2B29A

N-terminal domain of the rpa70 subunit of human replication protein a.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'GQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Single-stranded DNA mimicry in the p53 transactivation domain interaction with replication protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b29A00
2HQLA 3SGIA 2BA0A 3H15A 2UUBQ 2VNUD 2B63G 2AHOB 4JG2A 4JI7Q 2F4VL 1KL9A 1XPOA 4L5QA 3J81i 4B3TQ 4A3CG 4A3KH 1LUZA 3K7UC 1Z9FA 2BH8A 1I6HH 4RMFA 1NMGA 1Y1VH 1RL2A 2LXKA 2WAQE 4NXNL 4DAMA 5GAGC 4DV5Q 2C35B 4X64L 3KJOA 1FL0A 2F52A 3E0EA 4DR5Q 2UUBL 4POFA 1S40A 2R7FA 4JI7L 1K3RA 2N49A 2ASBA 2K4KA 3UDGA 1A8VA 2F3IA 1ASYA 2DGYA 2UXBQ 1K83H 4B3TL 1TWHH 4LF9Q 1X56A 4EX5A 2JA6H 3I55A 4A3EH 1N9WA 3ERSX 5M5XH 3I4NG 4AH6A 4ME3A 4HJAA 2JA5H 1MKHA 1OXVA 3PCOB 2JA8H 4DV5L 1VQOA 1KRSA 4JI5Q 5AJ3Q 3TS0A 4A3GG 4GLVB 5K36G 4DR5L 2VY3A 5IYDH 4BBRH 4GN3B 5IY0A 1B70B 1LYLA 1SRUA 3RZDH 5C0XG 4GNXA 2UXBL 2LSSA 1E1OA 1L1OA 1SFOH 3VDYA 3MXNB 4LF9L 2WP8J 3CMAA 1NJIC 4DV4Q 3HOVH 3DM3A 1L2FA 1WFQA 3GTMH 3S1MH 5GAHC 4PZ8A 4JI5L 1SE8A 3U58A 2IT1A 2OWOA 5AJ3L 3GTLH 5M3FH 1PH5A 2PMZE 1AE2A 1EWIA 1KRTA 3KYHC 1GKHA 2FXQA 3L7ZC 1CKNB 3PUWA 5HGQA 3OW2A 1Z47A 1PH3A 1YEZA 2R92G 4LF4Q 3UDXA 1BKBA 1P16A 4DV4L 4BY1H 3HOZG 3PO3G 4MNOA 2PI2E 2WB1E 4HJ8A 1GM5A 4JI0Q 3U4VA 4X6AH 4KLKA 3F1ZA 4XTCS 2MQHA 4PZ7A 3AEVA 3T1HQ 1VQFA 2A8VA 4DV6Q 1YHQA 2ZTEA 2IX0A 3GO5A 2AWNA 4DV7Q 1OTCA 5C3EH 2L15A 2YTXA 4O2DA 1PH7A 2Z6KC 4LF4L 3K0XA 4JCVE 3EN2A 1R9TH 4LUVA 4JI4Q 1JJ2A 2EQSA 2Q2HA 3I4MG 3HOXH 4JI0L 1VQ6A 4L5RC 5GAEC 3L2PA 4A3KG 4A3BH 3T1HL 5M5WH 3S1QH 1VQJA 4DV6L 3FKIH 5IYBH 3W1GA 1WYDA 4AYBE 4DV7L 3EBEA 1JJGA 3T1YL 2PQAB 1Y1VG 4HIDA 1MJEA 3GTOH 1CSQA 4JI2Q 1GVPA 1V1QA 1YHAA 1U5KA 3BZKA 4JI4L 4GN4B 4A3JH 1EYGA 4JV5Q 1L1OC 3G48A 4BA1I 5C4JH 2Q2IA 1VQ8A 2BH2A 4YCWA 2JA6G 2V1CC 4A3EG 3GD7A 3CCRA 3OTOQ 1PH1A 1XMOQ 2AMCB 2JA5G 3CXCA 2JA8G 1VQCA 3M9BA 4UP7A 3HOYH 4IOCA 4JI2L 2AWOA 1Q8KA 4JBJA 1YIJA 3UDIA 3GTGH 1TWFH 3S2HH 2Y0SE 1PVOA 5JJLA 2R6GA 4JV5L 4A3IG 4BXXH 1LTLA 1X3EA 4LUZA 2Z0SA 2Z6KA 3J81c 2R93G 1EFWA 2A1AA 1X65A 4TQUS 2JA7H 3HOVG 2UUCQ 3OTOL 4X62Q 4GOPC 1XMOL 1YHBA 2HT1A 3CP0A 3CW2C 4DK3C 3H0GH 2VQFQ 3K80C 2E2JH 4JC0A 4LUOA 2K52A 5IYCH 4BA2I 4DPGA 1CKOA 1DGSA 1LM0A 4Y7NH 4DR7Q 1N32Q 2GN5A 2ALYB 2YTVA 1YVCA 5FJ8H 3KFUA 4B3RQ 1IBMQ 2E5LQ 1X55A 3CAMA 4BY1G 1VQ4A 1PHJA 3HOUH 1NE3A 2UUCL 1VQKA 4X62L 4A93H 5E7NA 4NPSA 3BJUA 1Q12A 3KLWA 3CCMA 5LMNW 1L0WA 2QEXA 2MFIA 2VQFL 1YJWA 2YU9H 1JT8A 3D0FA 1EUJA 2N3SA 1VQAA 1D8LA 2I5LX 4DAYB 1YI2A 1P8LA 2IY5B 2KCMA 1YNXA 2D0PA 5IP9G 2E2HH 4DR7L 1N32L 1M1KC 1G6PA 2OQ0A 4LFAQ 4YWKA 1VCIA 5C3EG 4P71A 1K8GA 4A3DH 5M5YH 4TVAB 1IBML 2E5LL 3TRZA 2JK8A 4JBWA 2JQOA 4PG3A 3GTJH 4GNXB 1G51A 1E3PA 2VUMH 1L1OB 3AFQA 1QUQA 3OYYA 4QJFA 2ZJRA 4A3LH 1XNRQ 2BA1A 3PUYA 2OTLA 4BBSH 4A3BG 2IHEA 1J6QA 3AQQA 3FKIG 3ULLA 5IYBG 4YCVA 4IOAA 3FP9A 3K8AA 4GOPA 2K14A 3CCSA 2H5XA 4IPDA 2HIVA 2DUDA 4LFAL 1TWAH 3L0OA 3RLOA 3PIOA 2VW9A 5DLQE 1YBYA 4LF5Q 1C9OA 4R4OA 3JAMc 3U4ZA 4IPGA 4OXPA 2ZJPA 1HR0W 3CCJA 5C4XG 3TS2A 3AYHB 4JI8Q 1VQLA 2NVTH 1YZ6A 3I56A 3I4OA 1XNRL 3CC7A 4GKKQ 2JA9A 4DR2Q 4DR4Q 4WJ3M 4OWWB 3PO2H 1PH9A 1S3OA 1VQEA 2B29A 2R7DA 4MZ9A 1NTGA 2Q2UA 2WAQG 4A3MG 5JJKA 3HOYG 1EOVA 1CSPA 5M3MG 1CUKA 1X6OA 2IHFA 1UE5A 3CF5A 1C7YA 2NVXH 2UU9Q 3TREA 3JAMi 3HOWG 2K50A 1WJJA 4GS3A 3E9IA 1XPUA 4KHPQ 4JI8L 3I2ZA 3S24A 2KBNA 2QA4A 1N36Q 4R4IA 4GKKL 3UE0A 5IP7H 1Y1WH 1G291 4DNIA 1ASZA 2JA7G 