA 2HOQA 3NRJA 1QYIA 3WK9A 4EEKA 3ET4A 3PCTA 3W5BA 2YJ3A 3MN1A 4G9BA 1L7MA 2D2VA 2QLTA 1T9ZA 3WKAA 2DQSA 1TE2A 3ZW7A 2ZBDA 3S6JA 3B9BA 4Y2TA 2HHLA 2G09A 4DCCA 4GXTA 2ZG6A 2WF8A 2EATA 4BNDB 2B1QA 2FPWA 3K1ZA 4DFDA 3W5DA 1K1EA 4F72A 5AIAA 5AVWA 5AVSA 5ALRA 1ZD2P 2FPRA 2B8JA 3UMBA 3WKCA 2OBBA 3NIWA 5AI0A 3M9LA 1U02A 1WZCA 5AICA 2MSNA 4DWOA 1ZJJA 5AKZA 4BYGA 3I1YA 4EENA 3N8GA 1TJ4A 3ESQA 1RKQA 1Z88A 5ALQA 4OCZA 3I6BA 1IWOA 5A3QA 2IOFK 4KX3A 5AVYA 3L0CA 1NNLA 1Y8AA 3KOOA 2FPSA 4UMFA 3MPOA 3ET5A 2YMMA 1RMQA 1L7PA 4DW8A 4AP9A 3OCYA 4Y2XA 3QU7A 2BY4A 2W11A 3ZX4A 2G06A 3EF0A 2OYCA 5AKKA 3EWIA 2YMLA 2JAOA 2R8ZA 4UU1A 3UMGA 3KDPA 1CR6A 4AS3A 5AVZA 4XOUA 3E84A 2WM8A 5ALSA 1RLOA 3U7HB 1PW5A 2EARA 2P11A 5AVXA 4YGYA 1L8LA 1J8DA 1SWVA 2ZXEA 3L8EA 3CNHA 4JB3A 1L7NA 3QU4A 3DDHA 3WK6A 3L0YA 5AK4A 3UM9A 3OCVA 3W5AA 3DV9A 4L6AA 3AR9A 1RPZA 4ZEVA 2FPUA 5ALYA 1L7OA 5AKLA 4AS2A 1N8NA 3IB6A 2WF6A 2G07A 3AR8A 2C8KA 2IOFA 3EPRA 2BDEA 4L6CA 2B82A 2AGVA 2HX1A 2WHEA 1YDFA 3WKEA 3A3YA 3TLMA 1Z4LA 2YFYA 1AQ6A 1EK2A 1TA0A 2YY6A 5AKJA 2WF9A 4RESA 1YV9A 1ZRNA 5AM5A 3L0BA 2I55A 1RLMA 4Y2JA 3P96A 2P69A 3WK5A 2ZBEA 4OFZA 1VJ5A 3KC2A 3QUCA 2GHTA 2PKEA 4HGQA 4FE3A 5AVVA 1WPGA 1WR8A 2FI1A 3N28A 3ZWDA 3SHQA 4I9FA 4UU0A 2BDUA 2Q4TA 1SWWA 5AK3A 3QX7A 4Y2VA 5A3SA 1Z4JA 3UMCA 2G0AA 3SLRA 4CF5A 4OHFA 2YMPA 2FUEA 4HAIA 3L1UA 2CN1A 1KYTA 3ZU6A 3KBBA 2C8LA 2RARA 3OCUA 5AM3A 5ALMA 1SU4A 2G08A 3B8EA 4KNVA 4I9GA 2R8XA 4UM5A 5A3RA 3WK8A 3WK7A 2I54A 3QUQA 4YCLA 2OM6A 2P9JA 3QUBA 4XE5A 2B0CA 5AM2A 4G63A 1O03A 4KN8A 4HYTA 1RMYA 4EELA 1ZD5A 3E8MA 4C4SA 3RF6A 1ZOLA 2HF7A 3R09A 4UMDA 2PR7A 2B1RA 5E0OA 1RLTA 1Z4IA 2YJ5A 5ALIA 3QGMA 4L57A 5AM4A 2ZOSA 4UASA 4BX0A 5AW4A 3RFUA 1X42A 3OCZA 1RKUA 3OPXA 1NF2A 3U26A 2B8EA 4B6JA 3AR7A 5AKEA 3N5KA 4KX5A 4NFLA 3F9RA 1VJRA 1RMTA 3IJ5A 3NANA 3QUTA 1YJ5A 4Y2PA 1YNSA 5AKYA 3N1UA 3MMZA 4BKMA 2CFSA 3OCWA 2NYVA 1MH9A 5AKXA 4BEWA 2EAUA 4Y2YA 4UM7A 2IOHA 5AM1A 5AI5A 5AKGA 1S2OA 5AW2A 2GHQA 3ZI4A 2RAVA 2AMYA 2FEAA 4YH1A 4BEVA 3I76A 5AKHA 5AVUA 2R8YA 4XQ0A 1Z4NA 4ZEXA 4QQFA 2IYEA 2NO4A 2ZBGA 2P27A 2WF5A 3AR6A 3B9RA 5AI6A 4CE6A 4HGRA 5AM0A 4CF3A 3MC1A 2FUCA 3FM9A 3ZUPA 3QLEA 2RB5A 3FGOA 2ZBFA 4Y3UA 2HEGA 1RQNA 5IT0A 3DNPA 4UATA 1U7PA 3ZX5A 3ZVLA 2HF2A 2YJ6A 3E58A 1XPJA 4RETA 4EX6A 4E88A 4HGNA 5AVRA 4UAUA 3ED5A 4IFTA 1Z4QA 4GIBA 4UMEA 2QYHA 5ALPA 4J2TA 2GFHA 2HI0A 3W5CA 3WKBA 2HCFA 5ALNA 5ALOA 5ALZA 1U2TA 5ALGA 4QJBA 3QU5A 5AI9A 3WK4A 2I34A 2O2XA 4J03A 1LTQA 2C4NA 3ZTWA 3L5KA 5ALWA 3A1CA 5AW9A 3HYCA 3D6JA 2NO5A 5AI4A 3U7FB 3QYPA 4O8CA 2G1AA 2C88A 5AW8A 3NALA 2GMWA 5AW3A 4BBJA 1EK1A 3NASA 3KD3A 2JAUA 5AESA 5IS2A 4PNHA 5AHXA 1T5TA 2B30A 2W43A 4IG4A 5ALLA 1YS9A 3EF1A 1U2SA 3A1EA 1QQ6A 1F5SA 4Y2UA 2JAWA 1Z5UA 3IRUA 4FYPA 3ZVNA 1ZD3A 4UAVA 2ODAA 5ALKA 3PDWA 3L8GA 2R8EA 4YCNA 1Z4PX 2WF7A 5AW1A 3VAYA 4HGOA
chains in the Genus database with same CATH superfamily
3FKJA 2FMIA 3DE4X 2R44A 4Q18A 2Q3FA 3DB1A 3PCRB 3VC3A 2C2ZA 2XE6A 3S70A 2VP0A 1KFJB 2ANBA 2KM1A 2OCAA 4D99A 5CDFE 3IAAA 3I9MA 4NESA 2DFKB 3OJOA 2RJ3A 1KH2A 3U4GA 3UUEA 2ZAMA 4U2GA 2AHRA 5KVAA 2R8BA 2SKEA 1EI9A 5KHOC 1KJJA 3JQAA 1CQIA 4MRAA 3DDCA 4ZVQA 3I23A 4GPZA 4I8DA 2GCOB 3D6NB 4EKEA 3NBQA 3AWDA 2ILTA 2BVNA 2C9MA 2ETVA 3QM1A 4YC7A 4X60A 2Z2JA 3MWDB 1EFVA 2GNAA 4ZHQF 2GASA 2QZZA 5A6VA 1P8AA 3ROEA 3ZIDA 4PLPA 1YFKA 1N5MA 4D9KA 1TC1A 4UJ3A 4B3JA 1FMFA 2G8LA 3C5VA 3LQRA 5KNLA 4NBVA 2QPTA 4OM8A 4UCQA 2WUEA 1KE2A 2IP4A 3TD2A 5K4HA 2VBCA 1RC1A 2H0AA 3FXAA 1F3LA 2QZJA 3N8IA 4PYMA 2H54A 5IC4A 1S9DA 4B2YA 2C2HA 3FR8A 3TFOA 3ZWXA 3PNSA 1E1LA 4XFJA 1P2DA 3F6SA 5BN4A 2GJAA 4IDFA 1WB9A 3I9JA 5JSHA 2Y05A 4GR5A 1P2UA 4P4SB 1U6JA 2F1HA 5ILGA 4PPNA 2ORED 1KNQA 3KXLA 3EEBA 5ESDA 1IJKA 3EOZA 1XNHA 3NHRA 4JAVC 3VSAA 4OP2A 5E9QA 3EZ9A 1RTTA 1NOKA 5AQ1A 4G0YA 3ADOA 4MS4A 4QYIB 4B46A 4P92A 5BURA 3KWFA 3L4KA 1MX5A 1SXHA 3KAPA 1KHTA 1T35A 3QNMA 2JGMA 1QB7A 2V7PA 3PNMA 1ZMRA 1VCIA 4OHBA 4B31A 3RZOB 1C4OA 3CN9A 4JWTA 1AUPA 3CVXA 1C7IA 5L9AA 1YA6A 3I8SA 1JDBB 5K8LA 2YHAA 1ZBQA 3Q3JB 3TX6A 5A4FS 3H42B 1U0BB 1DX6A 2I4IA 5B3LA 1EWRA 5FR2A 3E1GA 1FNNA 2L42A 3MILA 5CLIA 3VH3A 1J23A 3NYWA 4M0FA 4WLVA 3SBDA 4EPYA 3VYTB 5A03A 5FKJA 4R1MA 2GOYA 3B52X 4I1OA 3HN7A 3N05A 1Q22A 4MQFB 4IDPA 4ROSA 4AN1A 1WD5A 4NAVA 4L4YA 4KYTA 2XMRA 2XBUA 3HFSA 2PJDA 2JRCA 4C21A 2J3LA 1LQUA 2HSZA 4MITA 4XJTA 3GYBA 3RNLA 4C6HA 1CSEE 2WAMA 4JDPA 4ZAWA 1HYEA 3GW8A 1TF5A 4HI0E 3SD7A 3F5QA 1ORVA 6LDHA 3I5XA 4P4NA 1V9LA 3AEXA 3FRJA 1XQXA 1LLDA 3ES9A 2Q4DA 3SSMA 1U5BA 2AQHA 2GD0A 3ZGZA 4R6XA 5CFNA 4TZTA 4BNYA 3Q8WA 2R48A 2VJLA 3SEFA 2WHYA 2ZTLA 1HDEA 1Y1SA 5C9ZA 3BOSA 5BR1A 4OHUA 2NAPA 4BRSA 3E05A 3DV2A 1Q7BA 1JDJA 3H05A 1YFLA 1OBFO 1RXSA 1RI1A 1C8BA 1XZLA 5BUQA 3FTQA 5LIPA 3QE9Y 5FP0A 3E70C 2P9ZA 3LUGA 3SJCA 4AXXA 3IB3A 5CW1A 4J3FA 1KAGA 2YJZA 1PJCA 1AE1A 2E6UX 1N7GA 2J67A 