2B1RA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with cellobiose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b1rA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2b1rA02
4YH1A 2P11A 1YDFA 2EAUA 2P27A 2CFRA 2D2VA 3U19A 4KNVA 3SLRA 3OCYA 4RESA 5ALYA 2JARA 1FEZA 5ALMA 2X4DA 3R9KA 1ZD5A 5AW9A 1TJ5A 3WK4A 1NRWA 3UMBA 1CR6A 2WHEA 4YGYA 1Z4JA 3PCTA 4OFZA 4ZEWA 2OA0A 5AVXA 4HGOA 1T5TA 1EK1A 1ZJJA 2G1AA 1TJ3A 3B9RA 4DWOA 3ZU6A 4BKMA 1XPJA 3W5BA 2WM8A 3NASA 2YMLA 3U13A 3WGUA 4DFDA 1Z4KA 4CF3A 4UMVA 2B0CA 4UU0A 1RKQA 3UMCA 2WF7A 4BBJA 1LTQA 3U7EB 1RRCA 5AVTA 3MMZA 3W5CA 3NRJA 5A3RA 3W5AA 3N1UA 4MWOA 3ZTWA 3ONNA 3EF0A 4UW9A 1L7PA 4EX7A 3GYGA 2QYHA 4XE5A 1YMQA 3CNHA 1L7OA 5AKGA 2WFAA 2DQSA 3AR6A 1WVIA 1NNLA 5ALUA 3U26A 4C4TA 3NAMA 1RLMA 2FPXA 1J8DA 3MN1A 5FP0A 3L1VA 1QYIA 4HGQA 4I9FA 5ALEA 2R8ZA 3IJ5A 3SF0A 1Z88A 5AM3A 5ALTA 3CZ4A 5AVQA 3FPSA 5AVZA 2CFTA 3J7TA 3EWIA 5AVRA 1F5SA 3NIWA 2FPSA 2GHTA 2C88A 1YNSA 2C8LA 4UAUA 5E0OA 1J97A 3L0BA 2QLTA 1QQ7A 2HO4A 3M1YA 2C4NA 2HEGA 3ZVNA 5AW0A 5AKXA 5ALXA 1L7NA 2YFYA 4GXTA 2HHLA 3KDPA 2JAUA 3IB6A 3L0CA 4GIBA 3E58A 2GMWA 1WR8A 4Y2QA 4NAVA 5ALJA 1RMTA 3KD3A 2FPRA 3DDHA 1Z4OA 2HF2A 3L8FA 4UU1A 5AI4A 2ZG6A 5ALQA 2ZBDA 4Y2PA 2HOQA 4BYGA 3WKDA 2WF6A 3QUTA 4CNQA 4L57A 2YBDA 1Q92A 2GFHA 5T41A 3N07A 1Z4MA 3E8MA 2C9MA 5ALNA 2G07A 4MUMA 1AQ6A 5AW7A 4Y2VA 2IOFK 3D6JA 3MPOA 5JJBA 2NO4A 1CQZA 4AS2A 4YCNA 1Z5UA 1YJ5A 3EPRA 4NV0A 5ALSA 3SKXA 3S6JA 4IG4A 3QXGA 2HI0A 1XVIA 2YJ5A 1QQ6A 3NALA 2I34A 4BNDA 2RB5A 3R4CA 5ALOA 3ZI4A 4UM7A 2I33A 3QX7A 2AMYA 4Y2YA 2WF9A 3OCZA 3HLTA 4Y2UA 5AVYA 1PW5A 3A1EA 3QGMA 1L6RA 5A3SA 4EENA 1Z4LA 4XOUA 4F71A 3ZTYA 2YMPA 2NO5A 4FYPA 1SWVA 3ZWDA 2WF5A 3E81A 5ALGA 4OHFA 3WK6A 5AW1A 4UARA 4EELA 3KZXA 4KYTA 3A1CA 3OCWA 1TE2A 3AR2A 4EX6A 1LVHA 3ZX5A 1RKUA 1RPZA 1SWWA 4Y3UA 3FVVA 2AH5A 2FPUA 3QU5A 4Y2SA 3L1UA 5IS2A 5ALFA 1JUDA 3QU2A 3QUBA 4ZEXA 2CN1A 2FEAA 1ZD3A 4FE3A 5AICA 3L8EA 5AW3A 3I76A 2FPWA 2NYVA 3I28A 2P69A 3MC1A 1S8OA 1RLTA 3WKAA 4ZEVA 5AI5A 5AM2A 4UASA 5AESA 3U7HB 3RFUA 1O08A 1U7PA 3AR9A 3L0YA 3M9LA 1RQLA 2R8YA 3FGOA 2G80A 2CFSA 2I54A 2G0AA 4G63A 4UMFA 4CF4A 2YY6A 3K1ZA 2JAOA 4AP9A 5ALLA 5AKKA 3QU9A 3R09A 3L8HA 3AR8A 5AVUA 2G06A 3ZUPA 2ZXEA 1RMQA 2W4MA 4UATA 5AKLA 5AM0A 5AI0A 5AKEA 2EATA 3ET4A 3N5KA 5AW6A 3W5DA 3NANA 3EF1A 2OM6A 3VAYA 3P96A 1TA0A 5AKIA 1EK2A 1U2TA 2YMQA 3AR3A 3OCXA 3AR5A 3WGVA 2P9JA 5AW8A 1L8OA 5AI9A 4CE6A 4BEWA 3WK8A 2ZBEA 3WK5A 1MH9A 3BA6A 4FFDA 1N9KA 2R8XA 4QQFA 4KNWA 4BX2A 3OTQA 2ZBGA 2BY4A 4OD0A 4YIHA 2FI1A 1KYTA 2YMMA 4RETA 3AR7A 1X42A 2YJ4A 3OCUA 5AKJA 5ALKA 3ESRA 5AK6A 3WKBA 3L8GA 1SU4A 3DNPA 4B6JA 4YIKA 3QYPA 2B8EA 4HYTA 2AGVA 4OCZA 2IOFA 5AIBA 4C4SA 1WZCA 3QU7A 2FUCA 3QUCA 4UMEA 3A3YA 4HGPA 4Y2XA 1L8LA 2FUEA 2RARA 2G08A 1N8NA 3E84A 1VJRA 4BEVA 1ZD4A 2RAVA 3L5KA 3NUQA 5ALIA 1VFPA 4Y2TA 1YS9A 1T5SA 2HCFA 5ALZA 5AK5A 3ZVMA 2YJ6A 4XPZA 1K1EA 3DV9A 3WKCA 2MSNA 1WPGA 5AW2A 3QU4A 3TLMA 5ALDA 4H1WA 3B9BA 1IWOA 4JB3A 2GO7A 2HX1A 2HSZA 4BX0A 2Q4RA 2OYCA 4G9BA 4HGRA 5AI8A 4NWIA 4HGNA 2O2XA 1YV9A 2PQ0A 3FM9A 3HYCA 1ZD2P 3L7YA 2OBBA 2YN4A 4QJBA 1ZRMA 5AKYA 5AW4A 2W11A 1Z5GA 2IYEA 3N8GA 2BDUA 3IRUA 5AK4A 4I9GA 4BX3A 2C8KA 2YJ3A 2JAWA 4JDPA 2IOHA 4L6CA 1RKVA 5ALWA 5AHXA 4KX5A 4C4RA 4EEKA 4HAIA 3U7FB 2EARA 3ZWKA 3BWVA 4O8CA 5ALHA 5AM4A 5AKZA 5AM1A 3SD7A 2B1RA 3ZW7A 4UAVA 3FZQA 4KN8A 2MU1A 4PNHA 3AR4A 1Z4IA 3ET5A 2ODAA 1S2OA 2I6XA 4KX3A 3PGVA 5AVWA 1ZS9A 3B8EA 2VKQA 4UM5A 4YCMA 3KBBA 5AM5A 3KC2A 1RDFA 1QH9A 3FPBA 1U7OA 2PKEA 5IT4A 3U7GA 1RC8A 4DCCA 4Y2RA 4EZEA 1RMYA 3ESQA 2B82A 3KOOA 3OPXA 1O03A 2G09A 5AK3A 2AUTA 3UM9A 1T9ZA 1QQ5A 4BNDB 2R8EA 2FDRA 3SKYA 1L7MA 5IT0A 5A3QA 4J03A 3OCVA 1ZOLA 5ALRA 2I7DA 1Z4QA 2Q4TA 2GHQA 2HDOA 2IA5A 4XQ0A 4NABA 3N28A 4AS3A 3SMVA 4Y2JA 1Y8AA 3ED5A 3PGLA 3PDWA 4CF5A 3F9RA 5ALPA 3ZX4A 5AVVA 3QLEA 2RBKA 2ZBFA 1U2SA 2O9JA 5AI6A 4L6AA 1U02A 3I6BA 3RF6A 2ZOSA 3A1DA 3WKEA 2I55A 4E88A 3I1YA 3DAOA 2Q5EA 5ALVA 3SHQA 5AIAA 4NFLA 2JGAA 4J2TA 5AKHA 3UMGA 1NF2A 1RLOA 1ZRNA 4UMDA 3ZVLA 3QNMA 2PR7A 1TJ4A 1Q91A 3WK9A 2B30A 1Z4NA 3QUQA 1VJ5A 1XP5A 1Z4PX 2WF8A 4F72A 4IFTA 5AW5A 2W43A 3WK7A 5AVSA 2HF7A 1RQNA 2BDEA 4YCLA 2B1QA 4DW8A 2B8JA
chains in the Genus database with same CATH superfamily
1VKZA 2O2SA 3C6BA 2IX9A 5JMPA 4I0WB 4KYVA 2PUWA 2YZKA 3QWBA 1WQ1R 1OZFA 2CLFB 1T25A 5DIZA 1K6IA 1L7XA 1ID8A 5HCNA 3VUFA 3OZEA 2ZJOA 4O4IA 4TMZA 2IJGX 2JHFA 3AVOA 3R6LA 1J5EB 2WSYB 1CRWG 2ZWIA 3DHVA 2CV0A 1NVBA 4J0KA 2CF5A 3QEKA 4ENUA 1HDXA 1ZG3A 4GPIB 4GECA 5IC4A 4KFTA 2VQEB 1AUOA 3FNIA 3GUUA 2AX4A 1WXWA 3DMHA 2TS1A 4X7PA 4US1R 3PXGA 3OOJA 3TJMA 1DEOA 2ZRMA 5JAMA 1Z4JA 3ZJUA 1PGPA 3OT5A 2PV7A 1EB9A 1G8GA 2CNWD 3K92A 5JLJA 4MV0A 1XPJA 1ZH6A 2GBPA 2JHAA 1BQ4A 1XLUA 3UHFA 5JI2E 2XWPA 3ABZA 2PL9A 2XAAA 4G89A 4MV5A 2FEXA 1RKQA 4G41A 4OQPA 4UU0A 2ZB2A 2WF7A 1G8FA 1NBOA 3OSUA 3ZU2A 2I3ZA 2FJ0A 3H5LA 4MWCA 2CCGA 4AMBA 4WOPA 1FXWF 4M6WB 4CCYB 4B6QA 1P44A 2QU7A 4URUR 2FLKA 4IJMA 1N0IA 1PFKA 1YA6A 3M81A 1NSYA 4ND1A 1AQYA 