2B20A

Crystal structure of enterochelin esterase from shigella flexneri enterochelin esterase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
395
structure length
391
Chain Sequence
ALKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Transport protein
molecule keywords enterochelin esterase
total genus 103
structure length 391
sequence length 395
ec nomenclature
pdb deposition date 2005-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b20A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2b20A02
3EYSL 5L2KA 3D1MC 3T0WA 4LCIH 1G7HB 4XPTH 3M07A 3OTTA 2IMNA 4KJQC 5H35A 3C5SA 3V6OA 1MQKH 4O2EA 3BP5B 4KE8A 1MCIA 4WJ5A 4FKBA 4WENB 3QEUB 1G7LA 4L3AA 1I3RB 4LP4A 1CXEA 1NSNL 2FBJH 3OJDA 4XWOC 5D2NE 3VXNB 2BXYA 1MT3A 4LXHA 4YHLH 1CF8H 4RFEA 4HHAB 1EEYA 4KKLC 1EGJA 2F53D 3BH9A 4QHKI 5F7FA 1CK0L 4EQ3A 4IS6B 4RGMC 3WKDA 3T2PA 3F58H 2BRRH 3IDJA 2VQ1B 3VFPB 3OAUL 4WY8A 1BX2A 4LNVA 4R2GD 5LBSH 4Z76A 1S9VB 5B3JF 2D7QA 4BFBD 4N0UA 1RZJL 4AEFA 1UK6A 3ANTA 2NYYD 4NHCH 5E94B 4G8GD 1CUYA 4G9FB 4GEGA 2NZ9C 2X7LA 1O0VA 2BP3A 2XKNA 4QWMA 3I28A 3A6CH 3T8XA 4H0GA 4P46B 5DEGB 3V4UH 3T4UA 4I0PD 3WJLA 2BNQA 4P9HH 3BEVB 2P8PA 2VC2H 3OAZH 2IX9A 4YXHL 5L2KD 3ARTA 4LQFL 2V96A 4KR0A 2FBOJ 4KK5C 3DHJA 3IFLL 3EO9L 1Z3GL 3VGFA 1HHKA 4FFVD 5T1LD 2VJAA 5J57B 2X1XR 3K46A 2QQNH 3W39A 4OCSH 4UQ2A 3QI9D 1KJ3H 1XIWB 5HHQA 4BFIB 3CFEA 3CFJB 3WHXB 4PTUA 1M7IB 1N5AA 1FORH 3H9YA 2YZ1A 5DJ6A 3U9PH 1T20B 5KSBF 4BP9A 4IJ3B 2EZ0D 3BH8A 4F7PA 3E2HB 4AG4H 5BZDA 3ULVH 1QZ3A 4U1JA 3FNBA 3EIOA 3BPCB 4WO4A 3LV3B 4QDOA 5FYKH 2DI8A 5T5FH 5E1AB 1KN2L 5IHUL 1WCYA 5ENWA 1UEMA 4QXTA 2E9JA 3TO2A 4OCXH 3C09B 1I9EA 4C83A 4HMDA 4O2EB 1VXOA 1DFBH 4CCYA 5I1EH 1BREA 5GRVK 3HPLB 2DWDB 3ZT6A 1A6WL 4HK3N 3ILPA 5D4QA 3E3QC 3QIUB 4RPCA 2WINA 3QCVH 3AUKA 3S98A 4BJLA 4X00A 1S9XB 1M6OB 4MQMA 1GJIA 3VXMA 5JOFA 5I1KL 1G9NC 2ICES 3D0VB 3BRFA 3ZKQD 2DBLL 1VFMA 2QHLA 5F1IB 3QWRA 2DL2A 3GGWA 4HUXB 4P5KB 1VKXB 1ZJ5A 1EHLH 1U3HC 4GI1A 1I1CA 1U3ZA 2ORBH 5IROA 3VE0A 5HF6A 1ZSDA 2YPLE 4J3VA 5IW1B 3IDXH 2H1PL 3MUHL 3T8XB 3CSPA 1ODAA 4LGPB 5HF9A 1E6JL 1QLRB 5C6TL 2DR0A 2IH1A 1FSSA 3EGSA 5EU4B 3VJMA 2BNRA 4B7IA 2AABH 3PWJB 4I9WD 1RSFA 3LRGA 1FYHB 4WCVA 1JPSL 5C0CE 5CJOH 2ED7A 4OQ1A 4O5LH 5ITBH 1ND0A 1T0NA 3MV7D 4OFIA 1FIGL 4XZUB 2XTLA 4LHUA 5FEBA 2CK2A 4MNHA 4PTUB 4DK6A 1M7IA 1AGDA 1N5AB 1S9YA 2LAAA 4YWGL 1JZ4A 3CVHL 3BKYH 3HC7A 2ID5A 4Y2RA 5HF5A 1QSED 4MB3A 4X4XA 1RZIA 1KCKA 3QIBD 1J1OH 2CDEA 4N5ED 4WTWA 3REWA 3ULUL 5GSVA 4OLZH 1YYLH 2AGJH 1JTTA 3S35H 2H7YA 3QIWC 4BZ2H 4PJEF 3L6FB 4AEHL 2JGMA 3FMGH 3HNTL 1VE7A 1P53A 2VDPH 3D5EA 2BVPA 1NAMH 2A9NL 1MFDL 3C5ZD 4P23D 2PSHA 4OI9A 1QSFA 4X8JB 4X6EA 2BUAA 3FOBA 2NTFA 3WKCA 1X7QA 3L7EB 3IFNL 3MBXL 2FJHA 3AJAA 4BE4A 2WINB 5DLML 4ZXBA 3D39B 4LEOB 4NN7B 1G6RB 4XBPB 3MOBH 3MUGA 4FQLL 1EPFA 4DJMA 1OW0C 5TF0A 3VWJB 3MR9A 2YMXL 5K9KA 1BF2A 3HE6A 4OCWL 3FHAA 5D1QB 1YEJH 1U3YA 2XQIA 5JALA 3MV7A 5E8PA 3RWJA 3TA3D 2XICA 4P99A 1XF5B 1PQZB 4FLMA 2VQUA 2H7CA 3CU1A 1WZ1H 1UZ8B 1JUFA 5EU3B 3ARFA 2R15A 1Q9LB 4AMZA 1MCPH 1QLFB 4UOJA 2XQKA 4QKXB 5E08H 3TIEB 2FZ3B 4PJXA 5C07E 4PJXE 4UAOB 2DDQH 2GYSA 2ERJC 2O5YL 5HHOA 5ALMA 3GB7B 1NAMB 4U6XA 1CIJA 1HCFX 4FFWD 4U1LA 2KH2B 5FUOL 4IOIB 5DHYB 3NUZA 1GXEA 2A74B 3O4GA 1G7LB 1HIMH 1IQWL 3BKCH 4JR9L 3ZE2F 1A4JB 4NFDA 1UXSB 1Q9WB 4LFHD 2K1MA 1WUNT 3IJSA 5DUML 3GUTB 1T0MA 1TQCB 1M71B 3EJYD 3ESUF 1A9BB 3FN0L 4LPTA 3VXUB 1N4XH 3WIHH 4ZQKB 3VFWA 1AKNA 2VQ1A 5AZEL 5HHPB 3W82A 1CUVA 2MQ0A 1CXIA 1BVLA 2ZCKL 2CXKA 3TZVB 3SKMB 1A7RL 2HFGH 3VRIB 5HVFB 2BMKB 4RGNB 3I3DA 3U0TA 4ARAA 2O5ZH 2IPTH 5HKAA 1TQBC 3WJLC 3WA6A 2Z31C 4JFEE 3NIGE 3UBXB 1NMAH 1LPPA 5DNVA 2XMBA 1CDJA 1FLRL 1YDPA 3K8KA 2GJ6D 3RX5A 1LPMA 2IALA 3OKMA 1MPXA 5JDSB 1VFUA 1S78C 5CD5C 1UM6H 4PJDB 1CBVL 3GZKA 2NY5L 4J3JA 3IA2A 1NGPL 1WAAA 2HTLC 1T5XB 3O6MH 2R2CA 3IDNB 1WT5C 3DGGA 2WUGA 5DD1H 5D1QA 3PP4H 2BGNA 3NWOA 3LD8C 1U8NB 4UQ2B 4QA9A 4NC2B 3RWCA 4QDXA 5K59E 5DD6A 1U92B 5C0CA 1JYWA 3THML 5FPPA 1T20A 3JTSA 2VZ1A 4CBPA 4IOFC 2PW2A 5IV2A 1BF8A 2P8SA 1PG7H 3FLAA 3PHSA 1T7ZA 3CUPB 2NZIA 3QQ3A 4J7RA 4PJAE 1XGRB 2EDWA 1PGRB 4U1SB 1ZOIA 2DRUA 3PUIA 4HZLB 1S8DA 2VH5H 3D0KA 2QUAA 1MCWM 2AJVH 2R69H 4UPDA 4WHYG 3BP7A 1T0MB 5GJTL 5EIQA 1IC7L 4EOWL 1OTUD 1REIA 1AHWB 1SQ2N 5FIEA 3RPKA 5ALRA 5CJXC 1AJ7L 4QOKB 3VDCA 2VXUL 4PRHE 1VE6A 2WLZA 1U95B 5CIPH 3DD5A 4RRPA 4P2RE 4OYLA 4CIAA 1QSVA 5LKAA 1NLBH 3WL5A 1A6TB 3V6ZA 5J13B 5IVHA 5TGBB 3U36A 1ZT1A 2PU7A 1KJ2B 2FECI 3QCTH 3VI3E 3BRGC 4QDZA 3HUJB 2RHTA 5TDPA 1W0YT 2IALB 2WWKO 4X6FB 4Y1AA 1S5HA 1BQHA 5HQ3B 3AREB 2VIRB 4K5QA 4RWYH 2WAHA 1OAYL 3LPGA 1H3VA 5HD8D 3WIFA 1A2YB 2ZCLH 3KS0J 4M7JL 3EQ7A 5HPMA 4MLIA 2B4CC 4JRYE 2NXYC 4M1GL 1XR9A 1DBML 2F54E 2XXCB 2OLDA 4J12A 5FK9A 5HYJB 3BHBA 2X4RB 2K7QA 1N0LA 3ZL4H 4JRXD 5INCB 2BCKA 4X94A 1CDUA 3OV6A 4L3EE 4LLDA 3KPRB 4WJ5B 1S7TB 1WGOA 2FJFB 5I16A 1NBVH 1YC8A 1JNNH 3IT8D 3N06B 3ECBA 3LS4H 3PDGA 4S1SL 4POUB 3DSNA 4F37F 3RUGB 3VXKA 1T7WA 5D7IB 4ALAH 3EQ9A 4HIJB 2DTMH 3RARA 4Y5YC 3G0DA 1HDEA 2CGRH 3VFPA 3JWDC 2EXWD 