2B1WA

Solution structure of the nod1 caspase activating and recruitment domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
GAMESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of NOD1 CARD and mutational analysis of its interaction with the CARD of downstream kinase RICK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Caspase recruitment domain protein 4
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2b1wA00
4JQWA 4JUPA 3KATA 1E3YA 1WMGA 4N1KA 2DBFA 4I16A 1CY5A 3LQRA 2NSNA 4P4HI 4P4HA 2N80A 4O6XA 2DBHA 4M9XA 2D96A 3CL3A 2GF5A 3J6JA 4O9FA 3MOPK 4N1LA 4DWNA 4F44A 1C15A 1DDFA 2N00A 4F42A 2P1HA 2YVIA 2NAQA 2A9IA 2MN4A 2YU0A 1A1ZA 3EZQA 2VGQA 4D8OA 2N1FA 2OF5H 4A2QA 1FADA 1YGOA 4UZ0A 4RHWA 3MOPG 1E41A 1NGRA 2BBRA 3LQQA 1DGNA 4IZ5E 4M9SA 2BBZA 2G7RA 3YGSC 1WXPA 4O9LA 4A2WA 2YGSA 3J63A 2KM6A 2F1SA 1UCPA 4ZBWA 2LS7A 2A5YB 2DBDA 2LWDA 2MB9A 2N97A 2L9MA 2OF5A 3YGSP 4N1JA 2KN6A 4E9MA 2IB1A 2DO9A 4QOBA 1D2ZA 2DBGA 4M9ZA 2M5VA 1WH4A 2MS7A 1Z6TA 2MPCA 2B1WA 4LWDA 3EZQB 4IZ7B 2L6AA 4IZAB 4EWIA 2NZ7A 4RHWE 3T6PA 1CWWA 1A1WA 2MS8A 2N83A 2YQFA 4O7QA 3QF2A 3MOPA 2O71A 1PN5A 2HM2Q 4FH0A 4NQKA 1N3KA 2LWEA 1ICHA 1D2ZB 2N7ZA 3CRDA
chains in the Genus database with same CATH superfamily
4JQWA 4JUPA 3KATA 1E3YA 1WMGA 4N1KA 2DBFA 4I16A 1CY5A 3LQRA 2NSNA 4P4HI 4P4HA 2N80A 4O6XA 2DBHA 4M9XA 2D96A 3CL3A 2GF5A 3J6JA 4O9FA 2MJMA 3MOPK 4N1LA 4DWNA 4F44A 1C15A 1DDFA 2N00A 4F42A 2P1HA 2YVIA 2NAQA 2A9IA 2MN4A 2YU0A 1A1ZA 3EZQA 2VGQA 4D8OA 2N1FA 2OF5H 4A2QA 2XV9A 1FADA 1YGOA 4UZ0A 4RHWA 3MOPG 1E41A 1NGRA 2BBRA 3LQQA 1DGNA 4IZ5E 4M9SA 2BBZA 2G7RA 3YGSC 1WXPA 4O9LA 4A2WA 2YGSA 3J63A 2KM6A 2F1SA 1UCPA 4ZBWA 2LS7A 2A5YB 2DBDA 2LWDA 2MB9A 2N97A 2L9MA 2OF5A 3YGSP 4N1JA 2KN6A 4E9MA 2IB1A 2DO9A 4QOBA 1D2ZA 2DBGA 4M9ZA 2M5VA 1WH4A 2MS7A 1Z6TA 2MPCA 2B1WA 4LWDA 3EZQB 4IZ7B 2L6AA 4IZAB 4EWIA 2NZ7A 4RHWE 3T6PA 1CWWA 1A1WA 2MS8A 2N83A 2YQFA 4O7QA 3QF2A 3MOPA 2O71A 1PN5A 2HM2Q 4FH0A 4NQKA 1N3KA 2LWEA 1ICHA 1D2ZB 2N7ZA 3CRDA
chains in the Genus database with same CATH topology
