2B25A

Human putative trna(1-methyladenosine)methyltransferase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
324
structure length
254
Chain Sequence
RPFQAGELILAETTKFKKLFRLNNFGLLNVPFGKIVGKFPGQILRSSFGKQYMLRRPALEDYVVLMKRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATFDAVALDMLNPHVTLPVFYPHLKHGGVCAVYVVNITQVIELLDGIRTCELALSCEKISEVIVRDWLVCLVARPVHWQPGHTAFLVKLRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human putative tRNA(1-methyladenosine)methyltransferase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords hypothetical protein
total genus 71
structure length 254
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2b25A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2b25A02
4ER6A 1KYWA 1TW2A 2JHPA 3TRKA 1M6YA 4C04A 4RTSA 9MHTA 2ZTHA 4XUEA 3VSEA 5K0JA 3LKZA 1P91A 4GC9A 4DZRA 5DRYA 2AR0A 3A7EA 3ER9A 1DCTA 5K0LA 3WSTA 3DMHA 3LKDA 1UFKA 2PXXA 3I53A 4K6MA 3LECA 4WVLA 5CVEA 5DWQA 1YFJA 2P7HA 2PKWA 3LX6A 3PS9A 4P58A 5EOVA 5GIPE 1BOOA 2IFTA 4GOLD 2XBMA 3UJBA 5GM2A 1RJEA 1TPYA 4IV0A 1F38A 3HVJA 4KW7A 4EQZA 5FUBA 4CKEA 3A4TA 4X63A 3EGVA 3BT7A 2P7IA 4BP3A 3HP7A 4Z2YA 4PYJA 2O57A 2ADMA 4OX9Y 5KYGA 7MHTA 4EMSA 2V74B 3M70A 3NMUF 1WXXA 4RWZA 3HCCA 5K01A 3TLJA 3FTEA 2IBSA 4V0QA 1NW8A 4M7RA 1UIRA 3PB3A 4HTFB 3OPNA 5C1IA 2YXDA 3AXTA 3FRIA 4GOMD 3JWJA 4F84A 4ATNA 3KR1A 2CL5A 4E2YA 5HFJA 3EVCA 3JWGA 3A25A 5DX8A 3GIWA 2B9EA 3SGLA 3DUWA 4POOA 5EHIA 3EEYA 3ELYA 5EKUA 2JH9A 3OE5A 2Y1XA 3HA5A 1B42A 2CKDA 4FSDA 3GRRA 1JSXA 4PWYA 2IP2A 4E70A 5ICCA 1AQJA 3PFGA 2ERCA 1FPQA 2YUIA 4GQBA 2I9KA 2BM9A 2CWWA 3G2QA 1L3CA 3BUSA 4RVGA 3BWYA 2AOUA 2PV0A 3C6KA 1XCLA 5CUQA 2OB2A 1P1BA 1QYRA 4YUWA 3GDHA 2XYVA 3EGEA 2OYRA 2GAFA 4RTKA 4P7KA 5DT2A 2HMYB 4RVHA 1RI5A 3I9FA 5F2OA 3CJRA 5GP1A 1P1CA 3QV2A 5DM2A 3V8VA 2C7OA 4E2WA 1JG2A 3EGIA 2DPMA 2XVAA 5K0NA 1M6EX 10MHA 2AN3A 5EGSA 2R3SA 1NE2A 1O9HA 3MB5A 1KPIA 2OY0A 2R6ZA 5BW4A 4PYOA 5EPEA 5LSAA 2PSSA 2ZWAA 3KQOA 3OE4A 2ZBPA 4C07A 3FUUA 1QAMA 3DR5A 3C6MA 1FP2A 2PY6A 4E2XA 5EEGA 5E2BA 3G88A 3EMDA 4U7PB 4AX8A 4QTTB 1D2HA 4FP9A 3GGDA 3FUVA 4ZTBA 3GXOA 3R24A 1ZKDA 1NW5A 5F2NA 3T0IA 4EKIA 3LGAA 2PJDA 1KHHA 2VDWA 1NKVA 4XCXA 1JQEA 1XDSA 5EIFA 1QANA 2PWYA 4OA8A 4HSGA 5P8WA 4KWCA 1PRYA 5CM2Z 2LD4A 3RIEA 4HC4A 3TFWA 2OO3A 2WA2A 3VC1A 1JG3A 2G72A 5EG5A 2NXEA 2HR1A 3KPUA 2I6GA 3BXOA 5E2AA 4RTMA 3F4KA 1I9GA 1ORIA 3KQSA 4PIMA 3LCCA 3BGIA 1R00A 5CCBA 1SKMA 2Z6QA 2PGXA 2PX2A 2ZVJA 4IWNA 2ZFUA 5DRTA 3GRZA 3REOA 2P3LA 3KR0A 3R3HA 5CCXA 1V39A 2UYQA 2ESRA 3S68A 2G70A 3NWEA 3SMQA 2QYOA 3O31A 3NWBA 5FWDA 4OQDA 5BP7A 5K0EA 3R6TA 4PIPA 4BP1A 3BGVA 3UJ7A 1BC5A 2FPOA 3CC8A 1SQFA 2IIPA 2OB1A 3CKKA 5FQNA 2BZGA 5E1DA 1DL5A 4RTJA 3OZSA 3B89A 5LR6A 1VL5A 1ZGJA 3NDJA 4QQKA 4Y30A 3VYWA 4AZSA 2WK1A 1X1BA 3IV6A 4PINA 1NW6A 1SUSA 5GM1A 2OZVA 4QPPA 3MERA 5EEHA 1IY9A 4GBED 1FJXA 3OCJA 2B25A 3P9KA 1T43A 2ZSUA 3KQQA 5LQCA 4DF3A 5HEKA 5HIJA 2YQZA 4RTQA 3FRHA 5C9ZA 4YUYA 3UA3A 1ZQ9A 3OU6A 5EMJA 4PYMA 3M6WA 3EMBA 3SSNA 1JR4A 3I64A 2IDKA 4NECA 3P2EA 3EVFA 3FPEA 5EQJB 5T6BA 2PT6A 2B3TA 4YUXA 2C7PA 1FP1D 4ER5A 3I58A 3O4FA 1ZGAA 3DOUA 5DTRA 5EIWA 4C08A 2C7RA 4X1OA 1JTEA 1KR5A 3ELWA 3THRA 3DMGA 3FUWA 3LBFA 2OPBA 4PYQA 2GH1A 2XVMA 3RW9A 2HV9A 4YUZA 4KRGA 1JSZA 3LCUA 1EIZA 2JHAA 1XXLA 2H00A 4M38A 2P1DA 3E05A 4PYIA 4DCGA 2GA9A 1NV8A 4HRAA 5K0BA 1MHTA 2IH4A 3I5UA 3ANXA 1VPTA 3KQPA 2YVLA 3PT9A 3TQSA 4CTKA 1BHJA 3M33A 3P2KA 5DTQA 4GUAA 4H0NA 5EMKA 3G5TA 5K0CA 5LQKA 1YB2A 3HVHA 5M5BA 4MHTA 3HCAA 1X1DA 5D1HA 3FTDA 4RTOA 2QRVB 5DXAA 1YFLA 1H1DA 2ZWVA 2C7QA 3GRYA 3PX2A 3UFBA 5CVVA 1FBNA 1RJFA 3GRVA 5E8JA 5JUWA 1L3BA 2ZIGA 3LBYA 3JWIA 4GOND 4FR0A 4HH4A 4U7TB 2VZ9A 1O9GA 2ZCJA 4P7GA 3JWHA 3TM5A 4E32A 2GS9A 5K03A 4GOOD 2ONYA 2QRVA 4DCMA 1G8SA 2AN4A 3M6UA 2GPYA 4Y2HA 3Q87B 3BGDA 3GNLA 2FK8A 4KDRA 3FTFA 3B3FA 3ERCA 3T7RA 2N47A 5E8RA 5FADA 5K09A 1R6AA 3ELDA 1SVUA 1D2GA 2PVCA 1WZNA 2NXNA 4QQNA 2PBFA 3HEMA 4FSXA 3TKYA 4R8RA 1JQDA 2PXAA 3DP7A 5KQSA 1DUSA 2G71A 3ELUA 4RVFA 2B2CA 2HWKA 1XDZA 3PX3A 4C05A 4DM3A 3ORHA 5BXYA 2CMGA 1IXKA 4KVZA 1I4WA 5CVDA 5FTWA 2JG3A 1SG9A 5LQNA 1TW3A 4FT4A 3GU3A 1WY7A 4P7JA 4OQEA 3KKZA 1YF3A 4X60A 3IYLW 2YXEA 5B1SA 3AJDA 2IH5A 1RI3A 3GO4A 4RYLA 1NBHA 3HCFA 2ZIFA 2Y1WA 5DM1A 4E30A 4RTNA 1WG8A 4OBWA 2BH2A 3FPHA 2IBTA 3B7PA 2YXLA 3FTCA 1N7IA 1PJZA 2B78A 2FYTA 4WXHA 1G60A 2Z6UA 5EHGA 3NVKI 5ERGB 2JHCA 3FPFA 4YMHA 2ZZNA 3NTVA 1NW7A 2XYRA 3LHDA 4XUCA 3PLAE 3BWBA 3HCDA 4LWPA 3T7SA 3UWPA 4ER0A 4FGZA 1I1NA 3IHTA 3M6XA 3SSOA 2ZZMA 1R8XA 2QY6A 4DMGA 4PGGA 4PCAA 1HNNA 3BWMA 1VE3A 2FHPA 2I62A 4B17A 4AZTA 4PCLA 1YZHA 2Z6AA 2AOWA 3HA3A 1G8AA 3G8BA 5CVUA 1EJ0A 5DX0A 1XJ5A 4RV9A 2HNKA 1VP3A 3B3JA 3C0KA 3Q7EA 2YR0A 3P2IA 4KDCA 4PYNA 4QDKA 4V0RA 1NT2A 2H1RA 1R8YA 5DM4A 3UJ6A 3IEIA 3UJ8A 2O0LA 2QM3A 3KPJA 3OFJA 4F85A 4E33A 3DTNA 5DXJA 2VP3A 3C3YA 3TPZA 2IPXA 3LPMA 1KIAA 5E1BA 1G55A 3E8SA 3FPJA 3E7PA 3EVEA 2V7EA 1Z3CA 2JH8A 3OZTA 5K0FA 2K4MA 1RJDA 1L1EA 3HTXA 1F3LA 2P3OA 1XDUA 4RVDA 3MHTA 4QTUB 4R6XA 5ICGA 3A26A 4DQ0A 5EKXA 1SQGA 3TKAA 4PNEA 1O54A 1INLA 1YZ3A 3FYDA 2OKCA 5DSTA 