5FA4A 3KHQA 3FN3A 1CD0A 4R4FH 3UTSE 3F7YB 4NZZA 2VSQA 1HINL 43CAA 1N26A 3UMJA 2VLME 2B4CL 2A9ML 3V9FA 1NGXA 2H32H 1I8MB 1Z5LA 2JF0A 2ICWB 4QYOB 2QEJA 4J4PD 1I4FA 1BFVL 4OCNC 1CU4H 3WL6A 2A83B 1OAZL 5AI5A 1GGUA 2W92A 1MJ7H 5C0BE 1X6NA 3IFOB 1XGTB 1ZAGA 4MAUH 5I8CA 3BEVA 2VL4A 3LB6C 5CGMA 5DJZB 4Z7UE 4GUPA 4CKVX 5CKAA 3FYUC 5I9IA 4X97A 1ZVSA 3VXQA 2BVUA 2BHYA 1HEZA 4L3EB 5GRJL 3STVA 5B39B 3SX4A 5TDPB 3WE6B 1NKOA 3NPSB 2YK1H 4POYA 1L0QA 3NCYP 4M4RA 3VJ6A 5C9JB 5ALTA 1AFVL 4DNOA 1FIEA 4EY5A 4LDLB 5CBEB 1AXTL 2VDLH 5GJSL 5F3BB 1CVSC 5D96C 2PTTA 3ZDYF 5J0BA 4RGND 3DO7A 4XPAL 4PSDA 3V1NA 3VGGA 4PRAA 2NY0B 2IH3A 1IGMH 3BPNB 4FTVE 4MJ5B 5EOCJ 1KPUA 5CIPA 3WFCH 1OQOA 2GTWA 5ADOH 1QBBA 3BDIA 4MQSB 4JM2B 1RIVH 3K4ZA 1DX6A 3HPLA 2OSLA 3BD3A 3GMRA 3RDTC 4J0JA 1ONQB 2F19L 3QIUA 1OTSD 5FA3B 1CFVL 4WHDA 5E8OB 3L9RA 2BVQA 2AEWA 4HIJA 3P0VH 4YXKH 3MRNA 2QS9A 5TQ2L 1NCTA 1ORWA 4G9FE 5T33H 5DNUA 3WFEH 4AEIH 1S7VB 4FA8A 4C4KO 2C3WA 5LXGH 3VFNA 1QFMA 4MLSA 5JPNA 2Y6VA 1MHCA 1CUSA 3H9ZA 4JM2C 1ES0A 4CVUA 1JGLH 2I9TB 5D71H 2XZCL 4Y4KA 5F1IA 1VA5A 3LKPB 4KDVA 1GT6A 4PGDA 1AKJD 2G9HA 5FM4A 4XH2A 3WK8A 1J18A 2X4PA 1DBBH 1DQYA 5HVGB 1H3GA 1DEDA 1OLZA 1RZKL 3ARDA 4EBBA 4HJGA 1QONA 1T83A 1UKTA 4YK4B 1VESA 4R97C 4JM4H 3R3VA 3GBMH 4GRWB 4R90H 3U0PB 1FFEA 5EI5A 3HHRB 4TNWF 4HAIA 3VXQB 2PXYD 2WP3O 1NANH 3C08H 3RLIA 1KT2B 5CBAB 4ZD3L 2GY7B 3PP3H 3D85A 1WTGT 1TJHL 2EYRA 4HFWA 3QEQA 1EHYA 3GK8L 2O93L 1DQDL 4EI5B 5C0NC 4F21A 4AZ0A 5MENE 3O6FB 3O41B 1TETH 5F1KC 1ZGBA 4TPRL 5IKCA 4P5MB 5I1IL 2DIBA 2EDOA 4XIIA 1SCQA 1NDGA 4ODVL 1R0AH 3LHPL 1N7ML 1FYTD 4U05A 1I9JL 1EZVX 2VL5B 3D18A 5D7JA 2DJ4A 4RSVA 5ACZB 2GFBA 4NM8L 2Y6UA 5FGBC 4N0YL 3VD4A 1H8OA 3PNWB 4XMPL 5F89B 2XI4A 1WIPA 3QEGH 4EY6A 3Q0HA 5ICXB 3AMKA 2YD4A 1RIUL 4KE9A 2CR6A 1NKRA 4IMKC 1BIHA 4KMLB 4YUEH 4PD4K 1AGCA 5J1TC 4XHJC 3BWUC 3D2UA 4E41D 1NEZA 4Y16A 3H8NA 2JB6A 2GITA 4IRSC 4HF5L 4RMWA 4XBPA 5EA0L 2GJ6A 4Y5VA 2BSED 3V1MA 5H3HA 1IZKA 4KROB 4GKNA 1HQRA 5L9DL 3N50A 2P42B 4OD1H 3GSUA 3GDBA 1QNZL 4L4VA 5KTEH 3D4LA 2BNQD 4NZTL 4MJID 5GRWA 1BCRA 1MPAH 2Z4QA 3RVWC 1JGUL 3GIVA 1FJ1B 3C43A 2CXGA 4QNNA 1KELH 5KOMC 1CRLA 5D6CA 4R8WL 3JWOL 3T0ED 3UYRL 2G5PA 2DIJA 4QXWA 2UUDK 2VZUA 4ZFOB 1ZVHA 4ZUVA 1XR9B 3WYDA 3RGVA 4QXUH 2GUOB 2Y72A 5TQ0H 5AK4A 1LGYA 4YBLC 4LLYA 5AYUH 2IAMC 5AP9A 1R3IH 3SDXF 1CGVA 4YQXL 1XGPB 3PDCA 2OPHA 2Q76A 2VLJB 5LWYH 4PFEA 4X83A 1Q9WA 3U0WH 3IVKA 1GVIA 1S7UB 3I75A 3QIBC 1IGCH 3V0WL 2YS4A 1R3KA 2ZJ7A 2IAND 5D2LB 3T3ME 3N1FC 3WN5A 5DVMA 2OMNA 1B6GA 3HLKA 1Z9SA 1KSRA 3HFML 5CSZA 3VFUB 4DSAA 2VN4A 4MB4A 4JVPA 1KCUH 4A2LA 1AO7A 1QIGA 1I9IL 5E8EA 5F8RC 1FDLH 2HMID 4WFED 2QKYA 3OG6B 1YASA 3QPCA 2FYYB 4FQHA 4TSCH 5DURB 1YR2A 1HZHH 4H26A 3SN6N 3BDXA 2EDTA 4PJDF 1QFPA 1L9NA 1RFDH 1UH2A 3C8DA 4HPYH 5T1LB 1BZ9B 1JNHA 5E4IA 5CZVL 1UQSB 3DOHA 2XT1B 2CKBL 3D69A 4EB0A 3CDCA 1NJ9B 3QULB 3WFHA 1KGCD 1JFQH 3PQYD 4OAWA 4G8EB 3VFSB 3CSYA 1A6AA 3QUYC 2HTKC 2GYUA 4I0PB 4JFFB 2GAZA 4GFTB 2Z4QB 3CXHK 3A67H 1ZHLB 4C4KT 4K6KA 2XZAL 5IT2L 3O6LL 4PJBA 3FZUD 4HXAH 3NFPB 3VXMD 4ETYA 3KWWA 3REVB 2HRRA 1KB5B 4F3FB 3WL9B 5DS8B 3RZWA 1FSKC 4M7ZC 3QUZA 5JW5A 2PYFA 2VR5A 5I17B 1S9WA 3QFJE 3UJJH 1KJ2H 5IB4A 2NW6A 3A6BL 3GJEB 4TSCL 4BSVA 5E2WL 3RTQA 1W2KT 3STZA 5E4JA 3PWNB 4F0JA 4P2RA 4Z77A 4MAYA 3FN9A 2GHWB 4WO4D 3R40A 5FDFA 5GZND 1VADB 3I02A 4Z95H 5E8NB 1KCUL 5C0FA 4RGOL 3VMPA 2HA0A 1A6VH 3FAWA 3NZ8B 1EBPA 4Y2PA 3HFMH 1Z0MA 3KYAA 2OAGA 2OYPA 1FVDB 1BM3H 3BW9B 1UK9A 3JVGC 2GT9A 4IIQB 3MJ7B 2ZSWB 3CXDH 3EZ8A 3Q2CA 4HK0A 4KEAA 1HOCA 1XGQA 4WWKD 5C0IA 4FQHB 4UV7H 2AJYL 4AENA 3U0WL 4U6YB 3UPAA 4PF1A 1EDQA 1K6QH 5JW4M 4U2GA 4PLKC 2PTUA 4HCRL 4X6CE 2OL3A 3DQZA 2DB8A 2J4WH 2QQKL 5KS9A 2HFTA 4NKDB 3L3DA 2Z8SA 3R1GL 3VWKA 5IMLB 1R9MA 1FNEB 2CO6B 3O6FC 1UADC 3AIMA 1A6ZA 1ODTC 4JFOA 3JWOH 1KLUA 5ALHA 2V98A 3LKRB 1BHGA 1VFBA 2X4RA 4YNYB 4DGVH 3OB8A 2CPCA 1QBML 4WU7A 5DRWB 3O9VA 3LDBC 1ZA3B 1WAAE 3G5XA 3MBED 3SOBH 1QNZH 4OD1L 3VJLA 3MYJA 4C6HA 3PL6A 2OK0H 3PWPD 5DDHB 2R29L 2D7TH 4P5TA 1KB5A 4HBQA 5FV4A 1DBJH 3V52H 5F7WC 3INUH 5A2GA 5GGSA 3ARFD 3G6DH 3QUZB 2V5MA 3CPLA 2ZNXA 5D72L 3RVVC 4XP4L 4IRSA 4IMLA 4JY4B 5EZIH 2XOTA 2Z8XA 4R4BB 1F4HA 4XPBH 4F9LA 4YHNB 2GI7A 2OGTA 1FL3A 4WTXA 1I3GL 2C5FA 3E6HB 5JLZA 3FL7A 3GNML 1MWAB 3L7FB 2AXJA 2FIKB 4XP1H 2PX6A 3I3BA 3SDDC 4NM8H 3ULVC 4DEPB 3BUYA 1OSZA 4ENEC 5CEYA 4BQ8A 4P2QD 3MJ8A 4DN4L 1YAJA 4MAYC 3LHPH 1WZMA 3BQUD 3VG9C 4GG6E 3O11A 4NRZA 3HSSA 1U8MB 1FJ1A 1KCSL 3AM8A 4QHNA 2FCBA 3T65B 5LZ9A 1QHOA 1ZD3A 2Q0XA 1B88A 1ZT4B 4XHQA 3WJJA 5B8CB 3KJ4B 1TJHH 4PJGA 3PL6D 3TN0C 5CZKA 1S7RB 3TWCH 2JGEA 1EFXB 4AL8L 4BQCA 3V9AA 2FRGP 5KW9L 3FAKA 2HVKB 4R90L 4BUHA 1QPPA 1FH5H 1H5BC 1MIEL 4X99A 5I73B 2G4LA 1SYVA 4JO1L 5LKRA 2X8BA 4OGYL 3LRHA 2NY6B 3FKUS 1ZV5A 4OB8A 4OSUL 4X9HA 1NCDH 4NRYB 3CN7A 4QEKA 4LPCA 2ZUTA 3AROA 4F8TA 4XRCB 5EH1A 1WHSA 2MQCA 1NFDF 5HGBB 3MVEA 3QWOB 2E27H 3Q5YA 1BWWA 1MRCH 4P3DA 5LGJA 3V5HA 1JV5B 5EIIA 3OAZK 1NANI 3FO0L 2WIGA 2WLYA 3HEAA 5AK6A 5LZ4A 4ZV9A 1F8TH 4N0FA 5D7KE 3RVUC 4Z7OF 1FZJB 1KIPA 