1VQHA 4DR4L 1VQNA 4DR3Q 1HZ9A 4UY8C 1U0LA 2CCZA 3LGJA 3G71A 4IPCA 3S1NH 4A76A 1QVFA 2ZTCA 1QVCA 1SMXA 4QY7A 3CC2A 3CCLA 2ES2A 1JMCA 4ALPA 5JEAJ 3CC4A 1FJGQ 1OXSC 1W2BA 2UU9L 1A62A 4HIOA 4KHPL 2PNHA 1TWGH 4LF6Q 4J15A 4A3FH 3PGZA 3HKSA 2B63H 1N36L 2VQEQ 1PFSA 1B8AA 1FVIA 2OCEA 2WFWA 3D31A 1PH2A 1K8AC 4DR3L 1Q46A 4HJ9A 3HOUG 4GKJQ 1I50H 3ULPA 1PYSB 5J3BA 3BU2A 4K0KQ 2B3GA 4DV2Q 1XNQQ 4IJLA 1FJGL 4KI0A 1IXRA 2K5NA 4LW1A 1E24A 3KF6A 3J80i 3CQZH 4C3JH 4DUZQ 3CPFA 2E8GA 4JOIC 4X66Q 4LF6L 3GTKH 2VQEL 3U50C 1QVGA 1HNZQ 4JBKA 4A3DG 1PH8A 2LXJA 4LWCA 2RHQB 5BR8Q 3HKZE 3TEHB 1NY4A 5LMUQ 2JE6I 4RG1A 2WB1G 3M85A 1KAWA 5ELNA 5FLMH 5IT9c 2EXDA 1KQSA 4K0KL 4Y52H 4APVA 4DV2L 1IBKQ 4DUZL 1SROA 1NMFA 4X66L 4BBRG 5IYDG 2E2IH 2I0QA 1XJVA 1HNZL 3UDFA 3GTPH 2YTYA 3GDEA 5BR8L 1VQ7A 4NB3A 5LMUL 3RN5A 3MEFA 4A4IA 1M90C 2IX1A 4DR6Q 3RZOH 2AKWB 4OX9Q 1YJ9A 1A63A 2ZJQA 4PMWA 3WWVA 1B7YB 2UXCQ 2NN6I 3A5UA 1OXTA 2CWAA 4JI6Q 4GLAC 1O7IA 1CKMA 1IBKL 3M4OH 5M3FG 3S15H 4AYBG 1HZCA 1YITA 1H95A 3B6YA 2K75A 2N8NA 1Q81C 2ZM6Q 3NENA 3TQYA 4YHHQ 2K5HA 5IWAQ 4MTNA 4DR6L 4JOIA 3HOZH 4H02A 1XTDA 3CCEA 1Y1WG 5IP7G 3PO3H 3RN2A 2XTIA 2UXCL 3JC66 1X9NA 4BY7H 1BBWA 1EQRA 4JI6L 1QUQB 4QQBX 1SN8A 4HJ7A 1MIUA 2KENA 4P73A 1HZBA 4YWLA 3G6EA 4UP8A 1KIXA 4LFCQ 3IRBA 1HZAA 3A5ZB 4L5SA 2ZM6L 4GOPB 5H1SE 4YHHL 2GVAA 2Y0SG 5IWAL 1PA6A 1WCMH 5ELOA 1HR0Q 4A3FG 4B3RL 1IL2A 3KDFA 1VQIA 4LFBQ 4IFDJ 3F8TA 3I4MH 3HOXG 2VZAA 4P75A 2Q2TA 3ER0A 4IPHA 1IYJB 1BVSA 3F2DA 1RIPA 1GO3E 3K81C 3ZJYC 2R7ZH 1X3FA 3PUVA 5EAYA 3RLFA 4C3IH 4LFCL 3I7FA 4C3HH 4PZ6A 2HIXA 4GN5A 4A75A 2ATWA 3K7AH 1HNWQ 3NELA 4OWTB 2JJQA 2ZTDA 2NN6G 4P74A 5JEAG 1HR0L 1EQQA 3RR5A 4R4CA 4X65Q 2A19A 4JI3Q 4LFBL 3J7A5 1D7QA 3CCQA 4R4TA 4DK6C 4FDBA 4A3JG 4HJ5A 4UP9A 5C44H 3PF5A 1UE1A 4JYAQ 4AIMA 2NVYH 5FLMG 4WJ4A 1OXXK 1I94Q 1HNWL 3W1BA 5IE8A 5GADC 2OTJA 2UUAQ 1WOCA 3CD6A 1SLJA 3S14H 1FGUA 1VQ5A 3KOJA 4LF5L 1KC8C 4DV3Q 3M4QA 4YWMA 4JI3L 4X65L 2YV5A 1KHIA 4DUYQ 3E9HA 2JEAI 4A3IH 3S16H 4BXXG 3HFZB 3EIVA 5JJIA 4LF7Q 1KXLA 1HNXQ 3S17H 4JYAL 1UWVA 3CPWA 4L5TA 4DR2L 2R93H 4AQYQ 2I5MX 1HJPA 3CCUA 1YJNA 1I94L 3F2CA 1Q1EA 2KHIA 3CCVA 2UUAL 1UEBA 2I5HA 1VQDA 2NZOA 1EIYB 4POGA 4OO1I 4B3MQ 3H0GG 1E1TA 5IYCG 4DV3L 3J80c 3RLNA 3PIPA 3PUXA 4DUYL 1N33Q 4IFDI 4QL5A 1QZHA 3KF6B 4B3SQ 4LF7L 1MJCA 3F2BA 5FJ8G 1HNXL 4IO9A 1AE3A 3J7ZC 4AQYL 1VQMA 4A3CH 4A93G 1V9PA 5HY6A 1VQBA 2CWPA 3AFPA 1WI5A 4IJHA 2YYZA 4QGUA 2MNAA 4LF8Q 4BY7G 1Q82C 4HIMA 1Q86C 1PV4A 1GD7A 1A0IA 4R1JA 1N34Q 1K73C 4JBMA 2MO0A 4B3ML 2CKZB 3BZCA 1TXYA 3Q8DA 4HIKA 1IBLQ 3GTQH 3G4SA 1N33L 5IP9H 5GROA 3T1YQ 1AH9A 1CKNA 1I5FA 5C0XJ 3DLLA 4B3SL 1J5EQ 3M3YH 1WCMG 1PH6A 3CMEA 3STBD 3H3VH 2VUMG 3UE1A 4YCUA 4GKJL 3A74A 1X54A 3NEMA 4KHZA 2QGQA 1I3QH 2K5VA 1JB7A 4XIGS 1N34L 1JJCB 4LF8L 2CFMA 3I4NH 4A3LG 4BBSG 4LNQA 1V43A 3KJPA 2R7ZG 3S1RH 1IBLL 1XMQQ 1XNQL 4NXMQ 2RHSB 4C2MH 4A3GH 2OQKA 3PV0A 1PH4A 3M4PA 1IZ6A 2MO1A 1J5EL 1E7ZA 3PF4A 2KCTA 3ICEA 1VS0A 5C4XH 4DV1Q 4OO1G 1N8RC 1UE6A 3STBC 4GLXA 2CQOA 3W5OA 1KD1C 2HHHQ 5C44G 4IFDG 1K9MC 2GVBA 3KF8B 3J81j 1E22A 5LMNQ 1XMQL 3A0JA 4NXML 1UE7A 4DR1Q 2PQAA 2D0OA 1VQPA 1Q7YC 1QZGA 3M7NA 1HH2P 4JI1Q 3PO2G 1T9HA 4YY3Q 1NBWA 3H3VI 1C0AA 4QIWE 1EIFA 2RCNA 2VL6A 4A3MH 1XPRA 3FHWA 5M3MH 1W3SA 3PUZA 2NVQH 3HOWH 4DV0Q 4DV1L 3RNUA 2RF4A 2UXDQ 4OONA 1VQ9A 2R92H 2HHHL 3S2DH 4OX9L 2F4VQ 4DKAC 1OXUA 3HKZG 1S72A 2VS1A 2NZHA 3KDFB 3ULJA 5LMNL 4UPAA 4P72A 1Y14B 2D62A 2N78A 2XGTA 4DR1L 4R4QA 5C0XI 2ID0A 1JE5A 2PI2A 3NBHB 2EIFA 2KHJA 4OWXB 1TWCH 4JI1L 4YY3L 2JEBI 1X3GA 5FLXc 4EQ5A 3PSIA 1SR3A 1PYBA 4GNXC 4O0AA 1K0RA 4NXNQ 4DV0L 1BBUA 1VQGA 2UXDL 1Q1BA 4X64Q 5GQOA
