2B20A

Crystal structure of enterochelin esterase from shigella flexneri enterochelin esterase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
395
structure length
391
Chain Sequence
ALKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Transport protein
molecule keywords enterochelin esterase
total genus 103
structure length 391
sequence length 395
ec nomenclature
pdb deposition date 2005-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b20A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2b20A02
5F1IB 3FB5A 4MXVF 3NACH 1I7RA 1U8QA 2V2XA 4JKPL 1QLEL 2IF7A 5AKHA 4RQQB 1FL3B 2GJ6A 1X2EA 1A3RH 2GSGA 5CFHA 3T1WA 4MXVE 5AG8A 1GXSA 1PQZA 4HD9A 3HI1A 1YNTA 4LAJH 1MF2H 1KENL 1E4KC 4FQ2L 2VDLL 4ZXBD 3SY0A 4O9HL 5KAQG 3KYKH 2GFBA 1U9KA 1JF1A 4Q6IB 5DC4B 5HDLA 1CFVL 3GIZL 1HHGB 3RWEB 4ITVA 1Z0MA 1W75A 4CG2A 2C3XA 5CWSB 2A9MH 4MX7A 1BZ9B 3CLEL 5F1NB 4NPYB 1XF5A 2A6DA 5IT2L 1EB8A 4FZEH 4JY4B 4P2RA 2XE4A 5CXXA 3RUGB 1NLDL 3BF7A 3WNKA 3LPWA 1PW3A 2CH8A 4LSQH 3UJTL 3IFLH 3D0LB 2ENYA 4OF3A 5T4HA 4GI1A 2XQBH 5C6TL 5DLMH 1A0QH 3OXRA 3GI9L 4WIQA 4PJGF 1DQLH 2Q7YA 1JMKC 4PSCA 4M48L 3JV5A 4PJFB 5BVJA 1U3ZA 3R1GH 5HDQH 3ILSA 2CRZA 1A47A 3CX2A 3ULUD 3RBGA 1ZA3A 3DCNA 3SOBL 3WL7A 1QRNA 4OB5L 4Z7VF 5T3ZD 4BFIB 3QXVA 1WFUA 2DQHL 3MV8A 4U2ZA 2ZJSH 5J1AA 1UKBA 4LEXL 1HI6B 5GGVH 3HG1A 2V98A 1RUAH 3QHFH 3C08H 4UT9H 3STLB 2I3ZA 3HR5B 3CLEH 3MV8B 3PWPE 3VXMD 4N8CH 3QMMA 1IRAY 5ID1A 5CJOL 2JE8A 3U0TB 1P5VA 1BCRA 1MCOL 4NKQB 5E00B 1UXWA 2DWEB 5D1ZB 1DVFC 2BNRA 3D48R 4A2LA 2Q7YB 1JGUH 2EH7H 1A7OL 4J0GA 3TBSB 1ORQA 3H9HB 5ESVB 3N1GC 3EUUA 1YQ2A 4KJYA 4WTWA 5C70A 1MPXA 3O6FC 2EO1A 2DQHH 3VXME 5J56B 2M8XA 4HUWB 4Z7UE 4AZ3A 1YPZE 2ZCHH 1KULA 1C12A 2QQNH 1BEEA 2JK5B 3CVHL 2FJHB 1HIMH 2AJZB 3DUUA 4H7HA 5DK0B 1INDH 1H9VA 4AL8H 3LKRA 5F9OL 3TBVA 4PRHA 1SC9A 1VFUA 3EYUL 4JFPB 1JFRA 5D7LB 1FYTB 4D0BA 2IMNA 5EBGA 4XRCA 3QIUC 4Y2JA 4UHCA 1T5WB 3UTSE 1DU4A 3DBXA 5E1HB 3G6JF 5A2GA 1T4MA 4OD0A 5T1LD 3DARA 1HHJA 1UWXK 4MA1B 4RRPG 1J0ZA 3PWUA 4PRIA 4HS9A 3MYZA 3OTTA 4FQQA 5I76B 5D1ZD 2WWKO 4GRWE 4Y7MA 3WFHA 4Y2QA 4HIJA 1YC7A 3P4LA 2BAGA 4EUSA 3L3OB 2BGNA 1PYWA 2FEEI 3Q6GH 4GSDL 3GFUA 3VH8A 5ALCL 3TJHC 4X4ME 2HVKA 4WDIA 1Q9WB 2OTUA 3DTXB 3CFJB 1YEGL 4NM4L 4KKLD 3KLAB 2ROQA 2D4FA 3DSFH 5I9QB 5K9JH 3TBSA 1K8IA 1OGTB 3ZSSA 5IVZA 1MCWW 5JIHA 4XP1H 3C6BA 4FZ8H 1MQKH 2FL5B 3VJ6A 5HYEA 3U9PH 3DV6A 5C07E 2BNQA 4S10A 2VLKB 1WJ3A 4XZUB 1EHNA 3PDOA 1GCFA 2APBA 4S1DD 5IT2H 3V8CA 4Q3LA 1MLCA 4MX7B 1WB4A 4GECA 1DFBL 1A6TA 3RVXD 4N8VB 2HH0H 1N8SA 3HRZB 2HKHL 3FAKA 1SVCP 1P4IH 1ZSDB 4GSDH 4PG2C 4DVBA 4Q0XL 2JJTC 3B3QA 1H3UA 3CSYB 1B2WH 4JQXA 4ZDHB 1XLUA 1U2CA 4WO4A 3D9AH 2XA8H 2GCYA 5I9QC 3ARBB 3BQUA 2V5YA 4P46B 4QRTA 3QPAA 2ED7A 2OJZL 3DUSB 3FO1A 4I4WB 4MXQD 5DO2C 1I7RB 1QLEH 1U8QB 1UOPA 5GGRA 4S1QH 1JF5A 4ZUSB 4NKMA 1K6EA 4PRNA 3ZDYE 4PW0A 1RUAL 4MA3A 4I48B 3WO4C 3F6LA 5GXBB 5H94A 4F5ZA 4YEEA 3UJIH 1XZIA 3PF2A 3MR9A 3P4OB 4KU1A 2PETA 5L8KB 3WIFA 1ZE3C 2Y23A 2FZ3B 1H8SA 3KPRA 1T0NA 4CJ1A 3ORJA 3EO9L 2C7UB 4PGDA 3CMOH 5FKAA 4DNFA 1MI5E 5IGXH 3RU8L 5FYKD 5HYJD 1K4DB 3HE6A 2R1WA 5D7KE 1NMCC 3UJTH 4DVRH 3FFDA 4R4NC 3REWA 2OS7A 3HB3C 2O5XH 2AEQL 5GGSY 1DVFD 4MZ3A 4IOIA 1T21B 4FQIH 2HA6A 1ZHKA 2V2XB 1JGVH 4A6YA 4Y5YB 3IDAA 1H0DA 5IHZB 5CILL 4AQDA 1RIHL 3STWA 1VB9A 3LV3A 3PE9A 3GJEB 3E4DA 2OQJA 2GJJA 3JWDC 4IHAA 1XZLA 2Z8VC 2OGTA 3FN0L 2LFGA 2H7CA 3BEVB 4JVPA 1J0YA 1K2DB 1DQQB 3C87A 2GBIA 4LRNH 5HVHB 4L4VD 5F6HI 1J8HE 1VZ3A 1OD7A 3OZ9L 4H8WC 3ULVC 5AH0A 1ZJ4A 3QCVL 2VLJD 5H2BA 4JJ5A 4NN6B 4Q9BA 3DVGA 5MENA 1RZKC 1I3RB 4Y16B 1IKFL 3E6HA 3C2SA 3FB6A 4Y4FD 4JDVA 4L3EB 1XF4A 3G04A 5EDXA 3E3AA 4M61A 3TGLA 1JPGB 1A5FL 4KUZH 2QKYA 4M6MH 1JGLL 3GBNH 1QGED 5JUEL 1IUOA 1WWWX 1U8KA 2ED9A 1K3ZA 1MWAA 4O2EA 4ZFZA 3QQ4B 1PG7X 3IU4L 4IRJD 1LK3H 4K3GA 2ZSWB 3SE9L 1FV1A 1CWVA 2WIIA 1WB5A 3PJSB 3QXAB 2QEJA 3PWPA 1DANT 1YMMD 3ECBB 4XBGA 4EN3B 4UNVA 5DJ8A 1RUMH 1XIWC 1JKMA 3NCMA 2DICA 3M17A 1GSMA 1SJEB 4LHUD 3KPPA 4NUGL 4KRLB 2V7HA 4OB8A 3GB7A 3TC9A 4O2FA 4QLRA 1BF8A 2AJVL 1OF2A 3BAEH 1MCPL 4WRLA 2V2WB 1VENA 4IH1A 1A7RH 1U3HD 2B4CC 4E41B 1BD2B 3BP5B 4DOHB 3VCLA 1IM3A 1KIQB 5GSVA 5AK4A 4P4RA 1LPSA 4U6YB 2XACC 1HCVA 2ORBH 4K94L 4ZAKA 5D6DA 1CV2A 4UILH 1RZJL 4NOBA 3BEVA 4XNYH 1C7JA 3RL1B 3IJSA 2NPLX 4OZFG 3O2DH 4WFED 3RRQA 1AKJD 1XZFA 4MA3B 4F3FA 2GK0B 1QSFB 1PKQB 3ZE1E 4NZUH 1A6UL 2DQUH 1AGBA 3RARA 3FCYA 3PL6D 1BGXH 4AN0A 4Y4KD 5KTEH 4BBZA 1QA9B 3GHEL 3T3PE 4PJ9C 4BTLA 2Y7QB 4PQEA 2PNDA 4KJWC 4XVTH 5IOPA 1R3JB 4AN1A 1QPXA 4IMKA 2DTMH 4CU6A 3FLBA 3LPGA 3BE8A 1XZCA 1QKZL 2X5XA 5C7XL 1AGYA 5DQDH 3MACL 3NFPB 1C5DA 3SO3B 4DQOL 2QTEA 2VXVH 5DQ9B 4CADB 4TTDD 1Q94A 3IRPX 4NS4A 3T1FA 2QTBA 3B9VA 1UB5A 5HDOA 4TUJB 2I9LA 5GRXG 2WTNA 5LWYL 5F88A 4NFDA 4IIQA 3WFEL 5E8NA 1DLHB 5JLZA 2VLKA 4MDJB 4MJ5A 4AO7A 2I07B 3IGAB 5IFJB 1CD9B 3HG1E 4J0HA 2Y06H 1BD2A 1JT2A 4H8WL 1DBKH 2BVPA 2DJSA 3BQUC 4PRNB 3H3PL 5IEHA 5KVDH 1GGYA 4Z76B 1RY7B 3OAUL 4GKSB 2WIJA 1TJGL 4FFWD 2PXYA 3QFJB 2XYCA 1A7UA 3EDFA 1KEZA 5EUOF 2VDKH 2R9HD 2LTQB 