2B25A

Human putative trna(1-methyladenosine)methyltransferase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
324
structure length
254
Chain Sequence
RPFQAGELILAETTKFKKLFRLNNFGLLNVPFGKIVGKFPGQILRSSFGKQYMLRRPALEDYVVLMKRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATFDAVALDMLNPHVTLPVFYPHLKHGGVCAVYVVNITQVIELLDGIRTCELALSCEKISEVIVRDWLVCLVARPVHWQPGHTAFLVKLRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human putative tRNA(1-methyladenosine)methyltransferase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords hypothetical protein
total genus 71
structure length 254
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2b25A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2b25A02
1M6EX 2YTZA 1L3CA 4U7PB 4X1OA 5E9WA 1QANA 2F8LA 3C6MA 5GIOE 3HCEA 5E9JA 4DMGA 1QYRA 3UJ6A 3EGVA 3P9NA 4GF5A 5KVAA 2HNKA 1EAMA 5F2OA 3BGVA 3DOUA 4RVDA 4GC5A 3DXYA 2Q41A 5EHGA 4HG2A 2HR1A 4OX9Y 2I6GA 4Z2YA 4RTMA 2C7QA 3BWBA 3FPEA 2HV9A 1EJ6A 3REOA 1M6YA 1XDSA 1G38A 3G88A 5FCDA 4GEKA 4R8SA 2NXNA 2ZBQA 2IH4A 1G55A 1TW3A 1T43A 3UBTA 2PWYA 3F4KA 4OBWA 2LD4A 5K0FA 1AV6A 1KIAA 1DUSA 3MAGA 3PX3A 3ER9A 4HGYA 4KRGA 3P71T 1KYZA 3KQQA 5E2AA 3U81A 3AXSA 3C0KA 5FWAA 1YUBA 1ZGAA 4ER7A 4OBXA 1XJ5A 4NECA 5E8JA 3G5TA 2XYVA 2ZWVA 3MTIA 3FPJA 4PCAA 4WVLA 5FADA 4M37A 4BY9E 2ZIEA 2YQZA 3KQSA 3BXOA 4U7TB 3PT9A 4HC4A 3I9FA 3BWCA 5GIPE 1BC5A 4HH4A 3TRKA 5BW5A 3TKAA 3C3PA 3PFGA 5P8WA 4PWYA 1VL5A 3DR5A 3SXJA 3UJAA 3EVEA 4AZSA 5U4XA 5GINE 3A4TA 5E1MA 4F85A 5EZSA 1IY9A 5CCBA 5CVDA 3EEOA 3LBYA 3G2OA 4E30A 4FSDA 5K0LA 2ZVJA 5K0BA 1G8AA 4AZWA 5EC8A 2GS9A 3D2LA 5EOVA 3KR0A 3BWYA 3M70A 4DA4A 1VLMA 1PJZA 2AOWA 5K0EA 1I1NA 3ID6C 2ZSUA 4E32A 2FK7A 2CMGA 2JHCA 1YF3A 1NW6A 3FTDA 3HTXA 5EVJA 2FPOA 3DULA 3BT7A 5DRYA 2BZGA 3UWPA 5EIFA 2PV0A 4LWPA 4Y2HA 5G02A 5HIMA 5EPEA 2HMYB 4B17A 5E2BA 4MTLA 4RTNA 3DLIA 4DCGA 3FRHA 4KVZA 2FHPA 3P9IA 2ZIFA 3GXOA 1SVUA 2BR3A 3KQWA 2OKCA 1YZ3A 4LECA 1XDZA 1N7JA 4HGZA 4CKEA 4PYJA 4P7FA 2QE6A 3FPHA 5HEKA 1WXXA 4DQ0A 4AX8A 3KPYA 4QPNA 3OZSA 4PYKA 4RX1A 4F86A 2AN5A 2GB4A 3SM3A 4A6EA 5CM2Z 1QZZA 3TLJA 1SKMA 3EMBA 1AF7A 4DKJA 1FP1D 5DX1A 5DXJA 2PJDA 4DZRA 2NXEA 1JG4A 2FCAA 4P58A 4FP9A 5HIIA 5BP7A 2BR4A 3DTNA 3DMHA 1VP3A 4CWAA 3MQ2A 4M7RA 4BP1A 5HILA 1NT2A 1TPYA 3M4XA 3P9KA 4R6XA 2QRVA 5EG5A 1YFLA 4YUXA 2AOVA 4PIMA 2ZFUA 3EVCA 5LQNA 4L7VA 3KQMA 3KR9A 4RTSA 4FS8A 3JWJA 3ERCA 2IBSA 3JWIA 1YZHA 3KQPA 5F2NA 2ZW9A 4BLUA 3IHTA 4CTJA 3H2BA 2BM8A 4E2XA 5FHRA 3THRA 5DM2A 3FUUA 2R6ZA 3KPVA 10MHA 4C05A 3P2IA 2PVCA 3FUVA 1ZKDA 2NXCA 4OA8A 4GBED 4V0QA 5FHQA 3G8AA 1V39A 3DXXA 3FUTA 2PBFA 3KPJA 1JR4A 1KR5A 1VBFA 4FT2A 3G5LA 1O54A 2FYTA 2IH5A 3EVZA 3O4FA 1Y8CA 1JG1A 2O57A 3GRYA 3K6RA 4WXHA 2NP6A 2UZ4A 4P7GA 5CD1A 3EGEA 3FTEA 3QOXA 2YUIA 2IFTA 3NVKI 2PKWA 2OXTA 1YFJA 4HRAA 3A7DA 4MWZA 4PYIA 2P41A 4QTTB 5EMKA 5LQRA 2NYUA 3TFWA 4GQBA 2O06A 1QAMA 3MTEA 4C04A 2PX4A 2XVAA 3Q87B 4G56A 4QQKA 3AWIA 1ZHFA 2OB2A 2PLWA 1P39A 3M33A 3R24A 5T67A 2AOXA 4H0NA 3OZTA 1JG3A 1ZGJA 2ZLBA 3B3GA 4P7JA 1QAQA 3MB5A 1KPHA 2DULA 5ERGB 4GOND 4GOOD 4KDRA 5BXYA 1MJFA 2VDUE 3VYWA 2DPMA 5KQRA 1O9GA 4YMHA 5K8VA 2AN4A 4E33A 5KYGA 4RYLA 4C4AA 3UFBA 1JQDA 3FUXA 2A14A 4PYQA 5GM2A 3TQSA 1N2XA 3BGIA 3KQTA 1NW3A 5C0OE 1D2HA 2O05A 2P8JA 3NW9A 3C3YA 3OE4A 1PRYA 4RWZA 2G70A 3S68A 3DH0A 4RTJA 4QPPA 1X19A 3EGIA 2WA1A 3HVHA 5DM4A 2B2CA 3R9XB 1MHTA 2BH2A 2ZZMA 2AZTA 3LKZA 1D2CA 2R3SA 3G7UA 3HVJA 2WA2A 4KIGA 5E1BA 5MHTA 1KPIA 1NBIA 1XVAA 2O07A 2IBTA 2PWPA 3I64A 2IGTA 4E2WA 5JUWA 3GO4A 4JXJA 3GU3A 3T7TA 4E2ZA 2Y1XA 4C03A 4YV2A 3HNRA 5KQSA 2B9EA 4A6DA 3DLCA 4FR0A 1XTPA 4X61A 2AOUA 3O7WA 3R3HA 3CC8A 4PIPA 3ELDA 5EEHA 3RODA 3A26A 5K0JA 2AN3A 2AS0A 1SQGA 2ZCJA 5IH3A 2PT6A 4PINA 4QQNA 2JH9A 2QM3A 2ZWAA 3BKWA 4QVKA 5FULA 3EVBA 5DM1A 4YUYA 1KHHA 3G89A 3LPMA 5DX0A 1INLA 2KW5A 4OQDA 4RTKA 3CGGA 2H1RA 4ER3A 2V74B 3THSA 2YX1A 3PB3A 5K0CA 4ER6A 3GRZA 3FZGA 2XYQA 5ICGA 1I9GA 2AOTA 2P40A 3GGDA 3R0QA 3SGLA 4IV8A 3KPWA 3SMQA 4DF3A 3P2KA 4XUCA 3KQYA 7MHTA 3GRRA 1SUIA 4FT4A 3HA3A 2HWKA 3GJYA 2YVLA 5ICCA 3PLAE 1WG8A 5H02A 1VP9A 2B25A 3LSTA 2BR5A 3UJ8A 2I62A 9MHTA 2HTEA 4GC9A 2B78A 2OYRA 1EIZA 1L3IA 3KR2A 3LDGA 5LQCA 3KHKA 3VC2A 1X1BA 1R8XA 2P3LA 4YV1A 3KU1A 3B89A 3UA3A 4YV0A 5GOZA 5K0NA 3LHDA 3HA7A 4C07A 3M6WA 3RW9A 3NJRA 4HTFA 1Q0TA 1FJXA 3CVOA 3NDIA 1B42A 1R74A 5FUBA 3IYLW 2XVMA 3AY0A 3PTAA 2IPXA 1YB2A 3FYDA 2ZTHA 5DX8A 2G72A 1RI3A 4RTPA 3FTCA 4X60A 5DTRA 3E05A 5DLYA 5B1SA 4RTRA 1R00A 3MCTA 4IWNA 5DWQA 5DT2A 5E8RA 3E23A 2ZIGA 1NW8A 3OE5A 3IEIA 3HEMA 5T6BA 2ADMA 2OY0A 3LDFA 3DMGA 2OO3A 3VC1A 2IDJA 1NBHA 1H1DA 4R05A 2G1PA 2P7HA 3OZRA 4ISCA 3EPPA 5D1NA 3B3FA 2PXXA 2V7EA 3NWEA 3SX0A 4BP3A 2FRXA 4MQ4A 3I58A 3FRIA 5EMLA 3ME5A 5E9QA 5LQAA 2ZZKA 4AZTA 3PFHA 3EVGA 5EKXA 1IM8A 5LQUA 5DTMA 5LR6A 3B7PA 5CUQA 3Q7EA 2P1DA 1UIRA 2IP2A 4P7KA 4GUAA 3UJCA 5M5BA 3FYCA 2PGXA 5BW4A 2GA9A 1XXLA 3GDHA 1VQ1A 3E7PA 1JTFA 2BM9A 3IV6A 3AJDA 4LG1A 3JWGA 3I53A 4RV9A 5DTQA 5EGSA 2JJQA 3LL7A 5EMJA 4M38A 1L9KA 5DSTA 3KQOA 2JHPA 5JR3A 4EQZA 3GNLA 3QV2A 3SR4A 5C9ZA 1DCTA 3LKDA 1DL5A 