2PSHA 4NATA 4DOMA 4A5SA 2IYRA 3DAPA 3I2GA 4EARA 5I6DA 1XDZA 5CVDA 1DBWA 2O5RA 2G28A 4AKGA 1IOLA 4FNMA 1MW8X 5KTOA 1PS9A 2YINC 2XUKA 3PENA 2IH4A 1KH1A 3FWYA 5C1BA 5J3JA 4Z51A 2QG4A 3K9LA 3RBXA 2QS9A 1V7ZA 1Z6TA 4A3DB 4HWRA 1I2DA 3KZVA 1DKOA 1GQFA 3TE6A 3RNOA 3L7KA 1NP3A 3W04A 1QRDA 2ZVQX 5DHTA 1Q0LA 1TZBA 1WCYA 3B13B 1NSTA 2NG1A 3O9ZA 3OOWA 1EA5A 4MMXB 2P77A 4YUWA 4ZZ2A 1JA0A 4RFLA 2NZ2A 5T67A 1VRVA 2OHOA 1X38A 1ODTC 2EATA 3D6AA 4KE8A 4M86A 4DREA 1NNSA 2RKOA 4C0SA 2XF2A 3K1ZA 2GVNA 3W5DA 5F7JA 3ETDA 4HBZA 3RZDB 2A9QA 1XLWA 1P72A 1U3TA 1MTOA 4NYIQ 5JQGF 1JAYA 2AEMA 2BFPA 2R68A 4B34A 2UUCB 2G1PA 1IN1A 3EY4A 2X7HA 4JD5A 4I08A 4J29A 2R92B 4OKSA 4BMPB 1GL6A 3K30A 4W9RA 3ORFA 2NQ2C 1PZHA 4TKUA 3KLBA 3Q1LA 3BFVA 4CQJA 5K09A 2C7OA 5H70A 5EIBC 3I9OA 4CM9D 1UWCA 4L50A 4ZKDA 2O8NA 5CLLA 4ZT4A 3UATA 1UEJA 2CLKB 4GGMX 1QGOA 1DKRA 1E0KA 4FCWA 4GKVA 3X1ZA 2IOFK 4LGYA 5AVYA 1YRHA 5C3EB 2FPSA 3IOBA 1GDDA 1WXIA 2P0AA 4KFCA 1G5QA 4ZXPA 3AONB 3OFKA 1K7YA 4GYKA 8ADHA 4CTNA 1M33A 4L0QA 1VI2A 2YRFA 1E99A 4LI3X 1QO9A 2P65A 4YASA 2V6FA 3MSCA 4AKEA 4TRJA 4YP1A 2RHLA 1FXWF 5ICMA 2XEXA 4KQ1A 1M1NA 1W87A 1AC5A 2ZSDA 3IP8A 4J2OA 3HXMA 3GTPB 1L1RA 1M0SA 3IC5A 2HREA 2WU1A 3NV9A 5AVKA 2XI4A 3G9ZA 5FOUA 4I1IA 4IS2A 2PX2A 2O8FB 1GU1A 1N2CB 2DC1A 1AIPA 4KZPA 3KQWA 5JSZA 3EPJA 1EB8A 3F6BX 1B1CA 1CR6A 2EP5A 2H1CA 2HQSA 3PFNA 5I8ZA 4YCJA 3YASA 3UOGA 3EIOA 2HA0A 4RMHA 4XOUA 4JYPA 3HU2A 1R0KA 2PQMA 5B1SA 3UC5A 2ZANA 3VSBA 4MB2A 3ZHRA 1Y1WB 1TYBE 4I1RA 4O2AB 4WW0A 3E5RA 1BMFA 3Q98A 2JIPA 4OH7A 5D3ZA 3AFHA 4B4KA 3KYDB 2Q45A 1DO8A 3NBMA 4JT4A 1PQPA 3T9BA 1SU8A 1V25A 3RS3A 5I8PA 1RI4A 1R0BA 4YUZA 3DL7A 4WFKA 2W6QA 5EHNA 3UOAB 5DM4A 1L3IA 3AR9A 2IOQA 3MW8A 5HYVA 1EWYA 2NGRA 4KAJA 1OH6A 1BDJA 5H83A 3T3DA 3W1WA 1RHKA 5HDBB 1IZYA 4LQDA 2WQ6A 1DV1A 4ARZA 1RYBA 2KE5A 1TM2A 3L6CA 3L7NA 4CU2A 2ZJ5A 5DSXA 3TIFA 4EY7A 1Z2CA 3K6KA 4UDYX 5KU7A 4FQ8A 3AUAA 4BAZA 2CBZA 2JVJA 1E7RA 2X6TA 3M3DA 4F7WA 1A9YA 1NE2A 3JSXA 1S2MA 1U98A 4Q3LA 1G9XA 1WZNA 1CT9A 2AQIA 3CJQA 3UXEA 1I80A 3TLMA 2HA7A 2I8AA 3NPMA 1YHZA 3S2DB 3BMOB 3BTOA 3U9SA 3LHFA 3AVUA 2O8EA 4DA7A 2I3BA 4C6TB 1QMPA 4IBOA 2I55A 2MYUA 4R1LA 2DVMA 4YQFA 2Y0PA 3LX8A 3VYUB 2YQ4A 4LF7B 2IS1A 2V9PA 1P1IA 2PKRA 4KIJA 1WP9A 1YCHA 1EDZA 2Y1LA 2ZPAA 4I19A 1NMEA 1QIFA 4WJKB 1WR8A 3A7DA 1KDPA 2XCQA 5CB4F 3CUSA 3RAFC 4RHUA 4DB2A 1FMLA 1DLJA 3WV4A 1GADO 1PNVA 2WVGA 2R0QC 3F4KA 3I39X 1EFUA 5A9SA 5A7GA 2NVTB 5HFJA 5DBOA 4G5RA 4QDJA 3RC1A 1PJQA 3MBIA 1Q3HA 3MQ4A 4LECA 6YASA 1X14A 3HN6A 4I14A 4C03A 5A9SB 3QG1A 4QTYA 5CCEA 5I7AA 4CBVA 4DCJA 3OCUA 3OZTA 4B7UA 2NTYC 3JZIA 5ALMA 3EK2A 3E2IA 3L46A 4DM7A 1Y5IA 4X97A 1IEWA 3EXIB 5FAXA 3MJCA 1IAQA 4B33A 1XK6A 4NZOA 3QX3A 1CRWG 1FRVA 4II7A 4KLZA 2ACEA 2WJWA 3U1VA 1R00A 4COKA 2ICAA 2V7QA 2WM9B 1U8UA 3FLAA 3H0CA 1NVVQ 1K5DA 1UBTS 1U6KA 1HOTA 4B7AA 2WYIA 4QUEA 4XLLA 1VCNA 5F52A 5J40A 1G6KA 5A4IS 3COYA 1U8CB 5HS4A 1TMKA 1NXWA 5IEBA 1P60A 3LUPA 5K8IA 3TE7A 2J7KA 4BU0A 2F3QA 2YWXA 2IZZA 3D7SA 3W8RA 4BFXA 3MOIA 4CI9A 5LU9A 4RJIA 3HEMA 5L8VA 1TU3A 4MEBA 1BVUA 2PBLA 3O7MA 4LJ6A 5H3HA 1U63A 1Z56C 1AKRA 4R54A 5G1OA 1SHJA 4XQ9A 1Z8NA 1R1DA 4GMGA 4LRYA 2BGNA 2C5GA 1DKUA 2JCBA 5G4KB 1Z0IA 1L4EA 2QQ0A 3F7NA 4EPWA 2Y1DA 5G02A 2FSHA 2XOKD 2FPMA 3C48A 3RIEA 4I1VA 3TCKA 3QIAA 3KQUA 4F9FA 2P2ZA 1GTSA 3EJWA 1RKUA 3L82B 1NF2A 3ECAA 1O4VA 2B8EA 1KI4A 4X9XA 3V6MA 4MV0A 1C4KA 5EJ9A 1CJSA 1HG1A 4KO1S 3VTFA 3IVAA 1S5PA 3G9XA 2FEOA 3G79A 3O3CA 5CIYA 1HQYE 1DWOA 2R93B 5F1YA 3MCTA 4LAFA 1FW6A 4YFVA 1DTSA 1GRNA 3CUEF 4FZ5A 1TUIA 1EE9A 3DOIA 3PSHA 1DG1G 2C96A 4M76B 2ZSUA 2H1WA 4Y0NA 4RDXA 2NVUA 1XPOA 2RHOA 2B69A 2O7VA 1VMEA 3HABA 3VKFA 3MCWA 5AKXA 3RVNA 5CPBA 1V48A 2IUSA 1LEHA 3M1AA 4IH1A 2EZUA 1UBKS 5E3IA 5HFNA 4DLLA 5AI5A 4ZARA 2CDBA 3TQRA 5FL3A 2GHQA 4H3SA 4P6VF 2FUKA 2AV6A 4URFA 4B3BA 3VR2A 1HE3A 2DFTA 1KZ9A 4HFMA 4Y9TA 5AKHA 3REGA 2W2NA 4JLSA 1I1HA 3AWIA 3ICWA 2FX2A 3O1LA 3NXSA 1NN0A 2FP4B 4QQFA 4HD8A 1LTKA 4AY5A 2K2WA 3ZGOA 2G5GX 3CS3A 4RACA 1DEXA 3HCPA 2KB0A 2HLHA 2FP4A 3C97A 4K8RB 4Y6SA 5GV7A 2BMEA 1KDVA 1EHYA 2ZSBA 3V46A 5JR3A 4K87A 3KTAB 1ZCBA 3H3JA 3KKKA 1W76A 2FPGA 2I78A 3LQ2A 4XYBA 3H97A 1PJAA 3WXBA 2YWDA 1B14A 3BGSA 3M6XA 2P68A 2NZ8A 2DFLA 4QGBA 4UAUA 1KHHA 3KPUA 4FQ5A 4GE3A 1U31A 4DJEC 3LI2A 1DINA 2FFQA 2QYHA 1AZSC 3WGIA 1IY2A 2BBOA 2DSTA 1TEVA 3FJ1A 4F5WA 1GILA 2VQSA 2I6FA 2B92A 1YU6A 2PJZA 2FX5A 4OLJA 2P62A 2C98A 5AOAA 3CF2A 2K7FA 1LDEA 1X8JA 3GTMB 3BPSA 3PRKE 3URMA 3CLTC 4U7HA 4HQFA 2ZJOA 4YAUA 3M6VA 4AXBA 2FPPA 4MS3A 2AMVA 4AKSA 5LBUA 3SGLA 4C3VA 4YBRA 2E2WA 1C14A 1KO4A 4S12A 5JARA 1QU3A 3AF1A 4O8CA 5K0BA 3PYXA 5E2IA 3MPUA 3JARA 3KLOA 1URPA 3VKVA 2G17A 1J39A 1M73E 2GTHA 1CEEA 4D0SA 5EIAA 2X2OA 3HYNA 3RWMB 2H4FA 1V7CA 5FTNA 3PUIA 5KWIA 2ZSJA 4P4UA 4JBLA 4DMRA 4QNRA 2PBFA 3NW9A 4ZODA 1TUEA 3UO8B 5EJGA 3W0LB 4TT8A 2NAFA 