4EVIA 1EQAA 3LDFA 3M6VA 5FULA 3QOXA 3HCBA 3KR9A 4FZVA 3UJCA 3UJDA 3HM2A 3OFKA 3GWZA 2UZ4A 2HTEA 2WA1A 1X1AA 2PX5A 3RODA 1JQ3A 4BY9E 2AZTA 5DX1A 4R6WA 1VP9A 2FRXA 4CKBA 3AXSA 4PYKA 3FUTA 3E23A 1N7JA 5DM0A 2O06A 1QAOA 3OU7A 4A6EA 4MIKA 4MWZA 4BLWA 4YV2A 5CD1A 1Y8CA 1G6Q1 1X1CA 4R8SA 3BWCA 2ZLBA 4PGHA 4LWOA 3U81A 2CMHA 4R05A 2BM8A 2Q41A 3KQWA 5DLYA 3UBTA 3B5IA 5E1OA 2YX1A 3HNRA 5HIMA 1RI4A 2NNWB 1RJGA 2XYQA 4GF5A 3EEOA 2PXCA 2F8LA 3EVZA 4X61A 3K0BA 2IDJA 3EVDA 3MTIA 4FS8A 5FA5A 4ER7A 5U4XA 5HILA 3DXYA 3NJRA 2NYUA 3NDIA 4RTLA 3GCZA 3D2LA 1NV9A 4YV0A 3UA4A 2PX8A 3G5LA 5D1NA 3P9CA 1HMYA 3SR4A 1RI1A 5EMLA 3P8ZA 4UOEA 3KHKA 2IH2A 1KP9A 4RSRA 5EZQA 1QZZA 4GEKA 3TMAA 4RX1A 5ICFA 3CJTA 3TOSA 2AN5A 1RI2A 5ICEA 3MQ2A 2P8JA 4PONA 2ZIEA 4JXJA 4QPNA 3DH0A 8MHTA 1UWVA 5GWXA 5T64A 3BZBA 3SXJA 4C03A 4MTLA 3PFHA 2P3QA 1AQIA 2AOTA 2E5WA 2FCAA 2UYOA 3HVIA 4MQ4A 1U2ZA 5E9WA 2BR4A 5HIKA 2EFJA 2DULA 1N2XA 3LDGA 3TM4A 1KPGA 5EVJA 4G56A 5HIIA 4CKCA 3DULA 4RTPA 3V97A 4QVGA 5BW5A 4IKPA 2AOTB 2A14A 3M4XA 1KXZA 4HG2A 1AF7A 1R74A 2BR3A 2ONZA 4A6DA 2IGTA 3CGGA 5FA8A 1QAQA 3G7UA 5DPMA 4CXMA 2NP6A 3P71T 3MGGA 2KW5A 4YMGA 3BKWA 3A27A 3T7TA 1L3IA 1SUIA 1WXWA 2GLUA 5FHRA 4E31A 1G38A 2EJTA 5FWAA 1JTFA 3SVZA 4AZVA 4QDJA 3DLIA 4GC5A 2G1PA 2VDVE 1D2CA 3KR2A 2YTZA 2P40A 3C3PA 2PLWA 2P35A 5C0OE 1AV6A 4RTRA 4YV1A 3FPGA 3SX0A 2PWPA 1JG1A 3THSA 3EVBA 3KQYA 3LL7A 4FT2A 1WS6A 5E9JA 2UYCA 3ER8A 4X41A 3GRUA 5LQRA 2VS1A 2EJUA 3HA7A 2ZZKA 3KQVA 5KVAA 2NP7A 3HVKA 5DTMA 3G2OA 5FQOA 2I7CA 3R0QA 5EZSA 3ME5A 3AWIA 3K6RA 1M0EA 3HCEA 5IKMA 5F2KA 3MCZA 1P39A 3KQTA 4EK9A 3OZRA 1EG2A 3DXZA 3G8AA 3L8DA 5FHQA 4BLVA 1EJ6A 5LQUA 2AVNA 4M36A 1Q0SA 3P9NA 1L9KA 2ZBRA 2PX4A 3CJQA 2AOVA 4L7VA 3NW9A 1XCJA 4LECA 5DSXA 5E1MA 4M37A 1KYZA 3G2MA 4OBXA 3FUXA 3FYCA 2FK7A 3A7DA 3B3GA 3AY0A 4P7FA 4CTJA 2ORED 4KIFA 3G2PA 2P41A 2AS0A 5KQRA 5IH3A 1VIDA 3KQMA 3G89A 4XUDA 3LDUA 5FCDA 3P97A 4C4AA 3DLCA 3EVAA 5EMMA 3SM3A 4OA5A 4CWAA 4YUVA 5K0GA 5LQJA 3ID6C 3MAGA 3SSMA 5T67A 3KPYA 1ZG3A 1ZHFA 4O29A 3UZUA 3MCTA 5LQAA 4BLUA 4IV8A 3CCFA 1R18A 3DMFA 4ISCA 2AOUB 5HZMA 1NBIA 3PTAA 5G02A 3O7WA 4AUKA 5CIYA 5GINE 3CVOA 2O05A 5EC8A 4ER3A 1XTPA 3FZGA 3GJYA 2GB4A 5GOZA 1VQ1A 1IM8A 3KU1A 3MTEA 4AZWA 2BR5A 5GIOE 3R9XB 5JR3A 3NVMB 3DXXA 1XVAA 1MJFA 5E9QA 2ZULA 3BKXA 1VLMA 3EPPA 3TR6A 3X0DA 1X19A 5HOQA 3KPVA 2UYHA 5KS2A 1BKYA 2OXTA 1NW3A 1Q0TA 2PT9A 2QE6A 3QOWA 3KPWA 3PVCA 5CVJA 3VC2A 4LG1A 4EKGA 4F86A 2H11A 1ORHA 1VBFA 3EVGA 3UJAA 1EAMA 2AVDA 2EG5A 1OR8A 4HGZA 4HTFA 3H2BA 4E2ZA 1KPHA 2AOXA 3LCVB 4QVKA 5K8VA 3LSTA 4PYLA 2NXJA 3P9IA 4HGYA 4KIGA 1JG4A 2JJQA 2OBFA 2ZBQA 3OU2A 5K05A 4DKJA 2VDUE 1YUBA 2O07A 5H02A 2EX4A 2ZW9A 2G8NA 3CBGA 2NXCA 3UJ9A 4C06A 4DA4A 5MHTA
chains in the Genus database with same CATH superfamily
1KYWA 2Q9CA 2WPNA 1M6YA 2X6RA 3WK7A 2PNFA 4EA8A 1JG6A 3AM4A 1WULS 3R7FA 1FZQA 2ZTHA 3C70A 2QAGA 3A9CA 3ADBA 2AZDA 3ZG6A 3G9QA 4FCVA 1SUFA 3I53A 1ZK1A 2W93A 2VP6A 4EGSA 1II8A 1Z4JA 2P7HA 3UUEA 4YRAA 1ZC4A 1BFKA 2ZU6A 3OZBA 5EOVA 4GBJA 1OAAA 4GL4A 1H42A 2VF4X 3HK2A 3GEMA 3H11A 4YAEA 5LD2C 1CUIA 2HZBA 3VZDA 3OY7A 3IAFA 3PC8C 5LMNB 3OIYA 5H9WA 2JB9A 1O94A 4EDHA 4FJ2A 1ESEA 1Y98A 3DMDA 3JALB 4KQIA 2WG1A 5B3LA 2ZS7A 4BNIA 1A9PA 5JBNA 1Z12A 4QVIA 3I04M 4ZK6A 4TOIA 5JRZA 4YRRA 4Z1MD 5LNK6 1KYXA 1GJRA 1Z16A 3KJGA 4MVJH 4KFCA 1RC1A 1AJEA 2Y0EA 5FWYB 3JQGA 1S2GA 2W22A 4KBYA 1WQ1R 2XA9A 4NU5A 3V80A 3VGJA 3IGFA 4B83A 3C3DA 1OE0A 1XRSB 5EZYB 2CL5A 2IYVA 4P3NA 4JEMA 3EVCA 4EUNA 3AILA 4EUEA 1T10A 4PPFA 1G5RA 4LK3A 5TNXA 3TEFA 5B6JA 1O94D 2ZRDA 3W2GA 3PC6A 1U11A 2VSXA 3WWYA 2WIGA 1BMTA 2GASA 1ZX1A 3FUCA 3GLSA 3HA5A 1DFIA 2C5EA 4GFDA 1XOIA 1Z6PA 4LXGA 1G8HA 3O4GA 2IP2A 1ADGA 1NRIA 3FVWA 1IXYA 1FPQA 2YUIA 3IQWA 4BVJA 3TS1A 4MWEA 3KX2A 1L3CA 2W6NA 4K46A 2LRHA 1KEEB 1MAWA 4AS2A 1B8PA 1SUEA 3MCAA 2WICA 3LPCA 3TEJA 4BP8A 4CMJA 2DWOA 3EGXB 4X92A 1CQPA 1P1BA 4TKVB 2Z4RA 3KSZO 2R97A 3EGEA 4W5HA 5M2QA 5TPZA 3TDKA 5K5EA 3LU1A 4MZDA 1NWHA 3L0PA 1XZJA 3ZNNA 3AM5A 2IEZA 2P2GA 3FGPA 3OP1A 4NAUA 1KU0A 4LA4A 5PNTA 4JKOA 4C6RA 4HV4A 2POCA 1CXZA 2R3SA 1G8JA 3BFJA 3KKKA 4D9KA 1O03A 4OXXA 4L2IB 3DE6X 5JNTA 4A92A 1IG0A 5JSHA 2VQDA 4HQFA 5EY5B 4MKIA 1J4AA 4L95C 1RJ9A 4EY4A 4U4AA 1TQ6A 2BMAA 2JASA 3K9GA 3KKQA 3DKIA 3L0ZA 4BNLA 2DM6A 1H2YA 4BP9A 3HEBA 1QM5A 4J76A 3QKTA 3EMDA 4FDVA 4TM8A 4G36A 2PGNA 3A28A 2UZAA 1EFKA 3AL0C 1XFDA 2GA8A 1GPYA 3UVEA 1J2YA 2XE7A 1LGYA 2ZKLA 3N2YA 1H4VB 4IFEA 4WW0A 1PR5A 4YCBA 4MICA 2UDPA 1E1RD 3MWLA 2PJHB 1KI3A 2DRIA 5AW8A 2UUPA 2W8BB 4YJKA 1JKJB 3AF3A 1ZN2A 1ZKMA 1RD4A 4L15A 4B71A 2WJWA 3AUKA 1I8TA 3P4YA 4EL0A 5A3QA 5C5EA 2ZI7A 2C82A 3KPUA 2DHQA 3GD5A 2KQUA 2QL7A 4RF2A 1WZCA 4L5YA 2WSMA 4REOA 3T3HA 4W8OA 4RTMA 4BJ5A 4XRRA 3DCJA 4YY3B 4AMGA 4PIMA 2DPHA 1KEEA 3S5JA 4GEGA 4MS1B 3WWDA 3AEQA 1QR2A 1YOVA 1QIHA 4IWNA 4RNDB 3N28A 4ECEA 4KLNA 3GRZA 3HEAA 4G84A 4RADA 5FBHA 1P0FA 4L28A 1TAQA 1Y7HA 1V0JA 3CUYA 3LZ6A 4R8VA 3VC7A 1UKEA 3S6JA 1U9IC 3IAS1 4KO2S 3KJXA 1SOAA 3KT8A 3S2EA 4I19A 2B20A 2QVGA 1ULUA 1LH0A 4CIXA 2X77A 3R0ZA 2ZPUA 2FPOA 4OH7A 4RDCA 2QJWA 2YDXA 