3SSMA 4ATNA 5HIKA 5FQNA 5C1IA 5EQJB 3UJDA 3HCBA 3LGAA 1RJFA 3TOSA 5EKUA 4POOA 4EKIA 1RJGA 2GAFA 2PX2A 4YUZA 2B3TA 3I5UA 4RVHA 1ORHA 2AOUB 1RJEA 3M6VA 4XUEA 1XDUA 3NVMB 3X0DA 4RTLA 2I9KA 3TM4A 5CCXA 2Y1WA 1N7IA 4RVFA 1AQIA 4LWOA 5HZMA 2ZBRA 4CXMA 2AVNA 1KPGA 4KIFA 1WY7A 3MHTA 2PY6A 4PYOA 4RTQA 1VE3A 3ELWA 2EG5A 2AVDA 1RI2A 3LCUA 3BWMA 1SG9A 2YXEA 4QDJA 3KR1A 1JQ3A 5CVEA 4M36A 5EHIA 1QAOA 5EZQA 5K03A 4OQEA 1I4WA 3B3JA 3C6KA 4QVGA 4KDCA 1JQEA 3A25A 3DXZA 5LSAA 5HOQA 2VP3A 1JTEA 3JWHA 1RI5A 3CJRA 1TW2A 1ZG3A 2VS1A 5F2KA 5GP1A 4EK9A 3ORHA 4GOMD 4RVGA 5DXAA 3SSOA 3GIWA 5CIYA 4E70A 3A7EA 1Q0SA 3OPNA 3LCVB 4X63A 2C7OA 1X1DA 1NKVA 3MERA 4CKBA 2YXDA 3MGGA 4MIKA 5FA5A 3OU6A 3UJ7A 1G8SA 3B5IA 1NV8A 1FP2A 2CL5A 1NW5A 1VPTA 2ZULA 3EEYA 3ELUA 3NDJA 4HSGA 3T7SA 2JG3A 2FK8A 2C7RA 2UYHA 5D1HA 2VDVE 1M0EA 2GH1A 1P1CA 4Y30A 2Z6AA 2Z6UA 1JG2A 4R6WA 3QOWA 3TPZA 1L3BA 4ER0A 2ZBPA 3HM2A 3FTFA 1KXZA 4YUVA 2K4MA 3G8BA 4GOLD 4IKPA 3P97A 1KYWA 3R6TA 3LBFA 3SVZA 3KKZA 2ONZA 1KP9A 3PX2A 3PVCA 8MHTA 3OU2A 2IDKA 3GCZA 4AZVA 3T7RA 4XUDA 5CVUA 1UFKA 1D2GA 1BKYA 2PX8A 3HCAA 4FSXA 4EVIA 1G60A 3KQVA 1AQJA 2EFJA 4PCLA 4CTKA 4R8RA 5GWXA 3KPUA 5HFJA 4BLVA 3HA5A 2NXJA 2UYOA 3M6XA 3AXTA 3CCFA 4RSRA 3E8SA 4PYLA 2ZZNA 1NE2A 2YXLA 1X1AA 3LCCA 3NTVA 4PYNA 1HMYA 2G71A 1XCJA 1SUSA 1P1BA 1WXWA 2NP7A 3TR6A 2PXCA 2WK1A 2AR0A 3HP7A 3EMDA 3TM5A 4C08A 2P35A 5DM0A 3UZUA 3P2EA 1RI1A 3LECA 1HNNA 3A27A 5KS2A 3EVAA 2OBFA 5DRTA 4E2YA 5EIWA 1L1EA 2XYRA 3HVIA 4PONA 2AOTB 3PS9A 1JSZA 2H11A 2PSSA 3FUWA 2I7CA 1ZQ9A 3OFJA 3P8ZA 3V8VA 3GRVA 5ICEA 5LQJA 3SSNA 1F38A 5FA8A 1XCLA 2QRVB 1EJ0A 3FPGA 2OZVA 1X1CA 2P3OA 2P3QA 4PYMA 4XCXA 5GM1A 5T64A 3EVDA 3G2MA 4MHTA 3BZBA 3HCFA 3BGDA 1R18A 3CBGA 4FGZA 5ICFA 4YUWA 4RTOA 5K01A 3MCZA 2G8NA 1BHJA 1BOOA 1P91A 3L8DA 5K09A 4AUKA 2EJUA 3CJQA 1ORIA 3M6UA 2N47A 2P7IA 1NW7A 3UJ9A 4EMSA 4UOEA 1RI4A 3OU7A 5CVVA 3CJTA 2GPYA 4QDKA 2E5WA 4OA5A 4X41A 3UJBA 1WS6A 2PT9A 2UYCA 1O9HA 2XBMA 3DUWA 1U2ZA 2H00A 3GRUA 5E1OA 3OFKA 2YR0A 3NWBA 1IXKA 1Z3CA 4QTUB 3P9CA 1SQFA 1OR8A 2GLUA 3UA4A 4DM3A 2ERCA 4FZVA 1EQAA 4K6MA 3TMAA 5K05A 2PX5A 5IKMA 5FTWA 1UWVA 3ELYA 3HVKA 2O0LA 2OB1A 2CMHA 3DP7A 1R8YA 5CVJA 4EKGA 3WSTA 1VIDA 3RIEA 2ORED 2OPBA 4YMGA 4IV0A 5EEGA 3GWZA 1JSXA 3G2QA 3ANXA 4V0RA 5HIJA 4E31A 4PGGA 4BLWA 3ER8A 2CKDA 3HCCA 3O31A 3HCDA 1WZNA 1FPQA 3K0BA 1G6Q1 3OCJA 4ZTBA 4F84A 2Z6QA 1F3LA 5E1DA 2IH2A 5FWDA 4PNEA 5FQOA 1NV9A 2VZ9A 4KWCA 2PXAA 4O29A 3TKYA 4C06A 2ONYA 3FPFA 4ER5A 2NNWB 5LQKA 4PGHA 4KW7A 3VSEA 1EG2A 1R6AA 1FBNA 1RJDA 3BUSA 4HTFB 3CKKA 5K0GA 3EVFA 4CKCA 2QYOA 5EMMA 3T0IA 3NMUF 2IIPA 2CWWA 2EJTA 3BKXA 3V97A 3LDUA 3DMFA 2C7PA 2JH8A 3G2PA 2JHAA 5DPMA 5DSXA 3LX6A 2QY6A 2UYQA 2VDWA 4DCMA 2ESRA 2EX4A
chains in the Genus database with same CATH superfamily
1WUTA 4DG5A 3GLHA 3H8VA 4A1OA 4GXNA 3HDYA 3OP4A 1DV1A 3V5NA 4XIJA 3IAM1 4CDNA 5FLYA 1BJRE 5JMOA 2QX4A 2O2YA 5TS2A 3RNLA 2C7VA 3M34A 3FYHA 4R4JA 5JNUA 2P67A 1KBQA 2VQ6A 2WI8A 4B7ZA 5ALLA 3VNAA 4ZU3A 4KFRA 3VMFA 3BHJA 4RD6A 1IEWA 2NTVA 4QXRA 5BSWA 2HV9A 2VDPB 2ZSBA 3NI2A 2LTAA 5KOJA 1TF5A 3BE4A 3F9CA 3KEFA 5J40A 1JDPA 1TB4A 4EHKA 4RHCA 3GVPA 4HMOA 3BCUA 4YRPA 4Z4CA 4R1UA 4W8OA 1XMSA 2K2QB 1SEPA 3IUYA 1T43A 3X1KA 1WCIA 4K6HA 3RJ9A 4C4YA 5KYTA 1E1RA 1RHMA 2ZPTX 1Z6XA 2IHVA 4E6EA 5EHZA 5EXTA 2ECKA 2JRLA 1DUSA 3LHKA 4G26A 1XZGA 4GZMA 3LGXA 3N3BC 3DVRX 3EXEA 2C2KA 3ZVLA 1FFWA 3SQNA 1S5PA 3ADPA 2GJSA 3GPDG 3I9NA 2H2WA 2RGUA 2J0UA 3RS8A 3GLIA 5C8ZA 5I7HA 1ZDMA 3EQ8A 3GFGA 3OETA 2PQMA 3IIMA 3EWNA 4FCCA 2VP4A 5DGCA 5P8WA 1P2VA 2AL7A 3SEAA 1KK2A 1EA5A 5GINE 2GXAA 1CV2A 1ECLA 1GGFA 3BXXA 3HEAA 4ONEA 2B20A 4WNAB 3ZDEA 4EEKA 1NWHA 4B6QA 1G6HA 4QG3A 3TTYA 1RC1A 2Y05A 3ZXIA 3WGGA 4PPYA 5EOVA 2XGMA 3ICEA 3E9CA 1Z26A 5CHYA 4BE4A 1MAUA 1E3IA 3ZQJA 2QXYA 5CA0F 1OAAA 2B5VA 4JVOA 2BMDA 2XOEA 2Y6VA 4KIJA 5K0EA 1OD6A 2AI2A 3LZ6A 2OAEA 3S28A 1ZIPA 1YCFA 4D43A 4E32A 2IE8A 2YQ4A 2ZSFA 4WN9B 4N8EA 5BV0A 4M98A 1KYTA 4JYPA 3RWMB 3WGLA 2NXWA 4B4OA 4LPSA 3EZGA 2JKZA 4TMWA 4JA0A 5ER9A 4B31A 3SFTA 3KS9A 3TJRA 5H81A 3VR5D 1X86B 2H29A 1VMKA 3S2SA 3ZHOA 1GGVA 2EZUA 2VPYA 5KHAA 4EB8A 4OLAA 2B35A 3HYSA 4RA9A 3MGBA 1WBJB 2H65A 4GBMA 1RJWA 4TMVA 2FGJA 5CD9A 2GILA 3SZUA 1YUNA 4ZAVA 2ZAYA 4YQEA 1LF0A 4OGGA 3K94A 1J99A 2V4MA 4AICA 3FFWA 2P65A 4PLHA 3SM3A 1TCBA 4RIEA 2UAGA 1OOEA 1ZAKA 2M32A 3FCEA 2QAJA 3UT0A 4M0FA 3CMMA 3D6VA 5FI3A 4L5IA 4FW9A 1E8MA 4KSBA 2FCAA 3HYTA 3ONWA 5KTYA 1IQRA 1GGEA 4PTYA 4KQCA 2J1LA 2VO1A 3HRKA 5IC4A 4RW0A 3AINA 4DCTA 1BQ4A 5F78A 3RJMA 3JQFA 1AGYA 4R40A 4FJ0A 1YGYA 1UBJS 4PIMA 5LQNA 1UOOA 5DYTA 2DC1A 4L57A 1G5FA 4BZQA 1P0FA 1EH5A 2ZE6A 4WXPA 1BGVA 3CIFA 1L7AA 1U7TA 3FHJA 5F2NA 3DUFA 2EFHB 1A8IA 1JV2B 4EB3A 4OMDA 1AS0A 2LDBA 5G4KB 2V6FA 3K15A 5I7SA 4H3SA 1IMJA 1P2BA 2JA1A 3LGSA 3QVSA 4CCSA 4Z49A 3EIUA 1Y42X 3B6JA 4K3UA 1JPVA 3D8BA 2OENG 1QMGA 1U65A 1ZSYA 2ZJOA 3LPLA 4D8VA 3NTQA 3WXMA 1WCIB 4J0HA 4BNFA 1ZNYA 5J59A 3A06A 2I4TA 3QELB 4G5OA 4TWAA 5JNSA 3SBDA 2WMOB 3LVBA 1HZJA 1LFAA 4LOKA 4UXHA 4DCMA 1A9TA 1S3FA 4C0QC 1V16A 2B1IA 1XBTA 1ZICA 1PR4A 4EPXA 3D5QA 4HX9A 