1USVA 1JHOA 3ZWQA 4IG4A 4MYHA 3X1YA 1ZXXA 3EWAA 4WCFC 4QG7A 4K1XA 1DJPA 2ZYDA 3MT0A 4Q3CA 4UM9D 4BLSA 4PSVA 1NHGA 1SHZA 1VECA 4D97A 3CLRD 3GMDA 3D6FA 4IFBA 3A14A 1YZYA 1PGPA 3QV2A 3B6JA 1EXWA 1R0YA 3CPEA 4R2KA 3PIIA 3ZQ4A 2PUVA 2YVAA 4D0NA 3C6BA 2HBYA 1GEEA 5C7YA 1H9BA 4NOLA 5ALKA 4H4DA 4QBKA 4II2A 5FPYA 4R1NA 3QFFA 3EHDA 4J16A 4BGDA 4IQGA 2O7QA 1J5PA 1XWIA 1RQLA 1YKSA 1T36A 3ID6C 4US0R 5ELLA 4YMLA 1FJXA 2QMUA 4DY4A 4R84A 5GV8A 5YASA 1IC6A 3DZHA 1HLDA 2R65A 4MKHA 4UU7A 2MYTA 2WD8A 5LMUB 2VHUA 2C3UA 3IERA 4LYHA 4PQEA 5IDYA 4BBAA 4NRDA 4JX8A 1H2RS 4WBNB 3GQVA 4PYNA 3MGCA 1E8MA 3DEYX 1M0TA 1FUKA 2IE8A 4F12A 4PIPA 4FSDA 3OX3A 4B1FA 4YRGA 4YIHA 1RXUA 3OEEA 1F51E 1ODLA 1U2ZA 5J5VA 4FZJA 3I8XA 4QTTB 5JAPA 1DAGA 2OC9A 2IEZA 4JLKA 4Q1AA 1HY3A 4EP1A 3HYTA 3BQ9A 3Q85A 4NDZA 4D4IA 2RK3A 3E9YA 3ORRA 1AG9A 3CF6R 3G2QA 4M0KA 4MYCA 3H1BA 4RQUA 1X7YB 4UARA 4D8VA 1G8HA 1M34A 4KMRA 1V0JA 4Q4JB 4Y2RA 1AUQA 3V1LA 3MUOA 4H08A 4CV2A 3T3NA 3HKCA 4QUHA 4BTVA 3IURA 4PR0A 3QXGA 4F4JA 2VQDA 3TMAA 1XRQA 1NIPA 4B3SB 2QN6A 5HZKA 2W2TA 3QKIA 5BMVF 1QX3A 2B7LA 4JCCA 1ZD4A 3WL6A 3L84A 4WUVA 2D1SA 2YDXA 3OLYA 2UYHA 2HMVA 4P0TA 4G4GA 3VPBA 1W36B 4ZREA 4MWOA 3GPBA 1Y7TA 4FE4A 5LD2C 1HEUA 5DHPA 1XAIA 4K9RA 4G1VA 2A5JA 3BA6A 3PKZA 1GUBA 3ZTYA 1LY1A 4A0SA 5BVGB 4HTFB 3L6RA 2H07A 3JTEA 4QQNA 5J5AA 2UYGA 2CGEA 5LJLA 1W36D 2EIHA 3ONNA 3OFJA 4G2NA 4IGIA 3N6RA 1Q84A 5A3QA 1HL3A 3U16A 1A5AB 4P38A 3OLWA 3SIXA 1QR6A 2WAXA 3CZ4A 3BAZA 1CPYA 1N0HA 5B3KA 4L72A 3I01A 3C5EA 3Q7QA 4BKQA 5CGZA 5AW6A 1AHIA 1X9HA 5GJWC 1QQ5A 4RIFA 3QLVC 3WNDA 1SXJD 5AW0A 2FG7C 4F2WA 2EERA 2AL7A 3W9SA 2F2TA 2WTUA 1AGNA 1N9KA 3O47A 4I6EA 4RCZA 4RS4A 2SHKA 4RJKA 3A8TA 4FZVA 5H80A 1U7WA 1N2ZA 2YBDA 4OJQA 5B6IA 4Z4GA 3TZLA 1EG2A 3C5CA 3TRHA 3K6SB 4ZVTA 1CNMA 4GPTA 5EE0A 5EUBA 3TLKA 3ZWVA 4DARA 1XA3A 1JFSA 4AUKA 1XCPA 3AZQA 4NQZA 2KMLA 4A6EA 4MGYR 2JLVA 1LDGA 2Q5EA 2V5UA 2VWQA 4M1ZA 3MF4A 4MWEA 5CXUA 3EOAI 4BGIA 1ZL0A 1QH9A 3UCXA 4AFNA 4BNDA 4UPEA 2W83A 3L8FA 5B3JA 2X9NA 2VYQA 3L07A 3L3BA 2MYNA 3LLSA 2BI4A 3Q3IA 4HQ6A 5L3RA 3U17A 3G2HA 1R16A 4C76A 3NCHA 2A88A 1YRBA 1GGFA 2IXDA 3M33A 4QYTA 4YQZA 2IX3A 5BVHA 4BZWA 5IVKA 1FNSA 2AF3C 5IG2A 1R5NA 4TXLA 1BU5A 2QTWB 4LJ4A 1T4BA 3WC4A 2XWQA 2QSYA 2X1VA 4M9QA 3OAAA 3Q0TA 5KYVA 2JLSA 2WU3A 5JAHA 1FXWA 3WFIA 1VM6A 3D6HA 1BKDR 1TK9A 2I99A 2Q2VA 2CCGA 3AU8A 3GK3A 3IUQA 1NQXA 1RQ2A 2JASA 4RA6B 5E6SB 4EG3A 3U6KA 1M2GA 2EFDB 4KWHA 4NV3A 5ALTA 1WLSA 1TQHA 1EVZA 2FPLA 2OPBA 3H6GA 1XAHA 4CL8A 1T5DX 1RDFA 3DR5A 1L7RA 2APJA 3M3HA 2IWHA 4AECA 5B7PA 5JNTA 1E9FA 1ZNYA 1MENA 3DTVA 1B6RA 3ROZA 4BP1A 2JC3A 2K2QB 4V2UA 4EO9A 4DJAA 2OD2A 2WK1A 1R8JA 4CIBA 1L5MA 3GT4A 3W5IA 3DMFA 4FYXA 4BASA 4KNYA 2R84A 4MR8B 4CM7A 1WU7A 2PIAA 2R00C 3KSZO 4E7PA 4PANA 1UKYA 4RBNA 2GD1O 3D7LA 2OTCA 4WKGA 3SICE 2H8GA 3LFHA 2NU8B 2AXEA 2II6A 1GT6A 2O6LA 5H81A 3ZV5A 3PSAA 1QUEA 3GNSA 1SCDA 1P6XA 2GRUA 1BXRA 1S2IA 2ODNA 3ESBA 4X93A 5A6SA 5A4MS 3I9V1 2QTCA 3EGWA 5TT0A 3WVNA 2O4UX 4QO8A 3U9TA 1YR6A 3TBFA 2WF8A 2ZJ3A 2CXQA 2D5CA 2R7NA 1G41A 1LVGA 2EX4A 2AMFA 4H3KB 3SF8B 2BEKA 4AWBA 3QFRA 3HJBA 1WPXA 2UXBB 1PFQA 4F72A 4MW1A 2MR6A 5F77A 4P2BA 5CHYA 4FEYA 4PWZA 2GZSA 4MVJM 1UC4B 4N8SA 1SMKA 4WNAA 4GMXA 5EWLB 4ILEA 3K5PA 3WLAA 3A10A 4D79A 1N77A 1YBAA 2IX9A 4Q9JA 1DBVO 1X9GA 1UADA 1Z75A 2CBGA 5IAGA 1U3DA 2RGYA 1BHQ1 4Y98A 1IHDA 2AOWA 3B1FA 1KKUA 2PMCA 4G0MA 4UE6A 3TQTA 4F3CA 3S1QB 1YJXA 1D0SA 2IEYA 1F3OA 2O2DA 2HUNA 3CWZA 4UOQA 3JPYA 3R7WA 3V55A 3UW3A 1RFLA 5B7QA 2PR2A 3N8GA 3W1EA 3OQNA 4C4PA 2O8EB 1XGKA 3BJEA 2WHXA 1QYXA 5L4LA 2QL6A 1MEOA 1SHKA 2XGMA 1DNPA 1T6YA 2JFBA 5DGIA 1J0AA 3H2IA 3QUAA 5JFOA 1G63A 2RHTA 4UHJA 3I5UA 4PSCA 5JQGB 3UV3A 2QP3A 4FFNA 1AK1A 2CLIB 3HLKA 2WTMA 1JAHA 4PWYA 1T4CB 1OWNA 4U8HA 4MPTA 4EW1A 5AK0A 3HQ4O 3QU7A 2W11A 3E82A 1SO8A 1RZ3A 4RENA 5IUKC 3ZK7A 3S2SA 3NGMA 4OB8A 1NY6A 4EVRA 3SVZA 2XECA 4UAGA 1GZUA 3VYWA 1P9OA 4KXFB 5HBRA 1Z2EA 2DT5A 4G8BA 4MI3A 2FSUA 4C3UA 1K3UB 2YL2A 5DLEA 3W9UA 1KXJA 4HLUC 4WMLA 3VOTA 1F7UA 2X14A 3TLGB 4J0QA 1OI3A 1B8UA 1PUJA 2P6PA 2JEYA 3FNFA 5ALSA 1W1UA 2JFVA 3U7HB 1KMMA 1OFIA 2EARA 4WACA 4ZA2A 3QF7A 4F3RA 2YVKA 4K05A 1LPAB 4TLBA 4D57A 1CUDA 1QKJA 2Q2OA 4OYHA 4RANA 4ZXFA 5SZKB 3DVSX 3IVRA 4QLOA 3TCNA 4DHEA 1WSAA 4NBWA 3NM4A 2WLSA 3ENZA 3FOFC 5A4JA 2WSIA 3LZ6A 4CV0A 4IRXA 4PE5B 1ZVJA 3G2JA 4PFSA 2HWWA 1S3SA 3W5AA 2ERXA 3L1HA 1Y9AA 2FPUA 2RB4A 4D7AA 1N0VC 2F9FA 6ABPA 4LKRA 4MR7B 4OLAA 3BKWA 4I1SA 3LBFA 4YT2A 2WYHA 2RG1A 4GP6A 4NMHA 3HYRA 2ZM5A 3PX7A 3KSRA 5FQOA 4DV3B 1B1AA 1EB9A 1DWUA 2HX1A 4EDHA 2FMTA 3RVLA 5JYCA 4L5JA 1ABFA 4XPIB 1PJ8A 1T4CA 2HN9A 4MJ3A 5H3LA 2JJ2D 2PBRA 4U7DA 5JJIA 5JZSA 1AM4D 2FHSA 4H3VA 5JD4A 4J4TA 4ISBA 2RAFA 2XV1A 3AVTA 3GMTA 4M98A 2CNLA 1P3Y1 1W1WA 2I1LA 4Q66C 3OQ6A 3SHFA 1XXHE 4Y9SA 3GGPA 4IDGA 3HCBA 4Y2JA 5D1HA 1Y6ZA 4CIWA 2XUOA 4RPGA 1K27A 