3O5AA 4Q48A 3AR3A 2XNDD 1DBQA 1KAEA 1FCJA 1VL5A 1TRHA 2HA2A 4GSYA 3M5DA 3QQ7A 3QK7A 2O8CA 4K0KB 3ANSA 1OAOC 4UDYX 4LOHA 1QLJA 2B25A 3IBGA 2EIXA 4MVJA 3OQJA 3JZAA 2OMEA 4NCXA 4J29A 3TB4A 3PUKA 3WHIA 1B0PA 3NPMA 1M0WA 5TEWA 2JGRA 2AQKA 3MWDB 4YUYA 1B14A 3OOWA 4HFMA 4NXMB 2O20A 1QTRA 4PQEA 5AHRA 3WDKA 2WJPA 4P86A 5CDYA 3OLCX 2Z2JA 1MCZA 5AVVA 8GPBA 3JQBA 1IUNA 4KNVA 2VUSA 4Z7OB 1BMFA 3VKUA 1Q17A 4C08A 1L4GA 1TEXA 3LI2A 4X1OA 4X71A 5CX1A 5SYMA 3UGQA 2A9OA 2ZSKA 1KR5A 1ML4A 1TA0A 2HA3A 1EVQA 1C8BA 2JJ1D 5KNDA 2QU8A 1FQJA 2JHAA 4OJKA 1G5TA 3QUQA 2YFYA 4U2FA 1ISMA 3C41J 4OAQA 5FL7D 3JASB 1GTZA 2X2EA 1WHTA 5CHEA 2A78A 1MHTA 4RJJA 1ZBQA 3DDNA 2ZE6A 3IT1A 3OQOA 2JKZA 3AEXA 4DBZA 5ARBA 2MYNA 4LV8B 3ZD9A 2WSIA 4EPVA 4A9AA 1TYBE 3TRDA 1IULA 2LP4Y 2ZJ4A 1HWYA 1PR2A 1HLPA 5D1HA 5T8KA 3IV7A 5IYZA 5CVVA 5ITVA 4K26A 5FWXA 3O2SB 4ZN6A 5JUWA 5AP9A 1M1XB 1Z0IA 1JBQA 3IEKA 1TUEA 4HH4A 5E4JA 5JZMA 1UINA 1WXIA 3MGAA 5LMUB 1Q19A 4RXUA 1UWCA 1P8JA 5ITWA 2J9YB 2AN4A 5IXJA 1KH2A 3KKNA 3SCZA 1JYEA 1ZUHA 2OCGA 5ESDA 1ZWKA 3HJCA 3WGKA 3W34A 3JW8A 3EEQA 5JYDA 2Q1AX 3GHYA 2P0YA 1EGAA 1K2VN 4NE2A 2O7VA 5ALTA 3TIFA 1A7UA 5DSZA 2PVCA 2P9QA 1G17A 4PNZA 3WOHA 2CYAA 3AINA 1GG2A 4D0GA 4BXOB 4AIIA 1L7XA 1J6UA 2EGGA 2AC7A 5JPCA 1IXKA 1U98A 2EBHX 2FPMA 2ADFA 4QDZA 1Y4DE 4P81A 3NNNA 3F6PA 3HCWA 1J8FA 3SC2B 4ZCSA 3BICA 3SZOA 4EZBA 1H65A 2G5CA 1RMYA 1N77A 1AKVA 3TOVA 3RBZA 3K1ZA 3IOBA 2WR8A 5EE3A 1NSFA 4UXIA 1IK6A 1RI3A 1ES9A 1XZLA 4HB2A 5ALWA 5DIZA 5C1OA 5IJAA 1SU4A 2XAAA 3TTTA 3V8QA 3ADDA 3GPIA 1FVXA 2FP4B 2YASA 3IO5A 4A8HA 4CLRB 1ZXLA 4NATA 3QYJA 5LIRA 5FOWA 3FLEA 4C6TB 5D3MB 4UTVA 1LNZA 2H57A 3R3ZA 4BE9A 3GFQA 3DZIA 4IH9A 2BW0A 5BSTA 4E5VA 1IWOA 1GA6A 2BE7A 2YJ5A 3FAZA 3QU5A 4OSPA 4L78A 4YRIA 2YZ7A 1RR6A 3I9JA 2E3JA 3MWGA 2I62A 1JYSA 2WD7A 5CFLA 3DFKA 3RCBA 5AVJA 1XYGA 2GRJA 3DE7X 2OO7A 2ASVA 2W2PA 1QCYA 3CRZA 4TZTA 2GM5A 5DGHA 4YI3A 5LQMA 1KDYA 3ZGNA 1P62B 3IELA 3RU2A 2A0WA 3JQPA 2FUG1 2QI9F 4JAVC 2HHLA 4DA9A 2PK3A 4F11A 1G18A 2A88A 3AEKA 3X1XA 2V8OA 3FPJA 3IP5A 621PA 4HH1A 1E1NA 3O8OA 4YRFA 1U0JA 5KSYA 4J0EA 2LPMA 4NV0A 3TUJC 3TW8A 1IN4A 4ZK2A 1HXHA 1QV7A 1A7KA 2XGSA 3MTBA 1SK9A 2JFQA 4NBSA 1KYTA 1RTKA 1XQXA 3I1FA 3JQGB 2IHVA 4RMGA 2FPPB 5JE8A 1BMQA 3V2UA 4QSHA 3HKBB 4XI9A 3TGLA 4C4XA 4HPWA 3JWPA 5ILQA 5CFZA 5CEEA 1E18A 2V4UA 4QXMA 2B82A 1WNTA 1HDRA 2QL6A 2WF8A 3A6LA 1LK7A 2R68A 1GDHA 4QSMA 2PKQP 3TXYA 3D3NA 3DE3X 5F1OA 3H2ZA 3HM2A 4UE3S 2W6ID 3HXLA 1EWVA 3MWYW 4LYGA 1KP2A 5B1DA 3L7BA 1KDRA 1RBZA 1V7ZA 2W6JD 3DOCA 4QUKA 2WU4A 4YASA 2J45A 3TINA 4PYKA 3AYZB 3U3DA 2Y9PB 2XE8A 1NVAA 1O5IA 1NC3A 1U7HA 3GFOA 3UMCA 4DCUA 2W71A 5CD1A 1FFBA 2C5GA 1SR8A 3FYTA 3U7QB 2QNIA 3ZQUA 1WP9A 2JAUA 4PGHA 4WFJA 1Z06A 3DBHA 3KQWA 1CZRA 5DLQC 3TW6A 4ICIA 4IJ6A 3A2LA 2FW9A 3A14A 1AMUA 2YWBA 1JDBB 2VDQB 3Q2OA 2OCYC 2ZIVB 4YECA 3MTIA 2IF2A 1G20E 1OW3B 1UJ4A 4LRUA 4ZRDA 5REQA 5DYTA 3DXYA 3IMGA 2N1MA 3D2LA 5G0VA 1GRNA 4NYJR 4A0HA 3LO5A 1P2FA 1BQEA 1I7SB 2VXYA 3K09C 3BTUA 4BMPB 3C5EA 3NX4A 3TFOA 4XM0A 5JVDA 3QXJA 1E1RA 5IZCA 1RWOA 1JE1A 2PUAA 4OGWA 3MLAA 1FTWA 3EEBA 4M53A 2H92A 3LVRE 2JKYA 4J1QA 3L77A 1KJNA 1M34A 3PFHA 4MR7A 5JQGF 1RRKA 4WFIA 1U2ZA 1ZGBA 4ZVTA 4EPRA 2LBPA 3RTBA 5B53A 4Y6SA 1DE0A 4K1XA 3UOGA 2VDOB 2JA1A 4CL0A 2GZMA 4H6WA 1SVMA 2OT3B 1JU3A 1IUOA 2PAFA 2KB0A 3E27A 4MK4A 4QVGA 4J7XA 4OK3A 4ZVSA 2IHTA 4K88A 2OD7A 2OC9A 4AK9A 1PU2A 4MUNA 4EEXA 2LTAA 5CIWA 1ILWA 2XAUA 2NPOA 2R4QA 3DP9A 3P71T 4R69A 4WN9A 4RIGA 3VOTA 2WE8A 4LF4B 1ZY2A 4DLTA 3OTQA 1ZW1A 4EHJA 2EAUA 2DG2A 2VPYA 3GNSA 1EINA 4UBNA 2EJTA 1FVHA 5AM3A 4J1TC 2D2VA 3TOXA 4OK5A 1JHXA 2EJVA 1FZTA 1UT8A 3RNLA 2J0QA 3UPUA 1XTZA 5BOVA 2BFCB 2NZYA 4DLZA 4KUGA 4IINA 4O8ZA 3U60B 1U8ZA 1YU6A 3CX7A 4F45A 3INNA 2H9YA 4RTRA 3SX0A 1TLLA 3GZTB 3MTAA 2ATXA 3ZE0B 1I10A 1SUWA 2TMGA 4IVQA 3JY6A 3NBUA 3OKAA 4ZOBA 2EW2A 3KQVA 3ZHYA 5K6RA 5AUNB 2RHWA 2C8KA 3BB3A 3PICA 4N01A 3PWZA 5JXJA 1J0BA 3ICOA 1CF2O 3DEFA 1PZFA 5I8WA 1G8FA 4EJMA 4RH3A 4R1PA 3TUZC 4ZYTA 2XWQA 1GU1A 3D6TB 3BWEA 1U1CA 3C3MA 4JLWA 5FTNA 1VYHA 1JHPA 4KG7A 2GYUA 3DAPA 2HQRA 5LA6B 2WILA 2H52A 3RFTA 3UMSA 1CC1S 1EK0A 4C3VA 2MT9A 4D9GA 3RS8A 3CINA 5DBGA 5FBZA 2O48X 2RHCA 3BTOA 4O4LA 3SC6A 3FYCA 3F96A 4FE7A 2A4MA 1TI7A 4N5NA 2HJSA 5EE9A 1PR9A 1Q1BA 1VGVA 3IIMA 4UKDA 3QE9Y 2AS0A 5BV2P 1RZRD 2GK3A 1FDIA 4ND8B 3SM3A 4Q9JA 3UKJA 1FX0B 3FSGD 4U9IS 4ESEA 3RROA 1T5DX 1NKSA 5BVHB 4EM6A 2RD2A 5JI2E 3BMCA 1YA8A 4RNCA 2L18A 2OHXA 1YR9A 1Q50A 2B5OA 1I3LA 2IKSA 3NTOA 4ISCA 3DHEA 3MSCA 3DEHA 1NHWA 4I1SA 4MUFA 1E0JA 3WB1A 1JEQB 4EB6B 1AKEA 3GJYA 2MWMA 3R09A 4JX9A 5J58A 1VQ1A 4Q21A 5JAQA 3ZJYA 3ZVKA 1YL6A 1ND5A 1CERA 5H0IA 3X0DA 2ZRNA 3EPPA 2WHRA 1AS0A 1XN1A 2DU8A 2WKWA 3F67A 1BKYA 1ZJZA 3FDIA 4NNPA 5EFOA 4GDFA 2ALJA 3KSAC 3FPUA 1E89A 3UJAA 4KXMA 3U1BA 4M22A 2EG5A 4BCCA 4ARCA 2FZLA 4WMLA 1RACA 1H23A 5CYOA 2XYGA 2HWYA 4LISA 5E4FA 1HQKA 5DVZA 3VHRA 1LTHR 1QLWA 4KYUA 2V6FA 2AOXA 5KQLA 1DAOA 2WVAA 2WJYA 3VYTB 1N78A 3D31A 4HGYA 2ZXEA 5A6VA 1G2IA 3B3QA 3OU2A 1J0EA 2JS7A 2CJWA 2VDUE 3STHA 1T9CA 1DUIA 4EZIA 2C2OA 2HA0A 4JEHA 2WB2A 