2OFXA 3GYGA 3U60B 4JLKA 3VZCA 2QJOA 2QQEA 1L1RA 3H9GA 3GELA 4MKFA 5AVOA 5JALA 1V95A 2WHRA 1NE7A 3GLHA 3I73A 3T95A 3ZNNA 3WYGA 1X74A 1ETUA 1OLSB 1G64A 3HCRA 3IQFA 4Y18A 3FHTA 2AOUB 4Q21A 1O2DA 1JBQA 2EW1A 3CY6A 1L5KA 5KHLB 3IVRA 4I19A 3MGKA 4Z1OA 2JIOA 4PHFA 2R6DA 1TO2E 1O94D 1AHHA 2PNFA 1B42A 3C6MA 4BRSA 3EZ6A 2FKNA 4CT5A 1AA6A 1X1RA 4PLPA 4CIYA 2UZ4A 5AM3A 4UBKA 1WM1A 3E22A 1K4MA 5ALTA 2CXSA 5CYOA 4WK4B 3JWGA 2QRVA 3QYAA 1L8QA 4YJ3B 2UYYA 4QUBA 4WY2A 2XE7A 5AVQA 1DO0A 2A9JA 2CFTA 5D5PA 2C2XA 1Q0RA 1UQUA 3PNBA 1NONA 4M0LA 1EFVB 4EYEA 2QQFA 2YY7A 3PYMA 3E3OA 3RHZA 4CM5A 5HKOA 1TYCA 3BCUA 1E2NA 4J75A 2B61A 2GAAA 4K6MA 5B55A 2NZVG 3IPAA 4FCWA 1EBUA 1V25A 3GLTA 3K5WA 3OX4A 4PCLA 4WZAE 3ULKA 3VU3A 4C88A 4NYIR 3EMKA 3GQBA 3V1TC 5FX2A 1AKMA 2L17A 2ORED 4XVUA 1B2LA 1C3OA 1VJ0A 4NLLA 5EZQA 3PG5A 1D3AA 1XAJA 1KZ6A 5K0NA 1CX9B 4QUJA 1K75A 1XXHE 2JAUA 2R5WA 4MWDA 3VX3A 3J81A 1UC4B 1IXYA 4J4TA 3AF2A 1W4RA 1DJNA 2HLDA 2NTYC 3NWOA 4C87A 2IKSA 3FPGA 4JBIA 1Z68A 3WYBA 4L85A 1NSTA 3CZRA 1Z6XA 1F2UA 3TN7A 2ZUDA 2H1CA 5FTMA 1T3ZA 1U3VA 2FPRA 5CW1A 2PZKA 1AH2A 3AFNA 2ZI5A 2AW5A 2PJZA 3O3MB 2ZG6A 1WXGA 1C81A 5CU7A 5B57C 3ND6A 4KQ9A 1LDMA 1RQ7A 2BFCA 1KS2A 2HOQA 1X8JA 1ZK1A 2VIIA 3MJEA 3AM3A 1HDCA 4KSCA 2CXOA 4GX5A 2G5GX 4P58A 1DGQA 2KJQA 4L57A 2XWBF 4KQMA 4RK5A 3W2IA 3OFKA 2ZKIA 1DC6A 1EDOA 1J39A 2JK0A 2ZGVA 1WKVA 1E3QA 4FZ5A 2PZMA 4JEUA 4MRNA 4IIDA 5IDVA 2FW7A 1SKMA 4MDFA 4A5OA 1P7ZA 4A8JB 1X7YB 3RBVA 2NO4A 1ZNYA 2OV3A 3NBZC 4GQIA 3RAJA 2HPAA 5BSUA 3VR6D 4B34A 1T2FA 3RK0A 5BSEA 4ADSG 4DPLA 1J06A 2D74A 4YPVA 3ENWA 3GGSA 4DY6A 3CX7A 1TC1A 1TM7E 3DF9A 2WE7A 4FOSA 5EAIA 2VHWA 1E0KA 1JPVA 2GFIA 2RC5A 4QLOA 5DB4A 3ITDA 4R2KA 1FFBA 1BZYA 5B58T 3GPBA 5HJ7A 3NAGA 4L8LA 1EP9A 2J7PA 1SKQA 3EZFA 5HF5A 2GJ9A 3FOWA 4HRYA 4RFVA 5DOVA 3K8QA 2JJ8A 3ZZMA 2O8BB 2AMYA 4CMIA 2WF9A 3JALB 3QJYA 4C6RA 1IQ0A 3ZDAA 1IY2A 1D07A 2O23A 1GTVA 3L05A 3OEYA 1N3LA 4IIGA 4X8OA 2YHSA 1IY0A 4YRPA 3QW2A 1GTSA 3AL2A 3EUEA 3IQHX 5HS4A 2FXIA 2J3QA 1W2HA 4E7OA 4FYPA 3AH8A 5G4LA 5JY1A 4M1KA 1OZGA 1TAUA 1VE3A 1NMEA 2Y1GA 4N8SA 4YK7A 2DF8A 3EGXA 3M3HA 3O6VA 4YRDA 1V1JA 4G1FA 4G1VA 4TKUA 1E63A 1EFUA 5IC6A 5IVIA 1GIAA 1Z2OX 1RJEA 1K7CA 1SIUA 3MM4A 3ZI0A 5C8XA 1NM5A 1ANKA 1YQEA 4HWKA 3RJTA 5I4KA 3LTEA 3PFGA 5JASA 2FWMX 2I7CA 2P2ZA 1NRXA 2ECKA 1TADA 1AK2A 1TU3A 1Q2UA 4MVJF 1BHJA 221PA 4Y6PA 1TQ8A 2YWHA 4MSUA 3F4KA 1MJ5A 2H16A 4ILKA 5E6UA 4GM4A 5DHRA 1SXJB 1L5HA 1MRSA 2E6UX 2K5UA 2FEAA 2BI8A 2YJTD 3WOHA 5LYJB 3PFIA 4KVGA 5FULA 2H59A 4MV4A 3U40A 5KS2A 1DOZA 4JAVC 1KDTA 1OXKB 1XL1A 1Z45A 2C5EA 2D1FA 1EE1A 1EFTA 2YV1A 1UJ4A 3BORA 3L6UA 5LZ7A 3T7EA 4RYDA 4BV9A 3JQ9A 4DLYA 5JQGF 3ILYA 1QZUA 5I4IA 3KYCB 4B2IA 4PSUA 1JG2A 1NW5A 4HQLA 3EVTA 2QS9A 3RIHA 4WEQA 5LSAA 2I7VA 2O1EA 4L78A 1ZR4A 3DZKA 2A8YA 2XYQA 5TQ0B 5CM8B 5DBFA 4AMGA 4EPTA 3ZNPA 4Z7JA 1BOFA 3IS3A 3ZDRA 2E4VA 2V9CA 4PNEA 3RUAA 1Z74A 2I65A 1U3WA 4MUJA 1RQLA 4RKEA 4V0KA 5E6SA 3V8PA 2Q9BA 4QBFA 3R7NA 3TGWA 2I54A 2O50A 4FR0A 4G65A 4MPDA 2E4XA 2IUSA 3S2EA 2ZRLA 3NJ8A 2Y67A 3PUZA 4D4MA 1L5QA 2QENA 1ZMTA 3AOEC 4U1RA 3CF4A 4AKTA 3RJZA 4LYHA 4MEJA 5B1YA 4J7UA 3EWAA 3KYJB 3TI7A 3VV3A 4YHHB 2VL7A 1VL1A 3AR8A 3PR2B 1J0AA 1UK6A 1Y8QB 3C6ZA 4LBZA 4HN9A 3DFFA 4CL8A 4MQBA 1F60A 1R0KA 3G89A 1J8MF 1PT8A 4DVJA 3Q3HA 2XOKA 1P73A 1K0FA 3BTOA 3HM2A 3H7IA 1IUKA 1MW9X 4XCQA 4Z86A 1FYFA 1XC7A 3E9RA 1V3VA 1YS2X 4HDOB 2ZB4A 2IYFA 4RTSA 4IQ8A 4EUFA 1HGXA 2GYUA 2PLRA 3KJNA 1XN4A 4RM3A 4JK3A 4IHJB 1Y3CE 3AX6A 2CW5A 1L7EA 4AKSA 2WIDA 4YJGA 2Q7OE 3SZUA 2C5GA 1T5IA 2R2AA 2JH8A 2QUHA 2ERCA 3LG2A 3CKMA 5IUNC 1YH3A 3L41A 4Z9FA 4IDCA 1VC2A 5ICFA 4FLEA 5E6RB 3ZVRA 3ZHTA 2ZR8A 1AT1A 3DV0A 4MQFB 3Q0IA 2JDID 3MZ0A 2B63B 1GPAA 1XCBA 2PCJA 4X63A 2FOIA 4CKEA 5BV8A 6GPBA 4LQCA 5E8JA 2R92B 2ZAMA 4IS3A 5AK6A 1US8A 1MF7A 4W7IA 1GUAA 2CMHA 2ZLBA 1HE2A 4WZZA 1XA0A 1E2FA 2KW5A 3CU5A 3MT0A 1AG9A 1QIEA 5IAJA 3U3RA 2PZLA 3FOEC 3T3NA 5AIBA 5BUZA 2FHSA 3D0QA 5FADA 3CUSA 5EGSA 3CVOA 1VMDA 2BEVB 4KH1A 3LLSA 5TF4A 1Q0UA 3V9PA 1SNYA 2FUEA 2LTAA 1WU8A 4A2QA 4CMHA 4C2UA 3DG9A 4GPTA 4LJ6A 1GTZA 2V7WA 1PVOA 3GUZA 1C0EA 3OIWA 3LC1O 4JIGA 5ALIA 2V3CC 1F4PA 4FMCB 2DHQA 4JC8A 1Y4DE 3MILA 5SY4A 2HCFA 5ALZA 5J2UB 2ZJ3A 1TRHA 3O94A 4LQLA 1VKHA 1AQNA 4W5OA 3I8OA 3DL2A 3H6HA 5HQTA 3UJPA 5E7MA 2BGUA 1VE5A 1WHTA 4EPYA 3D3KA 1K7EB 3AYXB 4IILA 3R6GA 3X1YA 1FQOA 3K9CA 2RBEA 3KCQA 4Q1AA 1T2CA 4JJGA 3TLMA 4LZZA 1EINA 1Q0QA 1IWOA 1DDIA 4CN8A 5KSOA 2VJDA 3VR6A 3AVXA 1IQUA 2JLUA 3I04M 2W2MA 1T3HA 1DFGA 4CGZA 1E1RA 2E2IB 3HHPA 1B0ZA 4F96A 2H06A 4DILA 3DBIA 1E3MA 2JFZA 3NVAA 4QXRA 1KVSA 3G88A 3IOMA 1U90A 2O2XA 1K5HA 4E1BA 3B85A 2H17A 3VH1A 2Q3MA 2XECA 1SPXA 2BDUA 3NTXA 3KL4A 4D81A 1E1CB 5AK4A 2V6GA 2CYBA 3HVKA 1VJ1A 1A71A 4NK5A 3ZI7A 2J0QA 2OHXA 2Q0XA 3A25A 3OA2A 1A69A 1RKVA 1ZBDA 3JYOA 3ACDA 3OFJA 3W5UA 3STYA 4YLEA 5JS7A 4O5AA 4INAA 4KGVA 3QJGA 4JXJA 3U7FB 2R6AA 2GD1O 1FNCA 3NDJA 1J1ZA 1E58A 2H0AA 1R4NB 2AC2A 3U09A 1DAEA 2V6IA 2VUIB 3MMPA 4YAOA 4LXHA 1Z6QA 1X8XA 3UB4A 2ETXA 4TRMA 