chains in the Genus database with same CATH superfamily
1SYGA 4WRDA 1HQRD 2VNUD 2AHOB 2EYLA 2F4VL 1PMRA 2A73B 5DAUA 1JOQA 2TMPA 4A3KH 1LUZA 2MJ8A 1B3AA 1TR5A 1TQOA 2L12A 4K8JA 2LXKA 5GAGC 4RWSC 1YNND 2UUBL 4JI7L 1K3RA 3QB3A 3UDGA 2SOBA 1BUVT 2DGYA 1TWHH 3OWFA 5CBAE 4EX5A 5C3EB 3M3YB 5FLXE 4HJAA 2F0VA 3PCOB 2JA8H 4O42A 3NQTA 1MSHA 4ILWA 5FLXL 1GUWA 1E1OA 1BCPB 1L1OA 3VDYA 4LF9L 1B44D 1SE3A 4PZ8A 4HN7A 1ENCA 5M3FH 1PH5A 2PMZE 1DOKA 1AE2A 4KKSA 1RD9D 3TBIB 3VR2A 1BO0A 3L7ZC 5HGQA 4A3MB 3UDXA 4DV4L 1P16A 1LO5D 4BY1H 2WKCA 3PO3G 4JI0Q 4HJ8A 3U4VA 4KLKA 4PZ7A 1PZJD 1VQFA 4ZRZA 3A8IE 4DV6Q 4ZLTF 3GO5A 1DZ1A 4ZUIA 2JA7B 2DNEA 2YTXA 2WACA 1D2BA 3CU7A 1E2ZA 3A7AB 4CDCC 2KQ3A 4JCVE 3P1HA 5BN3A 4LUVA 5A2QE 1R9TH 2EQSA 4JI4Q 4L5RC 1VQJA 3FKIH 1GHJA 4OELB 5E4WC 1DOMA 1WYDA 1PRTF 4AYBE 4DV7L 3T1YL 3HOUB 5A2QL 4JI2Q 4HEDA 4TKOB 4G4KA 4A3JH 1HTPA 3MZ5A 2PMZB 3NWSA 2Q2IA 1WD0A 4HCSA 1V1PA 2V1CC 3E6ZX 4H13C 4A3EG 3CCRA 2MGSA 3GTJB 4TRDA 3CXCA 1VQCA 3VYRA 3MXGA 1L0YB 4IOCA 1PFNA 5M5XB 1Q8KA 4JBJA 3BVZA 3NTKA 3UDIA 3GTGH 3S2HH 1PVOA 2Y0SE 2R6GA 1DOLA 2B2WC 1RDPD 1LTLA 4HSPA 4LUZA 4BBRB 4TQUS 2CVRA 1XMOL 2XN9C 1YHBA 1SFOB 2HT1A 3CP0A 4DK3C 3H0GH 2VQFQ 3K80C 4H7BA 1LLRD 1DGSA 2GN5A 2EYPA 4RGNA 3DWQA 3C1FA 3UI2A 1H9KA 2ALYB 4AYBB 5FJ8H 2EYFA 3ZYYX 2E5LQ 3CAMA 3VA7A 4A93H 3KLWA 2CHBD 2IPKD 1IW7C 1L0WA 1JT8A 1YJWA 3PIP3 2N3SA 2E2HH 2XVSA 1PFBA 4OGQC 5KEEA 4FXDA 3DEPA 3S1NB 4A3DH 5M5YH 2IX3A 1PFMA 2JK8A 4GNXB 3HP3A 3OYYA 2B2WA 4A3LH 1QILA 2Y0SB 2BA1A 2K03A 3PUYA 4A3BG 4A3FB 2IHEA 3AQQA 3HOXB 4IPDA 2HIVA 4LJZC 4LFAL 3T16A 3PIOA 1F9SA 1YBYA 4LF5Q 1JWMD 2XIWA 1HR0W 4OXPA 4OO1H 3TS2A 2JYOA 4R8IA 4B9XA 1XWEA 5E3FA 2NVTH 4GKKQ 3CC7A 1WTRA 4IUUA 2NWGA 2B2YC 4DR2Q 4DR4Q 2PCFB 1A2TA 5KNDA 4OWWB 4ID6A 3QJYA 4GZYC 5C4JB 1VQEA 4MZ9A 2Q2UA 5JJKA 5M3MG 1TVXA 5NUCA 1QWYA 1UE5A 1C7YA 3TREA 4GS3A 4JI8L 3I2ZA 1F9PA 2QA4A 3UE0A 5IP7H 4Q0FA 1G291 4DNIA 1V1OA 4ZYSA 4DR3Q 2HCCA 4ZAIA 2M00A 5ELDA 2ZTCA 3CC2A 1AZPA 1JMCA 2D2CC 5JEAJ 3CC4A 1FJGQ 2UU9L 1A62A 4KHPL 2PNHA 1B4OA 2EY6A 1STAA 3PGZA 2VQEQ 2E2JB 2L4NA 1Q8IA 1B8AA 1PH2A 4H44C 1GXDC 3ULPA 2SNMA 4IJLA 4DAPA 2NN6H 2E8GA 4X66Q 2HDMA 1RCVD 3QOLA 1PH8A 5BR8Q 2RHQB 3HKZE 3A7LA 1NY4A 3K5OA 5LMUQ 3M85A 3T53B 2K05A 5ELNA 5IT9c 1MGSA 1Y8NB 2EXDA 1TY2A 3OOCA 3GQBA 4KN4C 4DUZL 1SROA 3TN2A 5CC4A 2E2IH 3S17B 1G6ZA 3GDEA 4NB3A 1ICFB 2FJ2A 3RN5A 2IX1A 2AKWB 1RF2D 4OX9Q 4EQNA 2ZJQA 4OIKA 2UXCQ 1SDFA 1WTOA 2CWAA 2TSSA 2Z4HA 1A3TA 5F2DA 1H95A 3B6YA 2K75A 3IL8A 1UUPA 3NENA 3DWPA 3RUZA 5IWAQ 4DR6L 5IT9E 4ZK9B 1D1IA 3PO3H 2NVXB 3JC66 4BY7H 1WVLA 1QUQB 4XQNA 1CT1D 2AUJD 1HZBA 2KHSA 4P73A 4UP8A 3KLRA 1KIXA 4L5SA 2ZM6L 4IQZA 1MHWC 2GVAA 1SYFA 5ELOA 2GA4B 3FPUB 4M1UB 1PTOD 1VQIA 3KDFA 4IFDJ 2NB0A 4L6TB 2L11A 5C3WA 5AFWA 4IPHA 1QG7A 1TWGB 1BVSA 3NBHA 3GP7A 1H9SA 3F2DA 2B63B 1GO3E 4RCNA 2R7ZH 3RLFA 1CZWA 3I7FA 4PZ6A 4GN5A 1DONA 1HR0L 1HCZA 2EY1A 1EQQA 2Z1CA 2A19A 4P2CB 3J7A5 4J6HA 4DK6C 2K28A 4FDBA 4CJ1B 1CFMA 1UE1A 3GTKB 4AIMA 1HNWL 2OEOA 2C9OA 5IE8A 5IGFA 4UDUC 3MTSA 3S14H 2RDGA 5DM63 1VQ5A 4LF5L 4N8FA 4DV3Q 2YV5A 1KHIA 2IL8A 2JEAI 4BXXG 4FNFA 1NAPA 2XRQD 5EGTA 1KXLA 2F0TA 2DN8A 3CPWA 2JP1A 4DR2L 4NDXA 5FOBB 1O7YA 3GTPB 1YJNA 1JR0D 3F2CA 3A8JE 3VR3A 1E0BA 1PTOB 3E0JA 4B3MQ 1E1TA 1N33Q 4DUYL 3PUXA 4I7ZC 2EYHA 3WOEA 3TZUA 3H91A 3KF6B 1QZHA 1MJCA 1I4XA 1HNXL 