2QSZA 2VDPB 5D6NA 3ZIAA 1Y6FA 4CCYB 2P78A 4B7UA 1NP6A 5EZ6B 3H87A 4BTEA 4CLHA 4PG8A 4RTSA 1BE0A 3AETA 2HA7A 2Q2VA 4QOSA 4X84A 4F60A 5B5SA 1AUPA 4BNYA 3WYBA 1W35A 1NF8A 1VRVA 2F67A 5CAEA 2NN3C 1P91A 2OFWA 4ESHA 4WCVA 1CJVC 1DCTA 3SIXA 5BQXA 3A6DA 1KORA 2WFZA 3AEQB 2E6KA 5M34A 4GGPA 2KM1A 2Z57A 2FQXA 4GHWA 4EH1A 3WBJA 3V46A 3ZHUA 3TBHA 1G1AA 4QDTA 2CHVA 1R16A 2WJVA 4GI5A 5K8UA 5GM2A 1DQZA 3BS4A 4QLOA 2GBGA 3D4NA 1ZD5A 3BSSA 3I3SR 3QPWA 3C6QA 1NLZA 1GCAA 4CDNA 4GPIB 5I7OA 5JAPA 1Q1ZA 3QJGA 5TT0A 4PYJA 4HXEB 3GVCA 1EE1A 2KY9A 2HHCA 4HQLA 5JANA 3CVUA 4OX9Y 5KYGA 1FF9A 4EMSA 3FNFA 4W7IA 2AG1A 2PN1A 4WCDA 3MRTA 2Q0QA 2FE4A 1ESCA 2WHXA 5JMPA 3HZRA 3OQPA 3WHLA 4JI0B 1K2WA 3W5DA 2AV6A 3HQ4O 1Z2NX 2G0TA 1U0SY 2O50A 3OPNA 4HTFB 3MPOA 2ZI5A 2W6ZA 1C0IA 1Z0DA 3HRIA 1XF1A 2FSHA 2BCGY 1G41A 2BP7B 2Q1YA 1JX6A 2IU3A 2YWHA 2ZYHA 3ND7A 3OQVA 4HWPA 4JYMA 2DPYA 4M3NA 4OFWA 4RCVA 3DEIA 4PEVA 3QHAA 5ALMA 3VMMA 1MOZA 2K6GA 2PWAA 1U94A 2V7QA 2B4KA 3C74A 4KB5A 5DGXA 4ETIA 1J0CA 2DCUA 4GP7A 2J6IA 1RC0A 3MUOA 3ZE9A 1Z17A 1T2DA 5I7FA 3DL2A 1DOHA 2IY8A 2YWFA 3I9OA 2ERCA 2GCIA 1OFVA 1KSHA 3R1IA 4FVTA 5F3DA 4N54A 5CK5A 3WQRA 1T1IA 2R1UA 4R7ZA 2XNJA 3SYKA 1LLUA 3JAWA 1XMXA 2HDNB 3K2EA 5ERXA 3YASA 1QYRA 2P6RA 4I99A 3L04A 1CZNA 3DW1X 2PX6A 3OTOB 1CG6A 3ADKA 4DIDA 3LPLA 3HJFA 3FYHA 5JCOA 3BEOA 5C32A 4XEHA 3ZDZB 2EJCA 1JG2A 1HTWA 4TLEA 1NJFA 5AM4A 4PZDA 3RKRA 5BMVB 3WBBA 1E0SA 1I3NA 3WMGA 1NE2A 2ES4A 1U28C 3MB5A 1CNEA 1OFTA 2P4UA 2R6ZA 3K0SA 1NURA 4WBSA 4DPMA 1U3UA 3WK4A 3KQOA 2W42A 2AXQA 1X70A 1P9LA 2XB8A 2ZR9A 1RMQA 2WP8J 3OCCA 4NNJA 1Y6ZA 2V3VA 2WWXA 3MAAC 3GVIA 4N5DA 4WXYB 3IR6A 5EP2A 3K70D 4XWWA 5I3ZA 1D0IA 3WKEA 2FUKA 3CNHA 4HAVA 4ZTBA 3VH1A 3KUDA 3TLKA 3EISA 2XCUA 4Y0NA 3TVTA 4KITB 1I1HA 4NZZA 4PLPA 2W43A 1LUAA 1TLTA 3F2VA 3OBIA 3R6GA 1NVUQ 4LRSB 2PFGA 3ROTA 3K6KA 3M81A 4DKXA 2G72A 1W5BA 3LCRA 3WI7A 3G23A 4Z0TA 3N2GA 2H5LA 4N3AA 5E2AA 1MAUA 4UEOA 4NBKA 4X54A 1MJ5A 2NW6A 1T2NA 1WM1A 4X6YA 3ROEA 2H7YA 4L8YA 1UMCB 2VQ6A 4V0MA 1PS9A 4IKEA 3WK9A 2AL7A 3Q4GA 4B7ZA 4DLBA 3R3HA 4XWAA 4W1RA 4F4JA 1N0WA 4LYYA 4Q7MB 5LL6P 1Z6ZA 3W8NA 3PXUA 2WMNB 5FI5A 3Q6IA 2HU7A 3TD9A 4P5EA 1GAWA 2EFYA 1QGYA 5F9HA 4LF8B 3CISA 1MZVA 2GT1A 2HSEA 3E2IA 4KR9A 2V55B 5F7OA 5K8JB 2IY7A 1GTL1 2P2DA 1ZGJA 4QQKA 1U1EA 2EVWX 3F6EX 5HE8A 1HEYA 2PO7A 3IV6A 3N2LA 4HJXA 4OIMA 4XOUA 2XT9A 5L51A 2E49A 3G02A 2PR7A 5HTOA 4N18A 1ZMRA 3JQCA 1LQUA 1Y8QA 1Y5LA 2JFGA 4CMBA 3H3XA 3UAYA 1GZSA 4JJIA 4LBYA 4WNYA 1CQIA 1MU0A 2VEOA 1NA5A 4DIMA 5C9ZA 2YJ6A 3AQIA 3PR3A 8OHMA 4KFTA 2VNJA 4EFMA 3BK7A 5EFZA 1EUYA 5IAKA 4O25A 1BSVA 1MC1A 1T9ZA 2IIVA 3EG9A 3AI2A 4N8EA 4OHBA 4FW8A 1YRQA 4MULA 1R6DA 2RGEA 3IKJA 1OU4A 3QSGA 5T6BA 5F52A 4V1CB 3D1JA 2AKAB 2GSWA 3GCWA 5CPBA 3A9VA 1S0UA 1IHYA 1FS5A 3T9CA 4L85A 5H3LA 1Y81A 2H8KA 3I01A 3EFBA 1WO8A 2JGKA 4KRGA 2X23A 1RE0A 1VMKA 3VU3A 1EXVA 3EW9A 3HXOA 2ORYA 5DNYB 4NPAA 4PYIA 4MW1A 3DR3A 3SIRA 5YASA 4CTKA 4M7OA 2JAXA 2JLSA 4PC1A 2QR2A 1MB9A 1PLKA 3P9SA 4GYWA 4ZRNA 1D2MA 1RPAA 2X19A 3P32A 1EDOA 1TYDE 1JECA 2IYUA 1E1KA 3AR8A 3VYSB 2ZXUA 2OE2A 2LCQA 3G5TA 2NOAA 1JG7A 4N5MA 5I5GA 3G9XA 4HAZA 4MHTA 1HZJA 4C29A 2CV0A 3BXPA 1Y3IA 1JLLB 2CCGA 1I24A 4IIJF 4Y9UA 3C7DB 4UATA 3RKSA 4GRAA 3GMSA 3DM9B 1A9SA 3Q85A 4E5SA 4WK0B 1W4ZA 3FOCA 4BWVA 1WKCA 2ZT7A 3KTDA 4EEKA 2W4IA 1Z5PA 2DQYA 2PA0A 2IL1A 2YJ3A 3HDTA 1YMQA 3WRWA 3TSYA 4YJFA 3LUHA 4LV6A 2RAFA 4MV5A 2V7WA 2OAEA 1T9KA 2VAMA 1DELA 2XADA 1USKA 2HXSA 2JA2A 5IP5A 4PO3X 2D74A 5DOVA 1DDOA 4PFKA 3KBBA 2BMVA 2GEVA 2WY2D 4BTLA 2RMKA 2PRYA 5KQSA 3NVAA 5IABA 5LMZA 1N1EA 2VPZA 1OLSB 1XWWA 4TUYA 2YOHA 4YFYA 3M5WA 2Y71A 4M99A 5F5NA 3PHHA 3RVSA 4E51A 3AR4A 1LK0A 3W2IA 2DR2A 4X1KA 2GNPA 2Q1TA 3C4QA 1KQOA 1VHWA 2IH5A 3GO4A 2XGJA 1V41E 2ZIFA 3K94A 2GNOA 4NU0A 5DHUA 4TS1A 3U4DA 5KTOA 421PA 2BH2A 5K4HA 1Z62A 1YHZA 3OO0A 1GKLA 3ZLBA 3N6VA 1L7AA 1OI4A 3QXSA 4E1AA 4YNBA 1G4HA 3PDHA 4YP0A 4CKCB 1H6BA 2IYFA 2H1LA 3A2KA 2XYRA 4I9GA 3FOAA 3D59A 2Q0HA 4BE7B 4R1QA 1YHNA 3NEAA 2QUKA 3D4OA 1H3EA 3PLAE 3BE6A 4KLZA 2ZOSA 1QFYA 3WNZA 4ER0A 3U7GA 3VI4B 1TCBA 1VCIA 4FKBA 2H3HA 5HKAA 1ECCA 1G5IA 4EPXA 3LLSA 2B4YA 1HNNA 3BWMA 3ECAA 1SKUA 3PEFA 2HDOA 3CFYA 3GEPA 4RZHA 3K6JA 5F7XA 5AOBA 4ONEA 1SURA 1AE1A 1ZA1A 1X39A 1GXSA 4JP3A 3IDSA 3N2EA 2CXTA 5JS8A 1AK1A 1XJ5A 1RWPA 4RV9A 5EWMA 2JARA 3R9XA 4TLMB 1XQ9A 4D4KA 3I5YA 2PMEA 1I3CA 3CZQA 2I4RA 2IV3A 4RK4A 1ZWLA 1WDKA 3KTAA 5AJUA 1BKSB 1SVOA 2GWHA 5DYNA 3EDRA 4WKPA 4CM5A 1NQOA 3KDAA 3CUUA 3Q5GA 3V7FA 5G1OA 1YB5A 3GUYA 1O95A 2QI9C 3BE4A 3CEJA 3ND5A 2Y2UA 2D13A 1RJDA 2AT1A 3WLQA 1U9IA 5K3AA 3QKRA 4ZTZB 3QF4B 4FYHA 1QK3A 4YEDA 3PQ5A 4IYRA 4YREA 3F5FA 4HXYA 5I7SA 1INLA 4Z8XA 4ALJA 1LXCA 1I6KA 1VKOA 1PR0A 5B1IA 3STWA 1Z07A 1LPOA 2ZDHA 3O92A 4RHUA 1E7YA 4Q05A 1ZR4A 2JCGA 3QU7A 5TMPA 1PAUA 2WA1A 3FDJA 2J09A 4D0LB 2CUNA 4D9BA 1E7QA 2NTNA 2Y93A 2AUTA 3RS5A 3AXSA 4W1SA 4HB0A 4CKBA 1FP4A 4CV2A 4CT5A 4L5AA 5I45A 1TVMA 3QEMA 3PC7A 3CZ5A 3ICWA 4XYLA 2A1UB 2G80A 1NVTA 1V5WA 4G0MA 4HY3A 4UHCA 1UF9A 3M5PA 1G6Q1 1I4EB 1S9HA 3I2FA 1A97A 3BWCA 4RDHA 2B5VA 3A3YA 3WLFA 1M2VA 