2M2IA 4I5EA 2P2SA 4QTTB 5EMKA 4BO6A 2RC6A 2W2PA 5JIBA 3KDSE 3I8OA 4C04A 3B38A 2O14A 3IIKA 4FXPA 4C3VA 2HX1A 1B0AA 4CR8A 3HWX1 1BU8A 4GU5A 3M33A 2FSIA 4MVYA 4GL2A 2XUAA 2AOXA 1YE8A 2VNAA 4H18A 3AC0A 3HR7A 3QG1A 3ZDAA 4J1QA 3EG9B 3TIXB 1RM3A 3AVTA 1KK3A 5A5GA 1FDRA 1XMJA 2PWAA 1TQ8A 3PX7A 1KPHA 2I4RA 4NHEA 1IRXA 2DPMA 3WA7A 1BA3A 2E21A 4MVJM 1LJUA 2V7VA 2QRJA 4FIDA 4B6JA 3PC6A 4F2GA 1Q3KA 1ODJA 2BKEA 3T3HA 3UFBA 2C9CA 4EVQA 1JQDA 3FUXA 4RV5A 3H6GA 3CUEF 5EPPA 3C3DA 1AQ6A 2PUJA 1J5XA 2YUJA 3IUNA 5JJ5A 1N2XA 1I2BA 2J7PD 4R2MA 3H11B 3NW9A 2BF7A 2EFYA 4MV7A 2Q3HA 3FDIA 1UKEA 1KI3A 3ADDA 1V0JA 2GD0A 3BXPA 3D3WB 3JD0A 4TUYA 3CY6A 2VYND 3U4AA 3KYJB 3TNDA 1XPRA 1HQKA 3GH1A 3R09A 3IVCA 2OL4A 1HUQA 4BEJA 2C8JA 2G06A 4MMXB 4RDHA 2OPHA 4YYEA 4V3BA 3FI9A 3U3KA 2LZ0A 3CN7A 3ZJ4A 2AUTA 1JWBB 3R5JA 1JHUA 3HL4A 1R0XA 3LFTA 1GZ4A 1VI2A 2RGYA 2Y1KA 5E6SA 1JI3A 4LXQA 621PA 5IX8A 4LS3A 3W3AD 1N3YA 1LBEA 3UGKA 3NGMA 1SN7A 4ZEXA 2BMWA 4HPWA 1S2DA 3NB0A 4TTTS 1BS1A 1L7RA 1UP6A 3DBOB 3JTEA 2VPZA 4EHDA 4BVGA 2JFNA 2VP5A 3UPDA 3DB2A 1YF3A 4KE6A 2JL1A 1K7CA 3JQGB 3W7BA 5BW8A 4X9XA 4X6UA 3OCZA 1ML4A 3DUFB 4R9NA 2GEUA 4CKYA 3K1ZA 3MT7A 1II9A 4TRJA 5KMGB 3W5CA 5JJIA 1M1YE 1Z5PA 2XXBA 2BGGA 1ZC1A 1G18A 2ONKA 4G5FA 3DZJA 4L28A 3QX7A 3W79A 1P33A 4AURA 5ICCA 2RGRA 3K0CA 1EWQA 5F3RA 4NCNA 1NTRA 3F73A 3HHEA 3TLEA 2QRQA 4GC9A 4ZAWA 2OYRA 3FRJA 1A50B 3KUXA 5FNZA 4YPOA 1IM5A 1FYXA 2EQ5A 2P3LA 3CPEA 3CRQA 4RANA 4C0SA 3WKBA 3RC8A 2XDQB 1QM5A 2ZJ3A 3LX8A 4JX9A 1AKWA 1SQSA 4D9FA 5AW1A 1C7FA 4HS9A 3SHOA 2PS0A 3U7FB 1RAEA 5LZ5A 4QAQA 3FHTA 3HUEA 4URXR 3L5KA 1YB2A 4AN4A 4F4DA 3FSEA 4H7JA 3A2MA 3UWDA 2D1YA 1G19A 4EA7A 3AF1A 4ZYWA 4X60A 4RTPA 3DEYX 2QR3A 2FX5A 4NYJR 2P6PA 4I0WB 2RFLA 1O6CA 3NAZA 5IK2A 2YOHA 5M7EA 3O2SB 1PZFA 3WI7A 1W4RA 5TLSA 1PK9A 3K9QO 3WV4A 4L85A 2D2IA 2OOSA 4YHHB 2OHFA 2BEKA 5BSTA 1H1LA 3VBEA 2IKSA 1QG0A 1QFXA 2RHWA 2HMVA 5CNJA 2RD2A 1SRQA 4C4SA 1XQWA 1DG1G 1YRWA 1OFIA 3DPSA 2FR1A 3H87A 4HPXB 4X3PA 3VXKA 1QHNA 2IYPA 1SZDA 3FMPB 5LZ2A 1IG3A 1PG0A 2V5VA 3FRIA 3N0XA 5SY4A 1ZS9A 2BFMA 1LVGA 4GI5A 4UE6A 2FSUA 3IHKA 3O8DA 3VR2D 4ZO6A 5J2TA 2YN4A 5CUQA 1TYZA 2CZCA 3RUCA 4BPBA 2YRXA 3H9BA 4DNXA 1YAJA 1LDMA 2BZ1A 2H2GA 2XH8A 4W5OA 3EG9A 2M1ZA 1Z4MA 4XWTA 1E0JA 3VOSA 4HNTA 2HC9A 1JTFA 1S6YA 2D2XA 3AJDA 1ARZA 3EFBA 4N8SA 2X14A 4RGQA 5BOSB 3KB2A 4HYQA 4TXMA 2X1MA 3VAYA 1H9BA 3K35A 3P0IA 3PQ7A 3UUWA 4G5RA 2ZSHA 4G8DA 1FMFA 1PSDA 4E21A 1EHIA 4C2BA 4TQGA 5EXPA 3P0HA 2ZI3A 1CEYA 4RV4A 1Q3HA 1E4YA 4CCYB 2GVZC 4JWTA 3AMVA 2GJAA 4V2UA 3W2IA 2VHVA 4AO6A 3F6PA 3HJCA 3K1YA 2FPIA 3IMKA 5F1PA 2RCYA 3QVLA 2IUFA 1LRLA 2CUTA 4PPQA 4XUEA 1Z12A 3ZDXB 1BVRA 1NNSA 3LRXA 3O8BA 2X9NA 3RBXA 3UHAA 1DEOA 5JQGA 2X7HA 2JZOA 1N7IA 4JSRA 5B57C 3O84A 4ZICA 4YAFA 5IWAB 1J5EB 2IRWA 3RRZA 1KWGA 3OQBA 3A4LA 2MYNA 1NVTA 2X23A 3UGQA 1WDWB 4RJJA 1A7AA 4ON9A 3B3JA 3ZWQA 4KSCA 3TQIA 2AA3A 3NEAA 4AKEA 2YY6A 4CMBA 4ITVA 2RG7A 1UBSB 3X1ZA 3TNJA 1PD0A 1TW2A 4U2CA 2A5DA 1T5IA 5AW5A 3A1SA 2UUPA 5LDDC 4B3BA 5DW0A 1T9KA 3HB7A 2YV1A 3RQSA 1J2TA 2RK6A 5JZVA 3HKDB 1CUZA 5JHHB 5JWRA 5DULA 1Y33E 4DTCA 2DUMA 1NKVA 3MERA 1OFVA 2QP4A 1HURA 4HDKA 1XZMA 3ASUA 4OXKA 5D8DA 3UJ7A 4Z4QA 1CQIA 1NW5A 2W90A 3NOQA 1IL0A 5IAJA 3Q7RA 1SB9A 1AS3A 2C29D 3JATA 2FMFA 1CY4A 1CT9A 3C8MA 3NEPX 4JLJA 1B8VA 5TEWA 3GT0A 2GM5A 4KLRA 4BRSA 3CVVA 2I5PO 1ZA1A 2ZBPA 1WSDA 4JEUA 4PN3A 2QM7A 3O8CA 1TLTA 2HRBA 2HRQA 2TMDA 1IHOA 2EL7A 3LLCA 3AF4A 2ONZA 2HSJA 3K2IA 1U9ZA 2ZSJA 3PVCA 3I39X 3A6EA 4AJ4A 1HXHA 4F71A 3JAWB 3ZE8A 1CIVA 4XKJA 1JECA 2G9VA 1DJOA 2HCBA 4H2DA 2P9EA 1ILWA 5GJWC 3WJAA 1VG1A 3ET4A 4GYKA 2FV8A 1QJ4A 1FTWA 5HKBA 1CNEA 3KYIB 1VJ5A 1K8RA 1I3LA 4IO0A 4WX2B 2E9SA 5GVSA 5IT0A 2H1OA 4ZAYA 1B00A 1FZQA 3MW8A 1THGA 4DLAA 4G67A 2WP8J 3MJVA 1PR6A 4LBWA 4J3NA 3EGDB 4YI3A 3W4JA 4BNYA 4BWFB 3QE2A 1TMGE 1F2VA 3A1VA 3S3TA 2C77A 1O95D 2VT3A 2HMUA 2XE7A 4KBGA 1ZD2P 4NULA 4BWGA 5CFMA 4LGYA 3LECA 3L6OO 4G8JA 3VKWA 4G24A 3OAAD 4OHUA 3TD9A 2J5XA 1UXJA 1PWHA 3HVIA 4EK9A 1ZVKA 3WIOA 2I7CA 3OFJA 2H9YA 4R2KA 3DVLA 4YP5A 2ZAOA 3VKVA 2WU3A 3MINB 1QQAA 2HYIC 1ZP6A 2FUKA 4CM9A 4AS1A 4JNKA 1NF3A 3HCFA 5FR1A 3CISA 1RAIA 4YCAA 2X0NA 3OAAA 4ZEMA 3Q7QA 2W6OA 5HKKD 2J0EA 3STTA 2C9MA 1BOOA 4YVFA 3BD9A 4YT8A 5CDUA 4P3KA 1JQJC 1YRAA 3B2NA 3COJA 2JEZA 1N2SA 2NU6B 1CQPA 4TMFA 4ZVPA 3AZPA 1X87A 3CE9A 3I42A 1NW7A 5D3KA 3UJ9A 3EZNA 3L6UA 4C7VA 2JS7A 4UOEA 1A9XB 3SWWA 1C1DB 2N75A 3FOWA 5I4KA 3GRUA 2X7XA 3SQWA 2BYTA 1FCJA 1FP6A 3KXKA 1E2PA 3MTAA 1H65A 4REQB 3ZHQA 1N36B 4Q7KA 1IXKA 2YC2C 2ZDHA 1SQFA 3GA5A 2VA9A 3H1TA 4D3YA 4KXXA 3EAFA 3I0MA 4IDHA 5CURA 3KJFA 5F4ZA 3HN7A 1B2RA 1ULBA 2OCYC 3E58A 1EBUA 3OY7A 4QDZA 1OLSB 4KN6A 4Q1BA 1V4NA 1GG2A 3LT2A 1BMDA 5CFZA 4PZYA 2ZJ2A 3RVSA 5BR8B 2V65A 3BWEA 2PH3A 1JE0A 1SK8A 3OF3A 3ZWYA 3VVLA 4U7FA 1Q77A 5HIJA 5B53A 3WDMA 2XSZA 4DQKA 2WWXA 3JQRA 3G2JA 4M53A 4PM4A 1G6Q1 3ZLBA 5DTIA 3L8MA 3OZFA 3AP2A 2J48A 4KDEA 2R9VA 4W5JA 1TQ2A 5DTJA 3WIVA 4CJXA 1C2YA 1DEAA 2HBQA 1Z34A 1U0GA 3KYCA 5H3LA 4B46A 2EJBA 3WB0A 1Z2PX 3L6RA 1CJCA 1R6AA 2CXRA 3HFRA 2HIMA 1FBNA 3GOHA 5DK6A 