3MRIB 4PBVC 4UIKL 4NKMB 4L9LC 3VVLA 3S4SB 3HC3L 2NX5E 1Y37A 5J12C 3HPJA 4R4BA 5MI0C 2AV1B 4UOW1 3LKPA 4NBXB 5D1QC 3QXVA 1GC1H 1JGEA 2H26B 5ADOL 4G1FA 5AKJA 4RGNC 1SJEB 1V7NL 3IF1B 2DYPB 4MJIE 4M6AA 3VRLE 3LS2A 1AR1C 2VAXA 2YXPX 1NGQL 4IH9A 2AXGB 5JANA 1MELA 2LABA 4XPAH 2YUWA 5C2BH 1E4KA 1W76A 2WZPD 5B4MD 4NM4L 4RNRA 1BCSA 1XZHA 2CJPA 3ELAT 5D7LD 2Y06L 5DA0B 2Q20A 2UVEA 5CRIA 2CUIA 4NP4H 1FJ2A 2BY1A 1TTFA 1RIHL 5CP3A 2FZ3A 4PJXB 2EYRB 4HFWB 5DC4B 3TF7C 1J5OH 1WBXB 5IB2B 4GRWE 4QHMB 2D0HA 4U4BA 2C7UA 2HKFL 1W0VA 1CI5A 3KWWB 3REVA 2PXYA 2RB8A 3GB7A 3C2AH 3KYOB 4LSUH 1BJ1J 2AK4A 2X1WL 4HT1H 5AKKA 5JW5B 1N5MA 5E6ZA 2X4OA 5BS0A 2GSGB 5LLSA 2OP4L 1DINA 3CFBA 3LZFL 4BSVB 2PSDA 3FYTA 2GYVA 1YMHA 4UQ3A 3DVGB 5EWIL 4GBXA 5FV1L 1DZBA 4APQA 5BV7B 4DUVA 4MJIB 3GBNL 4NWTH 1A64A 1WWBX 5FF6B 3WMRA 3SDCD 1F3RB 4L5FH 1HINH 4PB0L 3SKNB 4H20L 3WFBH 4Y16B 1J8HE 2Q86A 1KBGL 2CGRL 1MY7A 1KEGL 1CXHA 5GXBB 1S7XB 4YX9A 3QH3B 4JM2D 4NKMA 1E28A 3FO0H 3D3VD 5HYIA 4NBZB 5IVOA 1EMTL 2P7TB 2YD5A 4EA6A 2XPGA 1YDPB 4LGSB 3GSUB 3NPSC 1NGWB 1Q72H 3ZYOA 1YECL 4OZFB 2H3NA 5EZOH 4G6AC 3RWFA 1KYOJ 3KXFD 1IZ8A 4LCCC 1KIRA 4NQXA 3ZL4L 1DUYB 1AO7D 2V5TA 1D5IH 5DJ5A 1L0XA 4PJCA 4PSUA 2BOBA 5KREA 4XMKH 2YZ8A 1MI5B 2G5TA 5CEXA 3NIGF 3HZMB 4ZUUA 4PY7A 4LDOB 3RWEA 2X42A 2BSTB 4IRJA 3VXME 4J0HA 1MLCA 1OAYH 3SJVD 3KPNB 1NDMB 5EU5B 1FVCB 2IPUK 5DD0L 5ICYB 5DRNB 1JF6A 2W59A 2V9ZA 2XMQA 1RK0B 1IFHH 1C08A 3EAKA 3KPLB 1KIUA 3MROB 3RY6A 2PXYB 4KQ4L 3BWAA 1A1NB 1RAMA 4LNRB 2Y1KA 3DTXA 3QDJB 4NCC1 3S36L 3EOTL 5CTAA 1MCEA 5HFNA 4F80A 1G66A 4FFWC 4JPKL 2VLRA 4XAWL 4U7SA 4NWUH 4WCYH 5JW4R 3ICVA 4YBQC 2IGFL 1UH4A 4XP1L 3RAJL 2HLAB 4ONHA 4QCIB 5DJ8A 1CR9H 3QHFL 2WM2A 3DECA 4JANB 4L4VE 5LGHH 4OD0A 3WS3B 3IAGC 5L2JA 5AI0A 2VH5L 2X9XA 2IQAA 4XP4H 2IAMD 4OF8A 4XVSL 2VXVH 1MCWW 2AK4D 1MNUL 5KVEL 1F3JA 4QLOA 2GJ6E 3SCMB 3W9UA 3V6ZB 1GAFL 1JI2A 3V52L 1YEKH 5LZ5A 3QPAA 2XPGB 1HH9B 1N6QH 2HFKA 5E8DL 4ODTL 1IGJA 5I71C 5L8KB 4NQXB 4KHTH 3FOMA 2IBBA 2CDFA 3HZYA 4BDSA 3E2HC 4HKBA 1NGZB 2XG4A 1HSAB 1H22A 1PX4A 1NCBH 3ARBA 3OGCA 2HA6A 4ZDHA 4P3CL 5CD5D 4AQOA 3T1WA 2DFPA 4P4KB 4FFZH 3MA9H 2WTNA 1SVZA 4ODWA 3KWJA 2BZDA 3V0VA 5CT9A 4KJXA 5SWSA 2H45A 2D2OA 2UWEA 5EFIB 1D6VL 1RZFH 3I6ZA 2AQ1A 1IAOB 5HGBA 1P7QD 1WSST 1K8QA 1S9WB 2A6KA 3CCHA 1PYWA 3IKCA 1N6VA 4U0QB 5D2NA 5IVZA 3CZJA 5F9DC 3T3PE 1NMAL 4EBQH 2AJYH 4RX4D 1X4XA 4D0DA 3QUKA 1RURL 5EUOB 3FAXA 1SEBB 5IB3A 4ODXA 3N2ZB 2CIIB 5C0GB 3RX8A 1B90A 2VR9A 2VZSA 1KXTB 3SGKC 4TULL 4B81A 2JEYA 2W9EH 4EN3C 4NNYB 3ARYA 3WJJC 2P5WA 4PRHD 1ADQL 4PJ8C 2P1YA 4IHOA 1DN0A 2DD8H 2YWYA 5JW3L 5A2LH 5JORA 1GGTA 4RGYA 1PW3A 4N9GA 1EINA 1HOCB 1XGQB 2ADGA 1H5BA 5D93C 1DDHA 4ZOEA 4CN6A 3L3HB 4BM7A 4FZEL 5FUOH 4K7PX 1KENH 2ARJB 2EYSA 5EBWA 3IURA 2VDNH 2OMBA 4E15A 3KSRA 1JWSB 1C16A 2M8XA 2BERA 4R7NA 5JHDA 1IGIH 4I3SH 4RAHA 2YC1B 3KPRE 3MV8D 4QRUA 5GZNC 2ITDA 4JRYD 4Y16D 3U48A 4KRNA 4DLNA 4ORGA 35C8H 1J86A 2GQHA 3MACL 4XP9H 4HJ0D 5C09A 5BOPA 3W0WA 2X4SA 1Y6KR 3BQUA 5EO9A 5HYJD 5EO1A 3E1GA 2ZYIA 5F3BA 3PDOB 1ZA3A 3OGCB 1EUUA 4LSTH 4C59B 3K81A 3ZKXB 4ZYKA 4MDIA 4U1IA 4KE7A 1BAFH 4KDTC 1R3LA 2P5WD 4PRHA 3DXAD 2ESVE 4P5TB 1Y7HA 4ODWB 5ALIA 4HUUA 1EAPB 4G7VH 5KWIA 4YZFF 1U8OA 3GI8L 5CZVH 4L1HA 2YHGA 5ISZE 3CPLB 3W11D 2OSLB 1AE6L 1LNSA 3QRFM 3C6LD 1DJSA 3QEQD 3W9EB 4YHNA 4NQSA 4DW2H 3H1BA 2Q86B 4NO3A 1ZWIA 5HYSB 2VLMD 4R26L 3HLAA 1NAML 2CLRA 4AEHH 3FRPA 1SEQH 4PGCA 1JYNA 4EUSA 3ROLB 2E5EA 3TO4C 5JATA 4G7VL 1IC5H 2AGJL 3ZE0E 3KPTA 4H25B 4YX2L 4KJWC 5C08E 1S5IH 3TP4A 2H7XA 5LZ7A 3MV9B 3QIUC 3CMOH 2LAGB 5KSAC 4OZHB 1EO8L 3HB3D 5F1NB 2D03L 5D7LE 1DLHB 3VXPA 4Z8FH 4NOFA 5FFLA 1ZT4A 5K3DA 1CUJA 3UUEA 4ODUB 3ZKSD 4JFPA 4X9GA 4Y4FC 4EUPA 4UBDD 2B5IC 5JADA 1A4KA 1EFXA 2XA8H 5AYUL 5JIHA 3WIIH 3PI6A 4A6YB 2HVKA 1R50A 1ZHBA 4JH0A 5A7GA 2FJPA 4FFVC 3CFDB 4MA1C 4PIRF 3GSNB 4RRPG 1J88A 4KMTL 3LCRA 1MRDH 1D5MA 2Q6WA 2WU4A 3TH3T 3DRTB 4YK4C 4R8WH 1P4LB 2BFNA 4PJ9B 1MPAL 1VACB 2EZ0C 3FFCA 4FRWA 5BJTA 3HUJF 2DQIL 1T3FA 5JW3H 5AKZA 3HABA 3BYTA 4WU5B 4HZAA 3PP3K 4UOW0 1UYWL 1R3LB 2IPKB 3MV01 4KK6C 1RD6A 1XZJA 2AJZB 4W63A 3QYCA 4RFNB 1RUQL 4P2RD 4ZSOA 3L1JA 3AZQA 3MLXL 3ULUD 2AEPL 4X8XA 4MD4B 1UOQA 2HFFB 3JV5A 1XZBA 1D5BA 1I8IA 3O4LD 4NQTA 4NPYA 3MLTA 5I76A 3G5ZA 3KDAA 3DOIA 3TYFA 4FP8H 4DVBB 3PGCB 4Y5VB 1EEZA 3WKNA 2DWDA 2HRLA 5IMMB 1LP9B 1DQTA 4H88L 3CMGA 5T5FL 4CRPA 4NO0D 2H8PA 1XGUA 4HS8L 3SK0A 3OR7A 4FFZL 2V5SA 3O2WL 4BAZA 3RWIA 4WFJA 1X5KA 3KPOB 4NBYB 4NKOB 2HA3A 2FATL 5I9QC 4P3CH 1NMCB 3RRQA 3L5IA 3BP4B 1K2DA 1NCBL 3OZ9L 2HLFD 3FFCE 2I5YH 3RVXC 1PJAA 1GPLA 4TSAH 1LBSA 3QUMA 2FEDC 1MCJA 5AI6A 1PKQE 1I8LC 1KJ3L 2FATH 3MGTA 3SJVE 2WG2A 2QQNL 3O2WH 1UGNA 1XZCA 1Z9OA 3ZYZA 1IAIL 2AW2A 1QFWH 1I1AC 1V3MA 5DQDL 3MRBB 2Z31A 1A4KB 1FO0B 1U0QA 4H88H 5FB8B 1K6EA 1IBGL 3EFFB 1QIHA 5JARA 1YEKL 1YY9C 3MRGB 5EU6B 1A8JH 1CUAA 4XVJL 1B0GB 2J1KA 5KVEH 4U7KA 5MERA 2EE3A 4XVSH 1KN4H 3KLAA 3I75B 1YMHB 4UQ3B 1CLZL 2XWTA 4BSWA 5HY9A 2QV2A 3QIWB 5AAWA 3WK7A 3TJHC 3QHFH 5JA9A 4NHCL 3DHMA 2IGFH 5DTFB 3L3JB 5KVGL 1X5JA 1FHGA 