4IO9A 5HY6A 5J39A 1SE2A 3AFPA 4N8X1 2I07B 4QGUA 4C1NI 1Q86C 1PV4A 1N34Q 4IUNA 4R1JA 3EJIA 1F2YA 3I3CA 3Q8DA 1EQVA 1IBLQ 3G4SA 1BDOA 1EU3A 1AH9A 2D9UA 1U4LA 3CMEA 3STBD 2VUMG 3I91A 5CBEE 5DNFA 3NEMA 4OL7A 1I3QH 2K5VA 1JB7A 3I4NH 1XXGA 3SK4A 1V43A 2J4XA 1A3UA 3I4MB 5C3XA 2EJGC 4A3GH 5K36H 3PV0A 4A3KB 1CI3M 3M4PA 4KD3A 3PF4A 3KBGA 3OW7A 2SDFA 1HA5A 2CW0D 1UE6A 2PZTA 3STBC 3X3MA 2MHVA 1KD1C 1PDQA 1MSGA 3VR5A 1JE4A 1ZXTA 1J9OA 3KF8B 4G57A 1E22A 5LMNQ 3I72A 2ICEC 4NXML 1HUMA 5COYA 4DR1Q 2PQAA 2BDNA 2A74C 3L9AX 3D3RA 3PIO3 3HZXA 5I6WA 1EFID 2RCNA 5IGCA 5C4ZA 5M3MH 2F03A 1W3SA 3C46A 4DV1L 2RF4A 2JA8B 2R92H 1YNJD 2HHHL 4OX9L 2F4VQ 2CW0C 2EOTA 1CM9A 2NZHA 3DM1A 3ND8A 4P72A 2D62A 1LT3D 2N78A 3S16B 3SK8A 4DF7A 1RJTA 2EIFA 4KKUA 2R93B 2F4IA 1ZKOA 5IGEA 4PQXA 1JB3A 2L1BA 2HQLA 2BA0A 2A6EC 2UUBQ 4JI7Q 4JG2A 1EEFD 1YNJC 2VB2X 2BH8A 4BY1B 4DAMA 1GUNA 1Y1VH 2C35B 3FMCA 3E0EA 1S40A 2R7FA 2Z4IA 2N49A 3GTQB 1AN8A 2K4KA 4IZ8A 4QF4A 5CV4A 1A8VA 4LF9Q 2BE5C 2L55A 4G7OC 1N9WA 3ERSX 4ME3A 1VF5C 2F3VA 4DAYA 1OXVA 1R9TB 2DY7A 1NSNS 5CV7A 1VQOA 3T4AC 1KRSA 3TS0A 4DN4M 5IY0A 1SRUA 5C0XG 3MXNB 2WP8J 3CMAA 2A69D 1NJIC 4DV4Q 3HOVH 3K58A 1L2FA 5ISRA 3GTMH 5GAHC 4JI5L 3U58A 5AJ3L 2KOLA 3G7LA 5I4DA 1HXYD 2RSOA 3KYHC 1H9JA 3NUCA 1CKNB 3PUWA 1C48A 1PH3A 2F0DA 3HOZG 3SHLA 4MNOA 2PI2E 3GTGB 3ITPA 1EQTA 3AEVA 3IAYA 1YHQA 1BXTA 4DV7Q 2CH4A 3RMHA 1HTLD 3WOFA 4XDXA 4OIJA 3KLSX 4CJ2C 3OMCA 4K14A 1TWCB 5KIXA 4ODGA 3D4RA 3EN2A 5KGUA 2F0MA 1LT5D 1FNUA 2Q8IB 3HRZC 4F7XA 3L2PA 3T1HL 4QMGA 5IYBH 1NR2A 1MBYA 3W1GA 3V05A 4HAEA 3EBEA 2XRSD 2K5WA 4HIDA 3GTOH 4FXKC 1CSQA 5IODA 1ZYRC 1B50A 3BZKA 5KYLA 1QB5D 1EYGA 2E2HB 2BH2A 2M2LA 2JA6G 4KJOA 2LKVA 2O5JC 5EPJA 4A3DB 1KDCA 1XMOQ 2JA5G 3KUPA 2DJFC 2C5CA 2JA6B 3M9BA 4UP7A 3HOYH 3P7JA 4S3SA 4ME5A 1LTBD 4DAVA 4JV5L 4A3IG 1PXUA 4BXXH 4CBVA 3Q23A 4G7ZC 2RBMA 2Z0SA 1EFWA 1X65A 1ICWA 4J1MA 4GOPC 1F2ZA 2JSOA 1H9RA 2PZWA 2B8FA 2QKIC 4JC0A 4FF4A 2K52A 1HFGA 4DPGA 1CKOA 4BA2I 3S1MB 2ENBA 1SBBB 2B8GA 3K6OA 3GTLB 2YTVA 1YVCA 3QG1A 2N88A 1GJXA 1VQ4A 1NE3A 1X3PA 2UUCL 1RODA 3EA6A 4DK1A 2MFIA 2YU9H 3D0FA 5LL6S 1VQAA 2I5LX 2IY5B 1LT6D 1JQYD 2B39A 1N32L 3R93A 3K5LA 1G6PA 1FNVA 4LFAQ 5C3EG 5KNCA 3AU7A 4U68A 1F77A 4KD4A 4TVAB 4JBWA 2JQOA 2VUMH 3BS1A 3H3VC 2XWJB 3OWEB 1L1OB 3H6MA 3NXWA 5CMDA 3FP9A 4GOPA 2LMCB 2H5XA 3DWAA 1TWAH 3L0OA 5M5WB 5DLQE 3S1QB 3JAMc 3KK7A 4K2KA 1PZKD 3CCJA 3AYHB 4JI8Q 1VQLA 1YZ6A 4UHVA 3BVGA 2JA9A 1PH9A 1CK1A 2FINB 4A3MG 4RFBA 3TP7A 1CUKA 3BZDB 2HUGA 2UU9Q 2K50A 1WJJA 3E5SA 1Y69U 4KHPQ 1CQVA 5DM73 1C8CA 1Y1WH 1QOHA 1TWFB 1BBXC 2E2IB 2JA7G 1VQHA 4UY8C 3W3AA 4IPCA 3OSOA 1HA6A 4CKEA 3M7GA 3ONAB 4ALPA 4ULLA 2PW7A 3Q6SA 1S5FD 4YIJA 3VYTA 1G8ZD 1MI2A 1VDZA 1PFSA 2PZUA 3FVQA 5IGDA 2WFWA 3D31A 3HOUG 4HJ9A 1I50H 1DXMA 3D4WA 1W6JA 2DY8A 1V1PB 1PYSB 3BU2A 3C3LA 1XNQQ 4KI0A 4LW1A 5FK9C 3J80i 4DUZQ 4C3JH 3CQZH 4LF6L 4BY7B 3CPFA 4JOIC 4N9TA 2AUKA 3U50C 4IUTA 4JBKA 4NP5A 3EFXD 4X3UA 2MP1A 2JE6I 5FLMH 4Y52H 5D14A 4APVA 4XXEA 1OO9B 1CQFA 4BBRG 4BBSB 2I0QA 1HNZL 2R7ZB 3ND9A 5J22A 2Z6BA 1VQ7A 1WTQA 1AEXA 3T56B 3MEFA 1M90C 4DR6Q 1YJ9A 1IW7D 1B7YB 3A8KE 2NN6I 3LWEA 1O7IA 1TKWB 2XWBB 1IBKL 3M4OH 4AYBG 1YITA 1HRJA 2LY7A 1Q81C 2ZM6Q 1D5XC 3PO2B 3TQYA 1RTOA 4DA2A 2F0HA 4JOIA 3HOZH 4K5WA 5EPKA 4HJ7A 1MIUA 3G6EA 1X3QA 3K57A 3A5ZB 5H1SE 3DXJC 4YHHL 2OF1A 2Y0SG 1PA6A 1HR0Q 1WCMH 4A3FG 3P75A 3F8TA 4RA8A 3HOXG 4CDDC 2Q2TA 1IYJB 4HMJA 2K7VA 1RIPA 1SNDA 3VR4A 1X3FA 4C3IH 4LFCL 2ATWA 1GHKA 2HIXA 1HNWQ 5D3IB 5HGTA 