4JQWA 4JUPA 3KATA 1E3YA 1WMGA 4N1KA 2DBFA 4I16A 1CY5A 3LQRA 2NSNA 4P4HI 4P4HA 2N80A 4O6XA 2DBHA 4M9XA 2D96A 3CL3A 2GF5A 3J6JA 4O9FA 2MJMA 3MOPK 4N1LA 4DWNA 4F44A 1C15A 1DDFA 2N00A 4F42A 2P1HA 2YVIA 2NAQA 2A9IA 2MN4A 2YU0A 1A1ZA 3EZQA 2VGQA 4D8OA 2N1FA 2OF5H 4A2QA 2XV9A 1FADA 1YGOA 4UZ0A 4RHWA 3MOPG 1E41A 1NGRA 2BBRA 3LQQA 1DGNA 4IZ5E 4M9SA 2BBZA 2G7RA 3YGSC 1WXPA 4O9LA 4A2WA 2YGSA 3J63A 2KM6A 2F1SA 1UCPA 4ZBWA 2LS7A 2A5YB 2DBDA 2LWDA 2MB9A 2N97A 2L9MA 2OF5A 3YGSP 4N1JA 2KN6A 4E9MA 2IB1A 2DO9A 4QOBA 1D2ZA 2DBGA 4M9ZA 2M5VA 1WH4A 2MS7A 1Z6TA 2MPCA 2B1WA 4LWDA 3EZQB 4IZ7B 2L6AA 4IZAB 4EWIA 2NZ7A 4RHWE 3T6PA 1CWWA 1A1WA 2MS8A 2N83A 2YQFA 4O7QA 3QF2A 3MOPA 2O71A 1PN5A 2HM2Q 4FH0A 4NQKA 1N3KA 2LWEA 1ICHA 1D2ZB 2N7ZA 3CRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JQW A;  4JUP A;  3KAT A;  1E3Y A;  1WMG A;  4N1K A;  2DBF A;  4I16 A;  1CY5 A;  3LQR A;  2NSN A;  4P4H I;  4P4H A;  2N80 A;  4O6X A;  2DBH A;  4M9X A;  2D96 A;  3CL3 A;  2GF5 A;  3J6J A;  4O9F A;  3MOP K;  4N1L A;  4DWN A;  4F44 A;  1C15 A;  1DDF A;  2N00 A;  4F42 A;  2P1H A;  2YVI A;  2NAQ A;  2A9I A;  2MN4 A;  2YU0 A;  1A1Z A;  3EZQ A;  2VGQ A;  4D8O A;  2N1F A;  2OF5 H;  4A2Q A;  1FAD A;  1YGO A;  4UZ0 A;  4RHW A;  3MOP G;  1E41 A;  1NGR A;  2BBR A;  3LQQ A;  1DGN A;  4IZ5 E;  4M9S A;  2BBZ A;  2G7R A;  3YGS C;  1WXP A;  4O9L A;  4A2W A;  2YGS A;  3J63 A;  2KM6 A;  2F1S A;  1UCP A;  4ZBW A;  2LS7 A;  2A5Y B;  2DBD A;  2LWD A;  2MB9 A;  2N97 A;  2L9M A;  2OF5 A;  3YGS P;  4N1J A;  2KN6 A;  4E9M A;  2IB1 A;  2DO9 A;  4QOB A;  1D2Z A;  2DBG A;  4M9Z A;  2M5V A;  1WH4 A;  2MS7 A;  1Z6T A;  2MPC A;  2B1W A;  4LWD A;  3EZQ B;  4IZ7 B;  2L6A A;  4IZA B;  4EWI A;  2NZ7 A;  4RHW E;  3T6P A;  1CWW A;  1A1W A;  2MS8 A;  2N83 A;  2YQF A;  4O7Q A;  3QF2 A;  3MOP A;  2O71 A;  1PN5 A;  2HM2 Q;  4FH0 A;  4NQK A;  1N3K A;  2LWE A;  1ICH A;  1D2Z B;  2N7Z A;  3CRD A; 
#chains in the Genus database with same CATH topology