2PKEA 2PTHA 2JDID 2Y0BA 3DFUA 3W2GA 2ZT5A 4P5DA 2B6HA 3G1TA 2YV2A 2J33A 3I9FA 5EAIA 4MP6A 3R0XA 1ZY2A 2RGAA 3NJRA 5FUVA 4I9FA 1ZISA 1ZSYA 1PWYE 1QKKA 3EAQA 4PICA 5FUXA 3S40A 2RE8A 1R9MA 2H1OA 2CWWA 4I5IA 3X2EA 3QX7A 2X1HA 1DZIA 2O3SA 2ZE6A 2ZRDA 1SAYA 4Q47A 3SLRA 3LC2O 4AYTA 4ID9A 3DBVO 1U7HA 5JAOA 3EPHA 1PJLA 2YMPA 3LA6A 2UYCA 2OAP1 4PC3A 4R8VA 4HADA 3TLYA 4OAOA 5JI3E 1C7EA 1SQSA 1MO6A 3A6HA 1DIBA 3EC7A 2F8LA 3N0WA 4FLEA 5E1MA 4RTRA 3V42A 3B8EA 1JWLA 1XZAA 1YB7A 1Y81A 1X3SA 3LZDA 4FDUA 4L95C 4JSRA 1S1MA 1TFUA 3PDIB 5AQEA 4F6RB 4XI9A 4B40A 2ZRFA 2IUUA 1A5ZA 3QUQA 3TYXA 1QF7A 3Q0EA 2B8TA 4R16A 4S24A 5B6PA 4GEKA 1PUIA 3ZEIA 4OBBA 2GAOA 4I5FA 4AQYB 4ND3A 3DT8A 3LHIA 4FSHA 1U2PA 2QTTA 8ABPA 2V96A 3BD7A 1ES9A 2WIAA 5BV0A 3BRWD 4X7RA 5DBEX 4RQAA 4GZ3A 3LM8A 3N2KA 2DOKA 1UBSB 4KIUA 3CWCA 3OJLA 5A2GA 1H6DA 3R75A 1R6BX 3VPHA 3KQSA 4I4LA 3ZNNA 5G0UA 4ARUA 5KNDD 2XIJA 2B20A 5GZ6A 2C4UA 3QKRA 1ETUA 3L4JA 1QNLA 1Y5LA 2FJPA 4FDLA 4Q93A 2O3TA 4KO2S 5B36A 5KQGA 2W6ID 3KEQA 4CMHA 2Q1YA 4BX0A 4ZYLA 3FDZA 4DRYA 4JYMA 3REOA 1P5FA 2B25A 4P2GA 1FPMA 3I2YX 3HG7A 1E7QA 2IUEA 4CKEB 1XTTA 1LSJA 5CEJA 4MS3B 2GSWA 4RSRA 3TNDA 3IUSA 3SS7X 2RHDA 2CV1A 2H8KA 3I5MA 3KR9A 4EKYA 2AFHA 2OXRA 4GRAA 3K2BA 1SBTA 3O84A 3QBTA 2HQ1A 2QL9A 4M46A 2OFWA 1A69A 3NBZC 4P4SA 4Q7MB 2PUCA 3F9RA 2RCYA 4W1RA 4D9GA 1FTWA 2DQZA 1RMTA 2RH9B 2XNSA 1UBGA 4BEJA 2IPOA 1N5KA 1XMJA 4GPAA 3RUIA 1CEQA 4G4JA 4DIKA 2JRLA 1SXGA 4DLXA 5AKYA 1CJCA 2XLCA 3IFSA 3PEUA 4JLBA 1IUKA 2JAPA 4DT1A 1UAYA 3MTJA 5EGSA 3ZU4A 1UPUA 3HUUA 3D8HA 3WL4A 1U5AA 1N0UA 5K0SA 4CDGA 5GONF 1V5WA 2QI9C 2PRIA 4CL0A 2IW3A 3IRVA 1KARA 2IU0A 4FHFA 1PE0A 2AMYA 2FEAA 1RCFA 2IS6A 4PNPA 1O95D 2JI6A 3HCOA 2IYFA 4MNTA 3WHPA 4FFSA 4Z0TA 2R1VB 2WWXA 3C70A 4TXJA 3KD2A 5H1YA 2OCGA 2B5VA 5TQ2A 1Z4NA 5KC8A 3WQSB 2P9CA 1XZKA 1M1YE 1TK2A 4Q16A 2POCA 1IZ7A 3EXFA 3U37A 4YMVA 2REBA 1I0IA 4W8HA 4EVSA 1BN6A 2JFQA 2ZE5A 1QMGA 4IR7A 4C5BA 4AF6A 5A9RA 3IEPA 5BSEA 1OREA 1VQ1A 1JVSA 1MD9A 3FGOA 3R5SA 4FINA 2XXAB 4Y6GB 1C9KA 2BZ0A 2KYRA 3OUZA 1QOZA 2A30A 2QM3A 4S1OA 4Z9BA 1HUQA 1PLLA 1NXSA 4EG8A 4YRKA 1TM7E 2WU0A 2CKDA 4CM4B 4DF3A 5EC8A 1ZIPA 4EFMA 4HGNA 3KPYA 1G60A 4ZOQI 1UJBA 4OL0A 1F9AA 1FW8A 1Y3IA 3QVMA 2X5XA 1WULS 2POQX 2DEUA 1KRHA 1H69A 4HYEA 2PFSA 1PJBA 1H1LB 3TZBA 3HP7A 3QG5A 2O19A 3OU7A 4N8EA 5KC9A 4X45A 1UZNA 2XGOA 3T35A 4ZAGA 4NOJA 3T95A 4I1YA 4IYJA 2QP9X 5E9WA 1S6YA 4D56A 1DTWA 1I1NA 1U0FA 1UUFA 4IS3A 4ZV7A 3SM3A 1T4MA 1SOMA 4NS4A 4F21A 5TEWA 4A6DA 3VUEA 1UPCA 4N0DA 1DC7A 3WDSA 5CA0A 3KM0A 4KXQA 1T9GR 2XMPA 3ANTA 5CFLA 2QB5A 3OKFA 2R751 3L93A 4DUYB 3W4JA 2CUTA 4LE1A 4D0GA 3D8RA 5AW3A 5COAA 1QG6A 5H59A 1KQNA 3VC1A 1U8AA 2A5FA 3JQ6A 3LK6A 2JFNA 3BJRA 4UNNA 1KFEB 4ZU1X 4D9BA 4ZFNA 1N32B 4PU0A 4YP7A 5EIWA 2ZZMA 3I9KA 4N82A 4WASA 3AF3A 3I2HA 4CCYB 2G0NA 2JCSA 4ZOAA 3AVPA 4DV6B 1UODA 4RE6A 2C61A 5E4YA 1YIDA 1KBOA 2RONA 3AEZA 3EF1A 3EG9B 2VT7A 3L7IA 4JP3A 4BV8A 3EIFA 1E2JA 1QQ6A 1JEJA 3TL2A 1ODJA 3WWPA 3HVIA 2AOXA 3P0JA 3TL3A 1E1DA 3UTCA 1D0VA 4DM3A 5EPUA 1ZD3A 5A5EA 1IHPA 1A77A 2ODAA 1AOXA 1M6HA 2XWBF 4Z3OA 4D92A 2FN3A 2B4QA 4HDRB 2P7IA 4BMXA 4PHHA 1KK0A 1X1TA 3DZBA 5IC5A 3VPAA 5MN4A 2IPAB 4CZ2A 3OQHA 4NV0A 1VKHA 4TOIA 2E89A 2RKWA 1GAEO 1JMKC 4JP2A 3A2KA 2IDJA 5HVNA 1XQWA 2G82A 2VKQA 1R15A 1KEUA 3U6BA 1S8OA 3T99A 1QU2A 1LSUA 5EKUA 5AP9A 1ZESA 5TQ0B 4LJ5A 4JI0B 3WLPA 4D9CA 5KYTA 2IQ5A 2IU4A 4DR6B 2Z04A 1GL3A 3KQPA 2V03A 4OBXA 2UZ3A 1HTBA 1RJ9B 2NVWA 2QRZA 1PSZA 2AWOA 2I4RA 1ORTA 4G26A 4E2XA 5A5GA 1MG0A 3C8MA 1L5HA 1OB2A 1EXNA 1TGVA 5FLXA 3G9TA 2HMSA 3CNLA 4UXJA 3G0CA 4CM3A 2P2NA 2Q9BA 1T10A 3HYSA 4HN2A 3EIWA 3SHVA 2DRIA 3VU1A 4C7OA 1I3KA 2Q0QA 1GZ6A 2O8BB 1MX1A 4IY1A 4F4FA 4BPRA 1SHTX 3GFTA 4GFDA 5B3AA 3LMKA 1X39A 1GNRA 4CCAA 4Z7QB 4CEIB 4C7OB 2IEAA 4BATA 3RVRA 3UTDA 1OMOA 2GZAA 1NQ5A 3KZMA 3E5MA 4XUEA 1FTGA 1VCMA 3TNLA 1JW9B 4I4TF 1WXFA 4L8VA 4BLVA 4E12A 1RIFA 3KJQA 3WTBA 1EGVB 4KXMA 4AC9A 2NVBA 3T0FA 1EQUA 3AV3A 2R5FA 3NHWA 3JQ7A 3LWZA 5EVCA 2OR3A 2QMZA 3DFFA 1DUVG 4PLVA 1SUBA 3F4LA 4TTIA 2I6XA 3KYDA 5E6RB 3DDSA 3GRKA 2WHRA 4M37A 4PBSA 3ZJ5A 1Z38A 3R77A 4NABA 2OV6A 1PKEA 2QN9A 2ZVJA 3HYLA 5HX7A 3RC7A 4ZK2A 1X1QA 2XRZA 3PQ7A 1SXPA 3AKCA 1YQWA 2H4ZA 4OHRA 2WOOA 1PO7A 1Z45A 1RVV1 3U7EB 4YJFA 4DG8A 3ICCA 5U4QA 3LBIA 1I5RA 4GZMA 4MQMA 5HNKA 3WWZA 2JFPA 3R3UA 3K7AB 2B83A 2Z6VA 2NPOA 4G4SO 1ZNXA 3TRKA 3H5NA 3P27A 5FJJA 3RE1A 2ODTX 1MJFA 3DEAA 4I55A 4RS3A 1F0KA 1VE1A 2GKSA 3U4DA 3AO0B 3VPXA 2OK8A 2Q3LA 4P5PA 1CXZA 2GRJA 4KL8S 2FPOA 3LC7O 4LDNA 3GB9A 5K3FB 4F5DA 2OGTA 3L49A 2C9CA 4K88A 2E5LB 2GI4A 2ZROA 3GVPA 4RSMA 2VEOA 1DC8A 2I76A 2X0KA 3LPMA 1V4BA 2AK3A 1O4WA 1YJCA 1ZA2A 1KJ8A 3PC3A 4HGPA 4Z99A 4BJ1A 3FETA 2ZJYA 2OQRA 4EI8A 3R7FA 1CIPA 4E5NA 1UBUS 3EEIA 4WKPA 3D0KA 4G1FA 4MRMB 4AO8A 1BMDA 4YDQA 1H4QA 4OD0A 5DTJA 1O6FA 4OIFA 4B3CA 4IVQA 1XJWA 2F43B 