4WY8A 1CK0L 1JJFA 4Y5YC 4HHAA 4FQXC 4RA3A 4APQD 1ADQH 4O58L 1SM3L 3IDGA 4O51B 4J1UA 1KJMB 4YNYB 1QIFA 1OM3L 4U1SB 2VDQL 4GWLA 1DBMH 2BOCA 1J2EA 4W1PA 5DVMA 1S7RB 3IFLL 1U8LA 2JGMA 1JI1A 2BNQB 2E9BA 15C8L 2HRPL 3G6JA 1JVKA 1PJ9A 3H9SA 1AGCB 1URLA 1QSVA 4X6DF 1NGWA 2YXMA 4YDKL 3QXUA 1YEGH 2ZOLA 5DD5H 4LCWE 2HMIC 1FBIL 1BMGA 4ELMA 1XRNA 2X4SA 1ZHLB 4XBEL 3G9VA 3VI4F 4X95A 1OHQA 2XFXA 4XP4H 5IB1A 3V0AC 1AURA 4JPWH 3NFNA 1LZLA 2QR0B 1ZAGA 5D7JA 2YWZA 1XKLA 2BVPB 2CKBB 3ARBC 3VXOA 3JWDH 3RDTA 4ZUUA 2FUKA 3GSNL 4JO2H 1A7BA 3RPIA 2DB8A 3DROB 3IB4A 4FXGA 5A2JH 5AOCA 4HBCH 3DJ9A 2Z8SA 2APFA 2DLFL 2EEAA 5H35B 4GG8B 3VGHA 4HG4J 4AQOA 1LO3L 3OG4B 2PCPA 5HVFB 4JFEE 4U6XB 3VXQB 4G5ZH 3BT2H 5C71A 1DQQA 2CEKA 3T08A 4S0XA 3S3PA 4I3FA 4OLEA 4E5XA 1VJ5A 5KS9A 4M7LH 1VFBB 1IGIL 3V48A 3QQ3A 2KZ1B 4PGCA 2Q8BL 5TFSL 2VLJE 5JTWA 5E1AB 1AXIB 4BZWA 3VMOA 4M7JL 4NYLA 1YECH 2WHRA 4AEIH 4U05A 3UJIL 3VFSB 5E8PB 4DGYH 3DV4B 4G8FA 1K5NB 3MV7D 4HXFB 4J3SA 1MJ8L 3GSNH 4I0PC 1HOCA 4LSRL 2PUHA 4X5WA 3M3DA 3D6GA 5I74C 4HFWA 1EA5A 1FDLH 1KN2H 2VKXA 3RWCB 2C1OA 3IT8D 1F6FB 3ZMRA 2MPAL 3W0WB 4P2OA 3T04D 2P8LB 1R24A 5EBMA 4PO3X 1GPOL 3V4UH 1EGJL 5FO8A 5AI5A 1ODSA 2P5WE 4DZBB 1ACJA 2CKMA 3VWKC 5ALZA 3FQTB 3BDBA 2BERA 4UAOC 1Q0RA 3WKDA 5IVXB 4JKWA 4OZGB 4JQIH 3SKUD 2V2WA 4OB5H 2C4XA 2UZXB 2VDNL 4NRYB 4TGLA 1P2CB 4X8JB 1R1DA 1N7MH 1YN7A 3SE4C 1KIPA 1NC2B 2HJLB 3QEQE 3F7RA 3EO9H 5AUMB 1T7ZA 5J9PA 1MCIA 3WK6A 4Z0XB 3DV6B 4HJ0C 4NNYA 3DYOA 5CEZE 3QIUA 3B43A 4P46D 5DC9B 1YJDC 4PB0H 2A6JA 1OCWH 3A6BL 5B3JE 5GRJL 1HQRB 2D0DA 4ZFZB 5SWSD 1W6RA 1H3TA 4JRYE 4LCIL 4EI5C 3SPVB 3HKFA 4KMTH 1TZHB 5FLKA 3FLAA 3FMGL 5K5EA 1W8NA 4O5LL 5HYSB 2AJ8A 1TNNA 5K3BA 2NY4D 1MF2L 1YZZA 1KTLA 1KSRA 5ALRA 1J1OH 4RMTA 4IIQC 3B8YA 3UZQA 1CLZH 5J6HB 1W0WB 4OM1L 2GSGB 5CH8A 3W04A 5GHWL 3F67A 4NQDB 2R4SH 2OCIA 4N8SA 1BX2A 5C0AD 4LQFL 3V7MA 1EA9C 5EB9A 4PD4J 3TJEL 4TYUA 2P24B 2OGZA 3QFDA 4O02L 4RNCA 4G4IA 5HD8D 2JF1A 4A5SA 3BUYA 3DRQA 1ERNA 4FZ8L 4X94A 1N6VA 5JD6A 3O3BA 4JR9H 1G7LA 2EC9U 5FUOL 1HHIA 4NFBA 3H2WA 1MHHB 1A6ZB 3QYCA 3KLHD 1TPXB 5LZ2A 3PWJB 4PJBA 1YYLH 4POZD 3DYIA 3B9EA 4OQTL 1S7TB 1KPVB 5IEKA 6FABL 3TF7C 4YHPA 4KC3B 2A73B 2P49B 2R23A 32C2A 3OKKA 4MNGA 4S0SD 1GIGH 2MQ0A 5JA9A 1C5DB 2Q86A 4Z8FL 4ONFL 3OR6A 1QIMA 2HHAA 5GS0H 4BFGA 4I13B 1JN6B 1KPRA 4XBEH 3DXAD 4L3ED 4OV6F 2HDWA 4G6AD 3S35H 1FJ2A 1D5BA 4DFHA 5I1DB 3MNVA 3WLWD 4MSWB 1JPTL 3RZCA 4FA8A 1R3LA 3QRGL 4XCEB 3VXRB 4YO0B 1RIUL 4N0CC 3RVVD 5JORA 1BZ7A 4GW4B 5EZLA 4Q34A 1YN7B 1D6EB 3NZ8B 1P7QA 4K2UL 2H1PH 5C09B 2NR6D 4C88A 2FGZA 2P8MB 5GRYA 1GZQA 4NFCA 5FKJA 3SBWA 1RZKL 4M8QB 3X13A 1CFSB 4V2IA 1HINH 3S88L 2BC4A 1DN0A 4EHBA 4HWNA 1CRLA 4P57A 1S9XA 2D3VA 1ODCA 4BQ9A 1QSZA 3HE6C 3NIFE 4QDZA 4FMPA 2XY2A 2QXUA 2PYFA 5C08B 2IQ9L 5I9IA 5AK6A 3EO1B 3S34L 4JH0A 4ENED 2OCLA 1CGSL 3G0IA 3MX0A 2UZ0A 5GS3A 3FQNA 2UWEA 5HTSA 5C2BH 4XCEA 1G9MC 3O4HA 5BV7H 2XOTA 1BHGA 4MNQB 2E7MA 1BROA 1MHEB 1IC5L 3T77B 5CBKA 4X5WB 3S9DB 1TJIH 5IMKA 5JYCA 3KNBA 3SQBA 1PZUB 4JO4H 1EVQA 4MS8C 5D2NA 2NY1D 1LD9A 4XXCC 4KHXL 3W9BA 2DWDA 2YD3A 3MRJA 1B4JL 4OGYH 3RY6A 2OSLB 5ANMA 1UH3A 5E1AA 4WW2B 4CKVX 3MFFB 4G9FE 2B4CL 3WJLC 1JNLL 1DQML 1JHTB 3RVUC 4XWGH 1CL7I 4X9IA 2Q6WB 4CMHB 2OQIA 3F9CA 3WI7A 5KANI 3IDUA 1DTEA 4UT6L 1FO0L 3ZT7A 4B6GA 1MJJA 3LIZL 5ICXB 3AIOA 4UPDA 2JGEA 1YUHB 4JQIL 1UB6A 2AK4A 3KDMB 3QSKB 1LNSA 1WPXA 2OTPA 5E7FA 3C8KA 4W1SA 1A1MB 1F02I 2DQCH 1WAAF 3PQYB 3DROA 2FJFB 4FXGB 4ZO6A 4TNVF 4Z7UA 3MUOA 1NGQL 4LRIA 4MQXC 1W72L 4LLQB 2J8UF 1A7NL 1J8HA 4F7CB 2PL5A 4NZRH 4LCUA 3S98A 4H20L 3MCKA 2C4FU 2DQJL 2D0FA 4D9RE 3C9NB 5DUPH 1UCBH 4U0RB 5F3HA 4EUPA 1XGRA 4HG4K 5JAHA 3WIIL 3WUZA 2R56L 2CRMA 5KSAA 1Y6KR 4J4PD 4YFEA 1YA5A 5C0FB 3G0DA 4G42B 2CLRA 3QDJE 4JFXA 1SCQA 3REWB 4UUQA 1NUFA 4JQXC 1Q9OA 3TT3L 1MHCB 3IVKA 1WIPA 5GJSH 4PRPB 1NBQA 5EU5A 4EZMA 4PJ9A 5IQ9A 4JY5H 5D6DC 4BSWA 4JY6A 5EFZA 1KLUB 1Z9OA 4N9OB 1MX1A 4X4MA 4MCZB 3SGDI 2FZ3A 5ANME 5EBLA 1EX0A 8CGTA 4OZIB 2F5BL 2WKWA 5FGBC 2WUCH 4W9RA 2WIDA 1UJ3A 1N4XH 2C3WA 5EH1A 4N5UA 1UA6H 4U1NA 2ATPB 4KRXA 3TH4T 1ONQA 3C5ZD 3WN5C 5GISH 5AKXA 3KR3L 3PHOB 5CSGA 1LO4H 4NQSB 4K3EH 4F37F 3E8UH 1MLBA 3PP3H 3QEGH 5JW3L 1UOQA 3FRUA 2AK1H 1QFWI 3OKEA 3BJMA 1BZ7B 4JREC 2MHAA 3BP4B 4G7YH 5CT8A 4WUUE 2VDRH 3MYJA 1FGVH 2EH8L 3H8NA 4H1LH 4PJEF 1CQWA 4B80A 2ZPKH 3OKDA 4ONFH 4F21A 3RPKA 1ZXQA 4FQPA 4NDMA 4B7ZA 4PGCB 2R8SL 1HL7A 5IJKA 1Z0NA 3IAQA 4V2BA 1QPPA 3T4YB 1QSEB 1G1YA 1A9EA 1CE1L 2BHUA 5CSZA 5DS8B 4JFXB 3DETC 1FZOB 4ODTH 1DN2A 3Q8WA 3SKOA 5MP6H 4FP8H 1RZJC 3NBNA 1ZI9A 5E2WH 5I8OH 3CCCA 5IM7A 3V9FA 3FB5B 3BP7B 5DSCA 3GBLA 3GSXB 5HYSG 4N8PA 1X4ZA 3CSGA 3OKOA 3OHXB 1SJHB 4UNUA 4L8SA 1RZKH 5HGAB 3IJHB 5FF6A 4CG1A 4MS8D 3MCLL 2VN7A 3A6CH 4HIJB 3LKQB 1J0IA 3QFDB 4LOUC 4N0UB 5T3ZH 1AQLA 1IZ7A 3FYTA 2GTZA 2HTLD 3BGFC 2DKMA 1XH3A 3VWKB 5FYJH 5I6XB 3B9KA 4LLWB 3H7BB 3LD8C 3H9YA 1DT5A 3B6SA 4V1DE 2YD8A 2N56A 3CCBA 5D96B 5C6PB 5KZCB 4NO5A 2VTVA 3ILQD 3HC7A 4PV9B 4NQDA 3H6JA 2OX5A 4Q9QH 1VFAB 2HA0A 4MCYA 1FYTA 4D0BB 1Z9MA 2L4OA 4GMTH 2Q1EA 