2QTZA 2FSGA 1Y6ZA 3WYEA 4EELA 4PGAA 3PD7A 1G1AA 2QYOA 3BL8A 3DAFA 4JS0A 1SIOA 2V97A 3DHEA 1GPWB 3AJRA 4BAGA 3VVBA 3L40A 4B0PA 3HSYA 5B2ZA 2AFVA 1U28C 2FP3A 3LX6A 4FHGA 4L8YA 3ZDBA 3IEPA 1RRKA 3PDIA 4A10A 4G07A 1LDYA 1WDTA 4U1RA 1CK4A 2C1ZA 1PR5A 3DT8A 4F4CA 2JFXA 5LC1A 1FDIA 4QT0A 1TC1A 4Y67A 4JEHA 4HXEB 5JJBA 4L4SA 4OD0A 1RC0A 3HCEA 4KFSA 4OGWA 3ZOZA 2WYWA 3UJ6A 2GAOA 4IVNA 1K4KA 1Q91A 2GJKA 1X7WA 3GC6A 3EASA 4NYIQ 5F2OA 3I8SA 2HR1A 1YR6A 3HXOA 5AJXA 4HG2A 2H4XA 3LJKA 1BYIA 2R8PA 3NLLA 3EQ7A 1A9YA 1OLOA 1BWSA 1ZEMA 4L5YA 3D0QA 1M6YA 1XDSA 4FFLA 3QX3A 3RFCA 1NSFA 4BNHA 4IH9A 4PQEA 4F2HA 2Q0HA 4K81B 3F4BA 1VJDA 1UEIA 4NCHA 4J6EA 2AMFA 4H7EA 3IPCA 3S8EA 4BQSA 5A4JA 5IUKC 4OBWA 4UVIA 1BVHA 4PO9A 2J09A 1KZ6A 2PH7A 3U3RA 1J5PA 3W7AA 3ZHBA 4FHFA 5AXAA 3I6IA 2WIBA 1IIRA 2NZJA 4JODA 4NECA 2MWMA 3NASA 4HXGA 5IANA 1N2GA 4F4JA 2WB2A 5EQFA 3AEZA 2WHYA 1P0PA 1B0PA 5BW5A 2OQRA 2PCJA 3FCOA 1XALA 1NOJA 4EUHA 3P45A 2AFRA 3QVOA 4P92A 4PC3A 4ZT3A 2NOAA 3BULA 1ZI8A 1T0IA 3CLTC 3ZV6A 4CV0A 1DXQA 3BB1A 5CCBA 4JJ4A 5CVDA 5JD5A 2R1ZA 5IWCA 5J23A 1O6FA 3S2FA 3ABIA 1G8AA 1N2OA 3LUKA 4S0ZA 4MQEB 5DVZA 4B3JA 3A1EA 3M70A 4NH0A 5DLEA 1PNQA 3GHYA 2YN2A 5G0SA 4OBBA 1IN5A 4HHEA 5JFGA 4ABTA 4B6FA 2AJLI 2DR2A 1NMEA 1ZC3A 3IO3A 1NW9B 4HNGA 1H2YA 2FK7A 4GXRA 2CJYA 1QCYA 4QLOA 1K8ZB 1S2GA 5HDBB 1BMFA 4W6ZA 4AWAA 1VKOA 4DMFA 2SBTA 1YC2A 2OV8A 1DIOB 3AILA 1VKJA 2A92A 2WJJA 3DULA 3JD1A 3NTUA 3HFGA 5AK6A 4MMZB 4AIRA 2ZXUA 1J97A 2MTBA 1I8TA 2QMYA 2PUBA 2W6JA 1YJ5A 1O97C 4KPGA 2GHQA 1FVHA 4TWJA 4QSHA 1IPHA 1T9DA 4AK9A 4P7FA 4RK6A 1QQ7A 3FPHA 5IKPA 2KB0A 1UPFA 3VTAA 4DQ0A 4JKIA 4L9WA 4ZO4A 4ZT6A 4ETIA 4PG8A 1P75A 3TW4A 1J2YA 4Z7QB 1YQTA 3A3YA 4WFQA 2JPDA 1ZMXA 2F1HA 3GUZA 5DKFA 2OHGA 3EMVA 3NHKA 1SG6A 3P5SA 1K4YA 4FIZA 4U2BA 1Q7TA 1QV7A 2E3JA 2WZCA 4FBLA 2V6IA 4NZMA 4DZRA 2W48A 3WQRA 1Z06A 3F6EX 4RGYA 1DO8A 5SV2A 3B6IA 2ENUA 2C42A 2AFHA 3H16A 5IM4A 2JGIA 3I45A 1XZFA 1JHYA 4D9MA 5HZGA 4UHKA 1R0YA 4QT4A 3A04A 5DLQC 2B34A 4DQDA 3BB3A 4M54A 4D96A 5BSFA 1JLRA 4LJRA 1EE2A 1QK3A 1F8XA 4QLAA 3U19A 2K7FA 4TT3D 5DNAA 3QTBA 3JTMA 4JQCA 4O2BB 5CYPA 1YDEA 1VYHA 4E5UA 1NP6A 4HH0A 4XB2A 1C9KA 2R6FA 2EDCA 3NYWA 1F2UB 1BWRA 4R1SA 4TYYA 3E9MA 2NUAB 1EX1A 3U1TA 1U1GA 4REOA 4C6TB 1WM1A 2IHZA 4ZOBA 1W1WA 3FB1A 5ECYA 4OA8A 1H6AA 1RYEA 2WU1A 4QNRA 5IZCC 2GFIA 4MIOA 5JPDA 3SK0A 2P9TA 4JLMA 4TLDA 4BJ5A 2R87A 3OCXA 4JJFA 3V8NA 5CFPA 4NCAA 1MV8A 2FZKA 3STWA 1ZN8A 1YJQA 2BMAA 1JHMA 4RMJA 3JQ8B 1WHSB 2IUSA 3LWZA 4NAVA 4X20B 2R4QA 2IFTA 1EXWA 4FKMA 4IGFA 3UQZA 3HS3A 3FDJA 1JPUA 4B2LA 2C95A 3AR4A 1GQFA 3GHHA 1SOVA 1NBAA 3E3NA 3MCWA 4GQBA 4DCOA 1MX1A 2VJKA 2EKDA 3EEQA 2PX4A 3EG5A 2CSUA 1ADBA 4P31A 1VB5A 2DQZA 1F6BA 3LO5A 2Q6IA 1Q1BA 2KYRA 1R6BX 4ZQFA 1QG4A 3RJTA 4ZHSA 2HNBA 2PV7A 3F67A 3KELA 1W4BA 3YASA 3EXIA 2O0KA 3U7JA 4TMXA 5IXJA 1C1HA 3WNQA 2R4UA 3IJ5A 4YDSA 3QU7A 2DULA 5ERGB 4JDPA 4LOHA 4C4ZA 5BXYA 4CM5A 4GYWA 2J8ZA 1UMDA 3I2IA 1TPZA 1G7CA 5IKEA 3R76A 3S27A 5CGQB 1Y1TA 1SCUA 3E0QA 2QW0X 1A0OA 2WHRA 2XQFA 3OO1A 4PSKA 3FZQA 1QRAA 5D51S 1Y7PA 1GAQA 1RRVA 4XJSA 3A31A 1UJ5A 3EH2A 4BGUA 5KYKA 5JTUA 4WK4B 1DEXA 1DBSA 4X7RA 4YUAA 2QM0A 4RMIA 4Y18A 1L6RA 2PD3A 3HN6A 4LHXA 5DHRA 1YI1A 4NAHA 5SYAA 1VMAA 1XVLA 1EFCA 1OAOA 4RPLA 2C2XA 3KT8A 1WVGA 3GJ4A 3S1LA 5KWIA 1KXJA 1HBJA 3NEJA 4UC0A 4QO7A 3VYTB 2IOFA 1XC7A 1E7WA 5BRAA 4QA9A 2NSJA 1UK9A 3T7TA 1YA8A 4XIIA 3QNWA 5EZ6B 2VPXA 3I1IA 3T5CA 2Q0QA 3R3HA 1LSOA 3K8QA 1MORA 1TTHA 4UUAA 3TBKA 3V1TC 2YV2A 2OG2A 2ODWA 4BV8A 3T1QA 4HKTA 4JJ8A 4ZVSA 5ISMA 3T9BA 3UGJA 5M29A 4C1NA 1FFCA 2H85A 3PR3A 5FAKA 5AJVB 2P5SA 1LK7A 1MKYA 1USWA 2I29A 3HADA 3PNMA 4FVTA 4QULA 2EG9A 3KQUA 4ER3A 2EX0A 5E4JA 4LXXA 2BMVA 2AFIA 4HQ0A 2IOFK 2B1QA 2V74B 4OAOA 2F2TA 5JASA 2VZ0A 1P6UA 2NUTB 1EAYA 4CIXA 4H7DA 4C3OB 4HD8A 2QAGB 3RTEA 2QF7A 1NDUA 1O97D 1L4FA 2BOVA 1PLKA 4AQ7A 3B9QA 4JWKA 3HACA 1RE0A 3ZQ6A 2IYQA 1A04A 1CR5A 1N0HA 5CEJA 2OVFA 4OEHA 4JCCA 4KZPA 4K88A 1II0A 2DHEA 4P4LA 4Z0HO 3LSTA 1EXDA 1OA1A 2BR5A 5JRJA 2G28A 1F20A 2QROA 4LSMA 1IZ7A 4L22A 1PQWA 1YIOA 5HCNA 4EL0A 4YCLA 3NBXX 5KO2A 2GM4A 2ZWPA 3DQZA 1Y6RA 1M2VA 2GPWA 2R7MA 4OQNA 3MUOA 2ZWMA 3Q3CA 2VPIA 4OHPA 1Y98A 3DAYA 1DU4A 4DUGD 3UV7A 1N0IA 5KSPA 4EA8A 4CIVA 1KORA 2JIMA 4FW8A 1C41A 4MQBA 2WABA 3F71A 5ALFA 3E9YA 2XQIA 1ZM9A 1CFZA 2AV6A 5BMVA 3L4JA 2C1XA 3ILHA 2PUHA 3MZ0A 4JLAA 5JQGB 3U2QA 5B7QA 4EP1A 4X00A 4G36A 2VI5A 2HJHA 1B8PA 3QNUA 1G6KA 2QMQA 4HUQB 1EX9A 5DYIA 2FUG1 3QOFA 5IAEA 3B6ZA 3L0SA 3OUTA 2DRIA 1UBFA 3QXCA 4WKGA 5CLQA 4CLEA 2AJ8A 1ORRA 4MRMB 1RM0A 5DYYA 3E15A 2RHBA 1M0WA 4UTXA 2QD5A 2X7JA 2QZ4A 4ISCA 1VMIA 1VHDA 1QONA 2EJWA 2IYVA 5GONB 6PFKA 1C7ZA 2Q3CA 3EXAA 4MGIR 2XRZA 4WNYA 3MCUA 3IUMA 3ZCUA 5E9QA 1IUNA 1NLYA 1AXGA 3KJIA 3Q3EA 2B2XA 4URWR 1C4KA 1TM1E 2AI1A 2X40A 4XGNA 3TL2A 3ZLUA 2OC4A 4NJMB 3ZY2A 1KIMA 3Q7EA 1PDOA 1UIRA 1FS5A 3IVMA 4ZCQA 4OPMA 2UZIR 1Q12A 2B8WA 5JCXA 1N9KA 4I8XA 4XSVA 3AETA 4AX4A 2NV0A 5J2TB 2H4FA 1JDTA 5H83A 3U7EB 1OLXA 3LUAA 5JO9A 1TADA 1S9DA 3FG9A 2HMSA 4KOEC 4DAEA 5A3RA 5JAZA 5IRCD 4RV9A 3L8HA 2PUWA 5K8UA 2HHHB 4O0LA 