 4JQW A;  4JUP A;  3KAT A;  1E3Y A;  1WMG A;  4N1K A;  2DBF A;  4I16 A;  1CY5 A;  3LQR A;  2NSN A;  4P4H I;  4P4H A;  2N80 A;  4O6X A;  2DBH A;  4M9X A;  2D96 A;  3CL3 A;  2GF5 A;  3J6J A;  4O9F A;  2MJM A;  3MOP K;  4N1L A;  4DWN A;  4F44 A;  1C15 A;  1DDF A;  2N00 A;  4F42 A;  2P1H A;  2YVI A;  2NAQ A;  2A9I A;  2MN4 A;  2YU0 A;  1A1Z A;  3EZQ A;  2VGQ A;  4D8O A;  2N1F A;  2OF5 H;  4A2Q A;  2XV9 A;  1FAD A;  1YGO A;  4UZ0 A;  4RHW A;  3MOP G;  1E41 A;  1NGR A;  2BBR A;  3LQQ A;  1DGN A;  4IZ5 E;  4M9S A;  2BBZ A;  2G7R A;  3YGS C;  1WXP A;  4O9L A;  4A2W A;  2YGS A;  3J63 A;  2KM6 A;  2F1S A;  1UCP A;  4ZBW A;  2LS7 A;  2A5Y B;  2DBD A;  2LWD A;  2MB9 A;  2N97 A;  2L9M A;  2OF5 A;  3YGS P;  4N1J A;  2KN6 A;  4E9M A;  2IB1 A;  2DO9 A;  4QOB A;  1D2Z A;  2DBG A;  4M9Z A;  2M5V A;  1WH4 A;  2MS7 A;  1Z6T A;  2MPC A;  2B1W A;  4LWD A;  3EZQ B;  4IZ7 B;  2L6A A;  4IZA B;  4EWI A;  2NZ7 A;  4RHW E;  3T6P A;  1CWW A;  1A1W A;  2MS8 A;  2N83 A;  2YQF A;  4O7Q A;  3QF2 A;  3MOP A;  2O71 A;  1PN5 A;  2HM2 Q;  4FH0 A;  4NQK A;  1N3K A;  2LWE A;  1ICH A;  1D2Z B;  2N7Z A;  3CRD A; 
#chains in the Genus database with same CATH homology
 4JQW A;  4JUP A;  3KAT A;  1E3Y A;  1WMG A;  4N1K A;  2DBF A;  4I16 A;  1CY5 A;  3LQR A;  2NSN A;  4P4H I;  4P4H A;  2N80 A;  4O6X A;  2DBH A;  4M9X A;  2D96 A;  3CL3 A;  2GF5 A;  3J6J A;  4O9F A;  2MJM A;  3MOP K;  4N1L A;  4DWN A;  4F44 A;  1C15 A;  1DDF A;  2N00 A;  4F42 A;  2P1H A;  2YVI A;  2NAQ A;  2A9I A;  2MN4 A;  2YU0 A;  1A1Z A;  3EZQ A;  2VGQ A;  4D8O A;  2N1F A;  2OF5 H;  4A2Q A;  2XV9 A;  1FAD A;  1YGO A;  4UZ0 A;  4RHW A;  3MOP G;  1E41 A;  1NGR A;  2BBR A;  3LQQ A;  1DGN A;  4IZ5 E;  4M9S A;  2BBZ A;  2G7R A;  3YGS C;  1WXP A;  4O9L A;  4A2W A;  2YGS A;  3J63 A;  2KM6 A;  2F1S A;  1UCP A;  4ZBW A;  2LS7 A;  2A5Y B;  2DBD A;  2LWD A;  2MB9 A;  2N97 A;  2L9M A;  2OF5 A;  3YGS P;  4N1J A;  2KN6 A;  4E9M A;  2IB1 A;  2DO9 A;  4QOB A;  1D2Z A;  2DBG A;  4M9Z A;  2M5V A;  1WH4 A;  2MS7 A;  1Z6T A;  2MPC A;  2B1W A;  4LWD A;  3EZQ B;  4IZ7 B;  2L6A A;  4IZA B;  4EWI A;  2NZ7 A;  4RHW E;  3T6P A;  1CWW A;  1A1W A;  2MS8 A;  2N83 A;  2YQF A;  4O7Q A;  3QF2 A;  3MOP A;  2O71 A;  1PN5 A;  2HM2 Q;  4FH0 A;  4NQK A;  1N3K A;  2LWE A;  1ICH A;  1D2Z B;  2N7Z A;  3CRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...