3ZIAA 4ZCPA 4OLBA 4X44A 4Y1FA 2V1UA 5GZ1A 5LBTA 3T3GA 2AHOA 3ND9A 1FMFA 4HZUB 4G0QA 1YK0A 2VI5A 5HTKA 1OH6A 3G0HA 5ECGC 4L4XA 4YR9A 3RAEC 2R7ZB 5LB2A 1ZGCA 3E1KA 4DJDC 1QIFA 3OQPA 2O3QA 4JP3A 3PT5A 3BA1A 3U17A 4AB1A 3R7BA 1N57A 3GLGA 2X9LA 2ZU6A 1O7JA 1Q20A 3JQAB 5C9ZA 2ANCA 1WHSB 2H08A 4XIGS 1F2TA 1NWHA 2OHGA 3DFZA 4YDHB 1GPMA 7AT1A 5FLYA 4KR9A 4N48A 3SEZA 1CUGA 1FTSA 1OSNA 2XLCA 2CZCA 2ZYWX 3LO5A 1EP1B 4GZ6A 3L6BA 2OKGA 5KX5A 4RKFA 3H2GA 1LK5A 4P82A 3SM9A 1NTOA 2CLOB 4YMVA 5F7OA 1MC8A 4IIHA 3EX7C 2ZB3A 3I12A 5LBIA 1N25A 4ZMRA 2LPMA 1E9EA 5KYGA 3VTKA 1UJCA 2M32A 4MP3A 4CKWA 2ALJA 1JLMA 2XY4A 2F4VB 4MS3A 5T8KC 4QBIA 3SJ7A 2BKEA 3JSXA 1KL7A 4L4RA 4Q5IA 3UM9A 3DHYA 2C99A 1DUVG 1DVRA 4Q93A 5EHIA 4OPMA 3CIOA 5IJZA 4FOLA 3UNXA 1KIMA 5HF9A 3VKVA 1I5RA 2Z8ZA 5J4LA 2QVXX 1BMFD 3ZS8A 4DCNA 1XCMA 4YJKA 1CK4A 1ZD1A 4P4GA 1IJFA 2OAQ1 1HETA 4IR7A 1ZEMA 2BMDA 3L01A 1DC3A 4L0DA 2BN4A 4AWAA 4KPYA 2FQYA 3B7GA 4HDAA 1ZVKA 4K03A 3OFND 4UHFA 8ATCA 3UAZA 2OO5C 3RK1A 5EKDA 4WGGA 4BRUA 4NABA 3MOSA 3GJ4A 3PRHA 3V8RA 3N2YA 4BN4A 3SEQA 2CLSA 3RBXA 1PP4A 4GMKA 4GPD1 4PZYA 4V0ME 2QUZA 1LH0A 1Y8AA 4CF5A 1BS1A 3ZWXA 4AQ7A 2XR1A 3F9RA 1D9XA 3ACBA 1OZHA 1YHYA 1EVKA 2EQBA 3BHIA 3HVIA 4RWZA 5HTOA 2IDZA 1K9VF 1P39A 2OECA 3PNVA 1NNI1 4MQMA 2MSKA 3FPLA 4ARAA 4FKZA 1U0HC 4DDUA 5LOVF 5F77A 3D4OA 2H2FA 1M1NA 2A94A 4RU1A 3OJFA 3RASA 1XQ1A 1ZHHA 4B4DA 3DEYX 3D6HA 4RTLA 5J2TF 3QX3A 3IXQA 1NBAA 4HSGA 3GIDA 1U65A 4WNAB 4WLUA 5KTKA 5KVQA 5ALVA 3UPUA 4MQEA 2O7RA 4IP0A 5CB4B 2RHCA 2X8AA 1ZCZA 2C82A 1I4WA 4J2TA 4AO8A 1RWQA 4DG9A 3ZE9A 1UXIA 1GGKA 3RVKA 3RAFC 2W8BA 5K8LA 3ISTA 2AIRA 2V5AA 2WA1A 3D0OA 1U1DA 3AY0A 3IODA 2ZPUA 2WD9A 1WZUA 4MYSA 1SBTA 4S1NA 5ELXA 3GDGA 1FSGA 4AJJA 3F6RA 2OQIA 5E2BA 4AJNA 2PYZA 4AY4A 5HEKA 1U1EA 5ED0A 1FA9A 1VL8A 1JG3A 3D54D 3EAFA 2VZ9A 4B6PA 4EYKA 2EBUA 4ISCA 5DHUA 1ISJA 4O2RA 3NKFA 3K94A 5AK0A 3VNQA 3BMQA 2ARKA 1H2EA 4RHUA 2LKDA 4NV1A 5DN6A 3STUA 3WB1A 1NBEA 2P2LA 2V3VA 3CUKA 2FN3A 3GUYA 3PKJA 4G3XA 4GICA 3COPA 4DW8A 1PV4A 4NCBA 3R9IA 1RHJA 4MKRA 2F2TA 3KSMA 3VSAA 1PWEA 2FX2A 3LAWA 2QNRA 3EIEA 5WRFA 2OV8A 3E7DA 4EUSA 1NP3A 3EXG2 2IDKA 1JHVA 1N2BA 2PVCA 2VK1A 1UOQA 3I01A 3FN4A 3FTCA 5BQ3A 1AO3A 5KVCA 3MJHA 2CMFA 5BN1A 3FYUC 4K1LA 5ALMA 5DLEA 2X4DA 5B5SA 2XGSA 5C8ZA 2WWVD 5EOVA 3O74A 1U0LA 5A7GA 3J7AC 4FSXA 1VP3A 1Z16A 1CR2A 1EVQA 2W2NA 3N2GA 1DTSA 3NTRA 1MX5A 3NLLA 1ZGGA 4JSYA 1UBLS 2XEXA 3SSMA 4JOBA 4E1AA 3CG4A 3BMCA 3NCTA 4AY6A 4XB2A 3M5WA 1TJPB 4W5RA 3GT0A 2YIDA 1L3IA 2GD6A 2VYQA 4LOAA 2XNHA 1CKEA 2WM8A 3NASA 3WGUA 3A11A 3E48A 1U98A 1NLYA 4OFBA 1NOIA 2WTXA 3HB9A 3T7KA 1E61A 3UO8B 4C05A 4A26A 4BFXA 1N2CE 2GLXA 2OQRA 3OOYA 4B2LA 5LOVA 4KXLA 4PU0A 1HNWB 1AQLA 1XU9A 3CZQA 3ZZNA 1W0JD 3I5MA 1NOJA 5KYWB 3N2KB 3NRJA 4Z4HA 2N46A 1JWLA 3KLMX 5FWXA 3HNRA 3IEMA 3DOEA 3LXXA 2MSEB 4JXXA 4F86A 2Z3ZA 3JPWA 5KNLA 1Z0JA 4LHZA 3GMTA 3ND8A 1N5MA 1P33A 4UW9A 3E7WA 3WRXC 1KVTA 1UC5B 3CNHA 4I50F 2DJ5A 2ZBUA 5AKGA 2X6RA 3E23A 2Q6IA 1ZD9A 3LVFO 4MROA 3FTFA 1J00A 1Z75A 2CMGA 1WVIA 1XSEA 3PJGA 5DRTA 5ILGA 3TXXA 5B30A 1Z0SA 2PK3A 2NUAA 4FGKA 1L8AA 2P0AA 3BXOA 1FIUA 4Z3OA 3YASA 1Y8ZA 3I83A 4H1VA 4MGZR 3DBOB 1ZGHA 2OG1A 8OHMA 5HYVA 2NXCA 1CJUC 4TLAA 5EJIA 3W7BA 1W25A 1VSTA 3PTAA 2C42A 2YHAA 2OE2A 3H5VA 4LC1A 3ABSB 4B3GA 4RX1A 2B35A 3HFRA 4JELA 3TLJA 4ZYTA 4MR8A 4OBBA 3L2OB 1E1MA 1DPFA 4ID9A 2HCRA 3V3TA 1ZN8A 3OAAD 4ESHA 1L0BA 1QAMA 3QHPA 5DHSA 1Q0LA 5DNVA 3N0XA 2BEWA 2FMXA 3NIBA 4PYNA 4P54A 4O8ZA 3TW8A 4B8YA 1PR2A 4FFRA 4E5YA 2IS4A 4D5GA 2WU3A 3JQ8B 3CB4A 2SECE 5AW0A 3FNFA 1HEIA 3IVAA 2IYZA 1C1HA 5CFMA 3GROA 1RAHA 3TB4A 2JAHA 1L7NA 4KQJA 5KTSA 2PJRA 3IB6A 4HXFB 3MW8A 4U7FA 1Y1TA 2DT8A 1A9XB 2QLJA 5JBIA 1G3RA 5JRDS 1XPUA 4YP9A 1T5DX 2O2CA 3E9ZA 3E58A 4US0R 2QQ0A 4IZIA 2BMEA 4D44A 4WN9A 2JNWA 2NZ8A 2VDJA 5FPYA 4PBSA 1B76A 2NNLD 4ALIA 5DE3A 3LVQE 2BGNA 1ZOOA 3T5AA 5G2OA 3KJZA 3EA0A 4K6OA 2O8FA 1UZNA 3L0PA 4RQUA 4UU1A 3TNYA 2IUUA 2WKQA 3T3PB 1K3TA 5NLLA 5BT8A 2I66A 3HDHA 3HKBA 2IZ6A 3E8SA 3A6KA 4IXWA 1X70A 1ONPA 4G0XA 4YCBA 2JI6A 1N6LA 5F4ZA 3MTDA 2B20A 1S2DA 2XT9A 2XGGA 1A2BA 1P8JA 1H66A 1Q92A 2GXUA 2J9GA 1E6KA 2NSHA 2XT0A 3IDSA 3L6CA 3N07A 4ND6A 3UW1A 5A1JA 4URXR 4D26A 1JECA 1I50B 3T5CA 1XCGB 4PVCA 2VJLA 1XZDA 4YV0A 5H4HA 4OY3A 2QRKA 5KYTA 4M8LA 5M3BA 1N2IA 3MTIA 2W6ZA 5E4FA 1S3FA 1GZ4A 2GTHA 3ZK9A 2P2NA 1NC3A 2D0IA 1K6EA 1B6RA 1V2GA 2OK8A 2G63A 3QVMA 3HUFA 2A5GA 5JNTA 5LUAA 1Z5NA 2HPVA 3G1TA 4LRWA 4BWVA 3PIIA 2MHCA 4EW3A 1FFWA 1CNMA 1KDVA 4CLRA 4XQEA 5ITZB 4LDPA 5F52A 3DLBA 4R1QA 2PXHA 1Y4SA 3C8ZA 4UHHA 4RAQA 1QZ3A 2UZ3A 5DNYB 4EGSA 5KNCA 3R7SA 1NFQA 1KI6A 2AEFA 3T1YB 1BA3A 4M83A 3T9FA 5TEVA 2C0QA 4S0XA 1VE7A 2GN8A 2IEYA 4ZVRA 4BC0A 2BEKA 2OLEA 1RI5A 1O95C 3ELYA 2F64A 4Q6WA 5D3QA 3STHA 4RYLA 1TZBA 4NJEB 4B46A 4DB4A 1H2WA 1MMFB 4WOJA 4PXSA 4FYXA 4YJ2A 2G4VA 1FVHA 1ESDA 3KTAB 4YRFA 2CNNA 3A1CA 5I8WA 1S4QA 3IA2A 3PJRA 1DHRA 1HE1C 2LDBA 5JSQA 5LXTF 3SE0A 1SCQA 2JASA 5M3FB 3O1LA 1F0NA 4Y3UA 5IYZB 4BLWA 3CR7A 3CX6A 3OM9A 5ER9A 2FUG1 2GS9A 