2P5WB 4KXZI 4HULB 4GMTH 3PWLA 2A1WL 3BGAA 2BRRL 2BJHA 3UTTA 1IQDB 1W72B 2VATA 5DEGA 1VFAB 4HMCA 4YXKL 2MCPL 5IJVA 4QRSB 4EUPH 5C8JB 1L7IH 1AIFB 1K8IB 1XQYA 3G9ZA 4RMSA 1CE1H 4X7TA 2R9HD 3H2KA 2HFFA 2YD1A 4G42B 4X6CB 3MLWL 3GJFH 4AQ1B 1AQKL 5ALUA 1RIVL 2NLJB 4JQVA 5KS9F 3O4JA 2XZQH 5LGKA 1CS6A 2M1KA 3WFCL 2P5EE 2R1WB 4Z18A 1IGML 2WG1A 3EJZC 3MNZA 5C0AE 2E8ZA 3AGVA 3WS6C 1XR8B 1I9RL 1OVZA 3V95A 2DLIA 4ZXBB 2ICCA 4WDQA 4FXGB 1P4BL 3VXTA 5AKEA 2ENYA 4XMKL 3VXSE 3B3IA 3JBG7 1RJYB 3FB5A 2WV3A 3SDAD 5IVXB 1F6FB 2YPVL 4U1KB 3TBVA 3CMOL 4WO4B 3CDFA 1S5IL 1MCKA 1SFRA 4Z49A 4X4ME 1C7JA 2JGKA 4HLJA 1VSCA 3BMWA 3WFZA 1S7SA 4X0KA 1DTEA 1EAPA 1AQLA 1EMTH 4BZ1H 1KG0A 1X4ZA 1F4AA 2EO9A 4KK9D 2AS5M 3TIEA 1JT2A 4LU5L 1BOGA 4NJ9L 3ANSA 5B22A 4DOHE 1Q0RA 1YMMB 2WJ3A 3MNWB 4G9FD 2J5LC 4CL7A 1KBGH 3IDGA 1S7QA 2R9HC 2VB5A 3GKWL 1CU4L 3WFBL 4H20H 3EJYC 1FZMB 3MXWH 4TUOA 3ARGA 1AZWA 4OZFH 3AIOA 4LASH 3BI9X 4RA3A 4LASL 1SYSA 1GHFL 1JI3A 2WFMA 4MX7B 4WW2A 2ZZUT 3GSXB 2H2SD 4R4FL 2APBA 3RVWD 4K7FA 1WQVT 5ALLA 3F12B 5IBLD 4TUJA 4QEGA 1RZGB 1MJUL 4QRSA 4XP9L 4OZIE 3MACH 3UBXI 1WEJL 3QXDB 4CMHB 4PGEB 4HTAA 1FNLA 3MTRA 1SBSH 2DJSA 4RFNC 4YDVA 1IGIL 3SQOL 3SHSA 4PV9B 3VXOB 1GGVA 2BY2A 2JB5H 5D1ZC 3ZT7A 3IS0X 3BN9D 4YO0B 4PJFA 1CUUA 2CDFB 4P93A 1ISPA 1EHAA 4PV7A 2ENSA 4Z6AT 2Y06H 3IAPA 3R06B 4Y19E 2GK0B 5DWDA 3WLAA 5LJYH 1CD1B 3KPSD 4NM4H 1P4BH 5HFAA 4QOKE 3MLSL 2XUHA 1XCTB 3KGRA 4M7JH 4OUOA 6YASA 3ARWA 3DIFB 3SDDB 3U30C 1P4LA 1R1DA 2ILLA 4UFNA 1IEBA 3DXAE 1P9MC 1T89C 3RP1A 2X5PA 4AN0A 2DD8L 2APVA 3QUYD 1V7NH 3G5XB 1U8NA 3UJIL 4TGLA 2DCMA 4YDKH 3EBLA 4BFGA 5LKNA 2W9EL 4WDIB 1AD9A 1K85A 2OL3L 1U92A 4R97B 1J8HA 5EC2A 1ODSA 2J8UA 1NCWH 4D9JA 4S1QL 4I8DA 3V5DB 3SY0A 2QZPA 2Y4SA 3RM3A 2X2YA 5H2BA 5EG6C 1RUAH 1RPQA 1G7JA 4GMTL 4OFVA 2VXUH 1I8IB 4HIIA 4JAMA 1EVQA 1HKFA 5GZOC 3O2DL 4Y5XA 2YPLA 2R0KL 3T0EB 4HS3A 2VJBA 4WFHE 5GJTH 4N9GB 3PGCA 5BS0E 3DPBA 1BEYH 4G4IA 5ALNA 4MJ6B 3DURB 4HIHB 5B3NA 4R0LA 5FYJE 1LVEA 4DN3L 1VENA 4ZFFA 1KN4L 2BUCA 3OSKA 4NKOA 4DOHB 3BP4A 3IIIA 1U8MA 4QOKA 5DMGC 2ZOKB 4WDRA 1Z2KA 1SCIA 3SGJA 3S96B 3FTGB 4F9PC 1MX1A 4JPIA 2J6EA 1CLCA 1F58L 3RU8L 1N6QL 1IAIH 4E41B 5E9DD 3TO4A 4DMHA 5HYQA 2O2HA 3K74B 4G8CA 4FMKA 2QQLH 2QBWA 5ALGA 1NUGA 3CU7A 4UT9H 2DHDA 1FC2D 4MWTA 3TBTB 5BRZE 5HGAA 5AKXA 1BQLL 2NR6C 5C0DB 5D3ZA 3H7BA 2WW8A 1XCQB 1CBVH 3HG1A 1QIEA 2P43B 3TZVA 1ZI8A 1U91A 2ADJB 3MRDB 5ALBH 3NIFE 5C8VA 4NWUL 2MQ3A 3DX8B 4WFEE 5GIRA 4JPKH 4XAWH 3UZQA 3U0TB 3FOLB 1KTRL 5D5ME 4XPBL 3D3VA 5FO9B 1Z9LA 5TE4H 3UBXA 3MRIA 5H94B 3G6DL 5KVDH 5ALXA 3INUL 4HKJA 4X7TB 4Z7VA 3QG6A 2JLLA 1A7RH 2HG5B 4AIXA 4YDKL 3WA7A 4YFDB 4EY8A 2R29H 5JXEA 4HIIB 4JAMB 1CLYH 4J3UA 5AZEH 5BO1H 3WNKA 1MFEL 1JGVH 2ACEA 3FLBA 3C5JA 2WIIA 4X71A 5DJCA 5DUMH 2SEBB 3TESA 3FFCD 3D59A 2NPLX 3ZTJH 1HIML 4FTWA 4XWGH 2D31B 2HN7B 4MGXA 1SM3H 4WI5A 2XFXB 2BHZA 5C07D 5I8EA 4YGAB 3R1GH 4QWWA 4PRBB 5D1ZA 2X1PA 3ZHDA 4Y16C 1THGA 1XF4A 5EZOL 3CJJA 4TUKH 5CGTA 5A3ID 1UOPA 3HACA 1N8ZB 4GG8A 2PSEA 1HH6A 2WJ4A 1MCPL 3QPQC 1W0VB 2M26A 4HRYA 1WEJH 3KWFA 1MJUH 3CN9A 1UB5B 1MHEB 4PP2B 3F98A 2MFNA 3OKEB 5CJ5A 4Q7DA 4DTCA 1FNAA 1Z0NA 5H37H 1MFNA 3D25A 4PB0H 2J6EH 4OGAD 1YN6B 4JFDD 5FRDA 4S10A 2GCYB 4LCCA 1GHFH 5JIKA 5FO8B 3HRZA 5SWZE 3GBNH 1A6VL 1VA4A 3QEHA 3RZCB 1AC6A 4M43H 4ZSOB 3M82A 3ARUA 1LPAB 3WWDA 2UZYB 2RAMA 5IB1B 2PO6C 3RWHA 3VDAA 3DO7B 3GKWH 3HN3A 2OP4H 2IH3B 4JFEA 3U9UA 4RAUA 5AM1A 4PJ7A 1MH5A 2AXFA 1KYOK 4I48A 4NJ9H 5TF1L 5GGSY 5FO7B 4I4CA 4JM2A 2X1OA 4YHMH 4BZ1L 2BUBA 4LSUL 3PGFH 4UIMA 3C2AL 4NFCA 4ODSH 3VXNA 4KHXH 4QGYA 1MOEA 1P7KA 2P5ED 1MF2H 1Q1JL 3GZJA 1MREL 4UNVA 5K3BA 1LBTA 2EIEA 1A3QA 3TFKD 4NQDB 1W75A 1UC6A 5HVHC 4QHLB 1UVQB 3RWDB 4BYMA 4ZOCA 4DCQB 3Q3GA 3ULSB 1T83C 3VFNB 4YWGH 2XZAH 5IT2H 2EDJA 3DUSA 4LXGA 3G5VB 3NN8A 3TBSA 3U30B 1KOAA 3DV6A 3R3ZA 5HYJA 4JFDB 1RZKC 4H0HB 3QHTC 3UDWA 3ZHKA 2CZQA 4UUQA 4M48H 4M8QA 1HDMA 4IRJB 1BJMA 4UBIA 1JFQL 3KVQA 5CLTA 3SO3C 5IFJA 4CIBA 2XZQL 3F9CA 3C8KB 4G8DA 1CGSL 1AQKH 3RDTA 5CLWA 5EBGA 5C6TH 2MKLC 4C56B 2VRAA 1CE1L 1YMME 3I6GA 3FCTB 3KG5A 2A1WH 3DTXB 3V5DA 1CUZA 2AI0L 4PRPD 3MV9E 3EOBA 3G6AB 5T5NG 4LKXA 3BUTA 1FNGB 3QJHA 2G75B 5KVGH 1A9EA 1YN6A 4OCRL 4Q1VA 4UHHA 3S97C 3CH1A 5AZ2L 3WK9A 4Q05A 1UZAA 3JUZA 3MBEB 2BDNL 3C6XA 4KRPC 5BZDB 5DJ8B 1AIFA 5IB1A 3ARBC 1NCDL 4OFYD 3QCVL 2H2PC 5E6IB 1ZS8A 4OSUH 1PDKA 3CVIH 1UZ6F 5F6HJ 4OGYH 1G9ML 5JD6A 4EBQL 5CXXA 1JRHI 1FFNA 4CJ1A 2VN7A 1CFJA 4JO1H 4KK5D 4RX4A 4EY7A 5LWYL 1MIEH 4FFWA 1FH5L 3LQAC 4P08A 5DJ2A 3EHBD 3MC0A 5HXMA 3FJTA 3ABZA 2MTPA 3C6SA 5CUSL 4PJBE 3QI9C 5DJAA 4CU7A 3MA9L 1WBYB 1IT9H 4H1LB 5IVXF 1PFQA 3I84A 4BTVA 4NQDA 1OQXA 3N1QC 5IMOA 4QY8B 1QA9A 2CBGA 3RWDA 3OKOB 3HCVA 3NCCB 3AIKA 4B80A 4YFLI 4HSQA 2I5YL 4KRMB 4QOKD 3OZ9H 4Z7WF 1QR1B 2Y7QB 4KHTL 4DGYH 5AD0B 4JRYB 4DN4H 3AB0B 3GSVB 3U1SH 7YASA 3H9HB 1OGAB 5E8DH 4LCYB 2HHAA 4NO5B 1Z3GH 3B5TA 3TIDA 4RMTA 5L9DH 4POZD 3ZWQA 3PABA 2ATPA 2IG2H 3VGAB 5CW2A 5ALDA 3EGSB 1I3GH 5EU4A 5ETUB 1ZT7A 3PUCA 2O2IA 3S37H 1JWUB 3V0AC 5D6OA 4IS6A 2NMSA 5DHVH 3V4UL 