2JJQA 3MXPA 5JOBA 4R4TA 4KMUC 4HJ5A 5JJZA 3IKJA 4UP9A 5C44H 3PF5A 1TS4A 1LTRD 1F2LA 4C56C 3W1BA 2OTJA 1WOCA 2K5QA 4RGMA 1SLJA 3CD6A 1FGUA 1HFNA 3I4NB 1KC8C 1EZ6A 4JI3L 4DK0A 4DUYQ 3E9HA 5IGBA 1IYUA 4A3IH 3HFZB 1G2TA 3SEBA 1HNXQ 4JYAL 1UWVA 2QEJC 3R8BA 1DCZA 1HJPA 1Y8PB 1I94L 5FO9B 5JVG3 3CCVA 3M4YA 1PRTD 2NZOA 4POGA 2EYMA 4B08A 3RZOB 5ELBA 4IFDI 4LK1C 3J80c 4XQJA 1F9RA 1SSOA 2WINB 3S15B 1EY6A 3F2BA 1K0SA 1XTCD 2F1MA 3J7ZC 2RCFA 3TP5A 2F0QA 4IJHA 3MEHA 1Q82C 4JBMA 2R92B 1K73C 2MO0A 2CKZB 3BZCA 1PRTC 4WJWA 2PO4A 1BQQT 1U9RA 2QDLA 2F0GA 4B3SL 4RHSA 3M3YH 5IOCA 3NP8A 3H3VH 3UE1A 1B53A 3A74A 4KHZA 2QGQA 4XIGS 1JJCB 2E74C 3J80E 1XNQL 1STGA 2B2UC 4NXMQ 2RHSB 1IZ6A 4DGZA 3J7AF 4C3HB 2NTTA 1BOSA 4DV1Q 1N8RC 3J80L 1Y1VB 4GLXA 2HHHQ 4F87A 3W5OA 4XYOA 1LTID 3J81j 4KY7A 4CKCA 1A3VA 3L3OC 2D0OA 3G6JB 1Q7YC 3M7NA 1D5MC 1T9HA 4QIWE 4A3MH 1CHQD 1SXTA 2NVYB 2B2VC 4HTHA 1F2MA 1XPRA 5E1FA 2VXWA 2F0EA 4XYQA 3S2DH 3VA5A 4DKAC 1OXUA 3HKZG 3KDFB 3ULJA 1RKNA 4UPAA 1WD1A 3AB9A 2HQEA 1Y14B 1SNPA 1A15A 2K1BA 1JCKB 2ID0A 3HKZB 3NBHB 2KHJA 1H9SB 4YY3L 2JEBI 2NBFA 4EQ5A 5IT9L 1SR3A 3HOVB 1K0RA 2B2UA 5KRUA 2KCNA 2H1EA 1EWHA 3H15A 2B63G 2BOSA 1BNZA 1XPOA 1O7ZA 4L5QA 3J81i 1EY0A 4A3CG 3K7UC 1Z9FA 1WTPA 4X3TA 2WAQE 4NXNL 2EY2A 2F52A 5EKLA 1KDBA 4POFA 2B2VA 2F3IA 1K83H 1FD7D 2KA7A 3OPOA 4RH6A 2RA4A 4QIWB 4B3TL 1AP0A 2CH4W 4A3EH 5M5XH 2AQ3B 3MC0B 3K0YA 1MKHA 4B9WA 4DV5L 4JI5Q 3FEWX 5AJ3Q 1GUGA 1QJOA 2VY3A 4DR5L 4BBRH 2HCIA 4GN3B 2L9HA 2UXBL 4C2MB 1SFOH 2I46A 3MFYA 4L8JA 4F88A 4CDFC 5KYIA 4U673 5C4XB 3I90A 2HDLA 3NBIA 1EL0A 1SE8A 2IT1A 1AZQA 1S5CD 1EWIA 1EY8A 1KRTA 1SJED 3OW2A 2WAQB 3HOYB 3HOWB 2WB1E 2NVQB 4V0BA 3F1ZA 1GUOA 4XTCS 2E75C 1S5DD 3D6CA 2EJFC 4K6LA 4RGOS 3T1HQ 2A8VA 2IX0A 4PMBA 3K5NA 5C6AA 1WTXA 1ILQA 1Y8OB 1PH7A 1VF7A 2Z6KC 4LF4L 5FO7B 1JJ2A 3NE5B 1EYDA 3I4MG 3HOXH 5GAEC 2KEEA 4A3KG 4A3BH 1TIID 2FFKB 1WTWA 5JAVA 1JJGA 1HUNA 2PQAB 4KTAA 3FRPB 1GVPA 1U5KA 4GN4B 2PPBC 2YU9B 4JV5Q 3N6RA 5G3LF 5C4JH 4YCWA 1KLUD 3ERQA 5I9PA 1I4QA 2BDOA 2AMCB 1TWHB 2JA8G 1S5ED 4FO2A 3J7YW 2WB1B 4BS9A 1C4QA 5C5LA 2A6ED 2F0OA 1YIJA 2X69A 2Z6KA 3J81c 2R93G 1TWAB 2A1AA 2F0UA 5J1ZA 2UUCQ 3R3OA 3OTOL 1L0XB 3CW2C 2V4DA 1E2VA 2E2JH 2RQXA 2K6AA 4C1NK 4DNRB 1LTSD 1WTVA 1LM0A 4Y7NH 1N32Q 4ZKBB 5M3FB 2BE5D 3KFUA 1B1ZA 4Q5VA 1X55A 3EROA 4BY1G 1PHJA 4X3SA 1VQKA 4ZQ3A 2R3ZA 5E7NA 4X62L 4DNTB 1Q12A 1SYEA 1U4MA 4N9PA 2IJ0A 3CCMA 5LMNW 1FYCA 1T5XD 1EUJA 4HCEA 4DAYB 1D8LA 4G7HC 1P8LA 3VYUA 2KCMA 5IP9G 2D0PA 2QF7A 4DR7L 1M1KC 2OQ0A 1D5ZC 1VCIA 3J81E 4P71A 3C1EA 3D4DA 3MWYW 1IBML 1E3PA 4TSSA 3AFQA 2OTLA 1KDAA 4MN3A 5JVH3 3FKIG 2F0PA 4YCVA 4IOAA 2EZVA 3I4LA 2K14A 1BCPF 1Q3LA 2DUDA 4K8IA 1I6VC 2KVMA 2VW9A 1SMYC 3H09A 3FKIB 1KAAA 1G91A 3U4ZA 4IPGA 4HR7B 1UAPA 1XNRL 3I4OA 3CQZB 5EJWA 2D5DA 4A3JB 1K8OA 4WJ3M 1S3OA 5E4XA 1EIGA 2R7DA 1NTGA 2J7ZA 1TU2B 1X6OA 2IHFA 3V96A 3CF5A 2NVXH 3JAMi 2F3WA 3BYTB 2L5TA 5CGKA 2G5DA 2KBNA 1EIHA 5EPLA 4DXFA 3S2HB 3NK9A 1ASZA 1A2UA 1VQNA 1SAPA 2CCZA 3LGJA 1KTKA 3KLSA 4Z9CB 2QW7A 3G71A 1STBA 4A76A 1QVFA 4QY7A 1SMXA 2ES2A 2XSCA 1ZYRD 1W2BA 2ICIA 1LTTD 1TWGH 4LF6Q 4J15A 2A68C 3HKSA 2B63H 1N36L 1SNQA 3H0GB 1U4PA 1PLFA 2OCEA 1J8IA 1SYBA 1K8AC 5C4HA 4GKJQ 2QILA 1HHVA 5J3BA 2F0WA 4A93B 2B3GA 1IXRA 3GTKH 3WDNA 5TSSA 1HNZQ 4A3DG 1SNMA 3TEHB 2WV6D 4RG1A 1SE4A 1KAWA 1JC7A 5M5YB 2PQEA 4K0KL 4DV2L 1IBKQ 3MA2B 1PYWD 5IYDG 3IFTA 3UDFA 4IUPA 3GTPH 4LAAA 5K5PA 4QUFA 5CV5A 1FGBD 3SR1A 1JOKA 4PMWA 1DD2A 3A5UA 1OXTA 4JK1C 1LV9A 2NVTB 