4IJQA 2TMKA 1E6EA 1M7HA 1KQNA 4G5XA 1FZTA 3IAM6 2R8OA 2CZQA 3QU5A 3K0AB 3L1UA 1TW3A 4AAYA 3EYWA 4JIMA 4WMLA 1GWNA 1SXHA 4YP5A 4E4RA 5CXQA 1HOXA 4CIBA 4JB8A 1II0A 2YXNA 3DOHA 1G8MA 3VZDA 3WLQA 1MXHA 3FBGA 3KJFA 4DA0A 5JDCC 5AICA 2HMSA 3ANSA 1VBMA 1MV5A 3E4DA 3FWHA 4PSKA 4WW0A 1VL2A 1YJAA 4L3OA 1XNRB 1GG8A 1ECJA 1NDHA 5CX1B 2C4UA 1QPGA 3GGGA 3INNA 3QF4A 1V16A 1XKXA 3AEQB 3DYBA 4PM4A 2NVUB 3BTUA 2G9QA 4CR8A 4F8YA 4GBJA 5A62A 4L5AA 2P3SA 2OQVA 3G79A 1HNXB 4LDQA 3ESDA 3P45A 3BWMA 4D02A 2Z2YA 4WOKA 4IIFA 4Z1MA 5JH7B 3MVEA 5G4KB 2VR1A 2ZI7A 4REQB 4YTEA 2DFDA 3LF2A 5I5EA 4UXIA 4IAOA 1JEAA 3EXEB 4MI9A 3T7RA 3WLKX 4I4TA 4MXDA 3X1JA 2JGNA 2TMYA 2JS7A 1T4DA 2WUDA 2Z08A 3LPCA 4QA9A 3EEIA 1JAHA 4XEHA 5C7LO 5DGDA 5CH3A 1JR4A 3CSSA 2L69A 3AM5A 3F8TA 2DQKA 1KZGB 4J0CA 1ONSA 4NCJA 1E7YA 3FDIA 4KL8S 5HE9A 3RK4A 4M0DA 3CPHA 2HIGA 2AKAB 3H2ZA 4DLAA 1GUFA 1GDHA 2B0JA 2OVFA 3DD5A 3G13A 5EEGA 2GPWA 3WI7A 3UIEA 2X7XA 3R9WA 4X62B 3ZJVA 4QLAA 1N0UA 2Z3WA 4JOCA 4DXHA 3N5KA 5TMPA 4B9EA 4EGFA 2REXB 2ZIXB 3EF1A 4NI5A 1WY7A 2CLLB 5EZ5A 1H0RA 2GXQA 3P96A 4N47A 1R6TA 3PUHA 1PT7A 3GFBA 1U2TA 1GCOA 3JQ7A 4GR9A 4DMKA 3KR1A 2HXGA 4A6XA 2HXYA 1EFAA 1R16A 2JLBA 4C01A 4OI4A 3WGVA 5AW8A 5CK5A 4BRZA 4FILA 2YDXA 1HRDA 3VHLB 2PJDA 3FWNA 3KPUA 3Q5EA 2BGLA 1EXMA 3WRVA 4B4VA 4HRXA 2RAUA 1H4SA 1YFKA 3V1UA 2A5FA 5AMXA 3VDRA 3OAAA 4Q3AA 1NJ1A 3D4IA 3F4LA 1M6VB 1JTEA 3OZRA 1XRPA 3KQMA 4HX2A 3OETA 4JFRA 3RRXA 4E7PA 3HO1A 2PU7A 2OXFA 1SBZA 3AR7A 5BN5B 2I2DA 3GPLA 4MUEA 2CNLA 2XPCA 4OQNA 4LG1A 4QU9A 4CQMA 3DNPA 2V7QD 6PFKA 3VOBA 5ED4A 2X3FA 4IGIA 4Z7NB 2ECOA 5EQFA 3EQ2A 2PX0A 5K3FA 3BN3A 3FUXA 3ZEAA 3AY6A 1PEYA 3F96A 2ZQ5A 3PR3A 3T5PA 3JAKB 4RABA 4I5GA 3QUCA 1E9CA 2BE9A 3C7KA 2CGEA 4IW3B 4CBVA 3WGMA 2BI4A 4NIMA 2IFTA 2O5CA 2EFJA 3TQQA 4C3ZA 1B6GA 2I2FA 4M8IA 4NOKA 1YRYE 2X40A 1GDTA 3Q6IA 4C7OB 3PC2A 4DV0B 2DKOA 1LW7A 5G1PA 2FRXA 3A3KA 3HYRA 3HXQA 4S24A 4XFKA 1OXUA 5EPOA 5J1TB 4KLCA 3OU6A 3RWBA 4CV3A 1QUFA 3RYIA 4INPA 1Y3AA 4ZC8A 4H1WA 1MPTA 4KN9S 5JJ5A 3VKHA 3UOGA 1U8YA 2GO7A 1I24A 3A04A 3N86A 4UUPA 2XBUA 3A4NA 1JSCA 4NNJA 5AOAA 4EARA 1UJ6A 3STXA 5M2QA 3FPFA 2ZE8A 1C9DB 1JBEA 1IHOA 3INGA 4F9FA 3FM9A 3HYCA 2A1UA 4JXKA 1QNLA 1ZRMA 1TEZA 2CHUA 2W11A 1P2UA 1YR7A 4M9UA 1AGNA 1Q7GA 2OAEA 5JG7A 4O3FA 3D4BA 2BFFB 2HWXA 4JA2A 2IOHA 4HWPA 3DEJA 1EK0A 2FZLA 2PL5A 3FE2A 1IJEA 2GNOA 4L6CA 4MO2A 4QT0A 3RFXA 4ARCA 1FXUA 3AO0B 4IQ4A 5CJJA 1XZIA 3H9UA 3RS9A 3CRZA 1KO7A 2GM5A 3F71A 3L07A 5E7IA 2OWDA 2W8ZA 5C7OO 1GUYA 1J5PA 2CB9A 1TM2A 4PO3X 3URMA 1PAUA 2F3PA 3BWVA 4XZ3A 5ITWA 1E6UA 1CUIA 2JAQA 5CXXA 1K8XB 3GJ7A 4ZV4A 5G40A 1WZIA 2IHYA 3H9QA 3QUSA 4RNCA 1BX3A 4WDRA 4EFDA 4UVDA 2C0PA 4H17A 3I6MA 2QLMA 4KO8A 1TYBE 4JGGA 2WWHA 5AKZA 3SD7A 3TYXA 3EG5A 1XZHA 2A6PA 2OCDA 4RQBA 3PFBA 4UAVA 3ZD6A 4P80A 1E9BA 4L9AA 3KYIB 3TO5A 1R4AA 4FFNA 1PSWA 1P18A 3CR3C 4X1OA 1Q0PA 3AR4A 4RTMA 1VLZA 3W8NA 5KNDD 4ZJZA 3UK1A 1M2GA 2WWTA 2HCJB 3TX2A 2GN9A 5FR2A 3VXKA 5EWJB 2ESRA 4O1HA 4YUAA 1XZJA 4GL4A 2IYOA 2I29A 2FDCA 3BC1A 4O59O 5FTJA 1SKYB 4FFWA 2VHTA 2OO3A 3JQPA 4ICIA 1QH9A 4E32A 1K08A 1BAPA 2VP0A 4Q3BA 2IYAA 4MI1A 1XMXA 1JA0A 1ICIA 2V59A 2JBAB 1RMYA 1G6OA 3LFHA 2O8DA 4KPUB 3FZGA 1JR6A 3D64A 2G09A 1E1QA 4OGLA 4C7JA 4QDZA 3VKWA 3G7NA 3T4PA 1BKDR 4FDLA 4BNDB 4C06A 2E6KA 3HEMA 1NBME 3DW3X 3QPDA 4R83A 4B48A 5BNZA 5CFOA 1ZJYA 3NHZA 4HMOA 4CU5A 4PX5A 1R8YA 5KINB 4MVJH 3IKLA 3KHKA 2PUJA 1P3DA 3WICA 3N8HA 3N53A 3DXYA 5LD2B 4O4IB 1V4NA 1YA4A 3KXIA 2XZLA 1NVXQ 4GOXA 5DTJA 4JYCA 4TM8A 2OLJA 4AS3A 2WIAA 1ZSNA 4MI6A 2R1UA 1T43A 3V33A 1E7WA 1S96A 4KYIB 4BTEA 5HQ3A 4ZODA 4MLCA 3N0VA 1LGYA 3MHPA 1K7YA 3RM3A 5HUQA 3H4TA 2N0SA 3QENA 5DGHA 5HIKA 5TLSA 2IL1A 5EINA 2V45A 5CCBA 1PJ2A 2QE7A 3RF6A 1CUSA 1XDDA 4BNGA 2C7RA 2DY0A 3A70A 4MWGA 3I37X 1L5YA 3ZD7A 1HYBA 2Q5EA 4CM8B 1QMPA 2IW1A 3NV7A 1SC4A 2O1XA 3P0EA 4CFSA 1CF4A 1KVUA 3TCNA 2KHZA 1FC0A 3E9EA 4JUBA 2LV8A 4PC1A 5AKHA 4EPVA 1EIZA 1U63A 1M2NA 1NT4A 4G0VA 1J2JA 3D6NB 1T8TA 2MYUA 3OHSX 3E03A 1ATIA 2LBPA 2O7SA 1OPRA 2WC1A 1IXSB 4C0BA 4BNLA 3AY3A 5CDSA 4XUCA 3RODA 2WPNA 2W6ID 2GA8A 5JFTA 5EZYF 1TKBA 1YFZA 5DK4A 2XKBA 1I5EA 2WRZA 1CY6A 2FZ4A 2LCIA 3GLHB 3HSKA 3HVUA 1ECPA 1Y34E 4W4TA 4ZV7A 3S14B 3FKIB 1MHPA 4B0PA 5JI3E 5EC8A 3KZVA 2CBXA 1QS0A 3O4FA 5IJ0A 3SC2A 1R1DA 3GEIA 3UK2A 1IEXA 4PE5B 4OQQA 4XYGA 2EAUA 1FOEB 3E22B 3OZAA 4U8GA 2QRVB 4DZTA 1DCMA 3IO5A 4LXQA 3LCRA 4XI9A 3ZLUA 5KWVA 3KSBC 4KIGA 3N6XA 3O2SB 1U8ZA 4QUGA 5EWMA 5BVGA 4PYOA 2F1OA 2AC4A 3THRA 1QPZA 1R66A 1NQTA 3C8UA 4NJOA 4COOA 3I4NB 1M83A 3PXUA 1V43A 2X77A 5HM6A 5ICSA 1SKUA 3W6PA 5K5EA 3UGJA 1OV6A 2PY6A 1BRTA 4D6YA 4YGYA 1M72A 2V6JA 2RE8A 1JTVA 4RF4A 3GQBB 4L6IA 1QO0A 2WJPA 1C3OB 5AHRA 1NKVA 1NVUQ 4JEMA 5KWSA 2A14A 1T1RA 2W2VA 4B40A 3S2YA 1I7DA 1NE2A 2O3SA 1SUBA 3FCSB 5BWLA 1MIHA 1UWVA 3FKSD 3UT6A 3WWYA 4D9BA 2H18A 4E1VA 2JIPA 4GI7A 4EY4A 2VLBA 3MJSA 3FI0A 1EHYA 3VFDA 1T0IA 3X1ZA 1DQZA 2VUTA 5I45A 1UKEA 3GJ3A 3HWSA 3MS7A 5ESWA 1F2UB 2AFHE 4HG2A 1QR2A 1H5UA 1FX1A 1JNYA 4EHFA 3FLAA 3CX3A 