2CRMA 2GZSA 4Y2VA 3JWDH 2AEPH 3MLXH 3K6KA 4YUEL 3H9SE 3K8LA 1JMXA 1QYGL 2D9CA 4DQOH 3IVMA 3RAJH 4XNMB 2IG2L 4WCYL 2OK0L 1QTIA 1SCKA 4L3CB 3SOBL 4AM0A 2HMIC 1G7MA 5GGTH 3WN5B 1FZOB 4F60A 3T77B 4CNIB 2YA2A 1OLLA 3CXUA 5DK3A 3QITA 4NO0A 2FBJL 1UKBA 4D8PB 2K3TA 4XAKD 2B8OT 3QQ4B 5HGHA 3EDJA 3IUQA 4QLAA 2BCEA 1U8LB 4NHUB 4LIQL 5DD0H 5DYWA 4XPTL 4JREC 3EYSH 1M7DA 3MRFB 4LCUB 1BIIB 1QE3A 4QRUB 1LNUA 3GBML 2FJGB 4PQEA 4Z8FL 2VAJA 4FQCH 3MLRH 3V79C 3W0WD 4HQQH 2JTDA 1RZKH 2H2SC 1IL1B 5EIEA 4Y2DB 4C4ZA 5ALSA 1DTUA 4PYHA 3VXRD 3PNWA 2E7LA 1IC5L 3S3JA 1QIJA 2CDGA 2OCKA 3A2MA 5K9QI 1F00I 4HWBA 5ESVA 1ZLUK 2RIKA 1I75A 2JEZA 2C5GA 2AI0H 1GYAA 3BWXA 1L6XA 1KXVC 3WJ1A 4JDZA 5D8JH 4LBEB 3IJYA 1FCGA 1S9XA 1R3HB 4NSKB 5DWUL 5I75B 5IB5A 1KJ2L 1CFVH 5ENWB 1SJVA 4NQSB 3I2GA 4L5FL 2B4KA 3GI8H 4KDTA 1WB5A 3ZT5A 2C4FT 4GKOA 5CZXC 4B41A 2AJXH 2VDQL 5C0BA 4J4PA 1Z9MA 1MNAA 1BAFL 4YK7A 1JJIA 2WU3A 1U2HA 1TAHA 1P84K 4XCNA 5F7EH 4UI2A 2EC9T 4ELMB 2DQYA 3WWPA 2Z35B 4Q6IC 2VDLL 3A67L 1E4WL 35C8L 4UBLA 3PWJA 3UDWC 4PLNC 4WGWB 5GS2D 5F9JB 3QUMH 1H2YA 2HA5A 3QDAA 1UKCA 4I3SL 3NCJL 4YFEA 1J5OL 1ZGLM 1ND0B 1ZSDB 5IW1A 3BKJL 1Q1JH 5E24E 1JPGA 1NC4B 4KROD 1B0RA 1IKFH 4R7DA 5DYYA 5IP4A 4FZEH 3Q6GH 1CUGA 5E1HB 4YHML 5HCUA 1JZ7A 5JDSA 1AGDB 1RFDL 1S9YB 1G7PB 5IM7A 2JGIA 2VDRL 4OZGE 1HZHL 3AU1A 2E9WA 4YDIL 3H7BB 1AP2A 1MJ7L 1RVFH 4OI8A 1U8KA 3ROOB 1I9IH 4K94C 3P4NB 1P0QA 1ADQH 2X10A 4K23H 4GSDH 1UCTA 4QWWC 3LKRA 3BN3B 4XBEH 2AJZA 3D3VB 2MPAH 1CFBA 3N9GL 2AKRB 3VFOB 3HC3H 5KJRH 3MRHA 3KLDA 4X4XB 1XRMA 3LEXB 3RVVD 4KU1A 3IJYB 4ODHL 4DNPA 2F74B 1MN6A 2DLTA 3BYYA 2OQJB 2Z93A 3QXUA 2W1NA 3CUPA 3STUA 3D48R 4OAWB 2E27L 3RWGB 4TTGA 3W04A 5C08D 4GHWA 1YQ2A 2I78A 2NTFB 4NZJA 5MHSD 2DQJH 1TMCB 5TQ0L 4I0PA 1D6EA 4HKXB 1KFAH 3ESVF 3MJ9H 5BCAA 1SM3L 2NNAB 5JQ6L 5HHMB 4UUJA 3GSOB 5EUOF 4QRQA 4JCMA 1B3JA 3KPSA 3HCVB 2DBJA 1NAKH 3X14A 1JGUH 4RAVB 2P4AB 5KW9H 4FQXB 4QRTA 2R4SH 3LV3A 3VDBA 1QLWA 5HHMD 1HKHA 1MFEH 2VTFA 5KTEL 3LQAL 5E8PB 1MJJB 1EO7A 3P9MB 2B1AH 4NRZB 5TGBA 1ZTXH 2O26U 4FNMA 3QZWA 1J1PL 1KCSH 4KUCD 1RJZA 3Q5TA 4F57H 3X11A 3GKZA 3TEJA 1NLBL 4Z7NE 1G5FA 2ED8A 3WQHA 4Z77B 1TVBA 1D3CA 1A47A 1AGFB 4ZUSB 3LRSB 3EYFA 3FWHA 4URTB 4WV1C 2D4FA 3SKMA 1KB9J 5ALBL 3P4NA 1RZ8B 5DC0A 3AFLA 2CR3A 3RIAK 3GNMH 2YASA 3GJFB 3SDXA 3NVQA 3ULUE 3EOTH 4RAUB 2NY0D 4W81A 3FYUA 1Q84A 1Y6MR 1BQLH 1RK1B 4ODVH 1CFQB 1A8SA 3U46B 1DWOA 4MD0B 1S7TA 1TETL 1N59B 1FZOA 3I1YA 2B5IB 1J1PH 1G42A 1OP9A 5JAOA 2IEPA 4EIGB 4F8QA 4LLWB 1IFHL 5B38A 1ZTXL 5SX4H 1XQXA 1U8QB 2NLJA 4HEPG 3LQAH 4ZD3H 5EHQA 1F58H 5HI3C 1P84J 4X6BA 2AQ2A 3X13B 3TEUA 4TN9A 3DUSB 3ICWA 3DV6B 3DWTA 4ELKA 4V1DD 2GZRA 4Y2DC 1T5WB 1E8DA 3GRWA 3UUFA 1Y18A 1FCCA 5IWLC 3DLTA 1KFAL 3S9DB 3HMWH 3PP4L 2L7UA 4CMMB 3UAJD 1J7VR 4L4TA 1YA8A 1F42A 4D9QE 2NY5H 3CC5B 3MMEB 1KULA 4ETWA 4TVPL 3RDTB 5J1AB 1T2JA 1NMCC 3O2DH 2P45B 3WS6A 5L6YL 5EPMB 1E66A 1G4HA 4GUPB 5BQ7A 3DDUA 5DD6B 1IM3A 4X0KB 5F8QC 3KPQA 3I6GB 3MCKB 4J3TA 3WFEL 4MQ7B 3LKOA 2AEIT 4NKQB 3EYQC 3DVIA 5TQ2H 3JTSB 3BXNB 2DM3A 1NCWL 2DQEH 3CFKB 3QHZH 1HXYA 3IKKA 3JTTA 4N5IX 4P2QB 3W05A 2CEKA 4OUKX 2MPAL 2OL3H 2BAGA 4XBEL 4B85A 4Z7QE 5BVPL 1H8NA 1T6WA 2QKIA 3BIAX 1FZMA 3NFSL 1ZICA 2XTJB 4JLRA 4GSDL 2OLEA 1XZIA 4K23L 3MR9B 5K9KB 4G4JA 3CDYA 2DAVA 3MBEA 1CFNA 1CN4A 4X91A 5EWIH 5CEYB 5CD3A 3MGOA 4UNTA 3A2LA 4U6HA 3MYZA 1MEXL 2VDRH 2FL5B 2YEZA 5D5MF 5ANMA 4D9RE 5GJSH 3ARFB 4JR9H 4HT1L 3QQ9D 5FF6A 1YS2X 2OCLA 3OXSB 5KOVC 1BZ7A 1MAJA 1IKFL 5FA3A 2YRPA 4GW1A 2JB5L 3DRQB 3WYRA 3BKJH 3U83A 2YR3A 4J0GA 1QSFE 5AAMA 3NCJH 1SBSL 2AV7B 4PJ7E 3QUML 1UK8A 1OAKH 4NP4L 2JBWA 3CK0H 3DROA 4NZDA 3GMNB 2GBCA 1I7ZB 3N1PC 3GSVA 4Y1AB 3H2JA 1CD1A 2E7BA 4WTZG 1OAZH 4F7EA 3G6JF 1YEJL 2X4PB 2X70A 1RJLA 3QWOA 4HS9A 1ZHNB 4YHIB 2AJXL 5A16A 5ETUA 1QFUH 4KK8C 1C5DA 4Y89A 4I3GA 3MV8B 5DLMH 1IM3B 4K3EH 4MXVF 4PRID 1T4KA 3IFNH 5EGNA 3MRMA 5F9OH 4HUWB 2DTML 2J3DA 4WJLA 4LU5H 2LTQB 5DRNA 2OJEB 5DJDA 2F74A 1JGEB 1VEPA 2H26A 2P48B 5KBYA 1EDDA 1JNNL 2QKIB 3EJJX 3SDCA 1Q0YH 5AHXA 1XZFA 4KMQA 3BPLC 4BA8A 4Y8DC 4GQ9H 3F62A 4PJ5B 43CAB 1IGCL 1TQCC 2V2XA 2VLRB 1XLWA 3PHOB 4M1CD 4UTAL 2NNAA 2V9RA 4M1GH 2XUPA 2XUKA 5AK5A 1R3DA 4H7IA 5EU7E 1U8LA 4G8GE 5FUZL 1R3IL 5IV2B 5J89A 3RL2A 4C56E 4AO6A 3C09C 1Z68A 1M7DB 1XF3B 3NBNA 1WB6A 1XGTA 2NY4B 3IB3A 5C0ND 4HV8A 4R0LC 3RY6C 3VH8B 5HI5D 5DMYA 4Y19D 5F96H 2GJ6B 4KK9C 1E6JH 1JIBA 5IWLA 5JOPE 1ZVYA 4UDUB 3IDXL 4HZLA 4X5WA 2MCPH 1RJZB 5IHZA 5DYOB 5FYLD 1KPUB 4NZTH 4PRDA 4W4OC 4ZSOE 3V2AR 3BN9C 2WUFA 4BK5A 3PQYB 2R23B 2DBLH 1XCQA 5ESVB 3L5WB 5CWSB 3TZVD 3DX6B 1EO5A 4PJGF 4JZNB 5BRZA 4U1GC 4U1NA 3QDGB 4EHBA 4HCRA 5EA0H 5AKGA 4W6XB 5D7KD 2AJVL 3MRNB 1CLZH 2XWBB 4NN7C 3JWDL 8CGTA 1OXMA 5D72H 3FYUB 3JV6A 5JPNB 4OBSA 2OG1A 1IUNA 2FHCA 4YDJB 1GL4B 3OKDA 4NUJB 4XMPH 2VR4A 3CX5K 4GXUN 5F71A 5E8OA 5DSCB 3BH9B 1U2EA 2NY3C 4QRPD 5DQDH 1QFWL 4PJHB 2OI9C 4JQXC 3U1SL 3S36X 1QBMH 3ARRA 4YASA 1D9KA 1HI6A 4DGYL 4IRJD 3U9PL 3CFCH 2C9AA 3BIXA 5JD4A 3ZO0A 1DQDH 3ZLTA 2EKSB 2ERJB 4J1UB 5FXMA 1ZA6B 1J2EA 1J12A 1IT9L 1CTOA 1ULVA 1MVUA 