5C44B 2VB3X 1ZEQX 4EQPA 4DU9A 3HGBA 4H0LC 4QCLA 1QNUA 4YHHQ 1M4VA 5T1GA 1XTDA 4CHTB 5IP7G 1JOOA 5I6YA 1X9NA 3LNNA 4JI6L 3S9WA 1LABA 3MVVA 4QQBX 4CGYB 4YWLA 1STHA 5FO8B 4LFCQ 2NTSA 3IRBA 1HZAA 4GOPB 1EY7A 2F0SA 5CV8A 1IL2A 5ELFA 1LTAD 3I4MH 1ENAA 2VZAA 4P75A 3ER0A 5IIFA 4KN7C 3K81C 1U4RA 3TRZA 4A75A 3K7AH 2A6HC 4OWTB 1BCPC 2ZTDA 1QNKA 2F0IA 2NN6G 4P74A 5JEAG 4NMZA 3SXHA 4JI3Q 4LFBL 3CCQA 3CHBD 1B9NA 4J8QA 4JYAQ 4K2LA 4QB4A 1TS2A 5T1IA 4WJ4A 1OXXK 1I94Q 2J0TD 3KOJA 1MD2D 3M4QA 4X65L 1YNNC 2L0CA 2HD3A 5EBDA 3FPPA 3S16H 2KUMA 3EIVA 5JJIA 3O13A 2R93H 3U9SA 4IN3A 2IW3A 2KHIA 2RVLA 3Q24A 1UEBA 1LACA 2I5HA 2UUAL 1VQDA 3W2DA 3JAME 4OO1I 3TSSA 1CZGA 4NKLA 1JWSD 5IYCG 3TZDA 3DHQA 1A6XA 4EQOA 3QO2A 4B3SQ 4LF7L 5I2XA 3DMUA 2EJMA 1XYIA 4AQYL 1VQMA 3NTIA 3A56A 1QE6A 3JAML 1WI5A 2YYZA 2MNAA 4BY7G 1R4QB 4HIMA 1A0IA 1FNWA 1JICA 3BDCA 4L63B 3S2DB 4WORA 4HIKA 1TXYA 3GTQH 5EQ0A 3PO3B 5IP9H 4FF2A 5C0XJ 3DLLA 4IUQA 1F9QA 1O78A 4RGTA 2IWHA 2JN4A 4RHRA 5I9OA 4GKJL 2LFNA 4LF8L 1ESFA 2CFMA 1I4GA 4K6DA 4BBSG 2PYKA 3KJPA 2M9VA 2R7ZG 3S1RH 4PNYA 5ELCA 1I4HA 2O2LD 1PH4A 3EVQA 4UAIA 1J5EL 5L37A 5C0XH 4FVMA 3ICEA 2Q8TA 1EYAA 1EY5A 4IFDG 1KNAA 2GVBA 2K33A 2PNRC 1XMQL 1B9MA 3PO2G 1QZGA 1K83B 1HH2P 5CR3A 4YY3Q 4PV1C 3H3VI 1C0AA 1I4PA 4A3EB 3OIPA 5KNBA 4KY5A 1EZ8A 3GV3A 3MXUA 4OONA 4MTKA 1VQ9A 3S14B 1S72A 2VS1A 4ZUJA 3H94A 4JI1L 1TWCH 1B2TA 1PYBA 4GNXC 4NXNQ 4DV0L 1BBUA 1VQGA 2UXDL 1Q1BA 1XPUA 1JWUD 3SGIA 1KL9A 1IHZA 2WIIB 5BN5A 4B3TQ 1ESRA 1NR4A 4RMFA 1I6HH 1NMGA 4DV5Q 1RL2A 1RTNA 4X64L 2KECA 3KJOA 1FL0A 4DR5Q 3IFDA 4CJ0B 2FHTA 4PMCA 2ASBA 2DNCA 1II3A 3MFGA 1ASYA 2ZT9C 2UXBQ 4FF3A 1X56A 5M9OA 2JA6H 3I55A 2EXZA 4FXGC 2B2TC 3OIQA 3U9OA 1ET9A 1RHPA 4AH6A 3I4NG 1D6EC 2JA5H 4CDEC 3BYYB 4BWGB 1I3QB 4A3GG 4GLVB 5K36G 5IYDH 4A3BB 3NSWA 5EBCA 1B70B 1LYLA 1HPCA 3RZDH 2RDFA 4GNXA 4IUVA 2F0JA 2LSSA 4A3GB 1PTOF 1S4ZA 3DM3A 1ONLA 1WFQA 5I2YA 3S1MH 1H9MA 3GV6A 2OWOA 3GTLH 3I73A 2NUCA 1XX8A 1GKHA 2ZXPA 2KJXA 1KNEA 2FXQA 4ABNA 1CHPD 1Z47A 1YEZA 2R92G 4LF4Q 4HSVA 1BKBA 3MHBA 5M3MB 1SEBD 1NNXA 5LHY1 1GM5A 4X6AH 2MQHA 2ZXRA 5JPMC 2B2TA 2K01A 2ZTEA 4JW0A 2G9HD 2AWNA 5BN4A 4EGVA 1OTCA 5C3EH 2L15A 4O2DA 2MPMA 3E3XA 2ZXOA 3K0XA 1S5BD 2Q2HA 4JI0L 1VQ6A 3QIAA 2F0FA 4Y7NB 5M5WH 5CYUA 1TT2A 3T13A 3S1QH 4DV6L 4C3HG 3DUZA 1SNOA 3P20A 1GUSA 4X3KA 2B2YA 5DEHA 4RKBA 1MJEA 1Y1VG 4F8MA 2PW5A 5JEAH 1YHAA 1V1QA 1GUTA 2EYOA 1PRTB 4JI4L 4IURA 3G48A 4BA1I 1PZID 3T51B 1VQ8A 3V2TA 1QCBD 3GD7A 3TDQA 4XQQA 3OTOQ 1PH1A 4R8NA 2E76C 4JI2L 2AWOA 5EKIA 1STYA 3EQLC 1TWFH 3K59A 5JJLA 1EU4A 4O1NA 1X3EA 1IKMA 5JPNC 2JA7H 3HOVG 2KEDA 4X62Q 3NQIA 1CA5A 1IYVA 4LMQD 3VYSA 3PQIA 4LUOA 2JXMB 5IYCH 1I4RA 3GTMB 4DR7Q 5CORA 5LL6X 2DJGC 4B3RQ 1IBMQ 1STNA 3HOUH 2O5IC 4I65A 4NPSA 3BJUA 2OXPA 4DXGA 1AW7A 3F2UA 3LWUA 4FF1A 4IALA 2QEXA 2VQFL 1TY0A 1YI2A 1CTMA 1YNXA 2K32A 4YWKA 1VMCA 1K8GA 4KK7A 1M8AA 2E5LL 3GTJH 2BCOA 4PG3A 1G51A 3J7AV 1QUQA 4QJFA 2ZJRA 1XNRQ 4BBSH 1V8QA 2MUYA 1J6QA 5IYBG 3ULLA 3K5MA 3BG3A 3K8AA 3CCSA 1UEAB 3CRLC 3RLOA 2QCPX 4KY6A 1C9OA 4R4OA 2ZJPA 5C4XG 1BF4A 1ILPA 2EDGA 3GTOB 4IFDH 1B3QA 1PTOC 1Z7TA 1LT4D 1TS3A 2QDBA 4KV6A 3I56A 4R9WA 2R61A 3PO2H 2Z9HA 4RAUC 2B29A 2F0LA 3I8ZA 1NUCA 2WAQG 3HOYG 1EOVA 1CSPA 2E2DC 3HOWG 1KLGD 3E9IA 3S24A 1N36Q 1FR3A 4R4IA 1D1KA 3TP8A 4GKKL 2RKSA 4DR4L 1HZ9A 5A35A 1U0LA 2XNAC 2SEBD 4DFAA 3S1NH 1QVCA 3SK5A 3CCLA 4HMIA 2RSNA 1OXSC 4HIOA 3KBXA 1HQMC 4A3FH 1FVIA 2O4XA 1Q46A 5C5MA 4DR3L 5EKKA 4XT3B 4K0KQ 1WTHA 4DV2Q 1FJGL 2K5NA 1E24A 