4D3DA 4CZ2A 1Z2AA 4J76A 1L9KA 4GH5A 5CTJA 1JHVA 3HCWA 4XVUA 5A0VA 1ESNA 2BM0A 5B37A 5A03A 3RRNA 4JI7B 2VP2A 2XZDA 2ZB8A 3NDRA 4RFVA 3FHLA 2FZWA 3Q3JB 4KE8A 2FEKA 4L9SA 1VKHA 1WUYA 2A5FA 3RIGA 1SBYA 3K70C 1RJGA 4U7WA 1L4EA 4YIKA 2R8XA 1G8KA 3I9OA 1X2BA 3PDJA 3A0RB 4JLKA 1E1QD 1I3NA 5CCXA 1PR1A 2Y1WA 3TL6A 4PFKA 2Z2JA 2ZJ6A 2AVNA 1VL8A 3PIRA 1Q3TA 4XVCA 5BNZA 2B8EA 3SC6A 2EG5A 3I12A 3IDFA 2OZPA 4LCBA 4FGSA 5F33A 4BHTA 5ALOA 2YXEA 3KZXA 4R71A 4YUYA 1UFOA 3GJRA 5K03A 2QTLA 4QU8A 1Z5ZA 5EL0A 3VNRA 4FYVA 4YJ2B 1L4MA 1OB2A 3RUIA 3Q2KA 4M1ZA 2Z3ZA 4Q3NA 1KMQA 1MOQA 2A0KA 2JBHA 3HKCA 4MCJA 4QUKA 4MPPA 2ZJFA 3QSGA 2V3CC 1W1IA 4HSEA 1Q7RA 1RQ7A 5CDGA 3B7GA 1JIQA 4E70A 1RLUA 1YRYE 2HLDA 2GUGA 2XUGA 1GILA 1T0BA 3CEMA 3OESA 1EVYA 2IXBA 5EJGA 1ABBA 4G1CA 1NV8A 3EEBA 4W82A 6REQB 1XYVA 1MF7A 5JOQA 5JAIA 2QUBA 1XLVA 2WU0A 3GJ5A 4AG5A 3PUYA 5ALTA 3X1DA 1SA0B 2O1EA 4NWIA 5DASA 2A9KA 1IHDA 3BRCA 5IJWA 1L3BA 1T4MA 1YKGA 3HGTA 5IT4A 3GEMA 3FTFA 4MYTA 4DRXB 1P1KA 1PWYE 4ZC1A 3R9XA 1ELOA 3IVGA 4JP2A 4AWXA 4CLRA 3R5TA 3FMOB 2ID4A 4XJTA 3CNLA 5J4LA 4X66B 3W5UA 3E84A 4LJ9A 1M8GA 2RGGA 1U2GA 3USZA 3GCZA 1BD4A 3A6ZA 4I2VA 4GR4A 1UFKA 1D2GA 5L7WA 1VIAA 3REGA 2JV2A 3PI6A 1AQJA 2OO5C 3EIQA 1QG2A 2RHCA 2Y1OA 3MXTA 4ZYUA 3U4QA 3CGWA 1SCKA 1LLUA 2XCTB 4XWOA 1QHHB 3O9MA 5C31A 2ZBVA 5C1DA 5AKLA 1US8B 2QU7A 3DBHB 1Q83A 3TH5A 5C5IA 1G98A 1KI6B 3NTVA 3DMDA 4FX2A 2XZTA 2ZREA 2DWOA 2X8AA 3CRW1 4OP2A 4QVIA 2BZSA 2ZSAA 1X3SA 3DKPA 2NT4A 1S3SA 2P35A 3E18A 3THYA 4AI6A 5DNYB 4XVRA 4Q05A 2HLHA 3KAPA 1ADJA 2ATCA 2HJVA 3OZCA 3LCRA 1G0OA 4DLWA 1M2EA 3H5NA 4IOLA 5JO0A 4ZAFA 1BH2A 1G3IA 5LQJA 2JFOA 3CUYA 2PH1A 1OHHD 4HQNA 4UHFA 4RORA 4B4VA 2NTJA 3IAEA 4ALMA 3CRMA 3W5VA 1I5EA 3A8TA 3G2MA 1M2NA 3WRVA 4Y6QA 1PJSA 4BKUA 2OGTA 3UT5B 4B3RB 3EAGA 2BGRA 1P60A 1R12A 2X2OA 2ZJZA 4UUMA 2A3RA 1YBAA 1U8TA 3R8XA 2EJUA 1P8AA 4CQLA 2YRFA 4IR7A 3QKRB 4NENB 4IIGA 2YIJA 3BRQA 5BV1A 3UAYA 3PC2A 1TT7A 4AQDA 3BD8A 2FUEA 5I7OA 1NONA 1TU4A 1XDDA 3K6SB 4GZ3A 4MI6A 4U4AA 3HBLA 3HK2A 4UU1A 1TEXA 1KR2A 2CMDA 3MS7A 4YCCA 3W8DA 4ZU6X 1Z33A 3CNHA 1EKXA 2F00A 1F9AA 3BERA 3P2MA 4C0HA 2NZUG 3FGPA 1QIMA 3D8TA 1XA0A 3NNNA 1IEQA 3IO5A 3NM4A 2NQ2C 3AM1A 4EKGA 3DOFA 1Z82A 1JQ5A 4TLEA 3VPXA 1TVKB 3RIEA 5EEGA 2OD9A 4R0NA 5G0WA 1C8BA 1JNYA 3ANXA 3NYQA 4MUBA 2IUEA 4MV4A 1ZSNA 2B4YA 4NU0A 4CTNA 3R9KA 4E31A 2C1EA 3BWDD 4ZTBA 1BCRB 2J9XB 3AOGA 3BG5A 3ZCVA 2ZRGA 1CXZA 2J6IA 4YP0A 5PGMA 4C06A 3MTGA 5FUYA 5C7YA 1M8JA 1N3LA 5H0IA 5C5CA 3T5GA 3ZV3A 1IBLB 4JUDX 4KK4A 3V8RA 2Q8PA 1ANKA 2D74A 3VSEA 1EG2A 5G0VA 1YHNA 5CLJA 3DDNA 3D3KA 1OVGA 2C07A 2R47A 4G2TA 2FX3A 1G21A 5LZ9A 2H7XA 1ATZA 4P83A 3V3TA 4TZ6A 2V6GA 2QHXA 1O4WA 2VDWA 3ZJ5A 5HBGA 3ROGA 1O94C 4DDMA 3C74A 1Q14A 4JENA 5E9WA 5ED0A 5EWMA 3QF4A 1PWXA 1WP9A 4P3YA 2B37A 4RY2A 1V8BA 1PHPA 2O4CA 3ZHTA 1TTPB 1B14A 1JKMA 1P6QA 3IKMB 1NMSA 5JSUA 3MGAA 4GF5A 4RPCA 4BNXA 1JBQA 2FVYA 5KUTA 5KVAA 3SJZA 1GFWA 2BFBA 4W7SA 1LVHA 2B4AA 1U2TA 4I5GA 4DMHA 2AFIB 1Z5WA 4KXUA 4NCJA 3DEHA 4MWDA 2A9RA 3D8NA 5KINB 3G88A 1IXRC 2J87A 2UDPA 4URFA 1XO1A 4MUKA 2REQB 5K3BA 2J85A 2O5RA 1SD5A 2GBLC 3K4PA 2X4IA 5LWHA 4XYLA 1Y8QA 4L5BA 2JC3A 4NF2A 2CFSA 5JV5A 4Z0PA 2NU7A 4ND6A 1OXMA 3PX3A 1ZWLA 3DYVA 2Z4TA 4KI7A 4DSOA 3IA2A 5D5HA 3H0KA 5E2AA 3AXSA 4N0DA 1SHKA 1DZIA 1GUYA 1THMA 3OQ6A 1X3LA 2XYVA 4G0UA 3C14C 2ZIEA 4PC1A 4G9BA 3V55A 4L51A 4HC4A 1K6XA 1KK1A 3E53A 3RUFA 3AY6A 1MA3A 3DDSA 1G7RA 1V3VA 4Y2SA 5BMVB 1H0SA 2WE8A 5MF6A 2DKNA 1M2FA 5J2UA 1WULS 4DMUB 3OOYA 1JHRA 4V03A 1KVTA 3ULKA 1QIEA 4I50A 4H6PA 3D3WA 4YP1A 4ZOQI 3JQQA 4QEKA 1CUSA 3RARA 3AVWA 1VTKA 3KE8A 1U81A 3U61B 1CR4A 4B4KA 1Q16A 3CH5A 1C5KA 2DTEA 3BWYA 5KNCH 2VQFB 1CU1A 1DDOA 1F6WA 1E1CB 3NHZA 4PV7A 2XF2A 1JR6A 1MOPA 3KU4A 4B7CA 1PFGA 1TVKA 4K9OA 1KFJB 5TEVA 4RELA 1T5BA 4QYXA 3IV7A 3VOAA 1W44A 3BT7A 5DRYA 2MM2A 1U9IC 2PV0A 4G0MA 1ZRNA 4N5MA 4QSMA 2WNSA 2HMYB 5BSVA 4O3MA 3ZNNA 1C50A 4V39A 1E66A 1XOIA 4DCGA 3FRHA 1GAWA 5ETJA 4YRAA 5GJBA 2J3DA 1YB7A 1SVUA 5AT1A 2AG5A 3AKYA 4YYZA 5FV4A 5CB8A 1ESDA 2D0OB 1PUXA 2XKJE 3UCXA 4A7PA 1V3TA 1XGKA 3D0OA 3SJUA 4A5SA 4CV3A 1GP2A 1Z0KA 3BIXA 3OE1A 2FVXA 4WESA 5IJAA 2FP4B 3OWXA 1Z4KA 3M0EA 3RRXA 3W1WA 2R7NA 3TLJA 9GPBA 1HYEA 1AN9A 2V54A 3N5CA 3REQB 3OCCA 1NMQA 4JHXA 4PWZA 2NXEA 3TB6A 1V1MB 2FPUA 5SZIA 1HORA 2QM8A 5D87A 5DOZA 4BMZA 2A5LA 1XMIA 1ZD9A 3HZOA 2CY0A 2YRWA 3H3XA 1TC2A 4UBOA 2PS3A 4Y1EA 3IBTA 1N5KA 2FG6C 4L8LA 4YUXA 5JTTA 3DZHA 3AP3A 3THOA 2ZRCA 2PGIA 3KWFA 3C16C 4M7OA 4HUJA 2IBSA 3GGGA 4I36A 4G41A 4CIAA 2L19A 5AKKA 5CG2A 3AF6A 4R2HA 1D04A 2VBGA 3FA2A 4HCJA 3DOJA 2M6RA 1XCBA 5JYDA 2O5CA 4QXOA 1GARA 3NFYA 1WLYA 2V8OA 5EQTA 3WL3A 3L05A 1DEHA 4G25A 4LDRA 5AI0A 1EK0A 4BLRA 1V39A 3Q8WA 4LSWA 3RR2A 3L4SO 1XE3A 3T5TA 3KOOA 4DR1B 1M5RA 2HWYA 2QI9F 4EH1A 1L5FA 3L46A 4RESA 1E3DA 3U7QA 1W19A 4RJTA 2P2NA 2CJWB 4NL4H 4ZT5A 4AN0A 4XFKA 2PUVA 5SYNA 4P7GA 3GGPA 3EGEA 3VTZA 1ZH6A 4M76B 4UDXX 1RACA 2BRUC 3NVKI 2PKWA 4JB0A 4P84A 4NHOA 1NKTA 1I3MA 1XQ6A 2W43A 2MYTA 3GFOA 3UG7A 3AFMA 3ISJA 3TFWA 3ZDCA 2BEUB 3D8SA 2ILTA 3D7LA 1Y8RA 4G56A 1HKHA 5K4GA 