4AAYA 4DG8A 3EX7C 1WHSA 4LQ4A 2JKVA 1MPXA 1NF3A 1U2PA 2J07A 3C3EA 1IXZA 3DTTA 3P9PA 3VTKA 5KNDH 2XWBF 3IV9A 1E3TA 5BWMA 4B35A 2J5BA 1U0GA 1XVVA 3L8YA 2FW6A 3MXOA 2YOFA 4QM7A 1DFHA 1U9CA 2UAGA 4RJLA 5ELLA 4C0LA 3JARB 4IVRA 2VBFA 3B20A 1WNFA 3IMFA 5EMLA 3HXTA 1ACJA 3N8NA 1PZEA 1E2EA 3GJ3A 1DBIA 3H9EO 1ODKA 3ICCA 2Q5OA 4RSRA 2QTVA 4TTPA 4ZOAA 4NVRA 3AEUB 4CKWA 4RY8A 1DX6A 4ZGBA 2FHSA 3E9MA 1P7VA 2OOKA 2WU0A 2YINC 5CPFA 3PUHA 3DH0A 1UDXA 1PT6A 3IBCA 5I7VA 2CV1A 4B4WA 4UTRA 5TS3A 1IY0A 2X8JA 2E5WA 4ZVVA 3IT0A 4GMXA 3QVVA 3DB1A 1FMJA 3K5IA 3LG2A 4B6SA 4WFQA 3THWB 4CIDA 4GZ3A 1M2OB 6REQA 1GKYA 3HBJA 4IWYA 4II7A 5HIIA 3ADPA 1YVEI 2A7QA 1AZSC 3FKJA 3SKVA 1PVOA 2YWCA 3ZIUA 3B9PA 2ONZA 2XECA 3MWEA 4HUQA 2J9FA 4UM8B 2ATCA 1D8AA 1OFUX 3GG2A 5MFZA 2IDZA 4TVBA 1NI3A 4PQFA 4BLSA 4CF6A 4CDRA 2CLIB 3IUEA 4ZIRB 3UHAA 2ZIUB 5TEVA 4BEBA 2PQMA 3EQZA 3IVMA 4H6XA 3R5JA 5E3IA 5CA1F 5CCEA 3WLJA 1KBQA 1D2CA 1Z75A 2YTZA 4O59O 2JIBA 4XSGA 4URYR 5H3CA 3C8DA 4Q02A 4H17A 4DT1A 4FDAA 3SZUA 2CXRA 1A04A 3RC1A 2RHLA 4CEIB 2DUWA 1NVWQ 4BIIA 1WCYA 2PSJA 1GT6A 1GY8A 4FFBA 4B85A 4TMFA 1JA0A 1HPLA 4QATA 2JCSA 4ZYLA 1PGNA 2BI7A 1P4JA 2QPLA 4CM1A 2KX7A 3R0QA 3IJRA 5KNCD 4JJFA 1BYIA 1GZ3A 5EWLA 4AF6A 3LRXA 3DLHA 4O5AA 4EK9A 5B6PA 1ITZA 1IZ9A 2FPKA 3O90A 1XA3A 2FRDC 1Q0SA 1ORTA 1AB5A 2PKRA 1ULTA 2Q5CA 4I4LA 2DUJA 3FA2A 4IJKA 3CJQA 5B1EA 1LVHA 2P2ZA 3WE7A 3BDAA 1Z5GA 4HQRA 3SDZA 3W3AH 3WWZA 4BASA 4EECA 3EOBI 4K05A 4MQFA 2HJGA 1EEXB 3WMFA 4JVNA 4P7FA 1PDWA 3DVSX 4MYUA 4JLBA 1U2QA 2WJZB 4Y6OA 2NU6B 3ZWPA 4C1NA 4I2NA 4EKYA 1MX1A 1NUUA 3DMRA 3G0BA 4I8XA 1JAIA 3R3XA 3P97A 4GI7A 3QBJA 4L5JA 3R7AA 2WWFA 1XRPA 3DWEX 2NPFA 3DAOA 1JZTA 3ROZA 3T95A 4BFLA 1GAQA 1UXIA 1XK7A 2SKDA 3L6OO 1DQPA 4K7JA 1LDBA 1N1DA 1NM5A 1U81A 3LNCA 3MCTA 5HZMA 2Q49A 4CTOA 1NU6A 2I1WA 2QVLA 2YYAA 4O2AA 5G41A 1UBHS 2ZANA 2AI3A 4Y0AA 5AOVA 2W7TA 4XGQA 1UUFA 1V6SA 4QLAA 3PE4A 3PXBA 1GARA 3ZHBA 3U19A 5EWJB 1YRHA 2OEPA 1I1OA 5J63A 2VZ0A 1N8SA 5GIOE 4REQB 3GBVA 2WHPA 2COKA 1MX5A 3RI3A 2VCHA 1N92A 5ADUS 1OIVA 2SCUB 2VJYA 3JV7A 3FF4A 4KAFA 5LZ4A 1Z4PX 5C81A 5LKAA 2PT9A 4XWYA 1JXAA 2F9LA 1B0AA 1LFDB 1U5AA 4M8SA 1K92A 5LC1A 1UC9A 2NTJA 1NR7A 3JX9A 1DVRA 3L0BA 3OURA 4D80A 3ZTWA 1YR2A 2Q4RA 1XLVA 1LQTA 3LCVB 1ODIA 5JNLA 5HBRA 1T4MA 2JJQA 5AW5A 3AI1A 4XIGS 3T41A 3GGSA 5IVHA 1GFSA 1RKVA 3QBDA 4UU0A 1OF1A 3RGWS 5M29A 5JYBA 2X2OA 2ZW9A 3L1VA 1QQ7A 4XDGA 4A91A 4BATA 1K3FA 3HDQA 1A5AB 1YJ5A 2FZGA 1M6HA 1XEFA 4MEBA 5FT9A 2JHPA 4L27A 4MUYA 4WE3A 1L5NA 1I94B 1R0ZA 2O2XA 3K3PA 1YFKA 4L6CA 1AVTA 5A0TA 4Y2JA 3VZPA 4CEJB 5AJHA 1V1JA 1E5TA 2PUHA 2YMMA 3EFOA 4TSKA 1U8CB 4KX3A 4Q9DA 4ZT2A 3V32A 3LHFA 4RZQA 5IH7A 1E4OA 1GV0A 3ECCA 4DDMA 2BDUA 1YC2A 1W4CA 2LDBA 2V1XA 1O77A 2WD7B 4P58A 3ZW9A 4EG5A 2ANBA 4F9GA 1PQWA 2GXAA 1EK5A 1AD2A 4OLJA 2AJTA 4HADA 4R2JA 1WD5A 1R5JA 3U3XA 2QTGA 4L02A 3U56A 1H8EA 3TLZA 4HNSA 2NZVG 4CKEA 3OX4A 1LK5A 2CJXA 3OX2A 4RZSA 3VBEA 3HP7A 5KTYA 5F7JA 4PSCA 3VR4H 3WYGA 1DAKA 3MGKA 5D7NA 5DM60 5D6YA 1ZNYA 1N5OX 3I2GA 5F76A 3MILA 1XHFA 5B7QA 1HE4A 4TZKA 3A6HA 3ABQB 4CHTA 4OXRA 1E0KA 1NW8A 2VDJA 1OX4A 4ZA2A 5FKJA 2G0AA 3RYHB 1PG5A 3A4MA 1IIRA 3CH4B 2NUPA 2QLJA 2HGZA 3GFBA 5DYYA 4EF4A 5C4MA 2ZGVA 2ZK7A 3JTEA 3JWGA 1EJ2A 2XE6A 2OOSA 3P20A 4N3CA 2VYVD 1LLCA 3HL4A 3SEFA 1IWBB 4BFSA 3DMYA 1K7XB 1J1IA 4FQ7A 5CYPA 3KG2A 1JEDA 1LF5A 3H9JA 5DBHX 4RELA 3REGA 3ZGYA 1V96A 4I50B 4BKUA 3QKRB 2DTDA 2WE7A 4P3YA 1QVWA 4OGGA 3AW9A 2XHEA 4N3NA 4B0OA 1C3OA 2D0DA 4U00A 4BV2A 4IHJA 4DSTA 4LYEA 3C6KA 3NBXX 1TA9A 4K1LA 5E4YA 3T7DA 3PE3A 1NQ5A 4YUWA 2XNHA 3CEPB 3D7MA 4LRYA 4XJSA 2I2WA 3UNXA 3HRKA 3UYLA 4RVHA 3MCVA 5JASA 2BT4A 2WJ4A 3ZWKA 1P5HA 1PCXA 1C9DB 5IAEA 4N5IX 1MTOA 1NFRA 4B81A 1YS1X 2W58A 1XAGA 2AN3A 3DL0A 1O9HA 2B1RA 1I0LA 5BW4A 5JSFA 5EPEA 4LRXA 1LPMA 2R1VB 2V9CA 3K0CC 1CQZA 4LRTB 1KJWA 4C07A 5MDHA 2J0VA 3KXLA 1QAMA 2B83A 4J75A 5TPWA 5FORA 1M76A 4PZ9A 1RWKA 3V8NA 4NL4H 5BO5A 4JLAA 1S3SA 4TRMA 1TF2A 2BFBB 3A3PA 3WKAA 4GX5A 1GQ2A 2IUSA 2YWXA 3EXIB 1VC2A 1YE5A 2OORA 3WLLA 3BAZA 1QZXA 1L4LA 2BZ0A 5DCLA 5B7NA 1M5RA 1H2WA 4A4DA 4J03A 1ZIXA 4EGAA 2JIQA 3BCHA 3KVYA 1QQAA 3MGBA 4LTNA 1EGQA 1T26A 3TW8B 4J0JA 4KUHA 2Y1LA 4UD2A 5AIBA 5KBYA 3E3AA 4PWZA 4YP9A 1ENZA 3VR6D 4U8GA 4DSUA 2UYHA 1OLUB 3CEHA 3UV7A 1E6KA 4B82A 5EP4A 3TQFA 5C53B 2WF5A 1X8LA 4CM9D 1AC5A 3FFXA 2D0IA 5EJ5A 1N75A 2G4LA 5AUQA 1TKRA 3IX7A 3D4PA 1NATA 2OGTA 4MW5A 4BNGA 2IYXA 1Q44A 4MAAA 2QMYA 2QM8A 4RE6A 3MG9A 2WOJA 3NI2A 4L07A 4MLZA 3HKDB 1E3LA 2CYCA 3CMMA 3M6MD 4GM0A 4PCUA 3CS3A 3SVLA 1G0NA 1L8AA 2HU2A 3KJZA 3VDQA 1DRWA 4YRZA 2R44A 4UHBA 3S2IA 4WOBA 3VR4A 4D0NA 1E7RA 4OYLA 5JJIA 1FFAA 2B1JA 1X1BA 5BPHA 1GRCA 3JQAD 1DO0A 5J2TA 3LV8A 4EHFA 2A67A 3P9KA 1HLFA 4FTWA 4LPKA 1CUXA 5LQCA 3JVIA 1TK3A 4P5PA 1L9XA 2EEPA 4LDPA 3W9UA 3U16A 2VVTA 4Q4AA 1SXJB 5HPYB 4LEIA 4Q3NA 3ANYB 2PR2A 2X3UA 4I1YA 4YRTA 3LA8A 1YRWA 4OK6A 1Z5UA 3FM9A 2D7DA 3PX7A 5BSVA 4RAOA 3RAEC 4TT3D 5F4ZA 3TMKA 1OCEA 1ZVMA 2XKJE 4UD6A 4HLUA 4BWFB 4IXNA 4C4RA 4R1SA 4D4LA 4UM9B 1F17A 3P9ZA 2EFHB 2OBBA 1DRKA 2O2IA 1QQTA 2ZT5A 1UFRA 1E6CA 1JMKC 