3KF6A 3QR8A 4RKLA 2EY5A 2VQEL 3SE0A 1GOZA 1QVGA 1SNCA 2LXJA 4LWCA 4XT1B 1CA6A 2WB1G 3X3NA 2H4OA 3TP6A 1KQSA 2VUMB 4KJNA 1NMFA 4X66L 1XJVA 3NHHA 1EOTA 2YTYA 5BR8L 3K7AB 1DYQA 1SJHD 5LMUL 4A4IA 3RZOH 1A63A 3WWVA 1O7LA 1T5EA 1VMPA 4K5VA 4JVZA 3NPPA 4V190 4JI6Q 4KKTA 4GLAC 1CKMA 2EPBA 3FDTA 2F0NA 5M3FG 1K28A 3D8GA 3CKIB 1G2SA 1HZCA 4MHEA 3S15H 3BDOA 4K5XA 2N8NA 2G9DA 2K5HA 4FP5D 4MTNA 2K5DA 3BVMA 4I7AA 3KF8A 3QWNA 4H02A 3CCEA 1Y1WG 3RN2A 2XTIA 2UXCL 1W6KA 1BBWA 1EQRA 1X32A 1SYCA 1SN8A 2KENA 1Y1WB 1SMYD 2X6LA 5IWAL 1AFPA 4B3RL 2Q8RE 5ELEA 4MIUA 1SYDA 4LFBQ 3LX0A 3A55A 3NTHA 2EVBA 2P5ZX 2NYZD 3D6WA 3ZJYC 5EAYA 3PUVA 3J81L 4C3HH 3S17H 3NELA 1EY9A 1I50B 3OHXC 1NCVA 1LTGD 4EVOA 5CV6A 4C3JG 3RR5A 4R4CA 4X65Q 1D7QA 2X6GA 4A3JG 3A54A 3OMGA 4C3JB 1ENFA 2NVYH 5FLMG 1K8MA 2RDHA 1R4PB 5GADC 2UUAQ 1EY4A 2EYJA 4OEMB 5D3DA 1EYCA 2WKDA 2A68D 3HS0C 4JPBW 4YWMA 3Q0AA 5D65A 3S1RB 4LF7Q 4ZKCB 2AQ1B 3SDZA 1EEID 4L5TA 5CV9A 1ML0D 2I5MX 4AQYQ 4KHVA 3CCUA 2FMMA 3SVMA 1Q1EA 4RCOA 2FMCA 1EIYB 3H0GG 3TMEA 4DV3L 3PIPA 3RLNA 1DJRD 3RD4A 4QL5A 3R2IA 3MXNA 3N52A 3M4OB 5G3LD 2LS01 4WFN3 5FJ8G 4FYDA 1AE3A 3NWTA 4A3CH 4A93G 1IKLA 1V9PA 1VQBA 3DEOA 2CWPA 2SNSA 1E2WA 2A69C 4LF8Q 1GD7A 1IL8A 2AQ2B 4B3ML 3HOZB 1JORA 1Z6HA 1N33L 1STEA 5GROA 3T1YQ 1CKNA 1I5FA 2A5HA 2EE1A 4M8AA 1EWCA 2Z8LA 1J5EQ 2NZ1D 1WCMG 1PH6A 1O80A 2OT2A 5FKAC 4YCUA 1X54A 3CRKC 3I70A 4A3LG 1N34L 4ZCKA 1WCMB 4LNQA 1IBLL 1XMQQ 4C3IG 3C2PA 4C2MH 2OQKA 2K04A 4E6IA 3HEJA 2MO1A 4CKBA 1E7ZA 5IGGA 4C3IB 2KCTA 2F0KA 1VS0A 5C4XH 4OO1G 1TS5A 2KCCA 3SK6A 1I6HB 1PTOH 2CQOA 1Q90A 5C44G 3AMUA 1K9MC 3QOJA 1K3BC 2N55A 3A0JA 4QUCA 3URYA 1UE7A 1DM0B 3R2TA 1VQPA 4JI1Q 1NBWA 1EIFA 2VL6A 3FHWA 3PUZA 2NVQH 3HOWH 4DV0Q 2JA5B 3Q22A 3RNUA 2UXDQ 4OHJA 3MAQA 2CQAA 4NW2A 3VR6A 5LMNL 3RZDB 1BR9A 4A3IB 2XGTA 4DR1L 4R4QA 5C0XI 3BDLA 5HURA 1JE5A 2PI2A 3PMFA 1KABA 2A6HD 1BCPD 1ET6A 4OWXB 3HG9A 1X3GA 5FLXc 3PSIA 1UNSA 4O0AA 1L1OC 4X64Q 5GQOA
chains in the Genus database with same CATH topology
2HQLA 3SGIA 2BA0A 3H15A 2UUBQ 2VNUD 2B63G 2AHOB 4JG2A 4JI7Q 2F4VL 1KL9A 1XPOA 4L5QA 3J81i 4B3TQ 4A3CG 4A3KH 1LUZA 3K7UC 1Z9FA 2BH8A 1I6HH 4RMFA 1NMGA 1Y1VH 1RL2A 2LXKA 2WAQE 4NXNL 4DAMA 5GAGC 4DV5Q 2C35B 4X64L 3KJOA 1FL0A 2F52A 3E0EA 4DR5Q 2UUBL 4POFA 1S40A 2R7FA 4JI7L 1K3RA 2N49A 2ASBA 2K4KA 3UDGA 1A8VA 2F3IA 1ASYA 2DGYA 2UXBQ 1K83H 4B3TL 1TWHH 4LF9Q 1X56A 4EX5A 2JA6H 3I55A 4A3EH 1N9WA 3ERSX 5M5XH 3I4NG 4AH6A 4ME3A 4HJAA 2JA5H 1MKHA 1OXVA 3PCOB 2JA8H 4DV5L 1VQOA 1KRSA 4JI5Q 5AJ3Q 3TS0A 4A3GG 4GLVB 5K36G 4DR5L 2VY3A 5IYDH 4BBRH 4GN3B 5IY0A 1B70B 1LYLA 1SRUA 3RZDH 5C0XG 4GNXA 2UXBL 2LSSA 1E1OA 1L1OA 1SFOH 3VDYA 3MXNB 4LF9L 2WP8J 3CMAA 1NJIC 4DV4Q 3HOVH 3DM3A 1L2FA 1WFQA 3GTMH 3S1MH 5GAHC 4PZ8A 4JI5L 1SE8A 3U58A 2IT1A 2OWOA 5AJ3L 3GTLH 5M3FH 1PH5A 2PMZE 1AE2A 1EWIA 1KRTA 3KYHC 1GKHA 2FXQA 3L7ZC 1CKNB 3PUWA 5HGQA 3OW2A 1Z47A 1PH3A 1YEZA 2R92G 4LF4Q 3UDXA 1BKBA 1P16A 4DV4L 4BY1H 3HOZG 3PO3G 4MNOA 2PI2E 2WB1E 4HJ8A 1GM5A 4JI0Q 3U4VA 4X6AH 4KLKA 3F1ZA 4XTCS 2MQHA 4PZ7A 3AEVA 3T1HQ 1VQFA 2A8VA 4DV6Q 1YHQA 2ZTEA 2IX0A 3GO5A 2AWNA 4DV7Q 1OTCA 5C3EH 2L15A 2YTXA 4O2DA 1PH7A 2Z6KC 4LF4L 3K0XA 4JCVE 3EN2A 1R9TH 4LUVA 4JI4Q 1JJ2A 2EQSA 2Q2HA 3I4MG 3HOXH 4JI0L 1VQ6A 4L5RC 5GAEC 3L2PA 4A3KG 4A3BH 3T1HL 5M5WH 3S1QH 1VQJA 4DV6L 3FKIH 5IYBH 3W1GA 1WYDA 4AYBE 4DV7L 3EBEA 1JJGA 3T1YL 2PQAB 1Y1VG 4HIDA 1MJEA 3GTOH 1CSQA 4JI2Q 1GVPA 1V1QA 1YHAA 1U5KA 3BZKA 4JI4L 4GN4B 4A3JH 1EYGA 4JV5Q 1L1OC 3G48A 4BA1I 5C4JH 2Q2IA 