5F1YA 1JKXA 5AOAA 3UKDA 5KNBD 5B30A 4A15A 4F6CA 3F5FA 3TSAA 2AIRA 1L7MA 4DWVA 4ZGBA 1KJNA 1T4GA 1OFHA 1B76A 4TV8F 4ALLA 1MJFA 1W48A 4KAFA 2VJYA 3U40A 5AIAA 1EFVA 4DXAA 2ZUSA 1E69A 3BDIA 5B12A 3IR5A 4LQDA 1EZZA 3RC9A 2Z5LA 2AFHE 2GCEA 4BRWA 1QHYA 2G6TA 3L1VA 3KYDA 3MSXA 1FW6A 2ZRFA 4YMUA 4BKRA 4EB6A 1XZEA 1VJGA 1K88A 3O47A 2PMBA 4ODIA 4PYQA 3TZEA 4BO7A 2FEPA 4DRZA 4DQVA 2Q4EA 3TCXB 4W9NA 1E2HA 2CJXA 2B7LA 3QU9A 5KCZA 3DOHA 4R7GA 2IZ7A 4Q24A 4US0R 3IQGX 3QE4A 4MA5A 1NNUA 1X19A 3LUGA 2OFPA 2J3EA 3I4LA 3CKYA 4BXOB 3AERB 5LA6F 1K06A 5CB4A 1QP0A 2E82A 4IJVA 3VZCA 1PEDA 1U8ZA 4FILA 1JSCA 3LHSA 3UBMA 4F8JA 3GLIE 4J16A 1CS0A 2PWPA 3E5RA 1PK8A 3HYRA 1E7YA 4Z7JA 1FBTA 4XQ0A 4CF7A 4RC9A 1HH4A 2K7ZA 4C03A 4MW6A 1HNWB 4K6FA 5HGXA 4JLBA 4YQYA 4FR0A 4UULA 2OHXA 4UPVA 2GHIA 3R4VA 2HLDD 4FQ8A 1GAXA 1YACA 2NMVA 4QNNA 5IH3A 2XMSA 1JXAA 5AJWA 4A82A 4AG3A 4BB0A 1R6DA 3REQA 2V45A 3V4ZA 3A05A 3MWKA 4H16A 4J2HA 1C4OA 3FKJA 4Q7EA 4MR7A 3QHAA 4Y2YA 2I6QA 4QRIA 3VYRB 2ECPA 3LPMA 4Y0AA 3J7TA 1RLOA 1SAYA 1TZBA 1XELA 2GM3A 2J3IA 2RKBA 1KS2A 2VOEA 3KKOA 4N82A 2R8RA 1AKQA 3Q7TA 4NP6A 5IARA 1YOVB 3OIDA 3EA0A 2OXTA 3FZGA 1QWOA 1WDMA 1AOXA 5AQEA 3S2UA 3SJ7A 2CDRA 2V7PA 1XK6A 1M1UA 4DF3A 4Y8VA 2VDRB 2UXCB 4LRYA 5BQ5A 3FNBA 1XFAA 4WI1A 4DUYB 1HE1C 4L2IB 4KFCA 4DR6B 2XE4A 4K40A 2AYZA 3JQAA 2ZRAA 1XL1A 4PC7A 3C4VA 2AQ8A 2LVBA 1L3IA 3MQ4A 4MV6A 4FHDA 4G01B 3VC2A 4JP5A 2O5EA 2X3UA 3I83A 1U8UA 3AEKB 3UA3A 2PKEA 2TECE 3WGMA 2QLTA 4KHZA 2ZOSA 4X24A 3CVOA 2I0FA 3QJ5A 2QGFA 5BOSA 2A67A 3OQJA 1KC3A 1B8OA 3IUPA 1J2RA 3KTFA 1I6MA 1ODIA 3SIXA 1GPBA 2I80A 1JDVA 3T4EA 3F7NA 4BKOA 1H4TA 5LYYA 4NBNA 3GMTA 3N58A 4D0GA 4R8KA 3PNOA 5A1JA 3OX1A 1KEEA 3E23A 3WHPA 1F8FA 2SECE 4KQJA 2ADMA 2OY0A 4XQ9A 1OHHA 1T8SA 1LVUA 2X8WA 3E9DA 1FVFA 5FT9A 2XAAA 3EUFA 3QMPA 1QVRA 3GLFB 1DG9A 1E18A 1BFKA 1VKRA 3E9QA 3TMYA 1QR6A 3V1NA 1PJAA 3AGPA 1EFVB 1XROA 2JFHA 2QE7D 1UKZA 3N05A 3EISA 3RANA 3RC1A 2C84A 1KMIY 1GXSB 5KI6A 2FLVA 1P18A 2IXDA 2XRMA 2YBEA 1FX0A 4LZAA 4CN9A 4HLNA 1PJTA 5D6WA 1T2FA 1ZIOA 4XYGA 5L6MB 4M0LA 3SDBA 1QDUA 2ZRDA 4IIUA 1PNRA 1XXLA 2WSLA 3T61A 3TFQA 2OV3A 2ZG6A 4D97A 4KO2S 3ECCA 3IV6A 4O5AA 5A7GA 2P2CA 1W30A 1HEYA 3RVQA 2ATXA 2WSYB 2YOGA 1BE0A 2X6TA 4FOPA 3DTYA 5K09A 1LRJA 1E6CA 2NW6A 5C9ZA 4EBFA 1ZJ5A 1QJCA 3IQEA 4KB5A 3OECA 1M7BA 2XNJA 4X8LA 1DUVG 2AFIE 2GFHA 1PFWA 4ASUD 4MI3A 1GTVA 1W46A 2XWPA 4D6XA 3L7CA 4MEJA 3A3KA 1VGRA 3GFQA 2IHKA 4DC0A 5EIAA 5EI5A 2BMJA 5JU6A 4EKDA 3NGXA 4NNJA 3UOWA 4AFNA 1PR0A 3JD3A 3P9SA 1FDOA 3DO8A 1T2EA 1UF9A 2NAPA 4GMXA 3DBRA 1NP7A 1SXJE 1BDHA 1VCIA 2IV7A 5KZMB 4WZAA 1ZN2A 2JLZA 1QC5B 1NPYA 3QKIA 2PM8A 3ED1A 5KC9A 1KZ4A 2A9VA 2WTBA 3TAXA 1I4WA 2ZJ0A 3N6XA 4IRXA 4O2AA 4W1RA 4R1LA 1EWVA 3A25A 3SQXA 3AUAA 3PNYA 3WLMA 1UQRA 1NU8A 2J41A 1CJVC 1C8LA 5HR5A 1RVV1 2OXCA 4Y6PA 1G20B 1NSYA 4NJOA 1IWBB 1MC8A 1B4DA 2WT9A 2D0PB 3F9IA 3QOYA 1UKCA 3WWDA 5HUJA 4TZ0A 3LCVB 1BGXT 2DLDA 3SJBA 1M1ZA 3EW7A 3LC2O 2UUBB 1AJEA 3WLOA 3VPFA 2YXDA 4MIKA 4QWWA 4KXQA 4IIXA 3DLPX 1Y4AE 2ZULA 3NDJA 4XVQA 3R7AA 3UF0A 3QTTA 2FK8A 3JQ9C 5KNDH 2B1GA 3V4SA 4OREX 5B1DA 3S1AA 4P4NA 1F60A 1YJAA 3VHLB 4BNDA 1Q0ZA 4BOYA 4UUOA 3ZCTA 4LF6B 5KTOA 2K4MA 3G8BA 3M3HA 3TL3A 3CFYA 1KY5A 4WCFC 3R6TA 3DL4A 4PGMA 2IVZA 5I3CA 1EFKA 1VJ0A 2F1IA 3DC7A 4DDTA 4GO1A 4TRMA 1IN7A 4N41A 4Y6GB 2R6R1 5IDYA 5C34B 2JLSA 3UO8B 4OG2A 4ZYVA 1NVVR 4AJHA 1Q95A 4PZ0A 5C8YF 2H1IA 2VHEA 2OO5A 1W5AA 2Y93A 4E2FA 5GAJA 2QTVB 1AK2A 1HEUA 1UQTA 1L5SA 2AE2A 3M6XA 1I30A 3P4YA 3W7VA 5K8CA 4Q9IA 3I9KA 5BYBA 1S8FA 4KVFA 1KETA 2G07A 5IM4F 1EA7A 1W59A 1KU6A 1IH8A 1C3EA 3HN2A 5BQ3A 1SUSA 2SICE 5E7QA 4YP6A 4IDPA 1OXXK 4QFDA 2JATA 1I9CA 3SC2B 1XEFA 1SKBA 3ZQ4A 1E7SA 3ZY4A 5DRTA 5H9VA 2V8BA 1L1EA 1X1RA 1NHGA 4ZO7A 4RNDB 3KZOA 4E94A 1TK3A 3BXZA 5DTEA 1VKNA 2HKIA 2O8CA 4JJ7A 2QRVB 1RXSA 2BBOA 5AW7A 5AKGA 3A6JA 4UTZA 3G8DA 3B51X 3FPKA 3BFPA 4L0DA 1NNEA 3HP1A 2G8NA 2RIRA 3ZWBA 3X1XA 1WXFA 3VTKA 2FI1A 3SYMA 3CVXA 3A4MA 2WU4A 9ATCA 1CUAA 1Z8FA 4HXFB 4NU6A 4ENWA 1T6XA 4Y2GA 1MB0A 2CFTA 2FPRA 4PGFA 2C04A 4HEJA 3E3OA 1EVZA 2FZLA 1E59A 4WXEA 1KEPA 2W0SA 3UJBA 5BQXA 5IDQA 3DB1A 1PJLA 2A9QA 4N0QA 3ZCQA 4AUMA 2PNJA 2GJ8A 3EWSA 3G68A 3NWBA 3PQCA 4DCUA 4MR8A 4F5EA 1NMYA 4NNOA 6NULA 1E3WA 1T15A 2F48A 3ZDYB 4LGCA 5ICMA 1Q7BA 5FPSA 3N76A 3CR3C 3ELYA 4BMPB 2O8VA 5IKOA 2YJNA 2VQEB 3SE0A 3BTOA 3DW1X 3ICVA 4HF7A 1UMBB 2GF2A 4M6WB 3W9BA 2BCEA 4E5MA 1JIVA 4K9MA 3KOXA 3IVAA 2Y9MB 3VPHA 3IXQA 1KEKA 2NVUB 1JSXA 1L5QA 1ZXXA 1R10A 4ZHQA 4J2OA 2IPOA 3MRSA 3QBTA 4I8IA 4JZYA 4W1PA 1CY7A 4GGOA 4B3CA 1P29A 4C22A 1DHTA 2E7ZA 3LP5A 5K8TA 2VDKB 1C8VB 4YRJA 3KQHA 2QP9X 2XE6A 4IYRA 1O6ZA 1OIWA 1OQAA 3K31A 2WFAA 2WZDA 5HRCA 3LZDA 3DMTA 3VZRA 3BK1A 2IODA 5K0GA 4U3JB 1LLFA 3CZRA 3LXUX 1ST2A 4IEEA 3CZ9A 2CWWA 2PH5A 4HP8A 4TWBA 3RPEA 2C97A 1XZBA 4ND3A 2JHAA 1G3RA 2TMYA 3TWOA 2WJAA 4OCZA 5LVAA 1OYYA 3M83A 5JMTA 5TF4A 2GWHA 5CIWA 3CONA 4GX2A 4UNPA 3PCXA 5IC5A 1R4NA 3RC7A 1WETA 1E9CA 4NOJA 4OHXA 4NESA 1C9EA 5FWXB 3C6MA 3VOTA 1QYRA 3K9FC 1ZR2A 3ED5A 1VIVA 2QX6A 3GZTB 3PITA 2QG4A 4PU0A 3DOUA 2CDNA 1OFTA 1DNPA 