2VSQA 1VXRA 1FZKA 5E8DH 4QEKA 3LQAL 5ILTH 4MGXA 3MXWL 5CJ5A 4H26A 1XZJA 2XLCA 2HMID 3G5XA 3K9BA 2XA8L 2ERJB 1CUJA 3BW9A 4LEOA 4D94A 5HHXH 1A02N 2DHCA 1CICA 1UJTA 1ZTXL 2B1AH 3K80A 3KYMA 5DD0H 1AXSB 4OD3L 1HE7A 3FONA 5EO9B 2C3GA 4XX1E 3LCRA 3HNSL 5SYNA 1TCRB 4GJTB 5JHLH 2FD6H 1EXWA 2VATA 3X12A 3JUYA 5D7LE 3I6GA 3PUCA 3MNZB 5A3IC 1FQ9C 1WHTA 1L7QA 3NFSL 5JZ9A 1G9NL 4R4FH 1L7IL 3O8XA 5T4FA 3NMEA 4P2CG 1X4XA 4PJ7A 3BE1L 1YEFH 1KJVA 5JPMB 1I3RA 5A43C 3DWTA 3G08B 3DYMA 3I2IA 4XCCL 4M7ZC 4NRYA 1UKQA 2BVEA 1H8OA 3MJGX 3BZ4B 1PZ5A 3QUYD 1CFQA 2R29L 1N64H 5FHBL 3CFBA 1HKFA 3HR6A 3SDDD 1NCUA 5FP0A 2RR3A 2YPLA 3O3DA 1S7WB 1R3IH 4HWEH 2I24N 1EO7A 1CLEA 4KKLC 3CSPA 2FX8H 2EC8A 5ESQB 1A88A 1HILA 4RNRA 2J4CA 2H2PD 3OKNA 1CDYA 3ZTJH 1VKXA 5EZLB 4YZFF 5IROA 3ZYIA 2ZVDA 3BYYA 1DQJA 1G66A 4MDJA 1M6OA 4MJ5B 4JE4B 4NQVA 3G9TA 4XNUL 1MFBL 4OIIH 4FFYL 4H7IA 2YMXH 3DVNA 4M6OL 1V7MH 4NQVB 4JHWL 4JANB 5FYKE 4U49A 2ZJSL 5C9JA 1T80A 3TO4B 3B2UD 4Q82A 3CN9A 2AABH 3ZKNC 5TQ2L 3ESVF 4FTWA 1S7QA 4P5MB 5EORH 1LNUB 1MTZA 4PJHA 4QRPA 3QJFA 4L5FH 3EIOA 4KJWD 1DDHB 4W6YB 1U4NA 5DHVH 3T2NL 5DD1L 1QFOA 5TQ2H 3MGAA 3WFDH 1ITCA 3QNZA 3ALPA 4CIAA 4M03A 3DSNA 1I1AC 1IFHL 2W1NA 5DJXB 4UIKH 3WNNA 3BDVA 1KCRH 3EJYD 2OL3H 3DX9A 4W4NA 3O9MA 3I85A 4ZSOE 3FNBA 3L3IA 2ZCKL 5B4MD 2NZ9D 3FB7A 5FYLH 1XGPB 4ORGB 3GB7B 3C2AH 3EOYG 1MVUB 5FHAH 2BNUA 1HQ4B 4FLMA 3ZWQA 1BE0A 3D18B 3ILPB 4JPWL 1T83C 5FUCC 1JMXA 1L6XA 4OQTH 2ZPKL 5DEFB 5C0NC 4P48A 3BZ4A 4Z5RB 3P4MB 1YN6B 3IDNB 2C1PB 3F12B 3QQ9D 3HPJB 4NHCL 5BV7B 3CDGA 4NQCB 4IRJC 4LHQB 6YASA 2P47B 1NAMA 3NACL 3HZMB 1A22B 4H7KA 3ULSA 4U1IB 1OD9A 3FT2B 1J8KA 5IBLC 4JO3H 3M17B 5E4JA 1UOOA 3BH9A 1E6OL 2QQLL 3C5WP 2ADGB 2L0DA 3ULSB 2CO6B 1CUYA 5GRVK 5EFIA 4YLQT 3L5JA 1V7ML 1N2RA 2WSLA 1P69B 1PGRB 1FIGL 3LB6D 4WENB 3IURA 1I7TA 5K33A 3EKCA 1UVQB 5AI4A 3LEXB 2CKBL 5FIEA 5CD3B 3C5JB 1AR1C 2HVJB 2C5FA 4H26B 4LFHG 1B41A 1YN6A 3IDNA 5FB8B 1QHPA 4AMZA 5SWSE 2VAVA 3U83A 2DQIL 2X4PB 3TT3H 1WOMA 2NY5L 2PW2B 3D3VB 4E0RA 1ACYH 3HC4H 3FHQA 4YK4C 1MFNA 4HIEB 5CINH 1KCRL 4WU7A 1A21A 1AO7D 1G7MA 1WQVT 1S9YB 3HMXH 4D9QD 4P2QE 2R1XA 5F4ZA 1AGEA 1CXFA 3OURA 3DL7A 5E4YA 1YPZF 4X6EB 5LWYH 5D7LA 3RWJB 1VE7A 3WYNA 4PP2B 1JTOA 2WHPA 1I1FA 5I8EB 3SE3C 4FWBA 2ZYSA 4NZZA 3VWJA 1HYSD 4PBWD 2VDPH 3IXAA 5JAUA 4FBLA 3RZCC 5I15H 2QT9A 4QWWD 5FCUL 4MNQD 4XMLL 1QR1B 1BN6A 2YMXL 4N0CD 4P2OC 3VXTB 3C6XA 4OUKX 1MX9A 4RX4A 4JHWH 4TSAH 3THML 1LMKA 4LPVA 1ZWIA 1TVDA 3VGDA 5LYYA 1A6UH 1WAAE 2DQUL 4N0FB 2VABB 3BRFA 2WLSA 1RYYA 3SK0A 1O7VA 2Z93A 1M6OB 2JJUA 3G5YB 4UQ2A 5DRWA 4GRWF 5BZWB 2X09A 3C09C 2WUFA 1U3YA 2Z3ZA 5D6CB 4X91A 4Y4FC 1EDBA 4TULL 5IBLD 2EDWA 3WWEA 3LS4H 3LQZA 4G9FB 5KSBF 4NC1E 4MA8H 1XF2B 3SE4A 4GKOA 1GL4B 1MFAL 3VGAC 5HFAA 4CVUA 3L9RB 5IB2A 2RJMA 5J11C 1UZ8A 3OB0H 3N1MC 2CQVA 2XUGA 3G9UA 4Q9CA 5GSVB 2JCCF 3LD8B 2DQTH 4KKAD 4L8CA 1NX9A 3PHOA 3E3QE 4R6UA 4RAUA 5DI8B 3D3NA 3U0WL 1ZK9A 2JB6B 1CIDA 2XWBB 1KG0A 3QNXA 2ZYRA 3O8XB 1N8ZA 4LCWB 5E2TL 5IROC 1LEKB 4QNPE 1JGDA 1SJEA 4HXBH 3KWWB 5HI3D 4CIBA 2ARJQ 1CG9A 3MNVB 3NCJL 1DLFH 4JRXB 3WIBA 1IGYB 2VL4A 2VLLA 1K4YA 4WJ5B 2QR5A 1AGFB 1RVFH 4I2XE 4OQTA 3SKNB 3K8MA 5CEYB 4H7DA 5TF1H 2KL6A 4GG6A 1D5XA 1E28A 1XF1A 2H41A 3ILQC 2QL1A 4RMVA 5EU3B 3ZT6A 5TPWH 1QFUH 3X3HA 4P9HH 1AKJB 1JHLL 2IPTH 1U92B 3IDMB 3ZDZE 1WAAA 4RFOH 3TV3L 5LCVH 5BXFA 4R9HA 5HVWA 1QNZH 1EPFA 3PWJA 2XZQL 4WW1A 4X71A 3FFCB 4QHKJ 3KXFD 3UPCA 3N85H 4CN1A 2BK8A 2XMBA 1F4YH 4DSAA 3MO1A 1JZ2A 5DTFA 2HLFC 5HHMB 3QFJE 1XZ0A 3K1KC 5JW3H 4BYMA 1NBZA 4KTDH 5IB5B 3WIIH 1QNZL 5EO9A 1F42A 3SDAD 3UJJH 1QSEE 5ALBH 1DBBH 4KK9D 1FH5H 1MNAA 3UTTE 4PD4K 4LIPD 5DK0A 3B3IB 5E70A 3CXHJ 4WFGE 3DKKA 1TCMA 5D96C 4O4YL 3QIWB 4HJGB 3WS6C 2OQJB 2QZPA 4WY7L 1ACLA 4BZ1H 4X8XA 4YHLH 2HFFB 4U1HB 5MP6L 3K4DA 3P4NB 4B85A 2X1QA 3S88H 3GEWB 3T0DA 3VKFA 3VRLF 1FL6B 1A1NB 3FFDB 1X6NA 1A9BB 2FJ0A 2EKSA 1T0MA 3I1YA 4D9JA 3N1FC 5T1KA 1N5MA 1IKNC 4ZMAT 3ULUL 5HGHB 3U36A 3W11C 4KJQD 1J0JA 5I1JH 4PRBB 3KPRB 3N06B 4U1GC 4LVNC 3PICA 3UTSD 2XPGA 4QXGL 4K8RH 4LQFH 4ODHL 3BKMH 3LRSB 1PG7W 1RD6A 2IPUG 2NW2A 2O5ZL 4LL9A 1HSBB 4UB0L 2V2TA 1XFDA 3VVMA 1NGYB 3R8BB 2JGKA 1VACB 5I8CA 3O6KL 4DN3H 2ADIB 5H37G 1JE6A 2Y72A 3SKJH 3ZDXF 1GAFH 3DO3A 1WFTA 3UPRB 5HHOD 5IMMB 5E6ID 1U58B 5FUMA 5DI8A 4WGWB 1OOAA 4OCSL 2DF3A 1GC1C 2W59A 3U7YL 1JFQH 5IMMA 2VH5H 3JYHA 4KMTL 5LZ4A 1FVEB 3ARQA 4QHKI 3QWRD 3GZJA 2G9HA 3D3VD 4F37K 5B21A 2FR4A 4ZOCA 1RJCA 3HFMH 3VW3H 1IC7L 2DQDL 4HK3J 2P8MA 4HWBH 5GSRA 3PIQB 4H0IA 4QGTA 1ZSDA 3P2TA 5BS0E 3SDCD 1R24B 5F9OH 4ZO7A 4CGTA 1RZ7H 3NTCH 4XNXL 1W72A 1IGMH 2DJUA 2I78A 3RDTC 2GFBB 1UACH 4NQEA 3EO0A 2EKSB 2ICWA 1R5IB 1QJ4A 3D39E 4HLZH 5CXUA 4EN3A 4JFYB 5J11B 5F3BB 3MNWA 3HZYA 4ZYKA 4A6YL 2HT4C 5IVZB 4Y0GA 1TTGA 1SMOA 3MRKA 3TA3D 5KVFH 1CFJA 2H6PA 1TZGL 3K74B 5J06A 3LZFH 3Q6GL 1AI1H 4NCC2 2GYSA 5SX5K 1HEZB 5ALCH 3VMPA 4WW2F 3GMRA 2ADIA 3W9EA 4Y1AE 4Z95H 1CBVL 1SQ2N 4QA9A 4M61B 2ID5A 2NY1C 4JFHE 5ADPH 4KI1A 4YBLC 5TH2B 2X1PA 2C4HA 1M33A 5IQ7H 3L5XL 3HZVB 4YUEH 3MJ7B 1R3IL 4HWEL 3EYQC 3TESA 3QEUB 