1Y3AA 3KLOA 3EHEA 2QLTA 4R4JA 2HV9A 2MSWA 5AOAA 1W59A 1OI7A 1Y8RA 2D62A 1BRTA 2Z8YA 3I8OA 5ETJA 3B52X 1L1RA 4KI7A 4L5BA 3T8YA 4D98A 3KWJA 2QHXA 4HRAA 3K1AB 2YJZA 2IH4A 1SKYE 1GSAA 1RKUA 2XQFA 1W36B 3I3OA 4TTRA 3P2KA 2OK8A 1JQAA 4PBTA 2WJHA 4X1YB 1TC2A 3NRCA 3RB8A 3OO1A 5LBUA 2RBGA 4UNRA 2WNSA 2YVUA 3H8WA 3WWEA 5JJ5A 1M5TA 3QY9A 4G9GA 4ENSA 3HE3A 1EDDA 2ZRKA 3AP3A 1SHKA 2OFOA 2JFUA 2ORWA 3PDUA 1YAHA 3Q40A 3C97A 2BFEB 2Y92A 4DGQA 1SPBS 1A8SA 4R31A 1VE6A 3FN4A 4BO8A 4R0VA 1CDZA 3TJZA 1T8PA 4AJKA 1XG5A 3MLBA 4EQ6A 4FD3A 2AW5A 3P0RA 1DJOA 3G8CA 3HGQA 2UUBB 2ZVPX 1Y3CE 5ANRB 5LZ7A 3X43A 4BOYA 1MGPA 1NVVQ 5HQTA 1TEVA 2O7QA 4WDQA 4Q19A 2EGHA 2NXNA 4EO9A 1GVHA 1A8QA 3BD9A 5HZKA 4MCJA 1UJ5A 1MO6A 1RM0A 4RVFA 5ICSA 4NEHB 1GKUB 2DKFA 4MVXA 2CMGA 5IU6A 2HSJA 3S3TA 4KVZA 2NZ2A 3CPEA 3FH0A 5FTWA 3RBXA 3E4DA 2DTXA 4JI8B 2G9NA 2UXBB 3V4LA 3GU3A 1YS4A 4FNAA 2I9PA 4HTAA 2ZYIA 1RQLA 1Q0ZA 2DUUA 3B6EA 3QU2A 4YJ2B 1E1DA 5DM1A 4GVPA 1X6VA 1J21A 1IOLA 1NVBA 2G7MC 2GJKA 2NVBA 3GEIA 1AGYA 1RYYA 2A9RA 2V58A 3WB2A 3WGNA 3G6KA 2C99A 2GF7A 3V2IA 1XZAA 4ND6A 4WXHA 1APBA 2ECQA 1VLVA 2Q1CX 3B1VA 4C78A 4D45A 5GADl 1CIVA 3I04A 1XE3A 4FLEA 4I36A 1PWXA 5DZSA 4KQ1A 5IUNC 1HFKA 1OZAA 1SXIA 3FNQA 4JJKA 2MCFA 2BM1A 4FHGA 4MQ6A 5KTKA 2SKEA 3QNUA 3R5KA 3SP1A 3SX4A 4ZYVA 5D3ZA 2DUNA 2R8RA 3GQBB 1YVUA 1UBJS 1VE3A 1VI6A 1YCFA 2C07A 3R5FA 4I9UA 1XQ6A 3BIXA 5IYZF 3ZTTA 2MHCA 3NP9A 4J43A 4XGNA 3G8BA 1MC8A 5F2NA 4W8HA 5K3CA 2JJ2A 1BEEA 1CD5A 4X93A 3B3JA 3MRVA 2SBTA 4KDCA 1DQYA 3AB7A 2IYAA 4EO4A 2ZT6A 1E61A 1I3MA 4ZOQI 4URFA 2QM3A 3CXUA 4RMJA 2YHUA 2ZCUA 1BDBA 3F47A 1J09A 4HEHA 2X40A 4M0UA 1IDOA 1YA6A 3DDCA 3U2QA 1SVNA 2G5PA 2VHUA 4U1RA 1P2SA 3L7OA 1EFCA 1H1TA 4I4TB 1P4RA 5JFTA 4A8TA 2WTEA 3G5UA 4HWRA 5FOSA 3WJAA 4EJFA 4AWBA 5IXSA 1GQYA 3GRPA 2BHLA 1NBWB 4L4ZA 4U7JA 5TQVA 3D8TA 3D43A 4PN7A 3FYSA 3JSXA 5C8YA 4K9PA 3R40A 4GPBA 2NSHA 1DO2A 3FYUC 3IOMA 3HS3A 2OHOA 4KKXB 5K6AC 5KOHA 1ZVJA 1DNPA 1JHZA 3A3OA 3E0XA 4GMFA 5D8DA 5BNZA 1R64A 1EQAA 2WVJA 4L9AA 3NM4A 2IS6A 1WMEA 3ZHQA 3LBAA 5M3BA 3I2KA 3TRJA 2UZ4A 1P1RA 3R0VA 3BFKA 3K0KA 4L0DA 1UBSB 2J9XB 4YCDA 4BY9E 6NULA 1EM6A 3IQXA 4U5XA 2JW5A 2WQZA 2DHDA 2OM2A 5L53A 3V4RA 3AR2A 3E23A 4NMHA 2EBUA 4G01B 1Q0QA 5JOQA 3KWFA 4BLWA 2FXVA 4H27A 5IDVA 1WLYA 5C34B 5E3HA 4TSFA 4DE5A 4XJVA 2C9OA 2HA5A 2WPDA 3OTWA 4QXRA 5I9MA 2N1BA 4JS0A 2R6AA 3F7MA 3VJLA 4JMLA 2YX1A 4K03A 4PV7A 1PR6A 3T94A 4UPDA 2HCJB 4BX9A 4X61A 2XUQA 1OTXA 1RKQA 1TIPA 3KOOA 3DFZA 2ORVA 2CMDA 4G5QA 4JC5A 2CFRA 3CNEA 5IHPA 1LV8A 4ABTA 1NQUA 1TC1A 3AVQA 4ZQFA 4JV5B 2UZ3A 3CZPA 1VG9B 3RC8A 5FNVB 4L6AA 2GQ0A 1G7TA 4G65A 2HREA 4UUAA 3PGVA 4WDRA 1ZNQO 3R7BA 1EUCA 3SYTA 2C4UA 4FN5A 1S01A 1XIVA 4DWOA 2AN5A 2CFOA 2PKYX 2Q1DX 2IWRA 1OU0A 2AX4A 5GWXA 4OF4A 4HZIA 2J41A 2JBAA 4JY7A 3LQQA 4WKNA 2VYQA 4F9TA 4MQ4A 1K27A 4KHPB 4ENQA 4YCMA 4JFRA 2EFJA 1J8YF 1XX6A 4QPJC 5EVJA 1WXDA 1Y9DA 4FYKA 2ISCA 4MQBA 1DGQA 3DPSA 3EWSA 3HG7A 3QWBA 4X8OA 5SY6A 3A6JA 2XMPA 4GX0A 5K3OA 3B85A 5DT9A 4BMYA 3HP1A 2Z5LA 3CGGA 2I6QA 4IO1A 1KAOA 1PDVA 3PT5A 1N5JA 2FLWA 3GOHA 3MGCA 1OFGA 3EF0A 5LZ5A 4CXMA 1HKHA 5JH7B 2PDAA 2ZKIA 3DC7A 1L3IA 5LVAA 1G38A 4XQ0A 4GBGA 1WMAA 4AZVA 5FWAA 3FSRA 1E6UA 3ZUGA 2X2PA 3F4BA 1P9WA 3H2HA 4QUHA 3TZLA 7ABPA 4EGQA 1X9HA 1AV6A 2NTEA 3E9DA 1L5ZA 4AKEA 3AFGA 3SHQA 1JEQA 2D5IA 4FYPA 3PSHA 2PMBA 4LPSA 5A05A 3VDXA 4BLPA 4KE9A 3LX5A 4F3CA 4GMDA 1TTTA 2XDQA 4XARA 3WK6A 2QY9A 1ACLA 1O96A 1VHTA 3HVKA 3NT4A 1XMQB 5EZSA 2O9JA 1OBVA 4F04A 2B3DA 2W6OA 4IJQA 4DYVA 5CA0B 5AW7A 4H9GA 1XTVA 1S2IA 3LM8A 1SXJA 2NNLD 3RKUA 4MUIA 3HV0A 5BWBA 3MMNA 3PYLA 3NC1C 4B4KA 3TLGA 3I2HA 1FRZA 1G3MA 2C5BA 1QHIA 2JZOA 5HKOA 1EMDA 1G16A 2QTVB 2J5RA 2OCLA 5J5CA 1DKRA 3G5AA 2FB9A 3L01A 3KE9A 4W7HA 3GGOA 3ZJVA 4B33A 4CF7A 1EESA 4QU5A 1V5GA 1HYGA 2NU7A 1WKVA 1THMA 4LMBA 5CT6A 4RY0A 1XMVA 4D82A 3KQMA 1XEWY 2XQIA 3WKDA 2ZB7A 4U9HS 1S7CA 1JFSA 2BTEA 2QT0A 3HKDA 4FYVA 4NZYA 3CNOA 3NTQA 4YTEA 2EHJA 3KFXA 2P4HX 4YP5A 1AS2A 5HM6A 3V1UA 2E4UA 2IWHA 1WUIS 3WLKX 3DDWA 4DLAA 2B30A 4BLUA 1XCBA 2JI8A 3VPSA 3KOYA 3HMQA 3WYAA 4WESB 3O7WA 1KFBB 3RIMA 4JZYA 2XSZD 3F71A 2BHTA 1BS2A 3MT7A 3O83A 1SHUX 3K9QO 5M04A 2UVDA 2BSXA 3L6CA 1U6JA 2WIKA 1AGRA 1MT3A 3FZGA 3NDRA 3PGA1 4DMUB 5EJ6A 4Z0PA 1DDIA 1OJ7A 1UKYA 1YWGO 1NQVA 1T8RA 2BFCA 2EW8A 2HF9A 3CN7A 4NWIA 4BVLA 5EJ4A 3K6SB 2QVZX 2VWPA 3K4QA 3LIIA 1L7EA 3GT3A 3EXIA 4CKZA 1WB9A 4MVJF 2VZ8A 4JBYA 1ZM4A 2DT5A 2VTEA 4NU8X 4F86A 1VBFA 2FFAA 5DDIP 3V2GA 3PD7A 3AL2A 3UMJA 3R20A 5CB4F 2O8FB 3VKHA 2UUAB 2XKAA 2I2AA 4BRZA 1NRJB 2QQ5A 1ADCA 2CFIA 2WLTA 3AERA 3H13A 1BE6A 2NXJA 4K86A 4MUKA 4PYLA 1PF7E 2Q28A 4QIHA 4HAYA 3AMVA 4XPIA 5ULLA 1NR1A 1TZ2A 3MOGA 3UXEA 4AZ0A 1QB8A 2O07A 1RBMA 3L5OA 1RABA 1MAHA 1W0JD 3MUNA 1BGWA 4G4SP 4QTXA 1ZK4A 4DANA 4YRJA 4YLYA 3DL7A 1D1SA 2OCDA 4S1OA 5DBFA 2ZYGA 4BMDA 1WUYA 4DA4A 4DMFA 5BQ3A 2PPVA 4N8DA 4KMMA 1F9EA 1NN1A 4PS0A 2PZMA 2B4AA 4J16A 5HS6A 3UAOA 1NU8A 3QENA 3RYFB 4DZRA 2O52A 5DU2A 1PSDA 3KJQA 2EX0A 1UFKA 4BBAA 1AZLA 3D0OA 1H8HA 4B3CA 4J3JA 2HBZA 5A4KA 1E94E 1Q0UA 2Q3DA 5ESRA 2IFTA 2H51A 4JGBA 