4ML3A 1W35A 2BFCB 3OQBA 2VF2A 2ZWPA 3PA8A 4BFTA 1ZM9A 3ZE8A 4B3FX 2XDAA 1QQAA 5EIBC 2KBEA 4XLTA 2NXNA 3K9QO 1QH8A 2ONYA 2XUDA 4FYMA 2Z8XA 1NNLA 4RTKA 3AEKA 1KAHA 3MJDA 5B1SA 2ZAIA 3UWPA 2DAPA 2HNBA 1H5QA 1N2HA 3AV0B 4I5IA 1IHYA 1TFRA 4BO5A 3LDGA 4LEIA 2GHRA 3H4VA 4NMMA 1NGSA 4NXMB 5LP6C 3JRWA 3KTDA 4XJXA 3PUJA 6CHYA 1HFWA 3F3SA 3ZV6A 2ZR0A 4B3DA 3ZDDA 5BYKA 1ZINA 4MP8A 5C4MA 1J99A 3GEEA 4PRYA 3C39A 3O3NB 2XRYA 4YRJA 2YXLA 2VDQB 5FNZA 1ZZGA 2EKZA 1P81A 1G5HA 4Q7QA 3NWJA 1LX7A 1A9TA 5GZ3A 2QX8A 1CZRA 2J59A 2JI9A 3O8BA 2QTRA 3OTGA 1VIDA 4NQRA 4P2GA 1XZ8A 2QLTA 3T6KA 3P4YA 1O95D 2AT1A 2VJCA 2W71A 3AT1A 3DEFA 3HCAA 4BKPA 4CMIB 2ZS8A 4RDCA 1ZMRA 4P08A 3I5XA 2D62A 1BH6A 1D2MA 4I1OA 5KQPA 5TVKA 2F8TA 2VF7A 2YFYA 2L18A 2FPPA 1ZNXA 3HPQA 3ORYA 4HAOA 3GR6A 4KZPA 5FQNA 3U0VA 3CM0A 2GNAA 1X15A 4AVYA 1EE2A 4DOMA 1Z2PX 2VTKA 3EGXB 4EYOA 3UWSA 1NXTA 1PT9A 4TKUB 4WE3A 3ZIDA 5C5DA 4FN4A 4DMUB 4F3TA 1N7IA 3W4KA 1QFYA 3JZIA 2YXEA 1C9YA 3CZMA 3GEMA 3INYA 3PT9A 3R77A 3PXCX 4E46A 4OO3A 1R0BA 1JALA 4CCAA 3B6EA 3RT1A 1EXDA 1CETA 1YVUA 2YIVX 3EARA 3IIKA 1GFSA 3SMQA 3TFWA 2H5LA 1YE3A 2H0RA 5E6UB 3ZNOA 3DL0A 1F20A 1L5HB 4IQGA 3ER9A 1AS3A 3NM5A 4OHPA 3AF3A 3H5WA 4GZ5A 2KMLA 4H7FA 3TLEA 5HJ5A 1ZWKA 1K89A 5EYPA 4MUMA 4WI1A 4M49A 3WMWA 1FF9A 2OKCA 4JWTA 2TECE 1A5ZA 3MPOA 4HQFA 2EZ8A 1SXGA 3VH2A 1DLJA 1CUAA 1VLVA 1JAZA 1I0LA 2I80A 3L06A 3N0WA 4KBGA 4LYDA 3HMKA 4JLPA 4ZDWA 2QKYA 4EA7A 5L53A 4Q1FA 2P7HA 4OAOA 1SMKA 4YA6A 1XP8A 4CWAA 3HUDA 1QQ6A 1N32B 5JPDA 2QZZA 3GP3A 3WLMA 4QKQA 3L9XA 2HQRA 1UDRA 1F0YA 5E6SB 2ZYDA 1EFRD 1K98A 3C3KA 5L3VA 2WYVA 4R69A 1E5VA 2AQIA 1X7ZA 4TROA 3PUYA 2R3SA 1OKKD 2I33A 2MINA 1PQWA 5FUXA 4F4DA 4J2HA 4DLPA 1P2BA 4Y2UA 1ISGA 2ISQA 3K4HA 4QOHA 2CXNA 4IRUB 3I3SR 4BMOB 1SIWA 1ZM7A 4GLJA 4HXYA 4X90A 2PNJA 4HATA 3ZTYA 4L95C 3BB1A 1FFCA 1H2XA 4DRXA 4CLOA 5KCZA 4ZAGA 3LQQA 1FTQA 1ZUNA 5FCDA 4MINA 3W4JA 3SFTA 4Y6LA 4AG3A 5LQJA 5FL7D 4L4SA 5L9AA 1BKSB 1SUPA 3WLPA 2X6TA 2WUFA 3GAZA 5LQAA 1NMYA 3SHWA 3T52A 1PR4A 2XKKA 4X5OA 5PNTA 4ZU1X 2XRFA 3EZNA 5F1YA 1Y6GA 1A9ZA 2HWYA 1QIMA 2VFAA 4JLOA 2D5BA 3KKOA 5CLLA 1AQIA 5DHAA 5DSXA 2EZ9A 3AUJB 3LNCA 1MZVA 1P74A 2GWHA 4JR1A 4L4YA 5EWLA 3UTDA 4ZJUA 5EHZA 1OW3B 2Y9MB 1I01A 1FE8A 1UDAA 2H7XA 2XZDA 3FROA 4U7PB 1JUDA 4WESA 2BJWA 4UKDA 5F9MA 4CDNA 1DIBA 1TTPB 3ML1A 4YJGB 4FMBB 1ZD3A 4I4NA 5E1MA 2NSYA 4EJFA 4JYZA 5TE9A 1U8CB 5SZIA 3QTTA 3CH6A 4A3JB 5F76A 1OXMA 5AW3A 1N2SA 3D3WA 3QKSA 2WJ4A 4WLVA 5KMGA 4YCJA 5IN5A 4CM9D 2AG0A 2RBGA 2DFPA 3DV0B 4Q1DA 5F23A 3NM6B 3GQVA 3QK7A 1M73E 3WKAA 5C8VA 4HO1X 1GU0A 5GOTA 3N74A 3DYVA 1K9SA 1US8B 4W82A 2DQ4A 3QKUA 4Z9XA 5EUMA 2GKSA 2C2WA 1N4AA 4EY7A 4MHSA 2ZUEA 3GC6A 5IH3A 3THWA 1PR5A 4BZQA 1D7OA 1N5DA 1U2DA 1WEHA 1X77A 4JSRA 3S40A 2R8YA 3Q8XB 3WLJA 5C46F 3FY4A 4QPJC 1UKBA 1KHHA 2F9MA 2EF1A 1QZZA 1IBRA 4QEZA 3B6JA 4G0ZA 2YFHA 2R85A 5EP2A 3A7DA 1I0IA 2J3MA 3E0QA 3PBKA 3LWDA 4YT5A 4EI2A 3WP0A 2VSFA 4C04A 3IAUA 3QU9A 2ZRHA 1YGYA 1O9BA 4U9HS 4G84A 5CJPA 3FLEA 4MRPA 3IHKA 2Q46A 4URHA 2A58A 4ECEA 3FDXA 2QD4A 3C0KA 1W5BA 4FEYA 3S99A 1Z33A 1YZGA 5FEMA 3ICEA 5AM0A 4LY6A 4UC0A 2OD7A 1LK7A 5KAMA 1I2ZA 4BY9E 1TM3E 1WHTB 3ET4A 5JR3A 3NX4A 1FSPA 1UT6A 4UVGA 5KWEA 2A78A 3WBBA 1GZDA 4A16A 2EOAA 2EFCB 2CCJA 1KWKA 1G41A 2MSLA 3H3FA 1FPMA 1NVWQ 2AW3A 2MR5A 3UJBA 4OMFG 2VOEA 3RROA 4GPBA 4D96A 2P9JA 4Q9LA 3RSSA 1W30A 2RGXA 5AR1A 1GGMA 4XTRA 4G5SA 3BA6A 3SX4A 2HWUA 1N9KA 2WHQA 4F7DA 1PCXA 3PICA 3BTSA 4EKNB 1A8SA 3FKQA 2QTMA 1RQRA 1XZAA 2W4IA 3I39X 3L49A 3COVA 1JJBA 3MQ4A 4Q7LA 4D42A 5K0EA 1JXQA 2VUMB 2ODQA 1VCIA 4CEHA 4YIHA 4KH0A 3QWIA 4MUHA 1XYGA 2PGDA 3RC3A 2O3RA 3SAJA 3SSNA 2CNDA 2A0UA 3P9YA 3ESRA 3G82C 3KVVA 2ETVA 4NPHA 1P4SA 3LC2O 3OJXA 4EDHA 3P26A 1E3WA 1G60A 1RKBA 1AIPA 3ROEA 3R0ZA 4H3VA 2GBGA 1R37A 4Q3CA 1RP1A 2DUJA 3K0KA 4YIKA 4E22A 3S5UA 1L5MA 1XZKA 1V0JA 2WHYA 3GA7A 4H3SA 4P5PA 4U6QA 5BW8A 5K0SA 4I4CA 1QGZA 2FU5C 2B5OA 3I0NA 1XI2A 2DG2A 1SRQA 2G4CA 1JHDA 3QELA 4WFKA 1LRJA 1DCKA 1DAHA 1M2KA 2VYCA 2BH2A 2WDZA 3A3YA 5DNEA 3P9IA 1FFXA 1QGYA 4XWTA 2XMRA 1R0YA 2WZDA 1IPFA 3GAAA 2XTJA 4FDMA 4WNCA 4U00A 4DUPA 1RWMA 4OHBA 2ZUFA 1G16A 1I7QB 1I36A 4NH4A 3X43A 1H2BA 2D2XA 4NEHB 2X0FA 3GLGB 4Q4CA 1OTHA 1DJPA 1S1MA 3KOYA 4HQOA 1J7JA 1O6CA 1WPGA 1RS0A 4X20A 1F2TB 1C7IA 1HMYA 3V4LA 3LLCA 4D8XA 3JYNA 1I3MA 2JIQA 2C29D 2QA5A 3NR2A 5T6MA 4PRKA 4D9GA 3UTCA 1JIUA 1GJRA 2FZKA 2D2EA 4WUVA 2KLHA 3MTBA 3ODPA 1DBSA 1V2HE 3O73A 4K46A 4TPKA 5KX5B 2X0NA 2ZU0C 1ZIOA 3GAMA 2QD3A 1BDJA 3DLAA 3QEMA 3UK6A 4L2IA 2A5DA 2WE8A 3AESA 5CVEA 2NVOA 3V48A 1L4NA 4PAGA 3IUBA 3DHWC 1V5IA 3FPEA 2LCFA 3AFGA 4EVSA 1GT6A 1DBPA 2GBCA 3I5AA 4RTNA 2GF0A 2IKQA 2QUJA 4CKWB 5CFRA 5HZGA 3O47A 3RANA 1H2ZA 2Z8YA 1EUZA 3LUHA 4MS3B 3ZW8A 1DEXA 3S68A 1E3LA 3HEBA 4BBAA 3GVXA 5K8TA 3W6OA 3ZCRA 3N8GA 5C32A 5JMWA 1OKKA 1XEWX 1SCUA 3ROTA 3X2EA 3IAM1 2X9NA 4EEXA 5BMVF 5JT1A 1AF7A 2YJ3A 3C6XA 3OZVA 1U28C 4BO7A 2P67A 2RC6A 2PQMA 3FNHA 1D6SA 5AHXA 1DCTA 1D03A 4BJ6A 3DVSX 3D6TB 3L6RA 1YUBA 1UPXA 1PQ4A 2EARA 3K0CC 