4I0KA 1C5BH 4RMUA 5GGVL 5AKYA 3C60D 2FLBT 4DAGL 3TBWB 1YEIL 2E6PA 3NH7L 3EAKA 3NPZB 3IDMA 2IH3B 3UMTA 1MNUL 2MCPH 5JW4N 3QCUL 4XPBL 1VFOA 4GW5A 1OARL 4HZGA 4KMQA 3WQHA 4QF1B 2YUXA 3T3ME 3ULVD 3WLAA 1MWAL 3UZEA 1JMZA 2XQIA 4QKXB 5TQ0L 4C87A 3ARXA 3PFCA 3VVLA 3KNBB 4ODSL 1C7TA 1XIWA 5DUMH 3ARUA 4KJYB 3D0VA 1NC2D 1EGJH 1DEEA 1UKAA 1K4CA 5CT9A 5F7EH 1ZJ5A 1GGVA 4QHUB 1U8NB 2AV1B 2QV2A 1INEH 1IQWL 4KUCF 1NLBH 5IB4A 1IAII 4AIZA 1TZHA 4PLJD 6FABH 5HYFA 4JRXE 5IF0A 5HHPA 2IQ9H 2WIKA 4PSDA 1YUHA 2E6JA 1FHGA 2DQZA 1CGSH 2YYSA 1JWUA 1NMAH 1I1AA 3TYGL 1U8IA 4NT6B 2JGIA 4KZDH 4H88L 3A2MA 4URTB 5H94B 2E9JA 5GRJH 5B22A 3V95A 2A6KB 4NOFA 1PAMA 1DWQA 5ALKA 1GZQB 4GS7C 3FCTA 1CD8A 4JO3L 5T33H 5C0GB 4ARAA 2JCCB 2FSEB 3HAEH 2P7TA 4LCWA 4PRID 4QRSB 3LIIA 2X6MA 1EHLH 3PV6B 3X14B 1Y0LB 1XF5B 2QHLA 4G6FD 3ARTA 4MNGB 3MLWH 2QMQA 5HBBA 4FHBD 4M93C 3FQUA 3QQ3B 4GRWB 1DN0B 4DYHA 4L9LC 2DQIH 2FGWH 3RVUD 2AV1A 1Q9KA 4K71B 3V7AG 5HF5A 4K94C 4M02A 1W72H 5IV2B 1I3UA 2JCCA 3VDXA 5AK3A 4ZFFA 25C8L 1A4KB 1MHHA 3L5IA 2Z31A 3P40A 1EIBA 3CUPB 1P0IA 5BCAA 3C45A 1S5HA 2AJDA 2Y6VA 2EDFA 1B88A 1PYWB 2NY2B 4XP5L 4K07A 1G0YR 4NT6A 4C4YA 5HYJE 5A7HA 2LV4A 4NKIH 1HSBA 2V2TB 2VQ1B 3VDCA 1BVLA 4JQVA 3QXDB 3LIPA 4QWWC 1D5ZB 1U36A 3VFVB 1QD0A 1VDGA 1Y7IA 2VDPL 1ZA6A 3DURB 4ENEC 5HDQL 3NVQA 5JXAL 5LBSL 2WFLB 2YK1H 3B4NA 4PUBH 1DEDA 4QXTA 2A2QT 4WV1C 2D0GA 4XH2A 4GAYB 4C4ZA 2P8PB 5IR1B 5ALNA 2Z92B 2OM5A 3BPCB 3BVNA 3DRTA 4TSBL 3SDXF 4XMPH 1NQBA 2SEBB 1TENA 4NZUL 5FYKU 3S35L 2XQKA 2AI0H 3DPBA 3VXSA 3UUEA 1QBMH 5IB3B 4JN1L 1T7VA 1BZQK 4AT6B 5IHUH 5HYIA 1AE6H 3LKRB 3ABZA 4ODTL 1BBDH 1IGFH 4JFQA 1KT2B 4FQHA 2AXGA 1I75A 1AR1D 2FJHA 2EE6A 4I5BB 1MRCH 2XZCH 4G6JL 1AC0A 2H6PB 5FO7B 4I19A 5LIPA 5D7IB 3S37H 2A6JB 4OLVL 4RAVB 4KV5F 1MCHA 3DURA 4YDJB 4A23A 1AGCA 3VFVA 3MRMB 4NP4H 3OKMB 1ZVHA 1GHFL 2P24A 2VZ3A 2JIXB 3L3GB 1MWAB 1JPSL 4PJFF 4MJ3A 3FRPG 2HFGL 1DANU 3SE8H 1N6QL 5I1LB 1IEAB 4UHFA 3QPDA 5FYJL 1Q0YH 2BOCB 2NY6C 4MLSA 4RRPA 3WEXB 2IPKA 3SGKC 2DQFB 1EDQA 3PABB 2O7VA 3U82B 2QUAA 3HZOA 1OPGH 4PY8J 3Q5YA 2VLRD 3HMWL 3KPNB 3IDYC 3O6FA 5IFJA 1VKHA 1IL1B 1KXVC 5HI4C 2AXFA 5F1OB 1DBAL 3RKSA 5CURA 4U1MA 4X3CA 3LKSB 5DEGB 1KPUB 3BDXA 4I0PA 3SDCB 4X83A 2OL3B 5DJCB 4UV7L 4Z76A 3RTQB 3L3JB 3QMVA 1E4XI 5I8KL 1IGYA 5K9KA 3ZLUA 1XZDA 1E27A 1Q38A 1WZKA 2FRGP 3KYOA 3AZPA 4XWGL 5EU7C 1RUQH 2E27H 2XUPA 3P73A 3KYKL 3MGOB 2P5ED 3LKNA 4R7DB 2YA0A 5F7EL 1XGUA 2RGUA 4U2DA 3EO0B 4IHOA 3EDJA 3RZCB 1AO7E 3H3PH 4EY6A 4YZFE 5AM2A 2CDGB 4J3WA 4UT9L 1F3DJ 4U31A 4Y4FA 1SCKA 4C01A 4P4KD 4W6XB 1U8JA 3SKMA 5E8PA 1HH9A 2FJPA 4HDIA 1ZGLB 1PKQA 2IPUK 3TRDA 1F4HA 5IVXA 1QEWB 3RY4A 1BZ9A 1D9KC 4QRQB 3RWHA 3DLTA 2E8YA 2YUWA 4GLRH 3H42L 1BECA 4E5XB 4Z49A 1CFNB 2EDYA 5I16A 3LKOA 3WDHA 5IOPB 1QQDB 3IDXH 3HEAA 4WI6A 3VXPB 3P0VL 1X5IA 1A7NH 5T1MA 1S7WA 3WIHL 4FS0A 4XPHH 3AGVA 2R0LH 4BH7A 3RAJL 4PJAE 1E4WH 3ARGA 1W1IA 1CDGA 4P4RB 1H3WM 3EGSA 3TZVA 4YR6A 1FJ1B 3CFKB 2BSED 3KS0J 2XZAL 3Q3GA 1HOCB 5GS1A 3VXUA 3RI5K 4OPMA 2CK0H 3LVEA 1E4WL 5GRVL 1IEHA 3QPXL 3OM8A 4XGZA 1KCKA 5FCSH 3O4LE 1ZTXH 2B1AL 3DVNB 1X2BA 1EAPB 4MAUH 2P8SA 1F58H 2DLHA 5CZVL 1QR1A 2GCYB 5AM4A 1PBYA 5EOQH 3I2KA 5AAWA 1NBZB 1NFKA 5SX5H 1YY9C 4TVSa 2B4CH 3O41B 1Y6MR 3H42H 3MV7E 2G75A 5IHLB 1Z5LB 4UMGA 4LPUA 1E27B 2V6HA 5IW1A 5ALLA 4WEBH 5EUOB 5HGHA 2UV3A 1I1FB 4LNRB 5ESRA 4JKMA 1GZPB 3LDBC 2X9YA 4RMQA 1I9JL 2WFZA 4Y16D 2J3SA 2A6IB 1EJOL 4G3YH 5C0BE 4BQBA 1LILA 5F7YC 1CL7H 1N26A 3P4NA 3F7YA 5HYSA 2EDKA 5SV4A 1IGTA 4PY7A 1OGAE 4MA7L 5BVPH 4OLZH 5JARA 1O6FA 4M7LT 1XAUA 1NAMH 5FM4A 3SCMD 2BY0A 1KCVL 4YHOL 1RK1A 5ALDA 2QR0A 5TE6L 5MEOA 5DJ2B 5GZND 2QS9A 1I9IH 2J88H 3KHOA 2FCBA 2XQFA 5HVHC 4U1LB 1DR9A 3TN0B 5FOQA 3WS6A 3QNXB 4HF5H 3WFZA 4Y4HC 2DQYA 2ZOLB 4TRPL 3QZUA 2VZSA 3OAUH 4L8SB 5HGAA 2VLKE 5ICYA 4XVCA 4YFDB 2VLKD 5DD6A 5DR5L 2X7LA 4I9WD 4XP9L 4B82A 4KTDL 5D2NE 2YD5A 1BD2D 3S5LG 4MA7H 5BVPL 5DJXA 1DBBL 3V5DB 1FZKB 1UH2A 4M4PA 4WU5A 1RMFH 4G8IA 4FFWA 3UTTA 1OSPL 4OFYD 5IW3A 3MRNA 2D0HA 1VZ2A 1L7TH 1QQDA 3CXDL 4LPYA 1CUDA 3BSZH 4JJHA 4O5LH 5GGTL 1ZLVK 4Q3OA 3D18A 3ILPA 4GHWA 2Q7NA 3EJZD 5D1XD 1ZA6B 1T21A 4J0JA 4R90L 3ALXA 3CN7A 3S3JA 3D25A 2EXWD 3MLTA 3H17A 1RZIA 2PUJA 1MRDH 4GXUN 1BOGB 4LVEA 3QG6B 1DLFL 2HKHH 5DDHA 4ZQKA 5KWIA 5I1CH 4OCWL 5JA8B 4QHLB 2H9YA 2Q3AA 2Y36H 3SE9H 1IAOB 2XI4A 3H9SD 2C26A 4F3FB 4ZV7A 2EDJA 3N0PB 5GRWA 2PTTA 3TVMC 4LDOB 3ZTNH 4DVRL 2V5TA 2E6QA 4L4TE 2BCKB 2G63A 4L8DB 5I1EL 3OKLB 1Q9KB 1FO0H 2YPLB 2NXZB 5JR1H 3MLPA 2BCEA 2JB5H 2R1XB 3BKCH 3HS0B 5BRZD 1AJ7L 1VE6A 3LKOB 1XGYH 2D7QA 1WV7T 1IZ8A 4XXDA 2G5BB 1ZT1A 1A6TB 4HKZA 4GW1B 1R3KA 1ZA3B 4G43A 4JCLA 3C6LA 1O5DT 3R3WA 5ABDE 5DUML 3HI6L 2OP4H 2XN9B 1Q72H 1WLHA 3UTQA 2G5TA 4OD2A 4BE9A 3MLYH 5T4EA 3D0LA 2GJ6D 5CJXA 2ZOKB 2IJ0C 3B2VL 1ORVA 4QYOA 5JW5B 4P2QB 1JPFB 1NAKH 3STZA 2ICES 3O6LH 1CVRA 3UYRL 3HC0B 4RAVA 2BFNA 4C54A 4YHLL 2OZ4H 4XMPL 4P08A 4PP2A 3DNMA 1IJ9A 5C0DA 1NU8A 1YNLH 4O08A 4GKZA 4Y2XA 2X5PA 3IYLW 1F5WA 4N0YH 4GRMB 1NAKL 5DTFB 4WW2C 1GKKA 4M6ML 5TE7H 5IHBA 3QUZB 3Q5TA 4FQQB 3L7FB 