2B1YA

Crystal structure of protein of unknown function atu1913 from agrobacterium tumefaciens str. c58
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
PNFRYTHYDLKELRAGTTLEISLSSVNNVRLMTGANFQRFTELLDFKYLGGVAKKSPIRIAVPETMHWHLIIDAEGHSGLAESSVKMLPAQPQATLTRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Hypothetical Protein from Agrobacterium tumefaciens reveals a new fold.
rcsb
molecule tags Unknown function
source organism Agrobacterium tumefaciens str.
molecule keywords hypothetical protein Atu1913
total genus 9
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08980 DUF1883 Domain of unknown function (DUF1883)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.1210.10 Few Secondary Structures Irregular Atu1913-like Atu1913-like 2b1yA00
2B1YA
chains in the Genus database with same CATH superfamily
2B1YA
chains in the Genus database with same CATH topology
2B1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1Y A; 
#chains in the Genus database with same CATH topology
 2B1Y A; 
#chains in the Genus database with same CATH homology
 2B1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...