2GZ3A 2QAIA 3FPBA 1IB0A 4PHGA 1L6RA 5ESWA 3IP9A 3M81A 4GNKA 4EZEA 2CFRA 3JD4A 1V4NA 3EG5A 4MRNA 4BXOA 2QZ4A 4OAPA 3ESCA 3MGAA 3KRTA 3J7AC 3FFBA 3EQ9A 3LT2A 3C3CA 4IOLA 2YZMA 3B78A 1YZ3A 4JVOA 4L0CA 1WZUA 4JB8A 4XR9A 3UN1A 3NT2A 3E9EA 3I53A 3IJEB 1SCUB 2V1XA 5EINA 4YRLA 1FFSA 2ZIAA 3FBWA 1KQOA 2DBVO 3M9XA 3NP7A 1ZHHA 5JNRA 3LYLA 4C78A 4HDKA 5TPWB 1M7HA 1ZGCA 2HBQA 3G0OA 4WVLA 4KTVE 3M5CA 2FW0A 3OJWA 4MWTA 1GL7A 2KI5A 5CMLA 3CJRA 3ESAA 4RMGA 5AO9A 1N3BA 2O57A 3GT0A 5BN4B 2CDNA 3I32A 5I7EA 4WKCA 1A8IA 1CZUA 1V2HE 3G0GA 2PZ8A 4KAXA 5ENZA 1NZJA 3AKEA 2PD4A 3BMXA 4Y6QA 1DC6A 4E1BA 1ZAYA 4K81B 1ZHFA 3A9WA 1R10A 1UZLA 2FW1A 1TE2A 3H99A 1LPOA 4QRDA 3ZW7A 1ULHA 4OQLA 2PGAA 3S6JA 5LUBA 3UXMA 2K5UA 3PD0A 4W5OA 1Z63A 2RH8A 3HWSA 2ACWA 1EWVA 4TL8A 3RAPR 1P2FA 3TVYA 3GPDG 3GLSA 3QXJA 4ZZ1A 3X43A 4M87A 3JD2A 1SBIA 4H4CA 3GO4A 3ETEA 2QMOA 2QV0A 3IP7A 3ND5A 1M2HA 3RIYA 1EGAA 5B64A 1T5OA 1SG0A 1VG9B 1HZZA 4C6SA 4DFDA 2O05A 3ODPA 3U4AA 1FP4B 1VYUA 3PE4A 1GCUA 4L02A 4IHKA 4NBUA 4K8OA 5GJBA 3MTDA 3WJ1A 3RYCA 2HSWA 3L40A 3V8MA 5CK4A 1GVNB 2VXCA 3N39C 3COZA 3NIWA 4MQFA 3GR6A 5EJIA 2C7BA 1RIIA 3GTLB 1GTVA 3SX2A 4JI4B 2TS1A 4M53A 4EIWA 2PANA 2Q28A 4ANFA 5EQTA 1TYDE 2IYZA 3GZJA 5JBIA 3QQ5A 4TTVA 1SOWA 1N3LA 1XZBA 2FPPB 5DYYA 3JVVA 4PLWA 1MNAA 1EWQA 2BZGA 2QTNA 1GRCA 3EVZA 2EZ9A 4RZUA 3B3QA 4U3JB 5CU7A 4EPTA 2ETXA 4DSOA 1B3BA 4LRWA 1IWBB 3KTFA 1C0IA 4Z0PA 1HFKA 3ICVA 2R6DA 4JLWA 4O1MA 5EMLA 4ZC1A 4RKWA 2H00A 4GPBA 1RXEA 1R5OA 3UHPA 3O4VA 2FZ4A 4EOGA 1NKTA 1KPGA 1ZITA 3RAGA 1X15A 3S44A 3OESA 4LQ4A 2PGJA 3HZRA 5PNTA 4LE2A 3E7PA 4JA0A 5DLQC 5F35A 4A2QA 5K6AA 1ZJ5A 4RFVA 1U9YA 2ZP1A 4ZDJA 4YY3B 3B2QA 4UUNA 3L43A 5EQFA 2Q46A 3AZPA 1IY9A 2VN8A 3U44B 4YRPA 4BQSA 1FSGA 4BNNA 2IF2A 4OHXA 3UPDA 5EZYF 4CV3A 4KH1A 3C8HA 4HJRA 1Y5MA 4GOOD 4XLTA 4PHCA 3UOWA 4DUGA 1BXGB 3QVUA 1Z73A 3DFZA 5K03A 3P0FA 1KP3A 3FYTA 4YALA 2P11A 2WUDA 4Z54A 4UTVA 5EESA 1YJBA 5DSTA 4GUAA 1U2EA 5BNZA 4TWRA 1LX7A 4LDPA 2UVDA 2OQ2A 2XMDA 3C3MA 1ZUHA 2DLCX 4WZAB 4ZK6A 2XT6A 3VO8A 4TRRA 3NAQA 5KX5A 4PTLA 3IXQA 1EAMA 1TRHA 1EFKA 1LDMA 4RJ2A 1NV8A 3IAUA 3LOPA 2JJMA 3UM9A 4DC9A 1XL1A 2QZ9A 4C2BA 1C50A 2GN1A 4DA0A 1R7RA 2VAPA 5ALYA 1OHHA 2Y1EA 4IJVA 1YCFA 3QLUC 4MVJI 4JC0A 1O9GA 1XLTC 4J8PA 1E32A 2FW7A 4UTRA 4Q9DA 2VK8A 2WNHA 3DOUA 4U3JA 4D41A 4JC8A 1TF2A 4EECA 4OYLA 2C8KA 3EYAA 3HCRA 2QXTA 3KVYA 1FVHA 1TM4E 3B6KA 4V2IA 4ZCQA 3S1RB 1E4VA 4C30A 3TUZC 1OGYA 3HU1A 4KHZA 2VTDA 3GJ5A 3K92A 1X0XA 4GX5A 2XZLA 4CN8A 1AQ6A 1EK2A 2QWXA 2ZWPA 2XT9A 5DM0A 2F1IA 2G8NA 1T2FA 3PA6A 2RBGA 2XEDA 4OQQA 4YRCA 4YYEA 1JQJC 1YV9A 2WJZB 2ZYAA 3L8CA 2FH5B 6AT1A 3T1TA 5CA1B 2ZTMA 2QQ5A 3DZDA 4LZNA 5L7WA 5CX1A 3KC2A 3D6VA 2PZFA 1E2GA 5DWVA 3RHTA 2ZWIA 3QNWA 1BYIA 4UAJA 3WMFA 4M0DA 4ZVVA 3ZZTA 1H05A 1VL0A 2FI1A 4NBLA 5LYJB 4IZIA 2CLMB 5G0TA 4TRNA 2R1UA 4E11A 1IN6A 3CZQA 2IH5A 3OJFA 3HJFA 1Q3KA 5CT6A 5TJ9A 2BZSA 5BV2P 5A3SA 4KR2A 5JZMA 1DCFA 1ZNZA 2LDXA 2OLEA 3ZDXB 1Z5VA 4YT8A 2IVZA 2UKDA 1NT2A 5JH7B 2V6JA 3ESXA 3O5AA 3MJSA 3OQIB 5KAPA 4WY2A 2F7SA 5F73A 3U61B 4B75A 3HJUA 1J06A 3ZU6A 1NNI1 4EY8A 1GSIA 1EHCA 2VJDA 3A6GA 1OLUB 3HXLA 3MT9A 2QD3A 3OQIA 5FA8A 4EHLA 1TAUA 4IUYA 4U9IS 3TOZA 1MB0A 4QOFA 3WSTA 1AKTA 5I45A 2XOXA 5M5XB 5LXTB 1O9HA 2V98A 4DDMA 2KX7A 4YCLA 3CN7A 1DIOB 2B0CA 1FXUA 3A2LA 4J1TC 1G8YA 2X5NA 5CD9A 4PAOA 4IIBA 5CA1F 4PXSA 2EG9A 5IZCC 3JQFA 3IOCA 1R50A 1F48A 1N6HA 2YZNA 1ZVMA 4L4XA 1EEXB 2QT0A 2CLFB 1N6OA 5TSDA 1IONA 1PF7E 3FKSA 5EIHA 1TCAA 4HK4A 4UNRA 4R1SA 3WBJA 1GQYA 1W5BA 1PSDA 3ANMA 3N6VA 2PX8A 5E7JA 4WY5A 3USZA 1RQ7A 1BDMA 2IBSA 3STYA 2ZYHA 5CX1B 2A92A 3VR3D 3DFMA 2GFIA 1JJFA 3VR5A 2XJ9A 5CNMA 3ZGLA 4JR0A 2GTIA 2HPZA 1U4NA 3B89A 2QRKA 2QAGA 3K09A 1JDNA 3THYB 2G9RA 3DUFA 3MMXA 4OBWA 1CETA 1MRZA 1Z0AA 2HV8A 3TLAA 4W82A 3BZUA 3WXMA 5LA6A 3LOUA 3SSAA 3NQ41 2O54A 5IMSA 1TA4A 4C2MB 4UU8A 2AFVA 1PJSA 1NW4A 4OL9A 3N5KA 4TS9A 1MDBA 2ZB4A 1T4DA 2BGKA 5IMBA 2OFPA 5LA6B 1F2TB 2WKWA 4IGAA 2A35A 1M8PA 4REMA 5BN1A 2X3UA 3DO8A 3X3HA 1R6DA 2PDAA 1GWNA 3WL8A 3JWJA 4W8OA 1EJ0A 4RHYA 1N6LA 1D2AA 5CXXA 4CLRB 1OBVA 2JD1A 2OOSA 1FDRA 2QI9F 3PGA1 3W3ZB 1LBEA 1PX2A 2H51A 2AFIE 1DS6A 3EMBA 3OPYB 2IOHA 3R6DA 4Y2YA 4CIAA 3MD9A 2YASA 4MDEA 1L7BA 2PGDA 3BMCB 2C04A 3TOCA 3ZI4A 4CQMB 5CJPA 2F6RA 5KTYA 4EG0A 3EFBA 2VYNA 1DU4A 1PS0A 1IXZA 2O1SA 1CP3A 4Z1OA 1O96A 4Q5IA 1YZQA 4ZO6A 4DC0A 4U7GA 4C5CA 2XYGA 1DIAA 2ZUVA 1WMBA 4CM1A 1ONPA 1RQGA 2C2KA 2Y3IA 3F5SA 4DADA 1G3IA 4AD8A 1N92A 3KXIA 4HGRA 1HR0B 1HLFA 3AVYA 1SVLA 4NNOA 3T9CA 1M6WA 3LX5A 3MC1A 4PG5A 1UJNA 2YOFA 4RWEA 5HE8A 1IPEA 3D59A 3HL4A 3MGGA 4KV7A 4N5IX 4UVGA 5EWLA 4Y3UA 4G41A 3NYQA 3OD5A 3SC2A 1TO6A 4NSNA 4X8OA 4I0WB 1HI9A 1VJ0A 2PM8A 2A2ZA 3IEKA 3R5HA 3ZCUA 4DBZA 5CG1A 2PJRA 3WIVA 2Y4OA 3DE6X 4IVNA 3M5PA 4A3EB 1UOPA 2VCHA 2NO1A 1VDZA 2D2FA 2BMDA 4HPWA 3VI3B 1XMQB 1DE0A 1XZHA 4GIBA 