4M0MA 1H5BB 1B0RB 3CD4A 5CUSH 5T5NF 2E6PA 1W4LA 2HU8A 3ARSA 4WUUB 4JQIH 1N8ZA 4GG8B 4JJ5B 3D39E 4NNXB 5D2NC 4YXHH 4Q3LA 4FP8L 5AM0A 1GRWA 4PJ8D 4L8CA 5EUOE 2EXYD 4UNUA 5HGDB 4E42A 3QULA 3CVHA 4JJHA 3OPZH 4F5ZA 5ALKA 1XIWA 2APFA 3K80A 3PWPA 5HHQB 4XBGA 3QDHA 1BM3L 4JEIA 1F6LL 1QQDB 4WFFD 1BD2B 4P2QA 3UTQA 3MV7E 1I1FA 3CFJA 1QSZA 3CFEB 1CIUA 5ICXA 4OCRH 1GGIL 5D71L 1NCUA 4RGOH 5C09B 1UYWH 4Z95L 1OCWL 2FUKA 2A83A 2FGZA 4PJBB 3FN0H 5L2JB 3GM8A 4AEIL 5I66A 4LVNC 2WSLA 4X95A 1QSEB 3LSOA 5E2WH 4GBGA 4O2FB 3UJJL 1A8UA 5GGVH 1IQWH 1E27A 1MH5B 3BKCL 1CF8L 3BD5A 2F19H 2UVFA 3VCLB 1UXWB 1MRDL 3Q0TA 5KAQG 4CCYB 5B39A 2YXFA 3HAEH 2CD0A 3GBLA 3LKQB 5CP7B 1FFOB 3KYMA 3OR6A 4UHFA 3W9EA 2XA8L 4GLRH 3WIIL 2QJWA 1KTKE 1FYTB 4HIEB 4UHEA 5D6DC 4X93A 5K3FB 3ETBF 1A7NL 4Y9SA 1YJDH 5D6CB 3RGVD 4RQQA 4X5XB 3G04B 3X17A 3KPSE 5C0FB 4IJ3C 2D03H 4EI5D 3IYLW 1EO8H 2GUOA 5HDOA 3W11C 1QIFA 1I1YB 1FVDA 3BW9A 2VLLA 3QDMB 3FQRA 1GZPB 5SWSB 1RI8A 4L3WA 4BQ9A 1ERNA 1QLEH 1QLRA 4PGJA 2YMXH 3BP5A 4X7FC 5GRJH 3O2VH 4YHIA 2M2DA 2V2WB 5J1SC 2AJBA 4ODSL 3FCXA 2OXEA 3MOBL 3PGFL 1MFCH 4JFPB 5AIBA 2QSVA 4HPYL 3WWOA 2NQCA 5EHNA 1H8SA 4QRRB 3WLWD 2HA2A 4DW2L 2DQFB 4GRLB 2OL3B 3MREA 1AE6H 3CVHB 4LLYB 4MQXD 4C88A 5ISZB 1F11A 1BFVH 3KHOA 3AINA 1YC7A 4YAQB 3FCTA 3AAZA 2Y6SD 1ZLWK 2VDPL 3QUYB 3FMGL 3HNTH 1GOGA 5F7LB 3VGAC 2P46B 5E94A 4BZ2L 1KU6A 4KACA 4OLZL 1T03L 3ULUH 4UBDC 1Q9KA 5CILL 2DWEA 2A73B 2J6EL 5DEFA 2QTBA 3MUOA 4X98A 3ULVF 2G5BB 5L8LB 3CVHH 3QNZB 3V0WH 4NDMA 4LHUD 3PWUB 3FQXB 2FO4A 4OV5A 3FB7A 2FEEL 4ALAL 1IUOA 1LLFA 2Z3WA 4Q3KA 4FLFA 3D9AL 1E27B 1ZXQA 3QI9B 3LS4L 4S1SH 4E9LA 4W1SA 2N7AA 5HGGS 1JTOA 1T1WA 5CJOL 2FYYA 2V7NB 2F8XC 1HNGA 5EIHA 1T7VA 2R11A 2R1XB 4QXUL 3IDIB 4U2CA 3D39A 2AABL 4LEOA 1KENL 3QPQD 1GC1C 1ZHLA 1DBMH 4QDTA 2LVEA 3D69B 4OJFH 4YH6A 4O51B 5CJ8A 2P8MA 3AXLA 2FEDD 3EYVB 2EIZB 1YUHB 2OR7A 1XF5A 5JIIA 1PQZA 2X4NB 3KAAA 4ZWNA 2WHQA 1A6AB 1X5GA 3KJ4C 5JZBA 1D7FA 1JGVL 1JTPA 5IHZB 2HA7A 5KSUA 4JFQB 4YBHA 1CLYL 1QLFA 1CQZA 3AS1A 1TCRB 1BU8A 4BQ6A 4K2AA 2L4OA 2H9GB 4QHNB 5KANI 1VOTA 4K6HA 2PKYX 1ZOXA 4FHBD 4JHBA 1JF5A 1ZT7B 5DD5L 3OG9A 5TE4L 3GSRA 1HHGA 2F53B 3GMQB 3DYIA 5CGYC 3FRUA 5JOFB 3ESCA 1XROA 4PREB 3ZE0F 4WW2F 5L7XL 4OCXL 2A74A 3WWEA 2E7MA 1D6VH 1IC7H 3BGFC 4EOWH 1A9BA 3GGWB 5GISL 2A2QT 5SX5H 4JN2A 5J13C 1FVEA 1VCAA 4LFHG 2F54A 5TDOB 5F9WB 5DSCA 3TLRA 4ZPVA 2FL5A 1N7MH 4LL9A 5J11C 1GGBH 1R0AL 4HKZA 4N90E 2G5BA 3UJTH 4ZUWB 4FLEA 3I2IA 1W0WA 3GK8H 3H42H 5F70A 1G9NL 5C3LD 1R5VA 3P9LA 1CWVA 3KPRD 4AIZA 3MV8E 1T1WB 3RU8H 1CDCA 3QUZD 3IFLH 1FGVH 4JRXB 3S4SA 1I85A 4OZ4B 2YD7A 3OJVC 3KYKH 4Z7UB 4JM4L 2Y1VA 3G6JB 4LCUA 1BIIA 2DQZA 4N5HX 3TV3H 1RQ5A 1FL5A 1MNUH 4PJDA 3U6RA 3EOAA 1DBBL 2DKMA 3A6CL 3QFDA 1U3HD 5KS9B 4H7JA 3NCBB 4G8GA 2ESVD 2KQNA 4Z5RB 5LGHL 5C86A 1CR9L 2BJMH 4XBGB 1QJ4A 3WKBA 5E4YA 1UM6L 4N8VG 4JGJA 2R0KH 2A0LC 5GRZA 1JGLL 1ZIXA 1FFPA 2F54D 1AR2A 4TNVK 4JZOA 1RUAL 3HS0B 5ACMA 3T0VA 3S36H 1C12A 2DKSA 3QEQE 3F58L 4X4YB 2YA1A 5I66B 4OB7A 1ORQA 4O9HL 3G5YA 1I3VA 3LSOB 2C3VB 1JFRA 1INQA 3MUGB 3TYFB 2ICWJ 2AXHA 3O4OC 4YHLL 5EIAA 4KQ4H 4F7CA 3GFUA 4U1SA 3S3PA 1M33A 5EZJA 2DF3A 1WFTA 2ZCKH 4DMFA 3UJIH 4PJIF 5IIEB 4ZNEE 5J8OA 4CADA 3STXA 4PJ5D 5CMAB 5CURA 3UTSD 3F6LA 3MLSH 3NABL 5DXWA 1UZ8A 1BBDH 2WSKA 3GSQA 3QUMB 1AXTH 4Y4HC 1QO9A 1WWWX 2Z35A 1U8HB 4YBQD 1D5IL 1CD9B 3J7HA 4HX1B 4MNQE 1T1XA 1A6TA 1T6VN 1QIDA 1F4WL 3PE6A 2K7PA 1LK2B 1O7VA 5EU6E 4ZXBD 5C0AB 3SQOH 5IJKC 1KJ2A 4E46A 4X6DE 4JRXA 5IMKA 3H17A 5EUKA 1WZ1L 2VIRA 1KNOA 4FNLL 2QT9A 3G6JA 2Y2VA 2XY2A 2P24A 2IBZY 4V2BA 5DFWH 4BCDA 1LDSA 1UWCA 1FAKT 5HY9B 4KVNL 1IGYA 4PR5A 3AU1B 2EO1A 3HYSA 1OHQA 3G8YA 1A2YA 3V8CA 5FDWB 1ZD2P 2RJMA 1FNSH 4FG6C 5J3HC 4P3DB 5LGJB 2BMKA 4Y1AD 2VT7A 2DTSA 2ITCA 3MO1B 2B4CH 2ATKB 5IF0A 2LV4A 1EGJH 4P4RA 4CN1A 1BJ1H 3ARGD 4N8VA 5DEZA 3LZFH 3DLQR 1Q9KB 3QO0B 3DOSA 4HUMB 1O6FA 3JV6B 4I0KA 2N4IA 3O8XC 1U3JA 4FTVD 2FSEA 4GXNA 5I16B 1ORQB 1MCSA 2R1YB 1AI1H 3D2BA 1NCAH 1MFDH 3H2GA 4MNQB 2ZUWA 5DMIH 2XYCA 4G6AD 1F6AA 2HKFH 3EDFA 4F58H 5KAQF 3VMOA 3VXUD 1J1OL 3TA3C 4PPTA 3G9VA 1VZ3A 1W72H 3VXTB 3KDMA 1U36A 3NCEB 1E5TA 2YPVH 1B41A 3H3PH 1IAII 1EEUA 1BOYA 4EN3B 2NW2A 1TVHA 5IHBA 3E3QE 2ZCLL 5C2BL 2QSCL 2P8MB 4IO0A 3MFFB 5ITBL 2BVYA 4L0CA 3NFNA 4N1EA 1SOMA 1SMAA 2P47B 4NNXA 3H2WA 4K7PH 3KYOA 2WHPA 2VLJD 3MOQA 2QRUA 4UHBA 3WUWA 3MLWH 1TCRA 3F65A 5D2LF 1I3UA 3D85D 3QG7H 2XUDA 3VDXA 4WI6A 3B5GA 1L7IL 3O8XD 2VZVA 4UIKH 2ORBL 4P4KC 3JVGA 1F8TL 3T2QA 1AGYA 4UBJA 1FNHA 5H8DA 1EB8A 2EE9A 4ZREA 4AB1A 3TZVC 4KROC 3P77A 2GTZB 2WBJA 4P5TD 3V5KB 5I1AB 4MCZA 2J4FA 1AGFA 4ZUSA 5CKGA 3BZFA 1J87A 1WOMA 1MRCL 3PFCA 4NQUA 3MJ6A 5C08B 2PU5A 2R69L 5IF0B 3C5SB 1FYTE 2MWCA 3DCNA 5C8ZA 3L3OB 4XVJH 3DNMA 1JJFA 2WP3T 1DFBL 1A22B 4K55A 4Z7VE 4E14A 1CCZA 4XGZA 4P2OB 1NGWA 3PWVB 4DMCA 1AD0A 4EEEA 5KZCD 2CIKA 1IBGH 1F4XH 2NY4C 4U31A 5JW4N 1Q0ZA 3FSGA 4X92A 4AL8H 1PG7L 3TWCL 4FABL 1ZGLA 5C0AD 4JZJA 4RZCA 4KAQH 4XCEA 2ZOLA 2AEQL 1CFSB 4JE4B 3THMH 5IW3A 2Y5EA 5HHOE 5HDBF 4PJCB 3X13A 5TPWH 4V2IA 3R8QA 5T3ZE 4TSAL 