3C3EA 2TRSB 3UVEA 5HOEA 1E4OA 2F8SA 3HS3A 2PDAA 4QQKA 3V00A 5ICEA 1AMUA 3I61A 3PEEA 1EE9A 1G4AE 1RC1A 1QFMA 2HPZA 2W2LA 3NI2A 4NY1A 4TXMA 4L07A 3RJ5A 3UUFA 5CVCA 2AEJA 3BB4A 4EITA 3VNSA 3HO6A 1ZH4A 2C92A 3EYAA 3HXOA 4B3RB 1KU6A 1M1NB 3QOWA 4E12A 2X22A 2ZEJA 1JQKA 1LQTA 5KC9A 2C4KA 2XMDA 1CEYA 4PC7A 1MX9A 1G0OA 2BLNA 2KSQA 3F6EX 3F5DA 5DLPA 1H9BA 3OLYA 4K6KA 5K8UA 2I6XA 4D4JA 1GNTA 4MIOA 4MQEB 2GN0A 4OL0A 1A0OA 2ZE5A 4UJ3A 1JA1A 2Z6UA 3WL8A 4DT1A 4ZMSA 2FWAA 3GLRA 4FJ2A 2WINI 2W8BB 1Y81A 3C41J 4Y1EA 4ZYVA 4O4JF 4FNGA 3FUTA 3N2ZB 2IOYA 3GU3A 3HI4A 1C3VA 2A5LA 1HDGO 1DBQA 1D6MA 3CRQA 3Q9UA 3CBGA 4HJXA 4DJAA 1G8JA 2GZDA 2OV1A 4NMHA 2W2QA 4YONB 2YJNA 2C1XA 4IRMA 4C4YA 2JKZA 4PYRA 5IBPA 1T26A 2PSSA 1LB1B 3G8AA 1N1MA 1L4KA 2AUTA 3KZCA 3BJRA 3BMQB 3TPZA 4DIMA 3GCZA 4M7WA 3TTYA 5DVZA 1CRZA 2GO1A 1G9TA 3U80A 2GCPA 1ZFNA 1YQDA 3KPVA 1H94A 4IDPA 4WCDA 1T1SA 5EL0A 5KAPA 5ECWA 2WLSA 1DQPA 4N82A 1KDYA 4RH0A 2F55A 1RAAA 4QQNA 2JIZA 1CJKC 2NZUG 3TDNA 1R9JA 4CI0B 1LI7A 4XQ0A 1AN0A 1NJGA 1AKYA 3WLHA 1FJXA 4OGKA 1XMJA 1IDN1 2VBIA 1XROA 1AOXA 1EFKA 1FP6A 2D1QA 5LMUB 3F5QA 5DYNA 2ACKA 4M0FA 3Q41A 2K2QB 2RGEA 3N2GB 5D85A 3JWHA 5EJ8A 2Z5GA 4LZLA 3G9UA 5DBOA 3RRFA 3MRVA 3C4VA 4U3JA 2AWNA 3BMCB 2BBOA 4XQCA 3ZBTA 2V4MA 3I6ZA 2IGTA 4S3MA 1D0IA 1A5BB 4E5VA 2GQ0A 1I7SB 1L3BA 3K9HA 3D0KA 3NHYA 1C1DA 4XDYA 1OD6A 5FWYA 1RHUA 1LQ2A 5LOVB 1UZAA 1N6HA 3A06A 4QOGA 4OAQA 2H63A 2XNDD 5E9QA 3MGCA 4C1NA 1QHHA 4OHXA 1T1GA 2FUKA 1RLOA 1Y7LA 1YR3A 1IY1A 2O14A 3HE3A 3DMTC 3N3AC 2BE7A 4P3KA 2XJ9A 5FWXB 1Z5VA 2C59A 4S2EA 1TJ4A 4XSGA 2W83A 4EHLA 1OC2A 1E1NA 1M6YA 1S3IA 1UJ2A 1LF0A 3E7XA 3EH2A 3PWSA 1ULHA 4XWAA 4A2CA 4CR7A 4EYSA 2YNMD 4ZKDA 1OB5A 4N6NA 3UHAA 2P40A 3NWBA 2WF8A 4MKXA 5DYTA 1KETA 3VYRB 2AEEA 4CUKA 4G1BA 1QE3A 3V8NA 4EF5A 1Q12A 1WMSA 2JGKA 1KY4A 4XVRA 1DX9A 2SKEA 4ZJPA 1ZK2A 3K0BA 2GJ4A 3IX7A 1GNPA 2NUAB 1A8QA 4C2MB 1P8AA 2CE7A 3HOXB 1IZ9A 3VR4H 1I1QB 4YH1A 3EOZA 5KB3A 5FI3A 1TM4E 5DM60 4BZPA 1A97A 4KIJA 1TZCA 3DVLA 2Q3EA 3IYLW 1X80A 4LOHA 4YWJA 5BSRA 4EI9A 3DS8A 3EGVA 5KPJA 3QH4A 3IUYA 4MR8B 2YZ7A 4G56A 3U5ZB 1O8BA 2R9VA 3M6FA 3GFRA 2Q3HA 4TS3A 3G2JA 4RELA 4DSUA 5J4VA 2FSGA 4H7KA 5I7RA 1DU4A 2R6FA 3TW8B 4RMNA 2BEWB 4H1UA 1TAQA 3BRCA 1R8XA 1X1TA 4TX1A 4W5TA 3A32A 1TYAE 3BGWA 3UMRA 4F2DA 1XMIA 3OE5A 4LYEA 2Z09A 4K8RB 3AKZA 4JQZA 4L08A 1TA9A 1VLHA 1ZM3A 2XT6A 3NH6A 5AXAA 4C0JA 1GZ7A 3GJZA 4I55F 5GJBA 3FWKA 3B9RA 4B6GA 4PSDA 2AR0A 5JYEA 3HYSA 4G5QA 4G0WA 3LY7A 2O5EA 3PVZA 1P2DA 1P1JA 4W5HA 2WUVA 1BU5A 1I9CA 2Q9AA 3PC8C 2RHOA 1NX9A 1DBRA 3P5BA 2X23A 4YX9A 4WN9B 2IHTA 1H42A 4N3NA 1SK8A 2Z3VA 1Q1GA 2GD0A 3PF8A 2O8FB 1JYEA 3ZXIA 1MTZA 2OC4A 3JQBA 1UOEA 3OE7D 4X94A 3D7MA 2PBFA 2JGJA 2DPXA 3O9MA 1RJGA 3EGOA 3HKBB 2AN4A 1XPOA 2XEDA 1ADJA 3CNQS 1A2QA 2M1ZA 4XVQA 2QYHA 2VG8A 1NVFA 1WB5A 1M54A 2ZJFA 1L7OA 4J43A 2I6QA 4LX0A 3L1IA 4KXYA 4BNYA 3M6UA 3L7DA 4OGFA 3U3DA 2HRZA 2BC9A 5CFNA 3KOZA 1X1AA 3OC6A 4F97A 5BWCA 4GBGA 1NG1A 3WLTA 4BNHA 4PYIA 1WX1A 2WJWA 2IXTA 2RCYA 1EB8A 4QX6A 5JAZA 2RI0A 4LWOA 3WBFA 1Q7BA 2XCUA 2ZJ0A 4L9RA 2XXBA 4XYLA 2ZBPA 1G55A 2UYQA 2JVJA 4QPCA 5DNDA 3SF0A 2PUBA 2GZHA 3L7NA 4OHWA 3EFOA 4NCXA 5TR9A 3WHIA 4F12A 2JFQA 1WL8A 3CZ4A 4Q47A 2X0DA 3HA7A 4KR7A 3SYNA 3OE1A 4WZAA 4ZI3A 2BFNA 3NGMA 4CLRB 5JSYA 1RBZA 1JT2A 2WABA 4J1NA 4E5DA 3IE2A 5E0OA 2QRQA 1MVLA 4YJDA 2P5UA 2HO4A 1XXHA 1KI6B 2QIOA 2E85A 3BQ9A 3Q88A 4FX5A 3ZLBA 3I9V6 4XGIA 4ZDKA 5C1PA 1E69A 3UJAA 1BE1A 2Z5LA 1E0DA 2V7EA 4XLLA 3AUKA 2YR0A 2RHWA 3OSZA 2PN1A 3A1VA 1L7QA 3CG0A 4IPTA 2LW7A 1PQYA 1UJNA 4HDNA 1K3UB 3WLNA 1GCAA 4JI6B 3W7AA 1KARA 3K72B 4MVJM 3G9QA 4PN7A 1FTYA 4JT2A 3CW8X 3CUTA 4LMRA 5CCXA 4EVRA 5F7JA 3H0GB 1A50B 2DWOA 1X1EA 3A3PA 3O7MA 4YJ2B 4QFMA 3VKFA 5KVVA 3PX7A 4Y2QA 3VR5H 4NAVA 4RADA 3M4NA 4FU0A 1DMRA 4OF4A 4MKGA 3P5SA 1TI7A 2CVFA 2HC9A 2QMQA 3C7TA 5ALQA 2OCPA 2PTGA 3S44A 4W5QA 4NBSA 3DHEA 4JLMA 3GI1A 3NNSA 4J29A 2Y93A 3KVRA 3PI6A 4JNCA 4RFSA 3RYHA 2XGMA 1KQPA 1P80A 2G7ZA 3MELA 4YMTA 4AUKA 1JN0A 3PSHA 4ZCSA 5C53B 2HK8A 4PC2A 5CCDA 4UHCA 5FPTA 3WGKA 4H0NA 2WTMA 5CLJA 2IEBA 2G07A 1USUA 4LVUA 3DM9B 3T1VA 4CIVA 3UHJA 3CLTD 4D97A 2OGUA 3LPNA 3WJ7A 2Z5VA 1NVVR 1ZCJA 1V16B 2JFGA 3QF4B 1YJ5A 3EPRA 5KTPA 3SKXA 3G9XA 5C3MA 4K86A 4WCVA 1R18A 5C51B 3LCCA 2HI0A 2Z6AA 2B25A 3JD4A 3WZLA 5BY2A 1Q1NA 5LZ8A 1XAGA 2V8BA 3OM1A 4DDMA 3WV4A 1LRLA 2O3JA 4EABA 3DJFA 3BRSA 2QM8A 3BERA 4L5BA 1WCWA 2O7NA 2C5HA 1WS6A 3HNOA 2IODA 4I4TB 4CKYA 2DTDA 1FNDA 5CG2A 2HHCA 3DF7A 4H15A 3AB3A 3G8CA 5DGIA 2QE6A 4RTJA 3NXKA 4NX2A 1PW5A 5EKSA 3ZR4B 1PTJA 1L6RA 1IFXA 1P6QA 1RNLA 1DO8A 3D7SA 3L7BA 4IICA 4BO9A 1XTTA 4FB4A 1BN7A 3IQGX 4IEEA 3H65A 2YNMA 1Q95A 5HE8A 1EX1A 3VH3A 1C9NA 4D92A 3ZHVA 3DM5A 3A6GA 2F90A 2GARA 4QDKA 5EHQA 5AW1A 1FJGB 4YUWA 4JJEA 4RCYA 2J0VA 4B71A 4GC5A 3GEBA 5C31A 4HWOA 1LVHA 1GA1A 1VA5A 2WM3A 4L73A 5THKA 1SPBS 2R86A 4OHMA 4A3MB 2YV2A 3OT1A 1RPZA 3JQ7B 1SWWA 3B60A 1R9TB 1W49A 1GYPA 1OI7A 2FZEA 2QP4A 5D6NA 4Q0MA 4K3UA 5A5VA 5KPDA 4RIIA 4NEGA 4LYJA 3HI6A 1GPUA 3DPSA 