3BCSA 1W2GA 4X8LA 3H9UA 2IZOA 3HKCA 4WK4B 5GONB 5H4HA 3HVJA 2GAIA 4HQOA 2FXIA 1TJ3A 3H5RA 3O03A 4C0SA 2C2WA 3C8UA 1Z83A 3BBLA 4M46A 5ALYA 3GUVA 4FFOA 3M70A 2BI4A 1LBQA 1QDEA 3CU5A 4FMDF 3I83A 4I5GA 2B2NA 2O8NA 1XK6A 3BMOB 3DG9A 2CW5A 1AQYA 4FYMA 4CNQA 2IYWA 5JAMA 4V0QA 4FW9A 4IF4A 2DZDA 4AJJA 1L8LA 4CR8A 1PIWA 1Q74A 1VKRA 3K5PA 3OQBA 4O1HA 4E1VA 4DDTA 1X7YA 1R10A 1I32A 1T6YA 5BSFA 1T35A 4F84A 4ATNA 3KR1A 1MD9A 3PFBA 1XGKA 2I78A 1XVIA 1L4FA 3MELA 4AMYA 3QKSB 4E2YA 2IZZA 1Z18A 2WT4A 1IBLB 1XMJA 2XW6A 1LTQA 3T06B 4BQSA 4HXGA 1N2CB 2IHKA 1LBIA 1JDJA 2CFSA 2PFKA 2VYND 4HATA 5DGTA 2FEAA 1W6RA 3S27A 2QAJA 3O2NA 2IPAB 1YS7A 4JASB 3ZDYB 2X0NA 1NNI1 4ILEA 1N9KA 2E21A 3ZE6A 4WI1A 3ZV7A 4B09A 3DLAA 4AKIA 3Q1LA 4GQBA 2R00C 3ND6A 5C5DA 4CEJA 2C04A 5BQ5A 4HT3B 2AK3A 1KS9A 1S2NA 5LWHA 1JHMA 1AKWA 2AYYA 3CLRD 4II2A 2D6FA 3PTZA 2VFAA 2WTBA 5ENZA 1SU6A 5F2EA 3EQ7A 3PNKA 3ZCPA 3IHKA 3F74A 1PJLA 5DT2A 2WD8A 3PFFA 5KX5A 1E7SA 2I6XA 4OL9A 1PJ2A 4URWR 5D00A 2WZCA 5AXBA 4E2WA 1CHDA 2DPMA 4Q82A 1X42A 1F5SA 3NP7A 1QIFA 3FMGA 2VCEA 5K0NA 3U4CA 4B84A 1QPZA 2AJ8A 4JOSA 2OY0A 3UAXA 1YBAA 1XRLA 1QJCA 5EAIA 4C43A 2ZWAA 4RKWA 3ENKA 4TWBA 1FDOA 4DA6A 2OO5A 3PG5A 1XPOA 3AWDA 2VATA 5AI5A 1Q3TA 4CFSA 3GL9A 1OZGA 3EXFB 1W36D 3PR1A 1CV2A 2W8BA 4J3NA 5GZ6A 5JXIA 3W1WA 4BB5A 1EFPA 4RMHA 3AV3A 3KD3A 5HIAA 3EZFA 3UOAB 2Q1XA 3WTCA 3ECSA 5I9SA 4QYIB 4DV5B 3LGAA 2PJDA 4DGSA 4B3SB 2FGJA 1DI0A 3M4JA 3L6UA 3UMVA 3BQ9A 1JR3A 1QPGA 3HO6A 4E46A 3LKVA 4F4CA 5P8WA 3IVXA 4ZAWA 1QNLA 1JB1A 3MFQA 2Q5JA 3BAFA 3IOYA 3L79A 1PQ4A 2JL1A 4GQIA 5EG5A 4YCCA 5C52B 4YH1A 2E9SA 2AGVA 1RQPA 1X77A 4LI3X 1WV1A 1KDTA 1RHKA 3NU1A 4MYTA 1QP7A 5I9TA 4M8KA 2QRMA 4JXZA 1O89A 2F7SA 2ZPAA 2AUNA 1RXIA 2QMOA 4ZEVA 2G70A 3IB3A 3T4PA 4Y9TA 1TCAA 1DJQA 4ESVA 4UVHA 4EW6A 4BGUA 4PC7A 1XD8A 5KDOA 2P6UA 2Y99A 3QPBA 4D8WA 4ZMSA 1KK1A 3HFSA 3JQEA 5ALZA 1SQFA 2WI8A 3F49S 5DNAA 5FQNA 1XCMA 2BEWB 3B89A 4IXTA 1FLDA 3I5MA 4CMIA 1R12A 3GPBA 1NW6A 1LF0A 1FJ2A 4M1WA 1RRPA 4PR3A 4XWTA 3WGZA 5EUBA 3C8HA 2WU1A 4QEKA 1CBUA 2PZKA 2PXHA 1ABEA 2CL7X 2Z5VA 1SCIA 1VSTA 1DXOA 2FWRA 3MD9A 1MUUA 2GCEA 2HCTA 2PGJA 5AHOA 4B4OA 1TMYA 1E2FA 4QX6A 4UAGA 4D7AA 4V39A 3VQTA 4PLVA 1LVUA 521PA 4U7DA 2OG1A 1AV7A 2MMGA 1V5EA 1RXSA 2CXSA 1MBZA 2O0MA 2H1IA 1DAPA 4I5IA 1NJGA 5FTLA 3HPQA 3NHFA 1M2NA 4JVSB 3UATA 2NYRA 5HWSA 4BKRA 1Y9AA 3E1GA 3URMA 4G8JA 3T1NA 3WIEA 1A3CA 2NO9A 4G97A 4M60A 3LY8A 4J0QA 4RF3A 3VDMA 5H3HA 4JC4A 3U09A 4CIWA 5FUQA 1DBPA 3ABZA 2ARKA 2GH1A 4GZMA 3RW9A 4BNDA 5EKSA 1JSZA 3LCUA 2FAXA 4OJTA 2BONA 1M33A 3SR0A 3VPFA 2OHVA 1EFDN 2P1DA 3UOWA 4DLXA 2GA9A 1ZOOA 1B15A 4YAOA 3IO3A 5F5LA 2PL3A 1ZICA 1ZJ6A 2QQRA 1I9CA 2WFLB 2Z58A 5AXDA 3RUPA 1K7CA 2RAPA 4IDHA 5A4MS 5JBQA 4IJ5A 1W73A 3H3JA 3ONVA 3ASUA 3WL5A 2VHEA 3F6YA 4MS4B 3PU6A 3EC1A 4ID9A 4EB0A 1CTQA 2CDNA 4IIUA 3HYCA 4ZANA 3OFSA 4M0PA 1Z47A 3U7EB 2RH4A 3HCAA 5JSYA 3RFFA 4CMIB 1U2EA 4D44A 5C8XA 2ZWVA 4IUYA 4BQPA 3VR5D 1FQKA 1ECPA 1IK4A 1DEKA 2XJ4A 4TPKA 3LWBA 1GU0A 1VKNA 2EQ5A 1XZNA 3V5NA 2IKQA 1NF9A 1KGDA 3UQZA 3TAXA 4CR6A 1G8SA 3X1WA 3HXPA 3KJEA 1TEZA 2WKSA 4BGEA 3M6UA 4G8DA 2GXUA 1TIBA 1T5BA 1TQ4A 3JD3A 3H04A 4OREX 4RHXA 1NUAA 4DLLA 4W9MC 3I1JA 2HLNA 2C92A 4D6PA 1UXOA 1EZ1A 5B3KA 2A5JA 3SJCA 3W2TA 4FWTA 1PZXA 4AD8A 1STOA 2AHOA 2EG9A 1B23P 1FP6A 1GFIA 1WY5A 2CLKB 3GY0A 4YBZA 5E7MA 3GC6A 2JRCA 3LPNA 2XA1A 2HWUA 5BSUA 1UT5A 3S1SA 3A6KA 1L5OA 5ITZA 2H7XA 4DWJA 4XPZA 4MS1A 4URHA 1V4NA 2O8BB 1CUYA 5FV4A 1QLHA 3E9QA 1Q14A 3KLMX 3F97A 3EIQA 1MQ8B 2X4IA 4YAJA 3U7HB 2HUPA 2D1SA 2JC3A 1JAZA 2WFLA 4YT8A 3CSSA 1WG8A 2FN7A 2Y0CA 4G0XA 4P3PA 3LOPA 3B7PA 2DFKB 3WLMA 3LY7A 2ZTMA 3FWPA 3KOMA 4UFPA 2VYFA 3EDMA 3FMVA 4K9KA 3ZI7A 4F5YA 1W48A 4KGVA 1YL5A 3H86A 2ROQA 5IZ4A 2JLAA 4LJ6A 3ZD7A 1PGJA 4RPHA 4R2LA 3X1YA 4TQ9A 4A8JA 3RT9A 4EG0A 2ZRFA 1U0TA 5F98A 3OOSA 3NAQA 1AF4A 3F3KA 4Y2UA 2GCNA 4M1QA 3BREA 3PXDA 1QIKA 3JQAA 1Q7TA 1E9AA 1GPMA 2JFVA 2AUMA 1Q7CA 4OKNA 2WG2A 5COQA 4PCLA 3UM9A 3Q3VA 4HK4A 2CLHB 3GYGA 3LWDA 4RY9A 4KQKA 3NYQA 2X7JA 4ZJUA 1KP3A 2O5VA 4OIFA 3A9WA 3DWGA 4V02A 4EY8A 2R84A 2O8EB 4UVDA 3S0JA 1QS0B 4DR2B 1JLRA 4B8WA 4FFNA 4ALLA 1W4AA 2YMPA 1QG4A 3MUFA 1PK9A 3E6AA 3T5BA 1BO6A 1L4HA 1T0UA 1WBBA 3F1KA 4GXNA 5CEJA 3KD2A 5KVSA 1SZPA 2QRZA 3QEOA 2YS6A 4IHKA 4R1UA 3R5XA 5H9VA 2V7GA 4BX8A 1FQOA 3KEOA 4EKNB 1CB7A 4W5WA 1A2BA 3L40A 4L74A 2FX2A 5ICGA 3TG2A 1NG9A 2GWRA 2IF0A 1UJMA 5F21A 3CF6R 5FBRB 1P7YA 1YZ3A 3FYDA 4MKGA 2WLSA 1EBBA 4FDUA 4MS4A 1R8SA 1I0IA 1XRRA 5DJ5A 3E03A 1KZGB 4PZAA 1AO3A 5FULA 3HCBA 4Z9BA 4N9QA 3A4IA 3UJCA 4UHFA 4D6XA 5I01A 3IUNA 4EUFA 3B1WA 4TYQA 3CNQS 3H7AA 3KUXA 4R6WA 4TMZA 1VP9A 4AJ2A 2HNBA 5LLSA 5HM8A 1OWPA 2ZYAA 5C80A 1DOZA 3K0FB 3BBPA 5ALPA 3QG1A 3AUXA 5FAXA 4OSEA 3VDRA 1HDCA 4ASUD 4BU0A 3PJRA 4R8SA 1YOBA 5HQJA 3RABA 3U4MA 2CMHA 4K8OA 2GGSA 3QEJA 5A2GA 5IDXA 2OV6A 3B13B 1GQOA 5JS1A 2QZJA 5T6MA 5IASA 2YV1A 1U0RA 5EE0A 1GCUA 1ISGA 2I4NA 4US1R 1B3RA 1KVRA 3K0BA 3PEVA 2CUKA 4ERNA 2OCXA 2WM8A 4JLVA 4EX7A 2WIDA 4QQRA 5JCZA 5CLLA 2YCLA 3W04A 1NZDA 2B7CA 1R4AA 5D1NA 1ZD4A 1BKDR 4CEIA 1RI1A 2GD6A 5CM8B 