4TVPD 4PLOB 3W0WE 1Q9OB 2JCCE 5ITFA 7FABH 3BGMA 3NMEA 2FWOB 4EN3A 1D5ZB 2WTMA 4OZFA 1MLCB 3IDYC 4OCSL 2BCKB 5DD1L 4FN0A 4X9IA 4UZGA 2D4DA 3I85A 2ADGB 4HS8H 3SGEH 4PV8A 5MENB 5D7IF 2YPLD 2XN9D 5GGUA 3MLZL 1BGXL 2YKLH 1XLVA 1LE9B 1U65A 3MMEA 3LCYA 3OG4B 4OGZA 1J05B 2VC2L 4GKSA 1FLRH 4OLEA 3B6SA 4WEUD 3MRQA 1OCEA 4M3KB 3MREB 4L9AA 3K2IA 2KZWA 3N1GC 1HHJB 5E7BA 3WLBA 1YPZB 1MCCA 3I2CL 3IFPB 5E5MA 3OURA 5DFVC 2O5ZL 5I74C 1FBIH 5FOBA 4KKCD 2OGZA 1WCQA 3MRLA 4OZIB 2WQZA 1RUQH 3O6FA 3QEQB 5LCVL 3O6KH 4GLRI 1VGKB 5DZLA 5HK9A 25C8L 2HLAA 1MUJA 1RZJH 3SPVB 1VERA 4JLRB 3HZVA 4YE4H 2Q8AL 4P46C 2DQIH 4CAGA 3OAUH 4PJCE 1PD6A 4JDTL 2YUXA 3K8MA 4Y7MA 1WC7B 1B0WA 5F7NC 4DGVL 5ALOA 3U4BL 3M1BB 5TH2A 1FFQA 1MNQA 4KMTH 4FFVA 4PJCF 4B6GA 2WLSA 4AMYA 1AGBA 2ADIB 1MQKL 2I25N 5C7XL 2RHWA 3WHE0 3WKEA 2DDQL 2QQKH 3W2TA 1VZ2A 4HFUL 3V6BR 4QNPE 3SCMD 3VFMB 2AK4B 2CLRB 4HK3J 4WHCA 5AWNL 1K6QL 4MXQC 5E2TL 1TZHB 2Y25A 3OF6D 4OQTH 5T1MB 4AEEA 4HH9A 2BRQA 3HI5H 3JV0A 1HQRB 2UZIL 2AVGA 2V5RA 2PO6D 1KGCE 3PQYE 4OUUA 4L4VB 1HH9A 2GYWA 2A77H 5MEPB 1KPRB 4CVXA 1EB9A 5SV4A 4YX2H 5JD5A 4LYEA 3LB6D 4J3SA 1RJLB 3SGEI 4GMSL 1SEQL 4XCCL 1GSMA 3ARBB 4NUGH 4HGKC 4OZIF 4GAYB 4R26H 2X4UA 5IFAL 2WBWB 1XLUA 4GG6F 1LO5B 2F5BL 4DKFH 2CMFA 3GBSA 3NIDF 1S7XA 1OP5K 3A6BH 3QO0A 3WSQL 1E28B 1T4KB 4N0CD 2EEDA 2YN3A 4DKEL 4CUCA 3PF2A 8FABA 5FYJU 2A9NH 4PGBA 1QEWA 3QUXB 4M7KH 5A2FA 3S35L 1RU9L 3QFJD 1MUJB 4O58H 3G9XA 5GS1B 5HI3D 1MI5D 1IILE 4LSTL 4GW4B 4LRIC 3BKYL 4N0UB 3ARBD 1CUCA 5K3EA 3O6LH 3TJHD 3MRKA 1I6WA 1AO7B 2LTQC 2D31A 3T2NL 5L8JB 5CEXB 2IPKA 4YR6B 1RUKL 5HI4C 1FIGH 1J0JA 1I7UB 2VYRE 1HPLA 1IC1A 4P46A 1EX9A 5EU5A 5JORB 3OKLA 4ZUTB 1MJ8L 1A88A 2Z0BA 3QNYA 5D7IE 5EHZA 1JPSH 3NAAL 1EK2A 4XP5H 1JZ3A 3MRJB 3EDKA 2VDNL 5LAXB 3T1FA 4G4GA 2KPNA 1AC0A 4F33A 3MLTB 1PVHA 5KSAA 4MA8L 4P2YA 3FQNB 4NNPH 5IQ9B 2XT0A 4WI8A 2H1PH 2NY7H 1QIKA 1XH3A 2HT4D 2X9YA 5CHNA 3RWJB 3LN5B 4JFFA 3EJZD 3K1DA 2HDWA 1OAUH 4ZRDA 3W9BA 1Q9LA 3GELA 4Z0XB 3RZCA 4ORGB 3PQYA 3DBXB 3KJ6H 3CGTA 4U1JB 3W0WB 4WW1B 4TULH 5J6HA 5ELIA 1AGCB 4Q9RH 1F2XK 4MCYB 4D0CB 4OM0L 3G5YB 1BQUA 4GAYA 3U4EA 5F3HB 1RURH 2P5EA 1V3KA 4PG9A 4PG2C 1A6WH 4JCLA 1C1EL 4KJYB 1HYRC 3QDJD 4LVHB 2OQIA 3H9SA 1RZFL 4YQXH 3G9TA 3D7RA 4HD9A 3H1AA 4JZJC 2ZJ6A 1QRND 4MAYB 3M17B 5FYKL 2VJCA 2X76A 2XB6A 3QCUH 3IU4H 2CKBA 4AG4L 2DHCA 2R56L 5JXAH 2HLFC 3VXPB 3EDDA 4JO2H 3BXPA 5DO2C 3UYRH 1FORL 4KRYA 1ZLSL 2XN9B 1PV1A 5DJYB 2Q8BH 3KLHD 3RGVB 2EDXA 4QTIL 5FP0A 1LK2A 3G9AB 1SJHA 4C56D 5LYYA 3OKKA 4ODTH 3NZHH 3V0VB 1JWMB 2HM7A 3RHWK 5JUEL 2DLFL 4B0MM 4Z78B 3T77A 2NXYB 4XC3H 4OLWL 1PZ5B 1TQBB 5ID0B 1FGNL 4AENB 2Q76B 2VLJA 4QRRE 4LQFH 3CCHB 4KK8D 5E2UH 1ZE3C 2R0LH 3SBWA 5JOPD 1LE9A 1F4YL 1GAFH 5A62A 4P9HL 5HGHB 4NN6C 5KN5B 4NQEE 5IMLA 2VXVL 4NHUA 1EA9C 1PSKH 2CIIA 4FQ1H 2R1WA 4NOBA 5C0GA 4LIQE 4LSQH 4XX1A 1ZHBB 4OTXL 1OGAE 2HU7A 2QXUA 4JFDE 1KLUB 2A0LD 1FNGA 5SWZD 1GGYA 1RIUH 2WMPA 4PJ7F 2ZJFA 3MRLB 2CJUL 3ZE1E 5LBSL 5IVXA 2FNBA 3FB6A 1OT2A 4PJDE 1UH3A 5E6IA 4MD4A 1WVZA 4C4YA 2OR9L 4NMWA 1T3FB 4TPRH 5DO2D 5GRYA 3OXRA 1XIWC 4OLYH 3SKUD 1C8PA 5C8XA 1DVFA 5J7CC 1CGWA 4KJYA 4Y2JA 4OGXL 3M1BA 3IDYB 3L1OH 1JWSA 1QSFD 2YBRA 3TN0A 5C0EA 5I8OH 5CT8A 3GI9H 1HK6A 3O45A 5IW6B 4GW3A 3C08L 4I13B 3S37X 1SC9A 1JZ8A 3JSSA 5FGCB 1FYTA 4HIEA 4AJ0A 3O9WC 4LHUG 4C89A 1BN7A 1UK7A 3BKML 4DVRL 3S8YA 1P9MA 1T89A 4MZ3A 4IQ4A 1ACLA 1J9CT 4HWEH 1XKLA 1DQQA 3ARGC 4IH4A 2GBIA 4YHYC 2XI9A 4LEXL 1GIGL 3OR7B 4UB0H 5K9JL 3MJ8B 4ZO9A 2KBGA 1YECH 4X80L 1Q72L 4RE6A 1YS1X 1QRNA 3PJSA 2V97A 3IUJA 4MJ3A 1BQHB 5LXGL 3BVNA 1B6UA 1CFTB 2KZ1B 2QSTA 4NQVB 5C07B 5FYLH 1KEGH 3WL8A 1KB5L 3P0VL 4U6VH 2HH0H 5DHYA 3WD5H 5FB8A 1FC1A 3SE9H 1TNNA 5HVHB 2YD9A 4M3JA 5DK0B 3V6FB 3ROLA 1QBLH 5A7HA 4NWTL 1CLOL 3O3EB 1DT5A 3LP5A 1M05A 2WQ8A 1EK1A 3FZUC 4LRIA 1JHKL 2BHUA 5J12B 4KKBC 2DKUA 3MRPB 1IVLA 3VRIA 4DZBB 1ZANL 4EDWL 3PWUA 4QZVA 4EUPB 3C5VA 1MFBL 1AFVH 5I71B 3TGXA 2YK1L 2I07A 5JA8B 1U9KA 2YBRB 1XR8A 2APWA 1RIHH 3NGBB 4FQPA 4KVCL 4S2SB 4AO8A 1LNUB 5E56A 3BE1L 1Z5LB 3AVEA 2W65B 5HPOA 1VB9A 3VD9A 4XWGA 1CQKA 4RE5A 4YHZL 2V6HA 4L8BB 2Q3AA 4TTDC 4QWWD 4Z7NF 1UCBL 2EECA 1P2CB 2ESVA 4PJ9A 2G2RB 4M9OA 1FFBA 5IR1A 4O51A 3SO3B 4PV8B 5MENA 2XWJB 4RNRB 1NGQH 2EE2A 1JZ5A 5ALVA 4JKMA 4OKVA 3SWWA 3S5LG 1GC1L 5AKLA 2A9MH 5DR5L 1MIMH 4GAJH 2IFFH 4WNQA 3LAFA 1VXRA 1TFHA 1YMMA 5IB2A 4IRSB 4JY4A 4JY5H 4JRXE 1JHLH 2W9DL 3HE6C 4N1HB 4U0RB 3DYOA 4TNWK 5FOBB 4WO4C 3RL1B 4HUVA 5I76B 2X44D 2YRZA 4K9EC 2V7HA 3Q48A 1XT5A 2F58L 3WL7A 2VE6A 4FQJH 4LF3A 5C0BB 1NBVL 2XUIA 2OZ4L 2PYEB 3MXVH 4PJIE 5IK3A 5D5MA 1BEZA 5CIPB 4Q0XL 5GS0H 1GXSA 3KPPB 2Z3ZA 3MRRA 3EUUA 2BX5A 3UXFA 2F54B 3UMTA 3P11L 3RGVC 4MMZC 1GOHA 3GMRB 2CRZA 1KTDA 1A7QH 4GAGH 3FO9A 3QPXH 4CDHA 3T09A 4AY0A 3TYGL 2FD6H 3GMMB 5D9SA 5F21B 4YXLH 4A6YL 4H8WL 3F7VB 2H9YA 5DTIA 3K9BA 4MA1B 4RWYL 4JFZL 5FUMA 1NBZB 1SY6L 2GBGA 1TTGA 3DI2B 1DP0A 3LMJL 3DMMD 1ZT1B 5I6XB 4TUJB 4X6YA 4FTVA 4L72A 1IM9B 4AMKL 4JHZA 1RY7B 1G7PA 5CS7A 5IM7B 4H1LH 1NFIB 4PS4H 1CXLA 1LEKB 4LCWD 3UROR 4XH2B 1UOOA 3WLWC 