5JZSA 4LCYA 4F57L 2QQNL 1JWMB 3ME0A 5DZNA 3WEXA 4DEPB 1KEGL 1OTSC 3L7FA 4DZ8A 4G5ZL 3IVKB 2IC2A 2WILA 4YXKL 1IGTB 2FH8A 3K0WA 2YXPX 4JM2D 5FOBB 4MQMA 5ERWA 1R9MA 4KMLB 4IO0A 4F7TA 2J8UB 5I0ZA 1E66A 1QFSA 5CGYC 1XZHA 5KANG 1NCCH 1RZ8A 5IEHB 3M83A 4I2XB 1KB5H 4LNRA 4HFUH 5I1AB 2PUQT 1HZHL 3Q1SL 1BQHB 1CR6A 1UZ6F 43CAA 3OHXA 1ACYL 3IULA 5C2BL 3WYDA 4YX2L 2XN9A 1AGDB 5B38B 3G04B 4NRXA 2H32B 4PJAA 2HH0L 1BLNA 4FLEA 3GHEH 3WSQL 3ZO0A 1LK3L 2LAAA 4BYHA 5C86A 3WK8A 1U8HB 4Q2ZA 4XPFH 2WQRA 4OLYL 4NRZB 4P59L 1CTNA 1Q9LB 3WD5H 2QQLH 5D72H 1CUVA 2DMKA 5IH7A 1UKTA 3VD4A 3SDYH 3JWEA 1QBBA 5FGRA 3VH8G 2YPVL 3ARFB 4U0RC 2WM0A 3WD5L 5D71H 1EFXD 1KIRA 4PYGA 5J13C 1YB7A 5E56A 4KACA 4HK0B 4AB1A 2LU4A 3G7NA 4BZYA 4HMEA 1LPNA 2FB4H 4K7FB 5IHZA 3H0TA 2K7QA 3OKNB 1VKXB 5ESQA 5AYUH 1QEWA 2N4IA 4J3XA 5IJKC 2W07A 4X80L 2WUEA 3WDIA 1ZWIB 2JIXD 3BZFB 2CJPA 1EI9A 5F3BA 3SJVD 3QEHA 5FFLA 3STBA 3OXRB 5ENWB 1W4LA 5CSBA 2NY7H 2WP3T 3JTTB 4LVNB 5IK3A 4H7JA 3JWOC 2RQ8A 4X80H 1JF6A 2UWEB 1XR8A 3VRIB 3RUGA 4C55A 1J18A 1MT3A 1RV6X 4OZIA 3O0DA 2Y2VA 1VGEL 3MJ9H 4ZXBB 5DT1H 1H3XA 2HA5A 1QTIA 3WKML 5D9SB 4F7PA 3ICWA 3ZLQC 5F9DC 3ESBA 1CZ8H 4YQXH 3HC3L 1K8DB 2W0PA 3SWWA 2FNBA 4S2SB 4D9RD 2FX7H 3UYOD 5D2LB 3SY0B 1J06A 5EO0A 5IVNA 3LKNB 4R7DA 1NJ9B 1R3DA 3QXAA 5EO1B 2D31B 1PX4A 4HIEA 3T0AA 5T33L 1P4BL 2YPLE 4P5TB 3ARBA 3BQUB 4EY8A 2ICCA 2J8OA 5ALGA 3O0RH 4TUOB 5DJDA 1G42A 4UBIA 1I9JH 1UFUA 4YO0A 3K1DA 1FFBA 1CUXA 3QUXC 5FECB 5F9JA 5KSBA 4L3EA 3UTZB 4EBQL 1FDLL 1KCLA 2OPHA 1J1XH 2OR9H 4X0KA 1KCSL 1SHMA 3ULVH 4HPYH 2HWZL 2ICEB 5JMOC 4YC2B 3IFOB 4O00A 4FFVA 5KSUA 5HPMA 3H7BA 2VC2H 3FB8B 3GUTA 5DJ6B 4PGEB 2VT6A 1OY3B 5DGRA 3X17A 5JAOA 3DLQR 4S1RL 4BKLA 3R06B 5JOFA 1K2DA 4G9EA 3HXKA 4X6CE 4HIIB 2NY3B 2VIRA 3VI3E 1R3HA 5I66B 3WXWH 2OI9B 4EA6A 4YHYB 1Z3GL 1CTOA 4H35A 1Z5LA 4RGNE 5FXCH 3WKCA 4X9FA 5C7XH 1CR9L 1IUNA 4U2YA 3NAAH 4OF7A 3T3MF 4F7CA 4IRSB 3VXKA 5BW7A 3QWOA 4BAUA 4LXHA 4DGVH 2L7UA 2BNUB 5D2NB 3QRGH 1MUJB 4NM8L 4EI6B 5IMOB 4FNLL 3A67L 1HXYA 1P7KB 4C56B 3HNVH 5KSUB 1IEBB 3HNSH 1V5JA 4MDIA 1U8MA 4LVHB 2R1WB 3ARDA 1BFOA 2YA2A 1UXWB 2DWEA 3O4LD 4CVXA 5M7QA 4PLOB 3UBXG 1DVFA 2VF2A 5DLPA 4K2AA 3WN5A 1C5BL 2A0LC 3CH1B 2O5YH 4HGKC 2YOCA 5GGTH 3MRPB 3S4SG 2ESVB 3ET9F 3U30B 1HDEA 3QPCA 3K8LA 2LU3A 3RGVA 4JFDD 2PYFB 5C08A 4Z77B 2ES4A 4JZNB 1U0QA 2B0SH 5FPQA 2IAMD 5CTAA 3AM8A 3V6FB 1XQYA 4PJ5A 1RQ5A 1NCCL 2VOTA 5FEBA 1YMME 1QHOA 1E5TA 2WIGA 3PHSA 2YH2A 5TQ0H 2AK4D 5ESAA 3VD7A 1F3DH 1LGVA 5LP1A 4OLWL 3F7PC 1OAKL 2PW1B 2YD9A 4K55A 2QJRA 3H18A 1KELL 2BRRL 2ICWB 1OM3H 1W8OA 1AY1L 5EO1A 3ROOB 4IMKC 2CSPA 5ITFA 2HFEB 3W2DL 3QZWA 4WUUB 3T4YA 3W39B 1DLHA 5E03A 2HRLA 4RISH 2DYPB 1J8HD 4X6CA 1UQSA 4Q6YA 4EVNB 5C07B 2P1YA 2VN4A 5F7WC 3X14A 2M1KA 4N8VG 5IK3B 1TIBA 3GIZH 4YDIL 4LPTA 4W1QA 3VG0L 1CFSA 4OZIF 5GJSL 2HA3A 5KSAD 5JQ6H 1TIUA 3D39B 2ADFL 2WAHA 4EBBA 1QA9A 2F58L 4BJLA 1I8LA 1Y18B 5GS0C 4RZCA 4OZIE 3DYPA 1JK8A 2IH1A 4P92A 4LCIH 3EBLA 1R5WB 1GAFL 2XTLA 4IOSD 4IS6B 3OF6D 3RDTB 3BKCL 3IJSB 3EQ7A 5E24E 5E4TA 4CCYB 4DMFA 3UROR 1A8QA 4QLOA 2FDBP 3AXLB 4FQCH 3MRPA 2ZCLH 1RI8A 4M5YL 5EZOL 2IALB 1C08A 3PWNA 3IU3B 4TULH 4NUJB 4IRSA 4LF3A 4PJEA 2A0LD 3B5TA 4PJ5E 1CGYA 4JAMA 4U6YA 5I1JL 2AJ3B 1KEGH 4JDZA 3U1SH 1RIHH 3V9AA 2ESVD 1S7SA 1NC4A 4NN5B 1NLDH 1IEBA 5D1QD 4QF1A 1MRDL 1CXEA 3V4VL 4CMMB 4XNXH 4HTAA 3R06A 4BUHA 2Y07L 3QQNA 1NC4B 1AKJA 1NMAL 4NJ9L 1LE9A 5EU3A 4NO5B 2QJWA 3U4BH 2ICWJ 1TMCB 5LXGH 2OYPA 1CDUA 2BVOB 2EE3A 5DNWA 4ZUUB 5E8OB 2H2PC 2WSKA 4OT1H 4OUOA 2CKBA 3D85D 4X6DB 4PTUB 5I1IH 4DMHA 1XRQA 2X70B 1MIEH 4HH8A 4GW5B 5KVFL 2ERJC 4HBQA 5DVKA 1KJ2A 4FFWC 3AS3A 3U7WL 1HCFX 5HJ3A 4GXUM 4NNYB 3QHZL 4DKDC 4KH2A 2FJFA 1FG2B 2Z9TA 1GKLA 4PJFE 3ISWA 4O2CA 4E11A 3IFOA 2D7TL 3V52L 2IFFL 4LCYB 1RAMA 1GIGL 3GJFA 4M6NL 4P5TA 3RL2A 4EY7A 1SBSL 3ANSA 1QFUL 1KEML 3V5KA 1L7IH 4TVPE 5EUKA 1S9XB 4X98B 2Y1VA 3EYVB 3M1BA 4LSSH 3T0XA 1NANH 3O2WH 1P4IL 2IANE 1RFDH 3QIBC 1W76A 5K3FA 3KYNA 3WWCA 3MSPA 2X4QB 5K9OB 4QNPF 5C0BB 4YHKH 2HU5A 4H88H 1HHKA 5CD5D 1MPAL 1P7QB 3NWOA 3GRWL 3V5HB 12E8H 1B3JA 2B5IC 1D5MB 4XCNB 4PP1C 4UNTA 4OCMC 4Z5RA 4F9PA 4F58H 4G8BA 4QDOA 2VJCA 4NQTA 1MIMH 1WWCA 4UBNA 4IDJH 2J8HA 5E4EB 2D7TH 3FHAA 3SCMB 4LVOC 1D3CA 4BAZA 3QUYC 4LARH 4NHUA 1SJXA 2ITCB 2YSSB 2PXYB 3QFJA 4X7SL 3B9KC 3DSFL 3STUA 3I6LD 4HT1L 4JO4L 2XWBA 1SYVB 3AAZA 4YASA 2W92A 4K6KA 4BA8A 4F2MB 1CDHA 4OGYL 4OM1H 2RHEA 2I5YL 4JRYB 4NBYB 3TZVB 1ZLUH 1CLYH 2OMNA 4X7SH 3TCXA 4Z77A 1JWUB 2OGSA 2G9HB 1EMTH 1UZ6E 3RNKA 1UK8A 3H2KA 5HVGB 1CDJA 3I6YA 3MLRH 4BFBD 3GMOA 1Z2KA 1XF2A 4BC0A 2JJTA 1DQZA 2DTML 4YE4H 1D6EA 1CDBA 2FIKB 1Z9SA 1G0XA 3ZKSD 3VRLE 1HINL 3O8XD 4FQLH 5MERB 5SWQB 2BSTA 5AD0A 2KKQA 4N0FA 5ALVA 1I9IL 4NWUL 5ITBH 2F5BH 3HJUA 5D7JD 4YDLC 3BMVA 3SGEH 3NIGF 4PJ8C 3ZYJA 2UZIH 3QDJB 4Q7DA 3V6OC 3IUMA 3ZI7A 3QULB 1NDGB 4WO4B 3GA7A 4OYYA 1SYSA 3QUYA 2Z91A 3RTQD 2DIAA 2FWOA 5EZJA 2OR8A 1EFXB 4QT5B 4HXBL 3QNYA 4N8EA 3UO1L 3EZJB 1BFSA 1U3HC 3BXNB 2I9TA 2IBZX 3DMMB 3I3BA 5EU6A 3TFKC 3RKDD 1AMNA 1ZICA 1INQA 4LCCB 3CMOL 5EHQA 3PDGA 3KYNB 