1C5KA 2ENWA 1DE0A 3NOVA 1HLDA 1XZMA 1U99A 3K16A 1UPBA 5T67A 2FX3A 3U3JA 1TW2A 3NHMA 4QASA 3M5CA 4R68A 5AHOA 1T0BA 2WD8A 5FUWA 3TNFA 3WQSB 4ZHSA 2BONA 2VDVE 1TECE 2YKGA 5CBKA 1JH8A 3GLFE 1CIVA 4YBRA 1Z2CA 5FA5A 1QP8A 4RE5A 5K3AA 4WFIA 1RHMA 1O6ZA 2GETA 2NXEA 4LJYA 2A59A 4KO3S 2R00C 5DSZA 2Z98A 2Y0DA 5IU6A 5AI5A 4URZR 2DSNA 5H3HA 1RRMA 4UASA 3TLBA 4J90A 3V7UA 2A7QA 5FPQA 3TMKA 1XDBA 2DYKA 3V4FA 3BFXA 4PGAA 1COZA 3BUSA 3TIXB 3VZQA 1AS0A 3KQTA 5DO9A 1GG2A 4IO0A 3VJLA 5K3FB 2CC2A 9LDTA 3GJTA 4JI3B 3CQ9A 1L4LA 1T36A 1EG7A 1UEIA 3DBLA 1LJ8A 2D0PB 3Q6NA 1TD1A 2P9GA 4F5WA 2QROA 3CLSC 3THXA 1YDEA 4BNWA 3H0CA 4RW0A 4W8GA 1OXSC 4JVNA 4O1IA 4X1IA 3DE6X 5ARCA 3OE7A 2YY6A 3VJRA 4AP9A 4X66B 4QPNA 4WHMA 1WD5A 2V9ZA 3V8EA 4LF9B 2D7CA 4HWRA 3UCXA 5JW6A 3A2LA 3MRXA 2W2PA 3EXFA 3CMMA 1A4RA 2IHVA 3ILSA 4E6EA 1EGVB 2OHVA 1ZLYA 4KIUA 4Y6QA 1ZL0A 2AK2A 3W9BA 4FHEA 1JIIA 1YS1X 4OX9B 3O83A 1CZOA 1ZZEA 3WIUA 1BO6A 1FFDA 3EZXA 4HDKA 1FPQA 2R5FA 3RYIB 3QMMA 3VAYA 1YZVA 1XDUA 5IK2A 4M21A 2IV7A 1KYYA 1W8DA 4FNAA 1EXVA 4I8DA 5DP2A 4IYJA 3C3PA 2ZRCA 1UODA 3T5TA 1EDBA 3R5TA 1MH9A 1YL7A 5M7EA 3IL2A 4IJ5A 1OA0A 3V4RA 2YFQA 1M75A 2PV0A 5LQRA 2AG1A 3QBEA 2A1UB 4ENRA 1JHMA 3QXXA 4MJ3A 4N3GA 4OD0A 2NUTA 4BMZA 1ORIA 2EKPA 1AB5A 4IGEA 4DSOA 5EJFA 5LWHA 5M04A 3MEQA 3NUGA 4H4EA 3UAWA 4QYWA 5HGXA 2OP1A 2YJ4A 3IBGA 3G5MA 4KE8A 1VRWA 4BIIA 2FGJA 1D1PA 2FA9A 4NE7A 3ZJTA 1SC3A 5IT9A 3A3NA 1K8ZB 2CDCA 2BCGY 3VOTA 5HM8A 1AKTA 2IIPA 3HO8A 3IV6A 1G2IA 3PGXA 2WAYA 3MLEA 3KBOA 4I66A 3TTWA 4CMEA 3SIRA 3NDBB 1XKLA 4QJ5A 3ZS9A 1WBBA 4ZOLA 1YQQA 2HRQA 3QYPA 5IDWA 3Q2OA 4R1UA 5IMSA 5EIEA 3W2HA 3BIOA 2HM7A 4PONA 4QJ3A 2W6OA 5I9IA 5BOVA 1OX6A 4GPEA 3I42A 3AEUA 3D5QA 3QBJA 4I9HA 2FSHA 2WB4A 5KTRA 3G0DA 3KWLA 5HX7A 4YACA 4X1YA 3AIIA 3VNBA 3ZWVA 7REQA 3FGPA 2P9QA 1OYVA 3GN2A 3KKEA 1HUQA 3UAVA 3B1JA 4PRZA 1V5GA 1VJRA 2HSEA 3GMDA 5FI5A 3U49A 4BEVA 4DQUA 2RAVA 1JIKA 2QTCA 3TOXA 1UMBA 4U7WA 3KL2A 1BVYF 3ZTTA 4FYHA 1ZMBA 3H5RA 3JWJA 4HLUA 1D2NA 1OAOA 4A0FA 1JNXX 4EQZA 3GEPA 3HY3A 2I6SA 3TZLA 3P2EA 3N58A 4AF7A 3VKGA 4NU6A 2V0NA 5DCLA 3GTPB 1Z6PA 2PIDA 3ZE6A 5TPZA 1TKRA 3LBFA 2BRUC 2OCLA 3LI2A 2JLCA 2QN6A 2OBFA 1MC4A 3NHSA 3LWBA 1KMHA 4PPYA 1SUSA 2MTBA 2P6MA 3H5OA 2H4JA 3BDVA 3LY8A 1XTSA 3O21A 1E4YA 4RZXA 3S1SA 4LJRA 1OROA 1WXIA 2D5CA 3FYTA 3U6KA 3ZDZB 2O8DB 4I1YA 1DADA 4R1NA 4NU0A 2IK8A 4JI1B 2OBBA 3DMDA 1I1HA 4IZ6A 4AG5A 4IRXA 4BQSA 1IRIA 1Z5GA 4UHJA 4P8RA 2E0IA 1JFFB 1PJZA 5DYIA 1QYCA 3P4XA 1CF9A 3MCZA 3MSCA 4RY0A 1L7AA 1XJ5A 2BR5A 2YASA 1WUIS 4GI3A 4H3KB 4H7EA 4MJXA 4S1TA 3WQQA 4UBNA 4C08A 4TS4A 2N1MA 1ZGJA 5CPFA 1YCFA 4EMUA 4QHSA 5FBRB 1DC8A 4ZARA 4RXUA 2QEQA 4KX5A 5FXMA 2A1TS 4BO0A 1XWFA 3EZYA 2JEOA 2DHDA 4IJ6A 1D4AA 1P3Y1 3WAGA 1N75A 2OFPA 4FIZA 4A10A 3V34A 4QD3A 2AI2A 3FCUB 1VMKA 1CUWA 3F3MA 3KKZA 5HQ3B 4BNJA 2FMTA 4ZICA 2DR0A 2W6PA 1KI4A 2OR3A 2Y0BA 3PYXA 3BXGA 4TV9A 5FV7A 5IZCA 3C5VA 5KSWB 4HYEA 1YZLA 2Z2IA 4A0GA 3R1IA 4I9UA 5H59A 3KQUA 1G2PA 4ZVQA 2O59A 4CDRA 3UJ8A 2I2XB 4F0JA 3A6ZA 1IBKB 4KN8A 1IIBA 3QITA 4KW7A 1CR4A 1P1RA 4KWEA 1CPYA 3VBCA 4DLTA 1D6JA 1FZQA 2AZ4A 2EJTA 1SKBA 1YHZA 5DCWA 3GDOA 5D7NA 4URVR 2F3UA 5FEUA 5K1ZA 4C30A 4PS1A 3Q8LA 2HMAA 2EL9A 3ICQB 1R6XA 1E1YA 2CWWA 1FYWA 1ORRA 2W58A 1O77A 2EX4A 4Q37A 1TVCA 4QGFA 5IDXA 3SQWA 1JU3A 2B4KA 2QR3A 4OMUA 2I3DA 2AMJA 3BGDA 3TIVA 3IFSA 3USCS 3ROXA 1NPDA 2ILVA 4Z9YA 3TL2A 4ER3A 3GG9A 1HYQA 1N2EA 5CRIA 1M0TA 1LSOA 2H1VA 1EXNA 4GQBA 5EE9A 1XUOA 4QNNA 4H2DA 4ZU3A 2PT7A 4JI0B 4UUNA 1NMXA 1NW7A 1NW4A 4CTJA 5K3OA 2VK4A 5EIAA 4UOQA 2XUOA 2ZXFA 4KO2S 4XD7A 1GU1A 1QS0B 3WS7A 5IJ0B 1R2QA 3F1LA 3SC2B 5CFZA 4KFSA 3LBYA 3LZDA 4D3XA 1T8SA 2YW9A 4TMFA 4OLFA 3GPIA 3UICA 1IAVA 2XQVA 2PGIA 4NG5A 4V0MA 3RG2A 4QIWB 3E5RA 2Q4TA 1XPRA 1PBNA 2REOA 3NGLA 2PAFA 3JQ6A 5EWMB 3VPAA 5IM5A 5BVGB 3VAAA 3K4PA 1IG3A 4D0NA 2ZJZA 3T06B 2PFGA 4K05A 4X6UA 4TYWA 2VH5R 4Y2JA 1W5AA 3IQEA 5FL3A 1TXGA 4ME6A 2IYTA 3AGQA 1HT2E 3ZOZA 4RV5A 1IBLB 2O8EA 2NO6A 3CUWA 1G5PA 3GV0A 1LFAA 4P3YA 3IA7A 1G6Q1 3QLJA 4G5FA 4M1YA 5KZMB 3H8JA 2AOTA 1ULUA 2CUNA 1QYVA 2PXXA 5CTAA 2PKCA 1PJ3A 1GTG1 1OU4A 3A1DA 3RHSA 1UBHS 3WKEA 1N0WA 2OORC 3CN7A 3LT4A 2NW6A 5HMMA 3TM5A 4HBGA 1MQ8B 3GNTA 3WFZA 5CG1A 4HUQA 3TW4A 4D8UA 4ENQA 1LBTA 2HSJA 2C00A 3F7TA 3I9KA 3VOSA 4DLKA 2PGLA 2GN1A 2VOJA 5T7BA 1KIAA 2N3ZA 2XTAA 4UMDA 2JB9A 4BO1A 2WY2D 2G6TA 3LH5A 1AB6A 4N3CA 3TQTA 2C61A 3GWZA 3H75A 1EMDA 4A8HA 3TAXA 1C7JA 3QLVC 2LNDA 2R44A 4JC4A 1HE8B 4DCJA 4JI2B 4PHCA 2HADA 3FSGA 3TLGA 4ERNA 4QTYA 1XP5A 4CTKA 5D51S 2F1HA 3M6VA 4C7VA 5F78A 2Q3LA 3DPIA 4ZU6X 1BSVA 4BNMA 3ZV7A 4TZ0A 2OXTA 1IUNA 3D3QA 2YWCA 4PHHA 1QH8B 5DWVA 2CB0A 5F64A 3OZFA 4KV9A 4RIEA 4NHEA 3T8YA 1P60A 3BH7A 3EH1A 3AEKB 5DEIA 1P9WA 3OOHA 3R5JA 1JFSA 1CZHA 1H69A 3DMGA 2B1QA 4UREA 3T7JA 5BORA 3LQFA 1Y3HA 2E82A 3L4SO 3OUTA 2O0KA 2AJBA 3EMDA 4EY8A 4WA8A 3WBKA 2IEGA 1SXJC 3A2KA 3E35A 3WO0A 4FHFA 4LCEA 4TTAA 5B1IA 4KFUA 4C0LA 3A4VA 2X6QA 4YCDA 1D2EA 1Y8RA 4AZ3A 4AX8A 3KQKA 3OEHA 4C3OB 5HKKD 1I3QB 1HYGA 1V1MA 3HV0A 1H3FA 