1C1HA 3KKZA 4JIGA 4M8NE 3LL4A 4NEGA 1L5HB 1WZIA 2XOKA 3NFRA 4D80A 1WWKA 2ZUSA 5FOVA 1MAUA 4JQSA 5EE3A 1GN8A 1J25A 3KZKA 5F9MA 2C8JA 5BT9A 4RCVA 2OXCA 3MRTA 3HGTA 1KWGA 2AG1A 1MIHA 2FSPA 4HDCA 4ZOLA 3TIXB 1FPQA 1U0LA 1U3FA 4FDAA 1E2HA 3K9BA 3GJTA 4EB6A 4CLRA 2CHFA 1WPRA 2WNSA 4IKPA 3ZTWA 3NJ4A 1JEAA 4IKOA 2ZGVA 3PQEA 1H9CA 3HO6A 4B3IA 4CT0A 4ZOLB 2LD4A 4XWTA 4J1QA 5DISB 3ZWPA 2IHJA 3PYMA 4ZAVA 3T7EA 2ZJAA 1U3GA 4MR8A 6PFKA 1N3IA 3UFBA 5K0EA 1D2NA 4ZCMA 1VPEA 3TI9A 2A1TR 1JGTA 5IKXA 2PRSA 4HNQA 4MDYA 1YMUA 1ML3A 3FNGA 3MMSA 3GTKB 3OIGA 1Q0ZA 3VZCA 2UZAA 1OBCA 3OIUA 3HBJA 3K9HA 4ZDKA 3R76A 2B30A 2GARA 2O2GA 1TIPA 3R44A 3BE6A 2AJBA 1GZ5A 3GGGA 3T4UA 1KTIA 1ODIA 3NBKA 4RY0A 2W93A 1UEXC 4L5BA 2IGBA 1SVKA 3T7TA 2J41A 4US1R 3FSJX 1PQ4A 3AFMA 4QBGB 2V7VA 1Y42X 4UUBA 3PLRA 2VDJA 4IG9A 2YV5A 1G17A 3PDWA 3GAMA 1H5QA 4CFYA 1ZW6A 3P45A 5JNSA 1ND5A 1Y4DE 2IYVA 3E9RA 2JGIA 2W8ZA 1NU8A 6GPBA 1OU0A 2BF4A 4UULA 4WN3A 1Y98A 3DNMA 4LHYA 1QRTA 4KAAA 2YCBA 4QBTA 4DJFC 2VXBA 1S0UA 2EWWA 4Y2QA 4EG6A 3GLFA 2V1UA 1TIBA 4IDAA 2WWVD 3ZU2A 4E7OA 2AG0A 5COQA 3DWFA 4RW0A 5AJXA 5DPMA 1DCMA 1TWGB 1UINA 2C2BA 1CQJA 2Q0SA 2IYPA 1SA0B 2GUWA 4U2DA 4BY1B 3CQZB 1XTIA 2F64A 4TMYA 1ZH0A 4MWZA 3CU5A 3O2SB 4LHWA 2CNNA 1M2OA 2XNKA 5LZ8A 2FLVA 3J7TA 2BAGA 3FPLA 3ETLA 1XYGA 3W7AA 1Z4MA 3ZXYA 4BMDA 3NCTA 4RABA 2H1RA 2BTOA 4K6GA 1LCIA 3ORYA 4UHKA 5BOSB 4MQLA 4RVDA 1I6MA 1VJTA 4NI5A 4L9WA 3SEZA 4P32A 3D0OA 3H5TA 3MRSA 2Y1OA 1XEXA 4JUBA 4AQDA 1TEHA 1E5LA 1APBA 1BQ4A 2DWOA 4UTZA 4DV2B 4WFJA 1HNWB 1Z6YA 4R9NA 2WAQB 4I9NA 1UDXA 3I34X 1RSZA 2VSQA 2O59A 4CM5A 3WDLA 1WRBA 2D13A 4K6MA 3C6MA 1DC3A 1OAOC 1BHJA 4A0RA 3P97A 4GLBA 3F3MA 4BE7B 2I4MA 1RHJA 3JARB 1DFIA 1U7OA 2O0MA 3N07A 3OWOA 4KU4A 4HX2A 2OHJA 5D84A 1UIRA 1ZG3A 4PG6A 3STHA 5JATA 2WG0A 5BWMA 3WGQA 4RXTA 1GZSA 2XLBA 1JBQA 1YS1X 4Z4FA 1NONA 1VE5A 1XSEA 2OFOA 1U28C 2VDVE 4NG4A 4ETIA 4G24A 1NR5A 1QH1A 5HFAA 4BQEA 4BRUA 5M7EA 1B74A 2IK8A 4DR5B 2OCIA 3M1LA 2GM5A 2HFKA 2PN1A 2H5IA 4FU0A 4I1UA 1QTNA 4D9MA 4ER3A 3W9YA 5K8CA 3UT5B 2GFQA 4XWOA 2GJ9A 3K9WA 4DMCA 3E6AA 1EE2A 1YMQA 2HDWA 4JNKA 3SE7A 2BD0A 3AEYA 3BL5A 2NACA 4HAOA 1HDRA 2LP4Y 3KKLA 3FVVA 2K7ZA 4UQOA 3AM5A 5TMEA 4EJSC 2G70A 1XQ9A 3FIJA 1XLUA 1NMSA 1IE3A 3ESYA 5DOZA 3TJRA 1W59A 1J7KA 2GF0A 4O1IA 1IDOA 1ANKA 1NULA 4N0PA 4CJXA 1XKQA 2XW6A 1I4WA 1WDWB 1BN7A 3RIMA 2DPYA 3VVLA 2CNWD 2ZIWB 3GP8A 4JJFA 4I3GA 5FNZA 3Q9SA 1FK8A 1N7HA 4ZT3A 4EYEA 2G72A 2HWKA 1COWD 3IHKA 3N3AC 5AUQA 1JJVA 3O26A 4EJMA 2JA5B 3L8HA 3SXUA 4GM1A 3TSOA 1NW5A 4QDXA 4YUVA 4KRFA 3QYFA 1Z9BA 3RR2A 3U60B 4XFKA 2QL5A 3G9UA 1N33B 3DF9A 1PT9A 1Y1VB 1CULC 3ZHQA 4OHOA 4EMSA 3AP1A 3VX3A 1SD1A 5IAOA 1JPVA 1GO2A 1X6VA 2ZJ0A 1THGA 3R9WA 4P0QB 3TGPA 3EISA 3LA8A 4AMUA 3O4FA 3TZKA 5JVDF 1KOJA 1NUSA 1TUGA 3FAKA 3K6RA 4PBRA 4R7GA 4MAFA 1H23A 4HHEA 4L8FA 4LNAA 3G2MA 4A93B 2EQ5A 2M98A 3SEAA 2FZGA 5JNWA 4MWCA 1TJYA 3C15C 1ISMA 2B5WA 1FUUA 1Z7WA 1D8AA 2C2GA 5EJFA 3Q3HA 3W5JA 5L3SA 3T9EA 3BIFA 5L53A 1MA0A 4L5IA 1YCGA 2Y92A 2OM2A 4R1PA 3F96A 1N6IA 3CBGA 2W37A 5DYGA 5B2ZA 4TPKA 2OAGA 2YJ3A 4PAQA 4MJ7A 2JAHA 3NHYA 4NBTA 1YVDA 3T5TA 4KPEC 3VDQA 3K1YA 1J9ZA 4Y30A 3R20A 3WMRA 3ZS8A 2CSUA 3BWMA 3NGLA 3PFHA 2FXVA 1RWMA 3OEYA 1OF1A 1KWKA 2VTBA 3HZZA 3EDQA 4M8LA 2XXAA 1SQGA 4FILA 4MIEA 4N9QA 3EVDA 3CRQA 4OXXA 2ACVA 4PX3A 4MUFA 1WUTA 1KAQA 2QX9A 3BTSA 1TZMA 3ZNPA 1L5OA 3KWMA 4Z0HO 4WBNA 3F74A 3SIPA 3ZN2A 5BRNA 1B8VA 4AZSA 1GNLA 2VHEA 1VA4A 2W6NA 3AF5A 3I83A 1YGYA 3OFNA 3OIWA 4MYUA 4PSAA 4WLEA 3N76A 5IVPA 4LY9A 2YV1A 2GAFA 4H17A 4DMKA 2QNRA 3ANSA 3ZK8A 2E4ZA 3K9CA 3GEHA 2AFHB 1ADFA 4MXDA 4RF3A 4D9JA 2CY0A 4BLUA 1U02A 2B4TO 3V7NA 2F00A 2C4TA 5DNYB 2FA9A 4HYQA 1FUYB 1GAJA 1Q7TA 3P2YA 3NO4A 4EA8A 1JI3A 3IDFA 4G01B 3I3SR 4BNIA 1HGXA 1Z25A 3MTEA 3NBUA 4O2LA 5EXXA 5TGTA 3RSZA 1Y80A 3ITEA 3M9WA 3GF4A 3H9BA 1G21B 4Q01A 5CH3A 1FQKA 1W19A 2K87A 5HCIA 4AZTA 3EBPA 1R0WA 4GG1A 3ZE1B 3N0TA 3KJZA 4U5XA 5DYTA 5IPFA 4K9DA 5JMWA 1Y6FA 3OF5A 1SU6A 4NDAA 4A3MB 3M1IA 3N2IA 1JSLA 4GRIA 3I61A 2JFWA 5KTRA 1XTVA 3GFRA 2Z58A 3OCYA 1M2EA 4OF4A 2BGLA 4CMEA 3UUFA 5B6JA 1C80A 5HF5A 4CGZA 4GKKB 1N2CA 5JSZB 5BSTA 4TQUS 2EJBA 4A8JC 1N1MA 3EWIA 1JSRA 1ZHOA 2SBTA 1F6WA 4M0CA 2OESA 3FH0A 2R8ZA 3NHSA 2ZJ4A 4FHDA 3LF1A 4JBWA 3PXGA 3R7AA 3LCUA 3CBQA 2OV2A 5KYGA 5IX8A 4QUJA 2ST1A 1Z8DA 2R6JA 2YN0A 1TFRA 3FNRA 1BRTA 2EEPA 3ZLTA 3BMCA 4O3MA 3T5DA 2REOA 1V43A 1E3WB 1PW5A 1GTZA 3FKQA 2GYVA 4XCXA 2E18A 3H1GA 2I2XB 1I6LA 1Z7GA 4JB2A 2P41A 4HDAA 2GT1A 3GVXA 3U3ZA 5A2QA 2RAPA 1L5VA 4RY8A 4HB0A 1M34B 1WW2A 1SZDA 3T6KA 2WUWE 3UXYA 2IYUA 4MP8A 4UTXA 1VE7A 3KEOA 3NMUF 2VSXA 3IQFA 4LYYA 2A4KA 4R2MA 1LFDB 2QR2A 3OCVA 2AEFA 1DFHA 1T5HX 3NJ8A 4LG1A 1ZSVA 3DGEC 5AUNB 2NZUG 1N2CE 4EKIA 5SY9A 1VYHA 3K5HA 4AS2A 2VYVA 1QH0A 1V8FA 2WDZA 1K3TA 1J8MF 1PK7A 1HRKA 1DXOA 2EGHA 5I9IA 2WF6A 3B3JA 1L4NA 1UWLA 1XZ8A 