2YZMA 4UOEA 5E95A 1QZZA 4MROA 3TMAA 3SEZA 4EYEA 2WWTA 4LZLA 4DRXB 1AB6A 4HLQB 5KYXA 1ODLA 1U2DC 2CJYA 2B92A 4RPCA 2NXWA 2VYVA 1YOVB 2F3RA 2X8WA 3IUMA 3KUKA 2MSCB 5JHHB 2H4FA 2WDPA 2AOTA 1NBMD 3CSUA 2Z08A 2HFKA 1EDEA 1Q0PA 2P9FA 5DHQA 4UTNA 5BWCA 4LKRA 3DJFA 1PLJA 5DASA 4BWYA 4XRGA 1E79A 2J3IA 2QR3A 1AMNA 2B8JA 2HB6A 2MSDB 1T5TA 4YLEA 3AKDA 4TWIA 2UVPB 1K5DA 5JD3A 1IZ0A 2NVOA 3M4XA 2F4VB 2VK8A 4QC2A 2BR3A 5LOVF 1X9IA 1Q1QA 1YRAA 2IGTA 2PKEA 1UBOS 1P75A 1XTKA 2Y2VA 1GPNA 4BO6A 2FG6C 3L9WA 3RV4A 5B6IA 3FZYA 5C7IO 1JMYA 3DWIA 1OASA 4BNXA 3A27A 2AJLI 3P94A 5FHRA 2R4UA 3F9RA 3IBTA 1YZVA 4U6QA 1YDMA 2MR6A 3PYMA 4FFLA 3WY9A 2WABA 2YDYA 5IVIA 5FP0A 2DUMA 1WPXA 3AHIA 4RA6A 2P35A 3BMQB 2JFYA 4RGQA 5JMTA 4YV1A 1QOQB 5IJWA 4FPXA 4HJRA 5JSZA 1X38A 3ZJ5A 2E4AA 5GVSA 1B8UA 2XWSA 1E2MA 3OZWA 1U2RA 4B43A 3G2OA 2I7CA 4GOKA 5JMOA 1PHRA 3VXKA 4QBIA 1M6NA 3H97A 1EVZA 1NPDA 5JEDA 1VLLA 3OCYA 3HUEA 3CX6A 1JFTA 5JY1A 3ZKAA 3D2AA 1NI4B 4A1FA 2R7MA 4WGGA 4X7MA 5A7HA 4AMBA 2C4VA 2ZJ3A 1AQNA 2H06A 3WR5A 4BUZA 1BEZA 4HVAA 4PG6A 3O38A 4RULA 4BTVA 5KOJB 4OBXA 5JY6A 5J3JA 4LFAB 1DTEA 1NXSA 2HBQA 1FTQA 4GX2A 4Q7KA 1R9GA 3DKVA 4Q9LA 4A8JC 1OBOA 2G4VA 1J56A 2QR5A 1DEOA 1FRQA 3DE4X 1DJMA 5CM9C 2X9VA 3T7KA 5FCDA 1NP7A 2ZTLA 5EMMA 3GFGA 3V1TC 1FSGA 4RIFA 4CCSA 1OAKA 5AK4A 4R9VA 2POQX 2ZR7A 2B1IA 1S5PA 4OHUA 4G2TA 4LHWA 4FQ8A 4RHFA 1G0OA 1C80A 1E2DA 4JB8A 4QA9A 4OB7A 3RYTC 1K98A 1NYQA 2QTAA 4G5GA 3RVMA 1MO5A 1GNQA 4R81A 3FPKA 4HXFB 4X1YA 3UCEA 4C0XA 3ST7A 1R6TA 5U4QA 2BEJA 3ROFA 4R98A 2NQTA 1O57A 3DLBA 5T41A 5IEBA 3VR4D 1MX9A 5FI3A 4AZWA 5B4TA 3U6KA 4GT1A 3EGOA 5D51S 5C51B 2IZ6A 1AY0A 2ZJ7A 4R0NA 1HE5A 2X5XA 3JQ7A 4JP1A 5K3BA 4E1BA 3UGJA 5F1PA 2QD4A 2ZJOA 1CJSA 4ZVKA 4D9IA 3GJRA 4FX5A 3X1MA 3THYA 3CVJA 1Z34A 1HZZC 4UPVA 5HCIA 1EFVB 1V43A 4G4SO 4NENA 5CMLA 1V25A 3BH7A 3LBIA 1A69A 3CB4A 3W79A 3RG8A 3QE3A 4KIGA 5AXCA 1KS2A 1IPHA 1YIAA 3KT3A 1N6LA 1C3VA 1UQTA 2CHEA 3EC2A 4RKYA 5FOVA 3GGCA 3QOYA 4NKRA 4R9UC 4ARZB 5LYJB 5DISB 1F9AA 4MQFB 3AVXA 3REQA 3H9QA 3U40A 5KU7A 1UKAA 1P2UA 2OXFA 3RVOA 4HS9A 4B6FA 2Y66A 4D4JA 3EC7A 4IG9A 3V3TA 4BN0A 4NAVA 5HXAA 2FZ5A 3DMHA 1VBNA 2JIMA 2OZKA 2C94A 3O82A 4IDAA 3UK0A 5J4KA 1YKGA 1BCRA 4Q7QA 3LX6A 4ZZIA 1N9ZA 2DPXA 2WQ7A 2E0IA 2RBEA 2GPJA 1BE8A 1KO8A 2F43B 4IFIA 4RPJA 3KAPA 1U0NA 3S99A 2BFAA 3BWXA 2R6CA 3SBOA 4D4GA 1CU1A 3GEDA 4M6WA 4GI2A 4UEQA 3RHTA 4F2HA 2I54A 1R6BX 2R6FA 2ZRIA 3MJEA 3QJYA 5FUBA 4FFBB 4EHIA 4F85A 3O91A 5EE5B 4ENTA 3ML1A 4Z1OA 3L7YA 4QO8A 1C8LA 2H18A 3ZI4A 2V7TA 5A9SA 2WWRA 3H19A 5C31A 4DV2B 1G2OA 3VGPA 3ZY5A 3UCFA 4UTOA 1XU9A 1LI4A 1ZCAA 2IBSA 4AFNA 2D8MA 4NHEA 1U2DA 4CUKA 1CX9B 2O7SA 1DJNA 1PEYA 1XZ8A 2OFPA 5LXTA 4W8GA 1XTTA 2CSUA 5EHXA 1JQLB 1NSYA 3PKIA 4YRGA 1YB7A 2VTBA 2Q2OA 1CUFA 1LRLA 1X8JA 3FDXA 2WF9A 1MJHA 1XYYA 4HGQA 4JP5A 2YHIB 1LBSA 3SGLA 5DX8A 5M7EA 4LBZA 3QPDA 4RD2A 2H5EA 4AZ3B 5JJLA 5FFFA 3CR8A 2G67A 3UV3A 2MYPA 4WUVA 4MEAA 5IANA 4P38A 2H1SA 2Q3EA 4XR9A 3RQIA 1GNTA 1DC4A 2I9KA 4U9UA 3LXMA 4KQJA 1UDWA 2FF5A 2BKXA 2NUBA 3H2KA 5G1PA 5HG0A 3KLBA 3QKIA 3IIEA 3QITA 2H65A 4EO7A 4BV8A 3G2NA 4TYNA 1VL0A 1FYEA 3O3CA 1ZK0A 3QXGA 5JZSA 4UVIA 2YQ5A 1P8AA 5CAEB 1PE0A 1J70A 1NMZA 3DFUA 2GAFA 1PLLA 1SVLA 4XDYA 4J7CA 5IT0A 4HBZA 3I9FA 4CODB 1EUDB 5GP1A 3HWSA 1UJBA 4DLNA 2JBWA 3T52A 5JT1A 3MF4A 1XJQA 4XX0B 5HFNA 4KNWA 1G98A 4E3WA 1VCOA 4FI3F 3VPHA 10MHA 2G8LA 2WINI 3ZGOA 5BRNA 1XTJA 3LRPA 1UBTS 1GZUA 1Y1SA 1NNUA 2UYYA 4JT4A 4CIBA 3WSWA 2ZS9A 2CLEB 2CLSA 2R1ZA 2QN2A 4YIKA 3RUEA 3H84A 4X6XA 1N2SA 1GL9B 1QU3A 2DCMA 3IP1A 2WWHA 4W1PA 4HAOA 4U7PB 1LBEA 2HF8A 3I30X 3ZV5A 2NUPB 3I2JA 3BORA 3NZEA 4I5EA 5BT9A 4XQEA 1VMAA 2OC4A 2XITA 1IXSB 1T6NA 4PX3A 2VH2A 1IWPB 3PD1A 5CX1B 5BT8A 2DLCX 3STVA 2MSKA 4HSGA 3ENZA 1YVPA 4ZVUA 3OICA 2G40A 3TFWA 5I8PA 4LJKA 3PQFA 1E4VA 1D1PA 2HN9A 1K88A 3E7XA 1HYBA 3OTHA 3S5UA 5KSWB 2HR1A 3IVGA 1FFXA 2PWZA 5T57A 4GZLA 5EPPA 3DEKA 3IURA 3H2YA 4Z6KA 3KP1A 1I9GA 2P9JA 4UFOA 3KQSA 3W3AD 4DG9A 3GPDG 3DZCA 1E5DA 1Y4ZA 3ZHSA 2ZYUX 3CNBA 2C9MA 2P3SA 2IK8A 3NOOA 5C1DA 3JQFC 5DRTA 5LU8A 3UMYA 3ESBA 1RXWA 4O2LA 2AN9A 4LJ4A 4PN3A 3E22B 2C20A 4JSRA 1QFSA 1QDNA 2XRYA 4GR4A 5CW1A 1GITA 3ONWA 3TDMA 2EOAA 5JD5A 3DPIA 1O58A 3HDHA 3VV3A 5K0EA 4ERXA 1UCFA 2PYIA 1XLWA 3G85A 4BMVA 5C46F 1J9EA 3WGOA 5CJPA 2XOKD 1OZHA 3HZOA 4H3KB 3X44A 4DNOA 3DL4A 4W5RA 3IESA 3VYWA 2L19A 3PFCA 4K6CA 4PINA 4WJLA 4HNUA 4DR7B 1YCGA 3LTEA 2VBGA 4J0HA 4OQFA 2BSQA 1EM8B 1PGOA 1E3EA 3L7AA 3BULA 5EEHA 2JZNA 5AXAA 6ADHA 2K7FA 1L7PA 2DY0A 3ON5A 4YPOA 4M1OA 5HEKA 4DUGD 1UKBA 1IBKB 2G6TA 4ABYA 4J2OA 3A9UA 2C1XA 4YPVA 1P2BA 1K97A 1NJ8A 4V38A 3B70A 1YUMA 3WNDA 1HYQA 1QVZA 1Y3DE 1DRUA 3Q72A 3ZGZA 2FG5A 1OH6A 4NECA 3QQ5A 2AMFA 1QGAA 5E6UA 1R5NA 4WXPA 2PSDA 3O9VA 4CIAA 4EF6A 3EA5A 4Z49A 1B16A 3N3BC 4KRFA 4O2BB 1SXQA 4PX2A 4BC0A 4TV8B 2C7RA 2ZRQA 2P9CA 1GPAA 3A4VA 1HE1C 3MCWA 5JFOA 4Z4FA 5BYJA 3IXLA 1OFHA 2I4LA 1ACMA 2Z1MA 3B36A 1ZO8A 3IALA 2OPBA 2QNBA 3A6ZA 4TTSA 4XFDA 4BFZA 4JB0A 4PTLA 1HNZB 4COOA 4Y2PA 1BW9B 1QBGA 4OFXA 4NV3A 1BA3A 1U0FA 1LDGA 3MOIA 1ODCA 4PSAA 3WO1A 4NJEA 5E7JA