4LP5A 4ODVH 1UKSA 4ZRDA 4LLQA 5I7UA 4G9DA 4KUCD 4QHMA 3O11A 4U7KA 1ROWA 5B38A 2HFFA 1WM1A 3MJ6A 2X7LB 4D0CB 4OKVA 1RWQA 3CCHB 3MOQA 5JO5B 3ZDXE 5IP4A 1QO3B 2YD2A 2YC1A 4Y8DC 1NMCB 1G7LB 2DTSA 4LSTL 4EBQH 3JBG7 4ZFGH 5ICYB 3PXHA 5EZIL 4LLVA 4XPAH 1HEZA 5CGTA 1S8OA 1M71A 1WTGT 1ZS8B 5C0IB 2EIEA 3H3KA 3O3EB 2DKSA 4PGBB 2CKBH 3WWOA 1C16B 4PTUA 1A6PA 3BEWB 2ZYIA 1G7JA 4H5SB 3MUJA 2HVJA 4YDJA 3U1SL 3T2OA 3FRPA 3MLZL 2Q8BH 2NW3B 3U9PL 5JDJA 3CH8A 1BU8A 3OX8B 4AL8L 4PREA 4MD5B 3TIDB 4Y2OA 1CUBA 1U92A 3BUTA 5HHNB 3RWIA 5ACZA 1QSFD 1RU9H 1J11A 1YPZA 5DQJA 2NTFA 4D0CA 4F7EA 3U6RB 1VERA 5I73B 5L0QC 2FBJL 2YUZA 3SDAC 1I1RA 4UINH 1C8PA 1LO2L 4EB0A 4N5EC 3VGGA 3V1KA 2YXFA 1DUYB 4QHNB 3MROB 1INQB 4LCCA 5H2BB 3B2UC 3FT3A 5GSRB 3L6FB 4F8TA 4H18A 3BAEL 5AKEA 2AS5M 2ADJB 4R7NA 1NBYA 3LQAH 3QIWC 1WTLA 4YHML 5HI5C 3EOBB 5TPWL 1FFQA 2FHFA 4PGJA 5B39B 1R3JA 1CS6A 5JW4Q 1FNGB 4X6BB 4AMKH 1GYAA 4MAUL 1E89A 5AIBA 1PSKH 3PP3K 4CU8A 4GW1A 1ULVA 4DW2L 1CE6A 5ACMA 4NYLB 4EOWH 1CU4L 4LPCA 5C0CA 3BH8B 5HGDA 4NKMB 4KQ3L 5CZXD 5D1XC 4NQXB 2WJ4A 4M93B 3AREA 5C09D 1QBML 2CK2A 3QIBD 4KK8D 3O2WL 4LVOB 1PFCA 3ZE1F 1FLTX 2VLME 3JV0A 4ZDHA 3ZLTA 3WIHH 3DS8A 3EZ8A 3U48A 2CUIA 1NGZB 1NMBL 3FO0L 4UUJB 5L9DH 3VXMA 4PLKC 3VDBA 3ESAA 1FCCA 3WHXA 1LQSR 1Z3GH 5DJ0B 1RSFA 5DO2D 4HFWB 2GYWA 1MLCB 2NZIA 3ROLB 4B0PA 2PN5A 3ZKXB 5I71C 1HWGB 4HCRL 1N5YH 3FSGD 4JANA 1U8OA 4EOWL 2FHBA 3P4OA 2ITCA 3MZTA 1ZANH 2CDGA 1OP5H 4ZI5A 2YWYA 5DMKA 2O5YL 4KK9C 3VXSE 1CUGA 1FL5B 2IAMB 3KPOA 3O8XC 2ENSA 4BELD 5T3XH 3WCYA 1Q83A 2H2SC 3MBXH 2WQZA 4WDIB 2DIBA 3VWJD 5GZNC 5EBWA 2PKYX 4WI8A 1D5IL 2F15A 2V5MA 4NN5C 1EHLL 3LKSA 1NEZG 4G8IB 3AINA 3W0WD 5C0IA 1U8LB 4GBXD 1UWEH 1U42A 2NY0D 1CQYA 3MLWL 3MMEA 3DX6B 3GNMH 5FK9A 1S9YA 5EUOE 4PRHD 3ZKXC 4MD5A 5I71B 3MUNA 3C5JA 3FTGB 4OGAD 1S7UB 2R0LL 4DCQA 4X9BA 3C6YA 4KEAA 4WI7A 5DK2B 5IESL 3FZUC 5MEQA 3RZCD 3S8WA 2EEPA 3WL6A 1AY1H 2JGFA 1WISA 2HJFB 4AIZB 5F7KC 2PO6A 4WDQA 4BP9A 3QAZB 2QLVB 4YC2C 2HA2A 2ZJ6A 3I6GB 1P7QD 4Z7NF 4NC2B 3WO3B 5CJQH 4M1GL 4CMHC 1MCFA 3MREA 1X7QB 4JLRB 5EU6B 4LPXA 4OJFL 1C1EH 4W70A 1XT5A 3CVHB 5DFWH 4FNMA 1VGKA 3ARGC 5GS0D 1BQLH 3OSKA 5INCB 1NPUA 4KRMB 5D7BA 4TUKH 3IA2A 3QHFL 1K63A 5CH3A 3VI4E 4RMRA 3AC0A 5IJVB 4X9HA 1FYHB 1LDSA 5DK2A 3QDMD 5MEQB 3OX8A 3ICVA 3BYTA 2G5BA 1G9MH 2LE9A 1YEDB 4EKXA 1EINA 3T4UA 5CP7A 3Q3GB 4MMZC 5I1HH 5BO1H 4PJ7F 4LLWA 1N59B 1TJHH 3AFLA 3I2GA 3RVWD 4U0QB 1FG9C 1IGIH 4R4BA 3RVVC 1L7RA 1G9NH 3OMZA 5GRZA 4K6HA 5FYJE 5KVGL 3E8UL 5L2KB 4PJ7E 4X93A 1HYRC 5A6VA 1Y37A 4JKLA 3TNMA 4N5ED 3PWLB 2XUAA 4M6OH 2B39A 2P5WA 2GKIA 3UTPE 4HH9A 2O26U 4Y4KC 4PF1A 4Y5YA 2AERT 5C1MB 2AJSH 3QDJD 1FJ1A 4MYWB 4OCWH 3FQXB 1U91A 2VXTL 3DO7B 4R96B 1OXMA 3O95A 1OQXA 4QY8B 1VXOA 4YBHA 4UBMA 3DDUA 4ZOAA 5J3HD 1TETL 1BJ1J 3D1MC 5AP9A 4D8PB 4XAKD 3D0KA 1LHZA 4OZFH 4R97C 2OR9L 2AEIT 3F8UB 4OBSA 3BN3B 5D8JL 4UUJA 4DGIH 1R6VA 3STYA 4RFNC 3OV6A 3W11D 4RWYL 1UH4A 4MNQE 4YDKH 5D1XB 1B4JH 1HN1A 2Q20A 1BN7A 3U4EA 2OR7A 1U93B 2HJKA 5SWZA 4BVJA 2EZ0C 2YD1A 5KREA 1RJZA 4Y2DA 3SJVB 1UWXH 3GIVA 4LSUH 3WIHA 4LCCC 4MLIA 4OFKA 5EU5B 5E99H 5DUBA 4TSBH 5C0RL 3S6CA 3G9ZA 2NTFB 4ISVA 4PJGB 4U1JA 4Y2TA 3OKEB 1KPUA 4I0PB 5A1AA 4M7JH 5ALSA 1I6WA 3HA0A 5FUOH 3WLBA 4I77L 3GO1H 2XWTB 4UTAL 1SEQH 5AZ2H 3G9XA 1BEYL 1QRNB 5BRZB 1WHSA 3GBML 3BHBB 1SY6H 3S34H 1VPOL 1BGXL 1OSZA 2NW6A 1UK9A 3UYRH 4NQCD 3VH8B 1X6LA 1J1PH 5C8JA 4NC0B 4OM0H 4BAGA 4MWFB 4Q58C 4RFEA 2XTJB 2ZSIA 4PLKD 3MV9E 1PZ5B 3MV9D 4QXUL 1WT5C 1XZAA 2MCG1 3S7GA 4L4VA 1THTA 1NGXB 3OR6B 4Z95L 1UT6A 3NGBC 4FG6C 3LN4B 4U2FA 3E0GA 1EVTC 1I8IA 4PRPA 4I77H 3L5XH 1PG7L 4N8CL 1VCAA 4HJJL 2F54A 4HWZB 4KI5C 4YHYC 3CVIL 3LPFA 1YMHA 2PU5A 3TN0C 3VFNB 3B12A 4QTIH 1AHWB 1ZI6A 4CMMA 2Z5GA 5EGNA 5IB3A 1S78D 3QWRA 3MA9H 1UK6A 2A77H 2DHEA 5FUCE 3WFCL 3ANTA 2XTJC 4O2EB 1P4BH 2J5LC 3B6SB 4Q74A 4E9LA 3BRGC 1CN4A 3GMNA 5LGHH 3BE1H 4WFGD 3EYSL 4F7TB 1EAPA 3D2BA 5DLML 3VFMB 1MVUA 5I1EH 3AFIA 2HA7A 1SM3H 2QSQA 3PWPD 5DGQA 4WFFE 2IIVA 2SEBA 3HI4A 5ALUA 3PGCB 3HLAA 4BQ8A 4OKVB 4GRLD 4TQEL 1IE5A 5JOPE 4W68A 4YHKL 5D7SH 4CL7A 1CGXA 4I3SL 3C5SA 5DJZB 5HGGS 4ZFFB 3MJ7A 2Y4SA 2RAMA 5YASA 1YAHA 4QDUA 2VR5A 3OJDA 5IG7A 1G6RH 4Y19E 2EH8H 3OPZL 1QVOA 1A64A 2VR4A 5L6YL 5D2NC 4KGLA 1UGNA 4YPGB 1AX9A 3ETBF 3HC0A 2HP4A 1YEEH 4HEME 5GGTA 4WW2A 3MCG1 1FVDA 4PJ8A 2FB4L 2DYPA 4QRTB 3FN0H 3DX7A 6CGTA 5HHQA 4M6AA 5DYOB 3KWWA 4AIOA 1E8NA 4Z0XA 2XWTA 4DGIL 1P84J 4IJ3C 3V4PH 1KFAL 1PLGH 1R5VA 2IQAB 3UMJA 4F57H 3GSRB 2ZUQB 3QBTB 3MGTA 3HRZA 1MEXL 5J3HC 1SEBA 4K23L 4HKZB 1B0GA 4U1GB 5JHDE 1MIML 1DINA 1T0NB 2WWMC 1J05A 3F8SA 4HS6A 4OLUL 2GITA 3MYJB 1EJ6A 4NCC1 4LSSL 2DLIA 4Z7VE 1A8SA 4IOFD 1IQDB 5ALFA 1QLFA 2NYYD 5E2TH 1I85A 3T0VA 2GBCA 4PS4H 2XUQA 1ORSA 4GQPH 3UYPA 1P0QA 4MZ2A 1LPPA 1L6ZA 4G4JA 1RHHB 1FLRH 1ZD2P 1IAKB 2DL9A 1M7IB 5D6CA 1U2HA 1U91B 2BVUA 3C6ZA 1IEAA 2VDOL 3C8HA 3R3UA 5EHZA 3GSRA 4A16A 5L7XH 1R0AH 3V6OE 1R5VB 3PGFL 4HAFA 1FFNB 4JM4L 2CLRB 4HLZG 3MLTB 5J0BA 3GK8H 5AM3A 3JWNC 2VSDA 2XKNA 4NSKB 5E8OA 3UBXI 5L7XL 4XTRC 4DOHE 3CH1A 1OAZH 2H45A 