4LE0A 4PO3X 4XASA 3USES 4DIMA 3TGLA 1RKXA 3ETCA 2GN2A 1MP0A 4WECA 5EZ5A 5TX7A 3RH0A 2WHEA 5DTEA 5E6UA 3P2IA 5BVHB 1T9AA 1TKBA 3QTLA 1W0KA 1YDFA 2A33A 2R79A 4H7IA 2E87A 1OHHD 1PL0A 3EEYA 5AJYA 1V5GA 2HV9A 5T4EA 4XDYA 1MZPA 4DE5A 2FN8A 2G7ZA 1DO2A 3WGLA 5ICSA 5E6UB 2LR0A 4GOJA 3EVGA 4QO7A 4B81A 4BP3A 2HEIA 4ESOA 4Q0MA 1HT0A 3DXYA 3GUCA 4Z9YA 5E6SA 1JB1A 3TRJA 1XKXA 3I2JA 3LQKA 4J91A 2C20A 4O0MA 2G5TA 5JDIC 4CIXA 2Z8XA 1SKUA 5FUYA 3EFEA 1UBJS 2ZS7A 1R4NA 1VZ3A 4YRRA 1PAUA 2A67A 1ODFA 1P6UA 2O48X 2PMFA 4LXGA 2XUFA 3ZLUA 3HTXA 2GEJA 3P4XA 3CR8A 3W1VA 3RVSA 2XZDA 2QBYA 2X6RA 2B63B 3HUFA 3ZZ0A 1RZVA 1JR3A 4LJSA 3V48A 1GEGA 1GT91 2BF7A 1YZNA 5G4LA 4YDSA 3WP0A 2BMVA 2Z5LA 3TZEA 1GP2A 1RXCA 1U2RA 1ZJWA 3F6YA 2JLAA 5EIFA 1MAWA 4QVGA 1Y9EA 4UXIA 4YWJA 4ERNA 2VK2A 2C7QA 3DHEA 5JZVA 4JBGA 1Z06A 3F8TA 1KYTA 4V03A 3ZWAA 4LN1A 1P7YA 4NMMA 2JEOA 2QZPA 1MB4A 4HFRA 5A6SB 4IQ8A 4B6QA 1CIVA 1HMPA 3CZ5A 3DMYA 3HXTA 2Y67A 3LVBA 3TLGA 4AYWA 3E3OA 1C7ZA 2PWBA 4UM5A 3DAYA 3CEHA 1DV2A 2WR8A 3JRNA 4KQFA 2H7XA 2ZETA 5EP2A 4CG2A 1OV4A 4DDVA 5JD6A 5MN6A 2VLIA 3EGIA 3U31A 3R3XA 2ZYUX 4E03A 5EJ7A 4WESA 1EX1A 4JJ8A 1MT0A 3TAHA 3G13A 3NUZA 4J16C 5B1DA 4DILA 4FMCF 1GTRA 1EVQA 4C7JA 3AB8A 3G23A 3IYLW 3R09A 3RGGA 4GU5A 4NZZA 3TXAA 1VSQA 2IZ6A 4UMDA 5HHTA 2EKZA 1YB5A 5CLJA 3VJKA 3IOYA 5IAAA 4NEHB 4Q9LA 2DPXA 1L5NA 4EI2A 4LYFA 4RSGA 3O4HA 4IV5A 1V41E 3SJZA 3C3DA 2W2VA 5GQSA 2BHSA 3WJ7A 3REQA 2EWMA 3KO8A 1C29B 3RC2A 1GGJA 4RTLA 2WTNA 4ZTZB 4OQYA 1PJ4A 2IXAA 3AI3A 3RBAA 3DOOA 3P26A 3I4FA 1HFEL 3RRYA 1IY0A 2ZLBA 4NJOA 4BMZA 4Q9KA 1GUYA 2WICA 1U2GC 4KRXA 4GYWA 4J9UE 1KYXA 1R88A 2AN3A 1CZRA 1K4MA 3N2ZB 4QL3A 1QG2A 3B36A 1GNTA 5LZ4A 1P2VA 1NURA 3E5HA 1EX7A 1CEXA 2JFFA 3DOCA 1GCIA 1QKIA 2XNHA 3KB1A 5LB2A 4AO6A 1NI3A 3BXHA 3IJ5A 4JCOA 1KI9A 1ZK0A 4N7RA 4AY2A 2IXGA 1NJ1A 4Q03A 1TNDA 5B1IA 3SMQA 4K9OA 4Y2PA 3KKQA 4DCTA 1FX0A 2J6IA 4R8RA 4QEZA 1Q83A 1E96A 1MRNA 2BKEA 2EEZA 4KVGA 4NYMR 5BSVA 4CTOA 3MTGA 4D4MA 1TWFB 1CJTC 2NPIA 3ZW9A 2Y1FA 2GEBA 5KTNA 4CR8A 1NMQA 1WW8A 4FD2A 1GG2A 2DP4E 3ZHTA 1T2AA 3ZIAA 2FKNA 1C1XA 1P75A 1P7VA 2WFZA 3HKBB 5K3AA 4YR7A 2CUNA 1GZ4A 3BEOA 1PRYA 2ECKA 2PZMA 2YCLA 3FYHA 5IM4A 4YMGA 4L28A 4M21A 1B76A 2FPIA 4Y0AA 3ZU5A 2ALJA 3GV0A 4H60A 4JLDA 5FI1B 3PR1A 1U94A 1HXHA 3PUVA 4BC0A 1ZKMA 3BJIC 4W9NA 3WAKA 2OENG 4QM7A 1E89A 3DYBA 4JI7B 1TTTA 4MUJA 3LBHA 5JWRA 2QBYB 4GL4A 2QJFA 1AV6A 5FLYA 3X1WA 1UOQA 5IUJC 3SY8A 3DZKA 1M2FA 1QYDA 1PJZA 2WUFA 1YULA 3GCZA 4Q4DA 4RF2A 1BJRE 5T3YA 3RU9A 5I4IA 1PV4A 3OKPA 3LKZA 1PR0A 2JCGA 4XGNA 1Q1BA 1U4OA 2VEDA 4EUHA 1RQNA 5IT0A 1YKFA 2PV0A 1FOEB 3BICA 2HF2A 3QE0A 2AYZA 4TMWA 3VR4D 2VLBA 5KJCA 2F3RA 2P6OA 4Z7NB 5AVOA 4IFTA 3E8SA 1JLLB 2BT4A 5CLHA 2QSJA 2YY5A 4PNZA 3K8YA 1QORA 4ETMA 4CT5A 2Q49A 2YKGA 2HCFA 3BCUA 5JC1A 3LBYA 1O6CA 1PL7A 4OJNA 4N4AA 4RLFA 3JQRA 1JTFA 1IXYA 2O5VA 1XJQA 5JG7A 1BCSA 3AESB 4KUHA 4YCBA 1SG6A 1DBSA 3FHJA 3WK4A 4AJOA 3SLKA 3V8PA 3FDJA 2LRHA 3ANYB 3O8QB 4AZ3B 3WP1B 3V3KA 2J4CA 2GR9A 4NMWA 1XWFA 2FZWA 1F0PA 2IDZA 2JBAB 2JKZA 4N3CA 3HYCA 3HO8A 1ISRA 2IHZA 2ZT7A 3I42A 2BW0A 4KZKA 4MVJF 2JI8A 3IXLA 1GOTA 2DF8A 1FP1D 2JBAA 4BUJA 1JH8A 2IC5A 1MJGA 2H2HA 2LW7A 2RC6A 2P4EA 3MJFA 3P52A 4MV8A 5LM3A 2HJWA 3D02A 1UMCB 5FRDA 1BROA 4BBJA 4KBFA 2M1XA 3LKVA 2JA1A 1B42A 3B6MA 4FFLA 5HCUA 3V7FA 2OP1A 2QHXA 3GA5A 3OT5A 3OTGA 4HNAA 1UMCA 4QAJA 4OOFA 1JR6A 1E9CA 3EZNA 1CQWA 2ASVA 4F5EA 5J2UB 2PMKA 1IBSA 3I0ZA 2Z2ZA 3Q7PA 5HCNA 3NM5A 2ECOA 2BLLA 3HMKA 1P7WA 3JQGA 4PQFA 1M5RA 4C3HB 2Q29A 3A1WA 2FUNB 5JS8A 4PZ9A 4JIMA 2ATVA 3U9LA 5FTWA 4CL3A 4DYDA 3KSBC 3UQYS 1X1RA 1OYYA 3C3BA 5FTKA 2J0VA 3IIMA 4R7TA 1ONBA 2D7JA 3W4KA 1PGQA 1LK0A 3VX4A 1W34A 1TCUA 3B9PA 3EWNA 3JY6A 3KSMA 3L8GA 5ENDA 5FHQA 3VUFA 4BBSB 3S68A 5HIKA 2DHEA 2R9VA 3G59A 9LDBA 2YHSA 3HS3A 3OOEA 3PNPA 3LNCA 4FYVA 1E1CB 1YFZA 4GS5A 2DWUA 4PO9A 3VR5H 2DPGA 2VS1A 3FGNA 3HVUA 4Z0NA 1G8MA 2QX7A 1TTPB 3N2KB 1L7DA 1SVWA 3HACA 3NORA 3WGMA 1RAIA 4WGGA 5BXYA 3HLYA 821PA 2VTEA 2QTAA 2ZB7A 3F49S 1JALA 2YV4A 1FRZA 3FGPA 3ZD7A 1UDWA 4P3NA 3BD9A 3GFPA 2QRVA 4AURA 2JZCA 3P9RA 2BV3A 2CMFA 2H9YA 1U1EA 5DN6D 4BX2A 4CTMA 4GRDA 4LSGA 2EX0A 3AOEC 4KR9A 1FTQA 1SB8A 4YCMA 1SELA 5I48A 4EY4A 3HKCB 3WYCA 5BV1A 1YH3A 2HGSA 3FYUA 4EYQA 5FEMA 3SKYA 4X65B 1LBHA 3M4JA 4AYBB 5CJJA 1RRMA 1M7BA 4CI0B 5CA1A 4U6QA 1A9QA 3THRA 1JHVA 1E2PA 1KI6A 3FNEA 3MUNA 3VZBA 16PKA 2PPLA 1EJ6A 2G80A 1NVUQ 2NO0A 4REQB 4DV4B 1JSCA 2ID7A 5FPQA 1Z35A 1WMAA 4MW2A 3PL1A 3ONFA 3KB2A 3V1UA 2IV7A 3IESA 1B2RA 2A1IA 2ZUCA 3WGUA 5LPNA 2W8BA 4HRVA 1BVYF 1Q2UA 1WM1A 2FZVA 1NVDA 3R7LA 4AP5A 1U0GA 1M75A 1RYDA 1IPHA 3KDSE 4MUXA 1OFUA 2OCBA 4OHPA 3HB9A 3TZQA 2PZJA 4J6FA 2ZIUB 3R9XB 1UBRS 2JK1A 1VA5A 2VZLA 3LY5A 2VRCA 4IHAA 1P74A 4LY6A 2JVIA 2WV9A 4P7GA 2Q6OA 2HU2A 3AR4A 1Z5WA 3PP8A 2VYVD 1F9EA 3LPAA 1JFVA 1CLUA 5FWNA 3BWYA 4EVIA 3IQZA 