2BGUA 1K7FB 3HV0A 1ULHA 4CV2A 1NG1A 2FPWA 1EJ6A 3N2LA 4RF2A 5EJ5A 1HG0A 3Q7PA 4FYWA 2QN3A 2FU5C 5KDOA 2ACVA 2YICA 3DCNA 4GEKA 5KTNA 3M5WA 2BFBB 2DJIA 3K9NA 3U44B 4WFKA 2WVGA 3M9WA 2MSLA 3TDNA 2XY4A 3LM8A 3PDCA 4AROA 5BNTA 3ER9A 4QUGA 1U3GA 4B2IA 2D7DA 1QP7A 4LV5B 4ER7A 1EM8A 3Q3IA 3OTHA 3U39A 1U94A 3W3ZB 1X0VA 1Y8AA 1Z0DA 3DJFA 5E8JA 4D6PA 5KHOC 4WKPA 4BX9A 2H2DA 3N0WA 3RGGA 4PFSA 4DIKA 1E77A 3BDVA 2QJWA 1EVJA 3C6BA 1XD8A 3IP5A 4HRYA 3RROA 1QFSA 3KAJA 2Q6OA 1JSLA 4PHFA 2X0RA 1V37A 3BMCB 3D6MA 2JGDB 2H06A 4MUGA 4Q3DA 4Q3OA 3CRVA 3KZNA 5F73A 1YK0A 1IY9A 2KY9A 5EZSA 4G1BA 4MKHA 4NDAA 3EZ7A 1T2UA 4LUCA 1O87A 2WSSA 2ZIXA 4QGGA 3TMKA 4FYJA 3V7WA 4R3WA 5CFQA 3H13A 3W5JA 2CNOA 1YQDA 2GS9A 3HP4A 1BFUA 2HUPA 3DKIA 3IEMA 1YXMA 2E37A 5SICE 2EHJA 2BCGY 5DNVA 2H4WA 2PYZA 3V6MA 3HU3A 3ANNA 4B3GA 3U81A 2R62A 1PGPA 3FYTA 3GUUA 3O5AA 5EJFA 1L8XA 1N9GB 1L7DA 2BBTA 3OP1A 2CHEA 2P4SA 4UBJA 3FF1A 4DLKA 5ECDA 1XXHE 3P0FA 4PLWA 3RVDA 3L7DA 4ZAGA 3UAGA 1KEUA 4DJ5X 5F12A 3ZVNA 4RTNA 4KTTE 2GN9A 1JTVA 1IK4A 4J0QA 5LOVB 3LUFA 3DWEX 2RI1A 5IVDA 5F1KA 4CQMB 4KKXB 3ZTYA 1S3IA 1FSZA 4CKEA 5DN6D 3NV7A 4DY4A 1JMKC 4YA6A 1ZGCA 1MRNA 2UUCB 1WXXA 4YLEA 4LHWA 1P5ZB 8AT1A 4K7JA 2W37A 1D09A 1JHQA 2XTNA 1KY2A 1TEVA 3LUDA 4B4DA 5AW8A 4IDBA 5FBQB 5IT9A 4E11A 2QENA 2GB4A 1UC4B 3JS5A 3ADBA 5KTRA 5KWJA 1WQ3A 2LRHA 1KQPA 1M10A 5H9WA 3RIMA 2WQ6A 1U0TA 2VJMB 1XZAA 3CO5A 1I2ZA 3LPDA 1XZCA 2RJ3A 4R9VA 4U3JA 4RXUA 3RK0A 2O2CA 5IF9A 4ZVLA 5BP7A 3PG5A 2PR7A 3OKCA 2Q2NA 2HH9A 5FPTA 5TXGA 1SU6A 3P0JA 2I6FA 3THXB 5JZSA 4DY6A 2IHNA 1I0LA 1HSOA 1KMHA 2PMWB 5HM8A 2C5BA 2XUIA 2ZWIA 3VU1A 3CR8A 4B71A 5AQ1A 1OASA 2W6JD 3WLPA 4ND5A 1UC8A 1JIKA 4PSDA 2BFCB 4RPIA 3SJCA 5K6AC 2YZ7A 1L6IA 4CPDA 5LMCA 2BP7B 4R2IA 4NOKA 1G3UA 2X13A 3UXEA 3MEQA 3DEAA 1VJTA 2A78A 3SJAA 4BV9A 3RU7A 2HFKA 2JZCA 2OLKA 2XR1A 2RSLA 4TQUS 3AVXA 4EG4A 2NO5A 3ODPA 2PZFA 1I36A 4OYLA 4UBIA 1R16A 4OXNA 4V0QA 3AW8A 1V43A 5CA1F 1FDUA 1ULUA 2IUUA 4HDOB 1VBFA 1JU9A 2GXUA 5HS6A 3R7BA 3GPCA 3H9QA 3IPLA 3ND6A 4YO8A 1TUBA 2GK6A 1AHPA 2UZ1B 1WSAA 1AKUA 3F0TA 3IDQA 5DXFA 3WVNA 3QPDA 5FL7A 3T38A 5J5AA 5CD1A 4QBGB 4UEQA 1Z6AA 4M87A 1JU4A 1GCOA 1CJSA 2O2IA 1JILA 2HLNA 3P2JA 3O0DA 4BNLA 3T99A 3QVGA 3T94A 1ITZA 2RGWA 4U63A 4URHA 2XOXA 2CFOA 2BHNA 5D6YA 2V0CA 1P39A 4HZUA 1CEEA 4QYWA 5KYUB 2FH5B 4WGGA 1XSEA 2YXPX 4FNOA 5ERYA 1L4YA 5T8KA 3B3GA 4CF5A 4RULA 4YRLA 5CNKA 1XTSA 3TRDA 3PE4A 1P45A 1A77A 1UBTS 5CBPA 2V1XA 2HA0A 4TMKA 2Y9PB 1YONA 3ZUPA 3ROZA 1B93A 1JEJA 1P9LA 2ASVA 2WNIA 3IQXA 3KSMA 3LVRE 1YH3A 2VJLA 1B3BA 4E33A 4CMCA 5K8VA 4K46A 4C4AA 1QVWA 2XYHA 3ND8A 1PZEA 4HBGA 4Z4IA 4OQZA 1DKQA 3L4BC 1T5DX 2E4WA 3U3MA 1RYYA 4AXXA 2A3NA 2I91A 4ND7A 1D2HA 3MRTA 1RLMA 2I33A 3CW2A 2F1OA 2BFAA 2OO7A 3C3YA 3JXEA 3MJFA 3GJXC 4KU4A 5ER6A 3U80A 3ZNOA 4ZP1A 4UAJA 2O8CB 2ZRKA 5I45A 4IIDA 4BLPA 4OIMA 5DM4A 3EF3A 1RMYA 2AUMA 4IZHA 2WVHA 1CUCA 1GEEA 4RD3A 4WUVA 4IJMA 3SC2A 3WHLA 2IBTA 3GLGE 3GT3A 2GPNA 3U3ZA 2V6JA 2EKZA 3GJ8A 1Z5OA 5ALWA 2V7TA 3K6KA 4RMGA 5AKXA 5AUOB 4MR9B 2G88A 4KBFA 4QTXA 1KYIA 3WMXA 3E1GA 1DJPA 1C1XA 2J4DA 3BH7A 3NTXA 2QXUA 2XQKA 2IIQA 5AM1A 3R4CA 3LRPA 5K3CA 3WYCA 3X3HA 4I1IA 4M60A 4R0VA 4JR1A 1ZQ1A 4NZNA 3IL2A 3GEPA 4QVKA 2PR2A 4Q4HB 4ZHQF 3TW8B 4D9EA 1DB3A 2J30A 3TYXA 2Q2OA 5JSZB 1BKSB 1DIAA 3DGFC 2J5RA 5F23A 4RHYA 1UKYA 4BTLA 4D3FA 3THSA 2C96A 4ALNA 1Q1EA 4ZVUA 2QW8A 5AKJA 2Q1DX 1R0BA 1C3OA 3KKLA 1Y63A 2AOTA 1V2HE 2WPDD 4DJFC 4TMYA 1BU5A 1SUPA 3PLNA 4IV8A 4OB6A 5KSYA 5K7SA 3FNRA 5BO5A 3HKBB 5JNLA 4BZZA 3IQFA 3HPRA 3VBCA 1E3TA 1NNI1 1TKBA 2I87A 2FKNA 3PGXA 2GZ2A 4DA7A 2I62A 3PD1A 1QF7A 3C1TA 4QGFA 1AKRA 1ZISA 3BMQB 3KR2A 4MEAA 3NRBA 2G6BA 2QTAA 5TT0A 3GLQA 4NBTA 4ZO9A 3ESYA 3TLYA 5INTA 5LP6B 3H4IA 4D6YA 5BUQA 2BEJA 1GKIA 3L06A 4XGKA 2XYGA 8ATCA 1MGPA 1T6YA 3H9EO 2PRIA 3PQ6A 4FMCB 4JFAA 4ISBA 4EATA 1V1RA 2H51A 2QZPA 4N5LA 5ILGA 1S7GA 1R4NB 3IYLW 2R11A 3OJCA 3X44A 1DARA 2VRCA 3FCAA 1JR2A 2BLNA 3OJOA 4AB1A 3ZHVA 4D9BA 1BDMA 3D7KA 3OMWA 4P82A 2WT8A 1GZ7A 3FCUB 1SULA 3QYFA 3R6LA 3N74A 3AVQA 3PC7A 4O25A 1MU0A 1OE0A 3G6KA 3OQNA 1GUBA 1Y1SA 5HX7A 4E3ZA 3K09A 2GK4A 2YY5A 1L1QA 3VR2A 1BSVA 2B61A 2HYDA 3JCZA 1CULC 1KP2A 1JKFA 3O0TA 3OZRA 3PQEA 2IXTA 2ZYTX 3ZS9A 3ZU6A 1QH1B 5K3SA 2M6SA 1R0KA 5C46F 2ZZKA 2P9QA 4CODB 4KQIA 2IZ0A 3UJPA 4LFAB 2DAPA 2HWWA 3TLBA 5LR6A 5F64A 4P4UA 1P0CA 2QZSA 1Q5PA 4BAUA 4MYRA 4FKBA 1RR6A 1V2GA 3Q15C 3QPCA 4CIYA 5JAHA 4F3YA 2W6ZA 1TKAA 1L5LA 4P0QB 4ZK2A 4LFCB 4QECA 2I3BA 4K9DA 3FNGA 2P0EA 2BM9A 1MUUA 2BGNA 2JBAA 1MLDA 5LKRA 2ZBUA 2RBKA 3LL7A 2WOOA 3WFZA 4DIBA 1GKUB 3TIVA 3TXAA 2YJ5A 2F7SA 3B6EA 3NKFA 2Y8EA 4I5FA 2NSLA 5ADVA 4UHJA 3A36A 3UT5A 2IW1A 4ENRA 4WE3A 2P91A 4HEHA 1JFVA 2G1AA 2JLYA 2X9QA 1ONOA 2GPBA 3D7MA 3ZVMA 5EKUA 1KZ9A 4POOA 1V11A 1FNBA 5IDXA 2N46A 1NW4A 5FO0A 2RCNA 3LAWA 1FIUA 1N6KA 4I14A 2BL4A 4OYYA 3AWDA 3NVMB 4AP9A 1QQBA 2OHVA 1TUEA 2CLKB 5BQFA 3ESRA 4TSFA 2XZOA 1AB5A 1N9GA 1TCVA 1F2TA 2G8LA 4Y6LA 3SBEA 3VX4A 4DADA 4O4HF 2JLQA 4WBNB 4JI5B 5AJYA 4NBVA 2GBLA 1FNMA 1FXSA 1ZH4A 1R64A 1VE3A 2AUNA 2P1ZA 3OICA 4GLJA 2AVDA 4M0PA 4PYOA 