3GMNB 1WCBA 1U93A 2HJKB 5SWZB 1EV2E 2UY7A 4TRPH 4TPRH 4APQA 3SDDA 1RZFL 3TGXA 4K5QA 5FYLL 1MAHA 1T03H 1X9QA 3IDIA 4BCCA 3UDWA 1EERB 2XKUA 5DMGC 5D2LE 5I19L 3C08L 2EDBA 3C6SB 3T52A 5FYJD 3ZKQD 1N0LA 4XHQA 4LCWD 4XNQB 3OJVC 3DO7A 5AICA 1HBJA 1C12B 4UOW1 3AZQA 1WEJH 2W65A 3QIWA 4HJGA 4Y5VC 1LPBB 2CBGA 3S4SB 3GSWA 1UM5H 3L3OA 2VLJB 5JHDA 4LHEA 4BKLB 2BOBA 1FRGL 1AIFA 3UBXB 4ZOEA 4CDHA 3REVA 5FDFA 2Y6SD 3BIXA 1T1WB 3FOMA 4G8EA 3LV3B 1TQBC 1N5AB 1W0WA 4V1DD 3MC0A 2QHRL 2GQHA 3ZSTA 3PNWB 1GGIH 5AO9A 2CO7B 2UYLB 3RDTD 1ZLUK 3D39A 1IVLA 4K8RL 5A2LH 4ZFOA 2HWZH 1J1OL 3ARYA 4MQ7A 3D2CA 1F58L 2OCKA 3I2CH 1CDIA 2DSNA 3DVIA 4MVBD 1R5IA 1ZD4A 1BAFH 1PVHA 1BQLL 1RVFL 3GJFH 2A1WL 4EN3C 4GDMA 4NZJA 4M4RA 2HU8A 1F90H 2VJDA 1JP5A 5CBEA 4Q3KA 4LU5H 2DL2A 1AE6L 3GHBL 3SPVA 2XKNB 3O0RL 4ZXBA 2X4RA 3IXTB 1BJ1H 1OQOA 4P2QA 5ISZE 2UVFA 5JOFB 3OPMA 1RURH 1F8TL 1MCLA 2FBJH 1J88A 2VZVA 3CGTA 5B8CB 4KVCH 3MRCA 1KELH 2BRRH 1MEXH 3VXSD 1A3QA 1CUWA 4RGOL 5J9PB 2YD6A 1P6AB 2VZUA 1PKOA 4FQCL 3IJYB 4KK8C 2D7NA 4LLMA 1AP2B 5EN2B 2BY1A 2C58A 5INDB 2ORBL 4OI8A 4Q05A 3ZDZF 4NKIL 2EE9A 4HKJA 3GMLA 3ZDYF 3SGJC 2BC4B 2XT0A 4LXIA 1JNNH 4X97A 3WKMH 2XRAL 1N3NB 4LLDB 2OJEA 4B84A 1OAXL 2JTDA 2I9LB 2DQJH 2X4TB 3WN5B 1KENH 2V7NB 3LQZB 4G9FA 3P0GB 5FGBA 2VLMD 5MEPA 4YHIB 4KROB 3HZKA 2B0SL 3BX7C 4L1DA 4PJEE 1FO0B 5KBNC 5LXGL 4JFZL 1PY4A 1BBJB 1ZVSB 2R23B 32C2B 4M7KL 4X6UA 1AI1L 4UV7H 4ODWB 4U3CA 3N2ZB 1QSED 3B5HA 4LYDA 3L3HB 3MRRB 3D59A 5HHME 2GY5A 4QGYA 1J1PL 1BRTA 2BNRD 3GI8L 2BNRE 4KXZI 4PGZA 1U8OB 1DJSA 5IVXF 3EOBA 2OZ4A 4UHEA 2NY6D 2BY2A 2XFXB 4I0PD 2W60B 1DQTA 3KXFE 5ALMA 2XG5A 1MCEA 1OCEA 2WU3A 4UU9B 4LSVL 1WBXB 2YZ8A 1ZLSH 3ULVF 5SWSA 2HTKC 1SEQL 4XVTL 5T5FH 2OLDA 5K9JL 4Y19A 3MOAL 2IAMC 5ENWA 2H1IA 2QVBA 2IH3A 4JFFB 1LP9B 3DI2B 1OAQL 3F7VA 2ZJFA 5E95B 1NUNB 3HE7D 3QUMB 4R0LC 4M1CD 5A16A 3O6FB 1J10A 4M0EA 5ACZB 3E0XA 3MLUH 4B83A 4I2XA 1F3JA 3KPMB 4GBXB 1YEDA 1MFBH 5AI8A 4BTVA 3O3BB 4KPHH 5C0CB 3U7YH 5AOAA 3VISA 1CEXA 1OAUH 2RIKA 4NJAH 2E3JA 5I30L 5T1LA 4GG6B 3E1GA 3LQAC 3U0PA 2R69L 1EXUA 1ZHLA 5C0DB 1W52X 4LLVB 4ODUB 3SOBH 1JZ6A 1IM9B 3JWOL 4AQ1B 5TGBA 4BRZA 4YDVA 5F6HJ 1MCBA 3FAWA 4QDTA 4KI5E 3QEQA 3DIFB 4MA1C 4G8GD 5BRZE 2VLRB 1NFDE 2J6EH 4PBVC 4E41E 1THGA 2G5PA 3G6JB 1AO7B 4PV7A 4LQ1A 4X4YA 1DBJH 4JHBA 2CLZA 4K3HA 5D4QA 4BZZA 5E8EB 3TJEH 2NX5A 4QCIB 4J1UB 4DTGL 4JB9L 5IR1A 3I1IA 4JYPA 4WI3A 1QP1A 4LOUD 4BDTA 4OGXL 2Z31C 3CPLB 4ONOA 1CD0A 3GROA 1N0XH 1YNLL 4PG9A 5BJTA 2R69H 1PV1A 1U2EA 1RJYA 1GC1H 1T2XA 1EHXA 2CUHA 3O3EA 4KUZL 4ZREA 3N0TA 5ALXA 5DJDB 4JZOA 1CUCA 3QWQB 4FQXD 1GH7A 1GGUA 3NN8B 2VTFA 3MODH 1GGIL 4HK3N 4KFZC 5KVDL 3LEVL 1Q72L 2AEPH 2N7AA 4HK0A 4XCYA 1FZMA 3KWJA 2XWJA 3QUZA 3HS0A 3LMJH 3O3AA 2GY7B 4UTBL 1DL7H 3CU7A 5E4EC 5FM5M 3RHWF 4N90D 5D5MA 2NW2B 3QNZB 4PV8B 5JLZB 3L95B 2PXYC 3HMXA 1I8MB 4OLXH 2DKUA 3KSRA 1QFPA 2DM4A 2Z4QB 5JXAH 3FVTA 3QDHA 4WWKA 5T1KB 4HGMA 3T65A 3NOIA 4OD2B 1T0MB 4OD3H 3KPRD 2O7RA 1NCTA 3F62A 4XP5H 2NXYB 2DMCA 2BSSB 4YWGH 4JFHD 1CZ8L 4YQXL 1JBJA 5EC2B 5M95B 2Y7QA 5F7UA 4G7VH 3BKYL 2I3DA 1A7OH 4AMKL 5L2KE 2ED8A 4GG8A 4C4XA 5KN5B 4Z7WB 2XWJB 4YHOH 4PREB 2CMRH 2X76A 2Y9RT 3UTTD 3KYOB 3K6KA 1FN4A 1T2QH 3RUGF 5ALTA 4Z78A 1ZT7B 4OYLA 2D2OA 5AKJA 2ZSWA 4ZAKC 4M5YH 3MBEC 4XT1C 4MQLA 2HLAA 4UAOB 1EO5A 3FMGH 4XCFL 3DOHA 4PLNC 5KJRH 1HZHH 3Q1SH 4HUKB 4LLDA 4D2NA 1FFDA 5HHVH 3VFRA 4UHHA 5AZEH 3L3KA 3QUML 3RK4A 5BJTB 1BQSA 1JPGA 3CDCA 5BW7C 5LVEA 1N5RA 1EB9A 3L6FA 1KJVB 2LU7A 4JG0H 5JPMA 3P11H 2AV7A 2VXVL 3LEXA 5KJRL 3KPNA 5ISZB 4FXKA 5AJHA 1KB9K 3P77A 4R26H 3RIAK 2KBGA 2ADFH 4PJCF 2DMBA 4NN7B 2DDQL 3ARDC 4J7RA 3KWFA 4ZWNA 2HM7A 2MOVA 1MHPH 1DEEB 4ZD3H 5MEND 4M1DL 4XC3L 3I50H 1T3FB 2K1MA 4N1EA 1MOEA 5F97E 2HFKA 5I19H 1I1YA 3BXNA 1UT9A 3X3GL 5HYQA 2I9TB 4F0JA 5H8DA 3M8OL 2B61A 4QRRA 5JIPA 2DJ4A 4LFHD 5KBYA 4X4YB 4NMWA 2MFNA 3QITA 5EOCH 4IRJA 4HUVB 4HPOH 4J4PA 2FECI 4JFQB 4ELKB 4PY8I 7CGTA 1KEMH 3VFWB 3H1BA 4E42A 1FH5L 3BPNC 2J6EA 5BV7C 3DUHA 3G6DH 3HPJA 5SWQA 3KPSE 2KUTA 3MMEB 4BH8A 2QSTA 1YMMB 2BSRB 5DHYB 4EN3D 5ALHA 3GKWL 3EOTL 2EDRA 2WINA 1UB6B 3TNNB 5ALPA 2QQKH 4HIHA 4DFIA 1F45A 4QTIL 4BH7B 1U3HA 5L0QB 5LGJB 1MRFH 4NQDE 2GTZB 3FFCE 5DVNA 3KJ4C 1BCSA 1GGCL 4B7IA 1FYTE 5CGYD 5JQ6L 2YC1B 3QI9C 1XRRA 4FDMA 1B90A 2CUMA 3DMMA 3I6LE 4L3AA 4EI5D 1FPTL 4MQTB 1TQCB 2R0WL 5GRUH 4NZTL 2V97A 3GSXA 4H25B 3QPXH 2WFMA 1EVEA 2NY0C 4LHJB 1ES0A 5FUZH 3ES6B 2MKWA 4EUPH 5C0BD 2RIPA 3MV9B 3IXAB 5CSZB 4AZ8A 5MERA 3INUH 3TO4C 2ZCHL 4OCZA 2R4RL 3D5EA 3HZKB 2QUBA 5AI0A 3TWCH 4XIIA 2DBLH 3L95A 1IT9H 4LF3B 1SY6A 1FNSL 4X6CB 3SE8L 1N6QH 5I1KH 4ZNCD 2Z8XA 5BOZG 4GS7B 4OZFA 1UCBL 3VXQA 5FO9B 3CXUA 1DUZA 3KPRE 4LLUB 1WZLA 4DWHA 4MJ2A 3QH3A 3RLIA 1CE6B 4NO2A 1NFDA 1MFAH 4OCRL 5K9KB 3G08A 5E5MB 1MCRA 3QZWG 5IW6B 1KXTB 1L9NA 2XA3A 4RZCB 1BQHG 4EQ2A 2XUJA 3M45A 3MRGA 1EDEA 4L3CB 2R9HC 3DGGB 4PS4L 4K8RC 1X5KA 4OCXH 3S35X 1FORL 1WZ1H 1TCRA 1XF3A 2OAGA 3PWPB 4XBGB 3KPSD 5I8PA 2X70A 4POYA 5GGUB 2DN7A 4JY4A 1DUYA 2GEEA 4F2MA 2A6DB 1DCLA 2DQFA 5A7FA 2QM0A 4PJ7B 4ZS6D 5B3JF 1A6AB 