3PHJA 4IDNA 3PFFA 1Z4KA 2X9LA 4M1WA 4JOQA 1EDDA 4IGFA 1J2EA 1HE2A 2X8JA 2XCIA 3CB4A 3FMFA 5A06A 4TQGA 3GAZA 4CKCA 4BFWA 5JCOC 5IK2D 4TQ9A 5LVAA 2OHXA 5F9HA 3DVAA 1NG1A 1DQYA 5F1KA 1SCKA 4ZJUA 6REQA 4CKEA 4N6GA 1NMZA 5ECYA 5DCLA 2O2ZA 2GJKA 4W99A 1Z47A 3WGYA 3BFJA 4E08A 4HVLA 1A7UA 3DW3X 3DHWC 4H7KA 2WWGA 2Q3DA 1NZFA 1P80A 3IELA 6REQB 3NDJA 1RXVA 1UBLS 1MEEA 3IAM6 5FFMA 5I5GA 1EE1A 1HBJA 2PGLA 4ZKEA 5LZ2A 3KAKA 2EFJA 1UZAA 4E6EA 3V80A 2GBPA 3H17A 3IMKA 3T3EA 2X0RA 1KEZA 2XGSA 4EABA 3DC2A 5CT8A 3UV7A 5KOHB 4KPFC 1J1ZA 1ESDA 1CDOA 1JFTA 2FR0A 1Z0KA 4MUEA 3COJA 3O03A 3HVRA 1XRMA 5BOVA 1UKEA 3A2NA 3MTQA 4QXRA 4YXWA 4D0LB 3AYXB 3GRRA 3PLAE 4JENA 4Q6BA 4GMFA 4GSYA 2M6KA 5JCPA 4NWIA 1GPBA 2RG7A 3O8LA 4TV9A 1WNTA 2HL6A 3JVEA 3KT3A 4FYHA 2VHQA 4Q3EA 2GN9A 3NTXA 1FSPA 3T7DA 4MSUA 1ZZGA 5CNJA 5CVEA 5I4KA 2OE2A 4MK4A 3SR3A 5FV4A 3AP2A 1E2BA 3AUTA 3HUTA 1WKBA 3IAS6 5KX5F 1KEKA 2PU7A 2VPPA 1TM5E 1RHRA 1PEAA 5CBPA 5FOTA 4NVRA 5H8WA 1J70A 3VZQA 4EFDA 4QTZA 5FWYA 2X2FA 5FF9A 1C2YA 2P5TB 3E53A 2XB8A 4XIGS 2C82A 1MC4A 2I3DA 1ZK3A 2BJHA 4LHSA 1NVBA 3BZBA 3ZD8A 1FU4A 5LDGA 4JLOA 1Y37A 4QUKA 4UVIA 2FLWA 3K2QA 3OC0A 3T0GA 5BYKA 4N7MA 1NUPA 4G84A 3CZMA 1AUVA 1B23P 2NU6B 1YACA 5B4VA 1G4HA 3F9IA 3JQ7B 2NU8A 3QHPA 1Y4ZA 1GL9B 3GDGA 1SQ6A 4PZLA 5KPDA 3CZPA 2JPDA 4DY6A 4AY4A 1AQJA 1K6JA 1BJKA 1L7MA 1EK5A 5AUPB 2FWJA 4EMBA 1M6YA 1DAIA 1K88A 3ROKA 4DZTA 1T9ZA 1U9IC 1Z83A 5BQFA 3K6SA 3NWBA 2PSDA 3D4BA 2OXIA 4Y2TA 1U99A 4PAMA 3BT7A 4XCQA 3LVFO 2G09A 5LB4A 2YFHA 1KXZA 1Q0SA 1L1EA 1PR9A 3CISA 3EXHA 2P90A 4NULA 5GP1A 1USKA 3OSUA 1QGZA 3WLQA 2A3NA 4ZVSA 2A6PA 1U3VA 3F6PA 4UDNA 3X1JA 4BNDB 4ENPA 4WNAB 3HY6A 4OA5A 3H9QA 1HLGA 3TO5A 4YCSA 2OKGA 2PL3A 3PI6A 3OMWA 4FCCA 1QHYA 1ULAA 2GJ4A 3P2JA 1HO3A 3HOZB 1QFSA 3C5HA 5JCJD 3E2PA 1FNMA 5JO9A 4NHEA 1PI3A 4BFTA 4JVLA 2W00A 1W85B 2P9TA 1YS6A 4JELA 3GRFA 3RQSA 2QEQA 1XLVA 3KHTA 4F2PA 1S3FA 2P9BA 1D7OA 5AKZA 1T8UA 3N7UA 3HE3A 1UOEA 1T0UA 1Q15A 4DLUA 3L4SO 3GIDA 5DHFA 4KE6A 1B8NA 3DNFA 1WBDA 3DTVB 1QYCA 4GR4A 1WOMA 2GA9A 4C4ZA 5TIIA 1BOOA 2NV0A 1T8TA 3UAVA 1YIOA 2ODQA 3KOOA 3GT7A 1PLJA 2YNMA 4LBWA 3BD8A 4LDRA 1G3QA 3JYNA 4I55F 2ZSEA 4KFUA 3EB9A 1GNSA 4N5LA 1EDEA 5D51S 4XD7D 5HQTA 4ONEA 3HP1A 1T91A 2WHPB 1LU9A 5K1ZA 3WRYA 5D6NA 3SX0A 5KDDA 3ZX4A 2CK3D 1RZUA 2J5RA 1VLQA 3N2NA 3SC4A 1FX0B 3DULA 4HDNA 3N7AA 2XB6A 5C7OO 2EDCA 2IDKA 2E21A 3ANXA 2OCPA 2ZITA 3T9FA 3TAUA 1UXGA 1I2ZA 2XE4A 1S7GA 4YJFB 4DR4B 2W2LA 1KMCA 4J0GA 2CF5A 3GLKA 2WIBA 2WM8A 3KE9A 3OVMA 4EG1A 3ABQB 1GA1A 1NJ5A 2VOJA 4LWOA 2A4MA 3ZVKA 2W2XA 5AVXA 2O0LA 3GD5A 3ZHZA 4ILKA 3CGGA 4BFUA 4E15A 1RXIA 1U80A 4JR2A 3LGAA 1E1RD 1RWWA 4LRUA 3ZWOA 3VHQA 2AC4A 1EZ1A 3JV7A 3IUYA 1DAPA 3UK1A 1CF2O 1DKNA 1RYEA 3G8DA 4M8KA 2X2EA 3CNHA 4LW8A 3L1KA 3O8NA 4UBOA 3SYLA 3NDPA 3U4QA 4PPQA 1LK5A 2YHBA 2A5YB 4EBBA 5IBPA 2GILA 2EKQA 3X2FA 1UQTA 2Q4OA 3HP4A 4E2FA 5ARCA 1W94A 5T8KA 2VUTA 2I2AA 1F4LA 3HPRA 3LFTA 4UNSA 4DLNA 3LP8A 4MVJE 1Q0RA 1Y5RA 2WW8A 1U4SA 2GCOA 3IJRA 1LJLA 5DEIA 3VKUA 1EBFA 4MJXA 1ECPA 4GVXA 3DLPX 3M4OB 3R0IA 5EJAA 2AGVA 1UF9A 4IP0A 3OA2A 3WRVA 4B32A 2AJLI 2DUJA 2QTZA 2Q5JA 4IWNA 1FFXB 4JC5A 5L7TA 1PTJA 2HJGA 3AUXA 3PXCX 2QM0A 1L9KA 2GXSA 4BXOB 4WNCA 1B43A 3EVCA 4PXAA 5IXYA 1E6CA 3KTOA 3SDZA 1QC5A 3U39A 1ISFA 4UUMA 1ZRSA 3G82C 3R0JA 5AM5A 3QPVA 3TSWA 3UXHA 2PWZA 2Q41A 1RLMA 2A14A 1H2XA 2NXJA 2XF8A 1ZI6A 2OV3A 3DMGA 4FTWA 4OO3A 1C1YA 3H5WA 1AB6A 1HNNA 5HQ3A 2F8TA 3T9DA 3COVA 4GI5A 1SB9A 2CHUA 4LBVA 1VOTA 2Y0DA 5JSKA 1ZPDA 1F0YA 5GVSA 2YZ7A 4BE4A 5E4JA 4HFJA 3FDXA 4MVCA 1NQWA 1MUUA 1S2LA 1VZ2A 1YA4A 4QX6A 3WO0A 5THKA 4TTTS 1N2IA 5EL0A 3QI2A 2A0XA 4R40A 1EWTA 1AXRA 3C4VA 3G7NA 3Q3EA 1Q17A 4K9QA 4C0LA 4DNQA 4OHFA 4DXDA 4F6CA 2P9YA 3U56A 3MXOA 4HNAB 5EP4A 4XYEA 1RBQA 1SEPA 1RW4A 2KLBA 4RULA 2CMHA 4HAZA 3ROPA 1R66A 5SZHB 1LBQA 3Q4GA 3FR7A 4D9FA 1K5HA 4C05A 1BXGA 4JVMA 5BNTA 1R0CA 2IHBA 4XB6B 3PHHA 5A3RA 3E61A 1W5AA 3T4EA 3WK8A 1GG8A 3LWBA 3VYRB 5ADHA 2P9JA 3H5OA 3QUBA 3Q2KA 3VNBA 1YZTA 4XVCA 3T1HB 4ND7A 1EXDA 2IS4A 1YR7A 1NVTA 1CQIB 1JPNA 1DAEA 1UT5A 2LBPA 1G9SA 3BXGA 3C3JA 3O4IA 3QVGA 4L08A 4FT4A 3S2FA 1U8TA 3IEIA 1DXYA 1GZHB 2FEKA 4YRZA 3QWFA 5EKDA 2QL7A 1YVUA 3QEOA 3KSUA 4LYJA 4EG4A 2W7TA 4J6EA 4AAYA 5CH5A 2Q3EA 4CMKA 1D2HA 1NTOA 3B1JA 4L0DA 4HRAA 1QG0A 1U5BB 3DO6A 4CMIB 2QRVB 3AILA 1XROA 3JQCA 2PRKA 4OGFA 5LQSA 3ZV7A 4YRDA 3V9PA 1O97C 3GJ4A 2A0YA 5AW4A 1Z2DA 1FRFS 1M72A 3A9CA 3D4NA 4HZGA 3RFUA 4HLUA 2HHJA 2UU9B 3CLSD 5JWHA 4Z49A 1K9SA 2ZYIA 3PFIA 1GLVA 5CM8B 1X1AA 4UCFA 3ZIAD 2Y0SB 3O74A 4MWSA 2QIOA 3IAM1 4FDVA 4H7DA 2PKXA 1KY5A 1E2KA 3P5SA 4LZJA 2ZDQA 4DQDA 3RVPA 1H42A 2P75A 4B6SA 5HWSA 5JCZA 1ZA1A 4YPVA 5AKEA 1OASA 4YAKA 4QM6A 5DM2A 2GX6A 4JYZA 1QVAA 2WLTA 5L40A 3OMXA 5THXA 5BPHA 3L01A 3WFZA 1TCVA 2JAXA 4HC4A 3EWSA 4ND8B 2WZDA 3BH0A 3ODGA 1Z5PA 2NYVA 2QU8A 3BXOA 2ZVPX 3INRA