5CLIA 5FPQA 3X2SA 3LF2A 4CT5A 5EZQA 1JQ3A 3RFXA 3PC3A 2P4UA 2WM8A 4W99A 1TK9A 3NBZC 2FF5A 3HNOA 3I34X 1T0HB 2PBZA 4G5GA 1RLJA 2DYKA 3F3YA 4ZQHA 5TQ2A 2JFQA 4WZBA 2QRLA 3KJEA 3H11A 3QPWA 2UU9B 1PYOA 1HR0B 3H75A 3HYLA 3OJEA 3HNPA 5IEJA 3PEWA 4OV6B 2CL7X 3ORHA 1CX9B 3N87A 3ABRB 4PANA 4QFMA 1GFSA 2HA2A 4PTLA 4OUKX 4GZLA 4KG7A 5EP3A 1G5TA 4TKZA 4Q3EA 2NQTA 4XPZA 3BIJA 1NZFA 1UZUA 4HK4A 5SYMA 3VAAA 1P2FA 4V1CI 4WA7A 4NNPA 3ZH2A 1R5JA 2E4XA 3PF8A 1UL1X 1D9ZA 1FP2A 3E2PA 2YBDA 1SHJA 3LD9A 4GR9A 2Q1XA 1FVOA 1PJ4A 1APBA 1P1HA 4QQRA 2Z0MA 5D1HA 1Y3FE 1YL7A 3TCKA 4DLYA 3TLAA 3I6YA 5DWVA 3A6FA 2DZDA 2G1UA 3E7FA 5KVQA 2CFIA 4H0FA 4EHFA 2H4HA 1FYFA 2C5FA 1RYBA 3M9LA 5LDHA 2XMDA 4PAGA 1POWA 3IH5A 1DDIA 1KKMA 4PHHA 5JPCA 3LL4A 1NF9A 4MV8A 5EIOA 1FJ2A 1IIBA 2Y66A 2QTCA 3T7RA 4BZXA 5L95A 1SH7A 4IUBS 3CNQS 1C7RA 3FNEA 4JJ6A 2W71A 2VCEA 4P0TA 3IRVA 2QAIA 1XTVA 1L5WA 1XZJA 3HB9A 5HQTA 2KBFA 1RMTA 2XCOA 4QYIA 2C9OA 3PGKA 3W9YA 3TNLA 2ZUFA 3R44A 2UYOA 3CLKA 1CUIA 2X5OA 4KMOA 3AXTA 1XJ0A 3CCFA 2NUPA 3I3SR 1E6WA 1U3FA 2ZTVA 1S2NA 3CLRD 3ZU4A 1SXJA 3RDPA 3WHIA 3LCCA 2G71A 5EMNA 2WUVA 2WK1A 3D0KA 3PEEA 4LYAA 4DMMA 2QMZA 2WF8A 2FQWA 1RI1A 2N9UA 4GPD1 4DV3B 5DV9A 3EVAA 1VHTA 3GEDA 3PC8C 5KAPA 4F21A 5EIWA 3H2SA 4BFVA 3KHTA 1Y6FA 2WWGA 4YXWD 4QWMA 4BB6A 3UNXA 1UDAA 3JPWA 4IILA 4YRKA 4JK3A 1RNLA 4MJLA 4RLHA 1X1CA 4XCXA 3Q2OA 3Q8XB 3HRIA 5I7FA 1E3SA 3BGDA 4WMLA 5CDFA 4DAOA 3T3NA 2AEMA 4Z8XA 3WS7A 1SHTX 2UZ1A 3B78A 2CVOA 5BQPA 3UUEA 1BHJA 2WEKA 1S2MA 1MO5A 4AUKA 1SCUB 2XOKA 3D64A 4LNHA 5EYPB 3W9SA 3FCCA 3ZY5A 2VYQA 4LF4B 1T5LA 3ZGVA 1DSSG 4GI7A 1C7EA 5IKXA 1VE1A 4MQ6A 1Y4DE 2UYCA 2XBMA 1SCQA 1XAHA 4IXMA 2FG7C 1E2IA 3MF4A 4GPZA 2WIKA 4TZKA 3GH3A 1TDJA 1WR8A 1B23P 3IKLA 1K68A 1JE1A 2H7VA 1XJCA 1GU7A 1IZYA 4YJFA 2ZUTA 4DM3A 3TMAA 3DFFA 3K1AB 1EFPA 1QNFA 2PJZA 2QEQA 4DGSA 4LJLA 5FTWA 5J63A 2FOLA 2I66A 2PL3A 1FQKA 2Q8QA 5ELLA 1TYBE 4MWBA 5CVJA 3NIFB 1WZ2A 3TW0A 2FQXA 4LW8A 5JEDA 2H54A 4QDXA 1JHAA 2GEFA 3EJ6A 4Q15A 4C7KA 3GP8A 4EG5A 4V0RA 3PNPA 5EIEA 4MTCA 5HZHA 4C4RA 3O31A 1AS2A 4CQMD 2PVSA 4RIHA 5BR4A 2IPLA 2JA2A 5HA5A 1S8OA 1NV9A 4KQ9A 3U7HB 5A5VA 1C0PA 1R9JA 2CLFB 2B6HA 2C83A 3W90A 2P2YA 1ZK4A 3S81A 1DXOA 2WWHA 1JALA 2B1RA 2H16A 2BSQA 2Y0EA 1U0SY 1XD2A 1JDBC 4U0JA 3F47A 3ORQA 3ANLA 4G4SP 4IOMA 1A9ZA 4IDAA 2EP5A 1FVXA 3BKXA 2C7PA 4KREA 1LB1B 1WPGA 1TD1A 2RI0A 2X86A 1XRSB 2XNHA 3DDCA 4EHJA 7YASA 1VCMA 3F3MA 1I7PA 3H1GA 3HDTA 4MB2A 1F0NA 4DFDA 4Z7OB 3F6BX 3T7AA 1L3CA 5FTLA 2WWRA 4H6XA 2JARA 1OH5A 2P69A 1NASA 1VLQA 4MQFB 5AI5A 1T3GA 2F3UA 4CM1A 1KSHA 421PA 1IG0A 5C80A 3BMNB 3AIKA 4J4TA 3ZV7A 1PQYA 2JFYA 1SQ6A 1T3SA 1LEHA 2JVIA 3ROMA 3BMQA 5E7MA 1PBTA 1EESA 1OAKA 1YA6A 3FOCA 2BFPA 1N1GA 2IOQA 2OORA 5FCDA 3SQLA 1ZGZA 2DETA 2NXNA 1NR1A 1Q0RA 5EA2A 3ZZUA 3FLMA 1P7YA 4X1IB 1PR3A 3JQBA 3WJ7A 3TTVA 5HJ5A 1XKLA 2KWIA 1QGUA 5CIQA 1U0BB 2II6A 4JR0A 4BO9A 5AM0A 3NHLA 5JXIA 5B5SA 4R83A 5AM4A 4ZD6A 4WK2B 3P71T 1COWA 2GZAA 2B69A 1DX9A 4Y98A 3LXRA 5KNCA 3WQHA 4UUPA 1D0SA 3CTMA 3JQ7A 2V03A 3QJYA 1K86A 1K6MA 1Q84A 4S1PA 4WKBA 2H48A 5TMEA 5AW2A 3VU8A 2AJBA 4LJ4A 1E3MA 1JHOA 5ILOA 2VT2A 3GLHE 1X7GA 4G5SA 4ENQA 1H9CA 2R8EA 2ZP1A 4DCJA 4YR9A 3FVRA 4GIBA 3R23A 2J0VA 3C1AA 1OLSA 4MRPA 4J9VA 1VRWA 3SNHA 4AZSA 3WADA 1ZUIA 3HI4A 1ENZA 1XG5A 4IJ6A 1J2JA 4K86A 5EINA 3EDOA 3LBYA 4ZOLB 2A0UA 1SCBA 3BWVA 4RE6A 3WMGA 5BY2A 2AI3A 5DNUA 2OXRA 5HRAA 4HL6A 2OWEA 4JBNA 3EIOA 2VJPA 4NONA 1EHYA 2WB4A 5BWMA 4XQCA 3O7MA 1ZL2A 5FA6A 4KQXA 2H3EA 4JSYA 3R40A 5G0UA 1P2TA 3GA0A 3RASA 4MV3A 1QCCA 5EVJA 1P19A 1UBEA 3LKBA 4WOJA 1XTIA 2QWXA 3A6DA 3N8IA 4A27A 4C0AC 3UPUA 5EPEA 4WNCA 3DW3X 3JZIA 3DBVO 3DVAA 4B17A 4BFSA 1UANA 5TPWA 4DZZA 4KVZA 1HDEA 2I55A 3P9RA 2QAGC 3H2KA 3KD2A 3A9TA 4HGZA 4EMBA 1PJRA 1QDEA 3KCNA 3PJDA 1MX5A 2C3PA 4MUNA 4KXFB 3IT0A 4UU0A 3DLBA 2ZUEA 3TDMA 2D0IA 4V1CA 1AVTA 1JFLA 1TJPB 1ILEA 1RYHA 2PANA 4OXYA 4PYKA 4LK2A 5DLDA 1JJ7A 2J5BA 4F86A 1TM5E 4MYHA 1O3YA 1XMXA 2SCUA 3CW8X 4O6VA 3K96A 1IYZA 4F4UA 1E3WB 1B6RA 1G7SA 5DXJA 1KH1A 1L1FA 4HZIA 2OHHA 2E4VA 1P73A 2X5KO 1NRWA 1XZNA 5CDYA 4CL2A 1MVOA 2BR4A 4INOA 4B6EA 5GADl 1B3RA 4K05A 2IV2X 3ZXSA 3IGFA 5HILA 3ONEA 4HQLA 5AVUA 4M0DA 1BN6A 3I09A 4JB3A 3QKSB 2CNBA 1G64A 1YZGA 2QTGA 3IAUA 1CD5A 1LA2A 3OZXA 4TXNA 3WGQA 5JALA 2Q5QA 4L7VA 3KQMA 5TVKA 5CB4F 2QN2A 4OHRA 5F7OA 4J2TA 4J7UA 1VDMA 3VHQA 2V7UA 1IHYA 3ERCA 2Y67A 2YZGA 3KQNA 4B76A 5HKAA 5ALPA 4S0XA 1E2JA 4KLNA 3QLUC 2XNDA 4MO9A 1H93A 3FUUA 4ZN6A 2WF9A 1XLWA 1FP4B 4N0EA 4RVNA 4EMUA 1O95C 2PVCA 1Q21A 2PN1A 5EFOA 3LIIA 2LNDA 1ACLA 1D1QA 2FPIB 2QT1A 2XZPA 1PGNA 5BVHB 2IELA 1PSWA 5JARA 3OUZA 3CUWA 1DIRA 2OORC 3E2IA 3O4FA 4MVJP 2ON6A 5G41A 2O57A 1J07A 2HO5A 4KJZA 1U9YA 3BC1A 1LI5A 1I3OA 1DC4A 3OT1A 2PMFA 2QZ9A 5L6LB 4GEGA 1ICIA 1ZNWA 1Y3IA 3JW8A 1N34B 1N8TA 3F97A 3ROFA 4P38A 3KX2A 4F9EA 1L7VC 3R9IA 1QSGA 1LPSA 3OZTA 1Q0HA 2QP3A 1H8HD 4FE7A 4KYTA 4HAIA 3KOUA 2FDCA 2PUEA 1QAQA 3C8DA 3K0KA 5EIBC 1GG5A 4N3AA 4G5HA 4BVJA 5JBQA 1L1RA 1U3UA 1WU8A 4AJ2A 5A9RA 2W11A 4HDKB 3VA7A 4EW3A 3ROEA 4I55F 4FQ7A 4RK0A 4W5RA 4ZDKA 1GDDA 3H17A 1FFXA