4HWBA 2BKLA 5EHXA 2AXEA 3CVHH 3ZHKA 1X5XA 1I9RL 5C6TH 1K6QH 3PDOB 4EJ1C 1JRHH 4M8VA 1YNTB 4KHXH 3V0VA 2JIXA 3L3GA 1KF9B 1QBLL 1G7IB 3BESR 4OI9A 4G8DA 5IVKA 4EUPB 1PX3A 3GO1L 4UTAH 1H2ZA 1IAIL 4UT7H 3RZWA 5GS0L 2GUOA 4KQ3H 5F7MC 5K59E 4KRPC 4FABH 1A6ZA 3TBYA 2AJZA 3SEPA 5BV7L 1CFVH 1RUPL 2VSCA 2R2BB 4XX1G 3C9NA 1C08B 3PGDB 1QVOB 2VIRB 5CUSL 5EUKB 3I75B 4HGWA 1IL1A 3NIDF 4XGZB 3U46A 4CN6A 2VAXA 4MCYB 4GG6F 3SGKA 3O4LB 2C7BA 2PSFA 5FF6B 3G0CA 4Y2RA 1YA4A 2F5AH 3NIGE 2PF6A 3T8XA 1UENA 1N5AA 5CT6A 2EEBA 4Z0BH 3T4AB 3ARGB 3U79A 3FOBA 4YFLI 2AQ3A 5JXEC 3PGCA 1MJJB 2XN9E 4G9DB 4MDIB 1IARB 3HZVA 4C6HA 2Y1KA 3EBAA 4YHNA 5K3CA 2D5LA 3W5MA 3CDYA 2ZCLL 5EZOH 3BWAA 3BIKB 4OCYH 5FCUH 1YASA 3PGDA 4C4KT 4UFNA 5L88H 3U2SB 4YK4B 3UJJL 2BNQE 2PKDA 2VZ1A 2AK4E 2ATKA 5I17B 1QYGH 1JRHI 2NY4C 1YEHH 3G6AB 4XPGH 4HXAH 4MJIE 1TCBA 3VFPA 2A9ML 3AS1A 4X92A 1TJIL 1JGDB 2F5AL 3H9HA 5H37H 3DD5A 2A1WH 4N9GA 3KPLB 4BRSA 1S7SB 5HY9B 5IFHL 2P8PA 1IM9D 1MFEL 3BZDA 4RFOL 2FH6A 4OUUA 4KE6A 3EO1A 5C0GA 4X7BA 4J23A 2J4WH 4U1KA 3V6OA 1OT2A 1PFQA 5CHNA 4H7FA 3OGOE 4JFDB 4MQXD 4ZGBA 5D70L 3HNVL 4ZTOL 2D7PA 4ZS7H 5GGUA 1HI6A 5TE4L 5DJAA 4YWGL 2IANB 1X5ZA 2ZJ7A 2CGRL 3JTTA 4G6MH 3TZVC 4IS6A 4R97B 3KXPA 3F7QA 2FSEA 5JD4A 3WO4B 3FRUB 3IIIA 1YY9D 2R0WH 3D7RA 5E94B 1U8JB 2W6CX 3SJVE 4F33B 1VA5A 4EIGB 3BPLB 4GAJL 5IMLA 5IGXL 4NHUB 3ARDD 2VZOA 1IKFH 2IFGA 3WL9B 4HJ0D 4XZUA 4LSVH 5IBTL 5K3AA 5JHLL 1OAYL 4HMCA 2C3HA 4YPVA 1RUKL 3QP3A 3WXWL 1AXSA 4MSWA 2FO1A 2V96A 2R0ZH 4JFDA 5T3ZE 4OIAA 4Y9SA 4IEFB 2Q86B 3T0EC 3MXVH 3V0WH 4GFTB 5EC1A 3CFJA 2XIDA 4ZFOL 3ZT5A 2RFXB 4JFOB 4X7CC 1IKNA 3O6ML 1OTTD 2Y5TA 2ILLA 4WTXA 3QZWB 3I6MA 1ZOIA 2XRAH 4QWMA 4RA0C 2NY7L 5CT4A 4GMTL 2HIHA 2HG5A 4MJIA 3GUUA 3NOXA 1S7TA 1B0RA 3D87B 1NKRA 3G6AA 4U6XA 3M81A 2PR4H 4KY1L 1RP1A 2ZWLT 5DMJB 1EHAA 3MRDA 4CRPA 4W4OC 4WI4A 1ADQA 1EUTA 3FBWA 2ITDB 3L7EA 1IGCH 4MYDA 1XH3B 4PJ5B 4M1GH 5KG9A 4P4KA 2GHWB 1JYWA 2YHGA 1IUPA 1VPOH 3WFHB 1WVZA 3U46B 2ONCA 1BM3L 4LASL 5ALWA 1X5LA 2XUOA 4NN6C 5KG9B 3VGEA 3PWVB 4N1HB 5FO7A 3L5WA 3GDBA 4R4FL 5IF0B 2JK5A 4HKBA 5CW2A 4R4BB 1YY8B 5J6HA 1KT2A 5ITBL 1X5YA 4N9GB 4MJIB 3C6SA 2B2XL 4EI6A 1T1XB 3MRLB 3V0VB 1ORQB 5J89A 3IDIB 1BLNB 5E08H 3P2MA 4YX2H 3LN4A 1CGTA 2WW8A 2OSLA 4JFFE 1JHKL 5HDBF 3MXVL 4HUWA 2X41A 4LEXH 43CAB 2H3NB 1L0YA 1NCNA 4AIXA 4QTHA 1SJVA 3VFNA 5CJQL 3BIWA 2WP3O 1DQDL 4EY5A 4MNQA 1YEFL 1ZEAL 1GJIA 3I2HA 1KIPB 2HJLA 4XTRD 1R5WA 2YK1L 3J7HA 4YGVB 5SWZE 2H8PB 1XLVA 1XGPA 4ORGA 1A0QL 5T4BA 2HLFD 1A6AA 3RWDA 4G6KL 4ZUWA 3ED1A 3INUL 1T5XA 2XNAB 1OP3H 2GZRA 2NY4B 4L4JA 1FZJA 4X4ZA 1HHHA 5IWLA 4XXDB 2AAVA 4AEHL 4XVUD 4JRWA 1CUZA 1QFHA 4JKKA 2HA4A 3UCRA 4XPAL 3HG1B 4WWKC 4HMDA 1A14H 4GRMA 5SYMA 1JGEB 4GUPB 2EEDA 3GSQA 1ETZA 4JN2A 3TJHD 3TBYB 4ZD3L 2XMZA 3STTA 4KKBD 2B20A 4Z9KB 1OGAD 5GGQL 1EO8H 5JNYB 1S8DB 4PJFA 5JW5A 1CF8L 1Q9LA 5GZOD 2ZOKA 3G5YA 4UQ2B 2V9RA 3WHE0 4P5TD 5HCUA 3GBSA 4ISVB 4PJGA 4U1JB 1EJOH 1I8KA 4C56E 4YIQB 4QDXA 1P4LB 1FL6A 1EEQA 3DVFA 2AJYH 3LRSA 4ZG1A 3G9AB 4G8FB 2BVTA 4NRXB 2NXYC 4QOKE 4W6WB 3C6LB 5BMFH 5HHVL 1S3KL 3CFCH 5ADOL 5MHSE 1XMWA 3U36B 3H0TB 4P5TC 1KTDB 3OGCA 2QXTA 3W82A 3T2NH 3STXA 3U7AA 3HAEG 1AQDB 1RK0B 4LARL 3FYUA 3RWGB 3SDYL 2NY2D 4IH9A 3D5OF 3K4AA 3MLZH 3Q48A 1DBJL 4DKAA 1JRHL 1T4KA 1U6AL 3EDKA 4Z7UB 1U3HB 2AKRB 5L2KA 1BEZA 4NZDA 4OLUH 4PJIF 1IC1A 3ZYZA 3F6IA 4X7FC 3P9LA 2NTSP 5H35A 4RGYA 4E41A 2PYED 3IS1X 2CXKA 4EY4A 5D7JB 25C8H 1EBAA 3QDAA 1BJ8A 3KXFA 3UC0L 1D07A 3QG6A 5DDHB 1QO7A 1RFDL 5CUSH 3CZFA 3RU8H 3W9EB 2VDLH 1QBAA 4AJ0A 1ORWA 4D3CH 1UXOA 4HPYL 2Q6WA 3T0ED 2YASA 4PJHE 4QRPE 3DUUB 2WINB 3CJJA 3H2IA 3SDAA 2ZCKH 5DRNB 3F5WA 3U9UA 4HIIA 4GKNB 5GIRB 2E9WA 3HZYB 4ZYKB 1QBLH 3RBSA 4IRSC 4FFZL 4X6FA 4OI7A 1FFEA 3RFZC 1J12A 5HGBA 3SDXA 5H3HA 4OF8A 1RIVH 5BWCA 4GH7B 2VERN 4M5ZL 1JWSA 2YPVH 3MQIA 3R1GL 1D7FA 4OCYL 3P9MA 4LLYA 2X4OA 4WV1B 1VHPA 3CX5K 4X0KB 1S5IL 2DR0A 2X8BA 2IAND 2PBLA 2W91A 2VXQL 2H32H 4U7MA 4KKCD 3ARSA 5DRNA 3WK7A 5IB2B 1F11B 3WKBA 5DTJA 3P4MA 3CAFA 2Z8WC 3LN5B 3MRHA 3R0NA 4P49A 1BIIB 2ZUWA 3TVMD 3ULUE 3MO1B 4JQVC 5EBWB 3GSNB 5LGHL 2G4LA 4X8JA 1IZKA 1S7XB 1QFWH 3CFDB 1MO2A 3AROA 3HTLX 1RZFH 2J4WL 3D2UA 4TVPD 4YHMH 2DCMA 4JUIA 2EDHA 5LLSA 2X10A 2NX5E 1Q0YL 4K7PH 2Y06L 1WIOA 5DURD 5E2IA 1INEL 2B1HL 3QUMA 4JFEB 3TYFB 5D7KD 3TO2A 1VA4A 3KLDA 4H0GA 1CUAA 4S2SA 4GBGA 1LE5B 3WUWB 4BCDA 2Z0BA 2XZZA 4NKOA 1K8DA 4XVSH 1FFOB 1YC8A 3C5ZB 1NCAL 2P8LA 1YEHL 3RTQC 1VA9A 3RWGA 3JV6B 1AQDA 1RK0A 3ARFD 5CEZD 1HQDA 3QDGB 2E7CA 1S9WA 5EI5A 1A9BA 3UTQB 3AILA 4F80A 3IUQA 5C8ZA 4OZHB 1XR9A 2R39A 4YHZL 1AGBB 1MI5B 1JZ5A 2P45B 4XNMA 4Y2SA 1ZD5A 1BFVH 1BP3B 3PF9A 4RQQA 5EWIH 5JXED 3H2HA 4F7MA 5DJ0A 4KJQC 1ZT1B 2ZUUA 1H3PH 5BWBA 2XN9D 4CVZA 3AZOA 3IUNA 3T0BA 2HAZA 4F60A 3BJRA 5GGRB 3SBWC 4K8RD 5JANA 5DK3A 1RZJH 3QYJA 4N8DA 4NQUA 5CEXA 5GGSB 1N7ML 4B41A 1RZIB 3MUZ1 5DRZA 4ELME 3WNLA 1BPVA 4K2UH 4J0CA 2J6EL 3A0OA 1PJAA 3ZV7A 4C89A 2HYMA 5CEXB 1QG3A 5JIKA 4KZEH 5JQHC 1L7TL 5F7NC 3O3AB 4XWOC 3GSVB 3ZHLA 4XI5D 4S1RH 4HZAA 4ELMF 4OLWH 4Y4HA 4BQ6A 3LEYH </