5HVWA 3UEZA 1HHHB 1Y6NR 5ID1A 2APXA 2MNUA 3CLEH 3U6RB 4X6BB 1CUBA 4WI3A 3QWQB 2FO1A 1YEIL 2SEBA 1CG9B 3G7NA 3O0DA 1YEEH 1JE6A 2XTJD 1I85C 1AUOA 1BVKB 1TPXC 5INCA 1TCBA 4G8IA 2IIVA 3HZMA 3KR3L 3C8HA 1R5WA 3VA6A 1BP3B 2MOVA 4I3RH 3FRPG 5EZIL 5E9DB 4Y2SA 3QDJE 5EB9A 1VEMA 2AV1A 1FRGL 1YNTA 3R4DA 3RY4A 4U2BA 5E0QA 3X12A 1DBJL 3ZE1F 2D7TL 2IAMA 1QRNE 4P46D 2R2BA 4C54A 3RDTD 3TBWB 3QWRD 5FM8A 3IULA 4LF3B 4HIHA 4K3GA 4Y88A 3BXNA 4MS8C 1YJDC 3DMMC 3OKEA 4UINL 1NU6A 1KEML 5CCKH 4BBZA 1AMNA 3QIBA 3NIDE 2VSDA 3VXMB 4YR6A 3F6IA 5J6GB 1AH1A 4LRNL 1KLGB 1N0XH 2NCMA 4R2GB 3P0GB 3PGDB 1FFCA 4OCZA 2YXMA 1DCLA 4PG2A 3JW8A 1TENA 4UFPA 1H3PL 1WM1A 2VF2A 2HT2D 1DL7H 1H15B 1F3JB 3WXWL 2J4WL 2CMRH 5DVOA 4N0CC 5T3XD 3T2OA 3AM8C 2ZCHL 4HCRH 2Y07L 5C0RH 5FGCE 4GKNB 1KG0B 5SV3A 4HS6B 3P4MB 4UFOA 5EOQL 2HJFB 1CPYA 3C60B 4KZDL 4K3DL 3B9KC 4UV7L 5DVKA 1AR1D 4YPGA 3SDAB 5ILTL 3CXDL 4YHKL 5AKIA 4BCCA 1T2QL 4Z0BH 2X4QB 4GBXB 5IESL 2NW3B 3TO4B 9CGTA 4U2YA 2HRQA 3DROB 2HFGL 3DJ9A 4LHUB 3QMVA 1NC2B 3LEVH 4YGVB 1N4XL 2WNGA 3MA7B 3WIHL 5KANG 2FHBA 4EJ1C 3O9WA 2X70B 5DD3L 1JK8B 2HADA 4G5XA 4EUPG 3GMPA 5DJXB 2A6KB 3MRPA 4L8SC 2QLVB 1JJBA 3M3DA 4M0EA 2P7TA 3HNSL 4DZBA 4J3WA 1C5DB 5F6IC 2YD6A 1X2EA 3MSPA 1TJGL 2J2ZA 5IQ7L 4D0DB 3VH8G 1K8DA 2BVPB 5ISZD 5E2VL 4KRPB 3TFKC 2JE8A 4YDVB 4C56A 4P9NA 1F6AB 2OTUA 1T4MA 2W6CX 3SC2A 4PJ5E 3QUZC 3VRJB 4EDXA 5FYJH 3EDEA 4FQXD 4M1DL 1UJ3A 4HXAL 3BJRA 5L0QC 2W22A 3PDDA 1GH7A 5E08L 4U2DA 3CAFA 4IHOB 3QIWD 4PGDB 3G08A 4LPWA 4M1CC 4X4MA 1FG2A 1XCTA 5J3JA 4MWFB 1A3RH 3C5ZC 4P23C 5HHME 3U7WL 1J1IA 3X3GH 5EU6D 4M5ZL 3GHBL 4Z78A 3V7AE 1BFSA 4OCWH 2RGUA 2I26N 2QQQA 2CKBH 1W52X 2XMSA 1TKRA 5K59F 5HI5C 5ICZA 3WFHB 1L7TH 4XCYB 4MQ7A 3U79A 4HBCH 2AJSL 3CLFL 2BFVH 3WUWB 3STLB 1HE7A 3H2IA 1OPGL 4CG3A 1QHPA 3L95A 4JEGB 1WBYA 4H1LA 2DQHL 5CH5A 1EA5A 1FDLL 2GSIA 4D0BB 2VJDA 2HWZH 1V7ML 2AJUL 5EDXA 4HRXA 3A6OA 43C9A 2V5YA 3V5KA 3JWNC 4I4WB 1L0YA 4LLAA 5D7JB 1IGFH 3SE8H 5BW7C 2XQBL 4PY8J 4JRYA 1C7SA 2ZPKH 4K2UL 5AG9A 1U8OB 3WEXB 1T1ZA 3TIDB 2GCYA 2VQ6A 2VISB 4FZ8L 5BZWA 3VWJC 2FIRT 4NKIL 1VFOA 4UDTB 3WYNA 3TN0B 5C0EB 3GJEA 3FTGA 3S2ZA 2VAAA 1NFDE 4P2RB 3O4LA 4O5LL 4OFKA 1UXOA 5IKXA 2NXZD 1J0IA 4LVNB 2JELH 5KWJA 2J5LB 2EDEA 2R0WH 4KY1L 2Z92A 1YZZA 4LSRL 4D2NA 3ZE2E 3EZJB 5CT6A 1KELL 4HUXA 1VKXA 1BBJB 4Q9CA 4Q3OA 4APQD 3MJ7A 1LEKA 3A6ZA 2HJKA 3DV4B 4H25A 4MWFA 1EXUB 3BPOB 2FWOA 3BF7A 1CR6A 5IUSA 4UT7L 1E4XI 4P2QE 1WZLA 2FH6A 3IDMB 1DLHA 1OB1B 2EDKA 2NY3B 3GMOB 4FG6D 2HTKD 5J3HD 1WLHA 4LDEB 5AOBA 2DM2A 3K1KC 5EN2B 5HKBA 2JGLA 1FAIL 1R4ZA 3RA7L 4X9FA 5SX5K 3BVNB 2B7DT 1CDHA 2X4TA 2IJ0C 1LEGA 1S78D 5BOZG 4BDTA 4ONFL 3O0RL 4QRPB 5D70L 4HF5H 3LKSA 3NH7L 1IZ7A 1FNEA 1HDMB 4I0CC 2ZSVB 5DC9B 3GROA 3WLBB 1U8PB 2BSRA 2Z8RA 3CSBA 5GSRB 3G6AA 2JGJA 4PNZA 1S3KH 2C3HA 1X6LA 1YB6A 4MHHG 4JJ5A 1YNTB 4XXDB 2XDWA 3QEGL 1K5NA 2C58A 4FS0A 1KCLA 3WFDH 4OFYA 1A5FL 1D5XB 4N0YH 4NZRH 2OJZL 3TPUB 1P0PA 1KN2H 5A43C 2R2BB 3HC4H 5GSVB 1I9JH 4PTTB 1M1SA 1JF1A 3KYNA 3I9GH 4IOFD 2PCPB 2D7OA 4D9RD 3ULVL 2VXTH 3RJDA 4KE6A 2VDKH 1AXSA 5I1IH 1JGDB 4B84A 2HN7A 5BVJB 3L5XH 1DBKH 5SYMA 3OX8B 4W9RA 4JYPA 4XPGH 1LD9A 4Y19A 5D1ZB 4M61B 4GLBA 4JFXB 4LBEA 1AGBB 4LCWA 4YIQA 1GGCH 3O4LB 4YEEA 5HHOD 3EO9H 3L7FA 3LQMA 4D9LH 4LKOA 3O81A 4BATA 4NPYB 1KIQA 2ICWI 1UJTA 3T0BA 3HNVL 1HWGB 4GRLC 2NTSP 3RIFF 1X9QA 3VFTA 2PF6A 4PB9H 1EEZB 4X5WB 3QT2A 4KKAD 4ZS6C 1SVCP 1CQWA 1X2BA 5HDBE 5HQ3A 2HJKB 4NO5A 4TNVF 3AS3A 4OUUB 1JMKC 4HIXH 1JUFB 4Y1AE 4D94A 3ARDC 1VLQA 5CH8A 2XZCH 3VXSD 3QXAA 4NC1E 4FQIL 3V7MA 3MGTB 4NVRA 5BV7H 1AGEB 4DSZA 1NUNB 5FV2A 5T33L 3RL1A 5T1DH 1FE8H 2I60H 2V2TB 5BMFL 1CK0H 4NO3B 3PHQB 1HNFA 1NC4A 1JPGB 2A6IA 1MJ5A 3ECBB 2NXYD 3PV6A 4U1HB 5LG1A 3QUXA 1R24A 3RUGE 5IK3B 3GM0A 4EI5C 1CUFA 2MMXA 5ALPA 1X70A 4AN1A 2WK2A 3Q1SL 2MSPA 2ZWLT 3N0PB 3WUWG 3G0GA 3RUGF 1YN7B 5HHVH 1AP2B 4JKLA 3P0YH 1QP1A 3VRJA 15C8L 4G6KL 3G9UA 5I74B 1YEFH 4LSSH 3LEYL 4MXWL 2YYSA 3AZPA 1ETZB 3GMMA 3QUYA 5AUMA 3S7GA 5A71A 4KH2A 2V17L 1H3UA 1YEGL 2E3VA 2XXMB 4QF1A 1CE6A 4IIQA 4ONGH 5IHLB 4QYOA 4JNCA 2DWEB 2Q3ZA 3EYOB 3OKNA 3HE6D 3SBWC 1J8HD 4MA7L 1F90L 5TE7H 4X6CA 4ZUTA 5ACLA 4JFXA 2C4XA 1FFRA 1XRLA 1ED3A 2BSSB 3OAYK 4LLUB 3F67A 4ZS7L 2EE6A 1LP9E 4LLMB 3MPCA 1OW0A 4WFIA 5ALZA 3EW3B 1F2QA 2Z93B 3QDGE 3MUNA 2DQUL 1TIBA 1KIQB 5B38G 2AJ8A 5M7QA 1QUNA 4W1RA 3L3DB 3MX0A 4MAUL 4B5EA 2WJ6A 4HWBL 3GSNL 5CHNB 2CLZA 3WNNA 2WQRA 1PLGH 3UTQB 3IDIA 3NGBC 3CCBA 2DLGA 2WWMD 2VUOA 4FXGA 3UTTE 2LU4A 3JUYA 3S88H 5IGXH 4G6FD 2C0PA 4MXQD 4BRSA 3HR5A 4Y2QA 3VGBA 4HWUA 3UBXG 3B8SA 2AK1L 3UTPE 1NGYA 4L9LB 3IETB 4WW1A 5DK2B 5GPRA 2DQCH 1AGEA 1EDEA 1MCQA 3OTQA 1FFNB 3QQ3B 5ESAA 3VCLA 3A2NA 4OD3H 1E6OH 1NX9A 2IAMB 3ZDXE 3KPMB 3S4SG 5D7SL 1A1OB 5EORL 1GPOH 1NMBL 2BNRE 1HILA 1CEXA 1A3LL 3GRWL 3I2HA 3BFOA 3GSRB 2BVQB 4J0DA 4LLQA 3T3MF 3HB3C 2CUTA 5BV7A 3SCMC 5GHWH 5DJ0B 1K2DB 3F97A 2VXQH 3LQZA 5I8KH 3O3DB 4JG1H 1KLGA 1DWPA 3VISA 3HG1D 2HA4A 2YRLA 4LVHC 5EC1B 3C6YA 3PGDA 4ZNCD 3SKNA 2Y7QA 1RZ8A 3QUXC 1SYSB 3WXVL 5D1QD 4KTYA 4ODBD 1H2XA 4KGLA 3QAZC </