1RLJA 3ZZUA 5MFPA 1KRXA 3HCPA 3OT4A 1YAHA 3VH4A 3THWB 1ZXXA 2NADA 1GCIA 3I9NA 3SWWA 2H9YA 4V02A 5HZMA 3T9EA 3BKXA 4KITB 4GMGA 1FMCA 2ZWOA 3MHTA 4AKIA 5DBEX 1U0OC 4M0PA 3ZDBA 1N2CA 2EZTA 3HXLA 4F3NA 2V7GA 1QRRA 4R01A 4DB2A 2BHNA 2QSZA 4NZOA 5DHTA 1D1QA 1MJGA 2FPPB 4LQ4A 4QDTA 1C8LA 4DEXA 1F8YA 1MRNA 3AP3A 2HW8A 4RY8A 1JAYA 2NAFA 3NEYA 1AKRA 4CIDA 4A0HA 2H2IA 4ND3A 3BILA 3VV2A 4AWBA 4ER6A 4ZIRA 1SVOA 3R4VA 3W5CA 1XMQB 1B8VA 2DHCA 5A3RA 3W5AA 3D6UA 3WGOA 3BH6A 1D0VA 2G3YA 2QM0A 3KHUA 4I08A 1GZHB 1U4OA 4B3XA 4DA4A 2ONJA 4JP5A 3CLHA 1UK7A 3ELWA 3GH1A 4RH3A 5IJ9A 5GONF 5C1DA 2RJNA 1Q84A 1AQUA 3HCDA 3NJRA 5LIRA 2C98A 4E2XA 3DCIA 1W7AA 1YUNA 1DT3A 1GRVA 1HF3A 1SOVA 3AVPA 4H4DA 3MUFA 4TGLA 5EZSA 4D6XA 3AG5A 4H3HB 5K20A 5K4HA 3AUXA 4B4UA 1KFBB 2FVXA 1LY1A 1UZMA 3IUNA 4K9QA 2V96A 3QJ5A 1OGIA 3S55A 4AN4A 4ARUA 1ZVVA 1HYHA 1P1IA 4B6RA 4JGBA 1XB2A 3FNEA 3C43A 4RGYA 3KP1A 4M1TA 1WCYA 2HFKA 3E9MA 4I9FA 2R8ZA 4NZMA 3MS2A 2CJFA 4W1SA 1Z88A 4IVNA 3VPSA 1ZI9A 4ASUD 3JX9A 2JFYA 3L0OA 4HQ0A 4R7GA 2QZ9A 4P35A 1N2XA 4Z9AA 4PLGA 3MBOA 2ZJ7A 1PZEA 4HAZA 4R41A 2EG9A 3EW7A 4K0RA 1PWHA 2DFNA 3DXFA 4XIIA 1CP2A 4CDMA 5JVDA 2FSIA 1SHTX 1J97A 1G9SA 1X7ZB 1QQ7A 4HH1A 5C44B 2J45A 2HDHA 2MINB 4JU8A 3VI3B 2JJ2D 2Z1NA 3Q3EA 1JVSA 1Y5LA 5CVDA 3B5IA 4DA7A 3FOBA 3Q7PA 2YOFA 3ITNA 3CVUA 5H83A 4AUEA 3GDHA 2V5VA 2J41A 5B37A 3KDPA 4LJSA 4OA5A 4W8HA 4KC0A 4KVFA 3U39A 4KSYA 4B84A 4DRXB 4C3HB 4OIMA 4CTMA 1ZUNB 1BXZA 1RADA 1E2KA 3T9BA 5IAOA 1YCHA 2W6MA 3EIUA 4Y6GB 4M53A 2QW1A 3OPMA 1QPBA 5C2JB 3EXIA 1G59A 4BP3A 5GADl 4NBKA 3VVBA 1AHIA 2AYZA 5G0TA 4M86A 4XB6B 1YUMA 1RZRD 4IGFA 4D0SA 3I2HA 5D01A 3TLYA 1ZXLA 4Q3KA 3BDAA 4RULA 5HRAA 1QVZA 2HRBA 5JSZA 5CNMA 5EWLB 3ROZA 2RGCA 3C70A 2B36A 1LLCA 3QUTA 3RSFA 4N12A 4OQEA 3DLCA 4KZKA 4MVJE 4WESB 4WSOA 1BDIA 1RKXA 5D2CA 2CSXA 4RHEA 3UGTA 1S2GA 1UP4A 3Q1LA 4W1QA 5T41A 1RBQA 3H99A 3R7DA 4D4LA 1H9AA 5GAJA 1V37A 4D45A 4E2ZA 5C7IO 3HJAA 1CY7A 3D3WB 2VYFA 3QKSB 1GZ5A 1TM1E 1UK8A 4DBZA 1Y1WB 1NAHA 2PKYX 1THMA 2R48A 1U5BA 5LDGA 3FTEA 1KSJA 2IIBA 2BGTA 2X7HA 1XRJA 4BL5A 4L8YA 2VSXA 4GVPA 4INOA 3WIEA 3D7KA 3GJQA 2VZ8A 3DBRA 3K05A 3OG9A 1JZSA 1JYSA 1S2IA 3EZ2A 1YVRA 3WB9A 3IKTA 3H05A 1EEXB 4LJLA 1Z29A 2WIGA 4KDRA 1GRCA 4Y9SA 4FEAA 5HFNA 1K0UA 2QU8A 1OTXA 2XE6A 4OM8A 3TS1A 5BR8B 2QNBA 2I7TA 2QTLA 3BM5A 1VECA 3T15A 4IH4A 2GM3A 3HGMA 4L7VA 1D9ZA 4NULA 4QIHA 5ESRA 3U7QA 3G6KA 4UNSA 4MPPA 3UJNA 4S0ZA 1V71A 2PWAA 2XKAA 3WQHA 1N5IA 1JB1A 4R7TA 3V7FA 3HDVA 3L4EA 4MMYB 1CVIA 4ZOAA 5AJXA 2YHIA 5EUCA 5EI5A 1LS6A 2VHVA 4N18A 2ZZNA 4WCFA 2GEJA 3KFLA 4M54A 4AZSA 4GMFA 1MX1A 1DQNA 1SU6A 4O2BF 2ZSUA 5C1OA 2NXJA 1E96A 1KR5A 4UDNA 2P7IA 1F12A 4IKOA 4XB1A 3WHKA 1B4DA 1AS2A 2R6GA 3LBNA 3E9YA 1E92A 2WWXA 1CUUA 4QUKA 4ZCQA 3REQA 4DXDA 1PEKE 1GAWA 2E49A 4BEBA 2FEMA 1Y6FA 4JYBA 3E8XA 4BHTA 2O19A 3ORQA 3IAXA 4PLFA 3H6GA 4GKBA 4NPAA 3OF5A 3RAGA 3SIXA 3U0BA 2L42A 2JJMA 4OHKA 2PMBA 2C7BA 3NWPA 4GRIA 2CN1A 4LC0A 2GBFA 2WAXA 1V9CA 4MUBA 2H2DA 2QSJA 2YY5A 3IMEA 1R6BX 1J8YF 4QATA 4A92A 4L4UA 4Q18A 4K26A 4CEHB 3B78A 3PF9A 2ATCA 2VHXA 5DI3A 1E2LA 3R3XA 4IH1A 3O4VA 5G0WA 2DKFA 2XXJA 4EW1A 4K9KA 1SUFA 2VSYA 4OJKA 4EEZA 1PYGA 2P69A 1S8OA 4ZEVA 3L4KA 3UENA 2J0EA 1TEXA 1NMSA 5AESA 5C4XB 1E3WB 2V6MA 1LU9A 3NW9A 4OFWA 1KEEA 4ZAVA 1FYDA 4DJEC 4FGWA 3GWGA 1NBMD 1ISIA 1VRVA 4BX8A 4ZQGA 1R5NA 1C80A 4B76A 1JEOA 5DYYA 1T10A 2DERA 1UFOA 2R97A 4DNOA 1IK6A 3B3FA 3GJXC 3KAPA 2G80A 4GR4A 2HRDA 2YW2A 3TINA 2VTEA 5I8PA 4FX2A 3K9BA 1RHKA 1YOBA 4ZI7F 1LDYA 2QPTA 3HC7A 3QELB 3QKIA 1T3SA 2NYAA 2Q99A 4JKOA 4UPDA 3KZMA 4EO9A 1JX6A 1FFXB 2QD1A 1YC2A 3LGXA 2NVTB 1YDWA 1VPWA 1H0KA 2RG1A 4TYNA 4PAMA 1E9RA 3C3BA 1TL7C 4BMDA 2NN3C 5HOQA 2H2WA 3CE9A 5AVUA 3A36A 3BVPA 3QXJA 3EBPA 3C15C 3S27A 1VCNA 4EJ6A 3MJCA 1V5WA 3AHFA 2QPAA 3EZ7A 1KI1A 5C52B 3ZKAA 3VYTB 2HA2A 3F8WA 4FGZA 4HDRA 1CVLA 4RD2A 4X20B 1U9CA 4EYQA 4C07A 4QQRA 3I4MB 3W5DA 1AHPA 2I1QA 4U6NA 3OM8A 3WE7A 2PUEA 3QYFA 3ZW9A 2A5JA 5FFFA 3CXRA 3DMFA 3A27A 2OYRA 4BP8A 2VQFB 2ROQA 1K5GA 1T15A 3GFSA 2GPBA 4G24A 5MN5A 3SVLA 1JDSA 4KU4A 4Y8VA 3LC7O 4TUYF 4DARA 3QEMB 5J4KA 1QQBA 4UFPA 3HQ4O 3L84A 1Y9ZA 4ASUA 4L2IB 3AESB 3OFSA 4KE6A 4BNXA 3WK8A 1SCIA 1L5VA 3WMFA 1K92A 3JQEA 2GKGA 4X84A 3H8VA 1JP7A 1NF9A 1ENPA 5H5JA 1W94A 3UXEA 5IJXA 1E5QA 1KYTA 1WCMB 2G7MC 1EH5A 2ZT6A 4U39A 5KO2A 3DBHA 4TZ6A 3M6AA 2CV1A 3HU1A 3VYSB 2JJ2A 1SCUB 2H7VA 3BULA 3AW9A 1LPOA 3L8GA 4G1UC 1H6CA 1ISPA 2ZUCA 1ZYUA 3DE7X 4PLCA 3SX2A 3HCOA 4B6JA 2DH5A 1BMQA 2HRCA 2EJWA 2JCYA 5JZVA 2F3TA 4PAQA 1YFLA 4ZT7A 4BJ5A 3RTBA 3DAGA 1L5LA 1P17A 2IOFA 2J3EA 2EC5A 3SJBA 4H7HA 1WV1A 1K4KA 3VPHA 1MJHA 1VYTA 4C4SA 4YAIA 3KRTA 2R5NA 4OHCA 4RLSA 3KHTA 3VR6H 4NJMA 3EGCA 2UVPA 4Y2XA 5EUBA 1VBNA 2RARA 5L4LA 3FJYA 4EGCB 3CVYA 4NXNB 3QXSA 5DU2A 1P1CA 2GRAA 1WP9A 3FG9A 1ZITA 1EWVA 2IV3A 2BFEA 4O3MA 2ACVA 2FWPA 1IULA 2V7PA 4M37A 4C0XA 5I3ZA 3LL4A 3WKCA 1K1EA 3EEYA 3UK0A 3IEXA 1Z12A 3P9CA 3MRSA 4WJZA 2AR7A 4TVBA 3UV7A 1TF2A 2GH1A 4LSMA 1K2VN 4DT1B 4MGHA 3VR2D 4PPFA 5K3CA 1LPMA