1VQ8A 2BH2A 4YCWA 2JA6G 2V1CC 4A3EG 3GD7A 3CCRA 3OTOQ 1PH1A 1XMOQ 2AMCB 2JA5G 3CXCA 2JA8G 1VQCA 3M9BA 4UP7A 3HOYH 4IOCA 4JI2L 2AWOA 1Q8KA 4JBJA 1YIJA 3UDIA 3GTGH 1TWFH 3S2HH 2Y0SE 1PVOA 5JJLA 2R6GA 4JV5L 4A3IG 4BXXH 1LTLA 1X3EA 4LUZA 2Z0SA 2Z6KA 3J81c 2R93G 1EFWA 2A1AA 1X65A 4TQUS 2JA7H 3HOVG 2UUCQ 3OTOL 4X62Q 4GOPC 1XMOL 1YHBA 2HT1A 3CP0A 3CW2C 4DK3C 3H0GH 2VQFQ 3K80C 2E2JH 4JC0A 4LUOA 2K52A 5IYCH 4BA2I 4DPGA 1CKOA 1DGSA 1LM0A 4Y7NH 4DR7Q 1N32Q 2GN5A 2ALYB 2YTVA 1YVCA 5FJ8H 3KFUA 4B3RQ 1IBMQ 2E5LQ 1X55A 3CAMA 4BY1G 1VQ4A 1PHJA 3HOUH 1NE3A 2UUCL 1VQKA 4X62L 4A93H 5E7NA 4NPSA 3BJUA 1Q12A 3KLWA 3CCMA 5LMNW 1L0WA 2QEXA 2MFIA 2VQFL 1YJWA 2YU9H 1JT8A 3D0FA 1EUJA 2N3SA 1VQAA 1D8LA 2I5LX 4DAYB 1YI2A 1P8LA 2IY5B 2KCMA 1YNXA 2D0PA 5IP9G 2E2HH 4DR7L 1N32L 1M1KC 1G6PA 2OQ0A 4LFAQ 4YWKA 1VCIA 5C3EG 4P71A 1K8GA 4A3DH 5M5YH 4TVAB 1IBML 2E5LL 3TRZA 2JK8A 4JBWA 2JQOA 4PG3A 3GTJH 4GNXB 1G51A 1E3PA 2VUMH 1L1OB 3AFQA 1QUQA 3OYYA 4QJFA 2ZJRA 4A3LH 1XNRQ 2BA1A 3PUYA 2OTLA 4BBSH 4A3BG 2IHEA 1J6QA 3AQQA 3FKIG 3ULLA 5IYBG 4YCVA 4IOAA 3FP9A 3K8AA 4GOPA 2K14A 3CCSA 2H5XA 4IPDA 2HIVA 2DUDA 4LFAL 1TWAH 3L0OA 3RLOA 3PIOA 2VW9A 5DLQE 1YBYA 4LF5Q 1C9OA 4R4OA 3JAMc 3U4ZA 4IPGA 4OXPA 2ZJPA 1HR0W 3CCJA 5C4XG 3TS2A 3AYHB 4JI8Q 1VQLA 2NVTH 1YZ6A 3I56A 3I4OA 1XNRL 3CC7A 4GKKQ 2JA9A 4DR2Q 4DR4Q 4WJ3M 4OWWB 3PO2H 1PH9A 1S3OA 1VQEA 2B29A 2R7DA 4MZ9A 1NTGA 2Q2UA 2WAQG 4A3MG 5JJKA 3HOYG 1EOVA 1CSPA 5M3MG 1CUKA 1X6OA 2IHFA 1UE5A 3CF5A 1C7YA 2NVXH 2UU9Q 3TREA 3JAMi 3HOWG 2K50A 1WJJA 4GS3A 3E9IA 1XPUA 4KHPQ 4JI8L 3I2ZA 3S24A 2KBNA 2QA4A 1N36Q 4R4IA 4GKKL 3UE0A 5IP7H 1Y1WH 1G291 4DNIA 1ASZA 2JA7G 1VQHA 4DR4L 1VQNA 4DR3Q 1HZ9A 4UY8C 1U0LA 2CCZA 3LGJA 3G71A 4IPCA 3S1NH 4A76A 1QVFA 2ZTCA 1QVCA 1SMXA 4QY7A 3CC2A 3CCLA 2ES2A 1JMCA 4ALPA 5JEAJ 3CC4A 1FJGQ 1OXSC 1W2BA 2UU9L 1A62A 4HIOA 4KHPL 2PNHA 1TWGH 4LF6Q 4J15A 4A3FH 3PGZA 3HKSA 2B63H 1N36L 2VQEQ 1PFSA 1B8AA 1FVIA 2OCEA 2WFWA 3D31A 1PH2A 1K8AC 4DR3L 1Q46A 4HJ9A 3HOUG 4GKJQ 1I50H 3ULPA 1PYSB 5J3BA 3BU2A 4K0KQ 2B3GA 4DV2Q 1XNQQ 4IJLA 1FJGL 4KI0A 1IXRA 2K5NA 4LW1A 1E24A 3KF6A 3J80i 3CQZH 4C3JH 4DUZQ 3CPFA 2E8GA 4JOIC 4X66Q 4LF6L 3GTKH 2VQEL 3U50C 1QVGA 1HNZQ 4JBKA 4A3DG 1PH8A 2LXJA 4LWCA 2RHQB 5BR8Q 3HKZE 3TEHB 1NY4A 5LMUQ 2JE6I 4RG1A 2WB1G 3M85A 1KAWA 5ELNA 5FLMH 5IT9c 2EXDA 1KQSA 4K0KL 4Y52H 4APVA 4DV2L 1IBKQ 4DUZL 1SROA 1NMFA 4X66L 4BBRG 5IYDG 2E2IH 2I0QA 1XJVA 1HNZL 3UDFA 3GTPH 2YTYA 3GDEA 5BR8L 1VQ7A 4NB3A 5LMUL 3RN5A 3MEFA 4A4IA 1M90C 2IX1A 4DR6Q 3RZOH 2AKWB 4OX9Q 1YJ9A 1A63A 2ZJQA 4PMWA 3WWVA 1B7YB 2UXCQ 2NN6I 3A5UA 1OXTA 2CWAA 4JI6Q 4GLAC 1O7IA 1CKMA 1IBKL 3M4OH 5M3FG 3S15H 4AYBG 1HZCA 1YITA 1H95A 3B6YA 2K75A 2N8NA 1Q81C 2ZM6Q 3NENA 3TQYA 4YHHQ 2K5HA 5IWAQ 4MTNA 4DR6L 4JOIA 3HOZH 4H02A 1XTDA 3CCEA 1Y1WG 5IP7G 3PO3H 3RN2A 2XTIA 2UXCL 3JC66 1X9NA 4BY7H 1BBWA 1EQRA 4JI6L 1QUQB 4QQBX 1SN8A 4HJ7A 1MIUA 2KENA 4P73A 1HZBA 4YWLA 3G6EA 4UP8A 1KIXA 4LFCQ 3IRBA 1HZAA 3A5ZB 4L5SA 2ZM6L 4GOPB 5H1SE 4YHHL 2GVAA 2Y0SG 5IWAL 1PA6A 1WCMH 5ELOA 1HR0Q 4A3FG 4B3RL 1IL2A 3KDFA 1VQIA 4LFBQ 4IFDJ 3F8TA 3I4MH 3HOXG 2VZAA 4P75A 2Q2TA 3ER0A 4IPHA 1IYJB 1BVSA 3F2DA 1RIPA 1GO3E 3K81C 3ZJYC 2R7ZH 1X3FA 3PUVA 5EAYA 3RLFA 4C3IH 4LFCL 3I7FA 4C3HH 4PZ6A 2HIXA 4GN5A 4A75A 2ATWA 3K7AH 1HNWQ 3NELA 4OWTB 2JJQA 2ZTDA 2NN6G 4P74A 5JEAG 1HR0L 1EQQA 3RR5A 4R4CA 4X65Q 2A19A 4JI3Q 4LFBL 3J7A5 1D7QA 3CCQA 4R4TA 4DK6C 4FDBA 4A3JG 4HJ5A 4UP9A 5C44H 3PF5A 1UE1A 4JYAQ 4AIMA 2NVYH 5FLMG 4WJ4A 1OXXK 1I94Q 1HNWL 3W1BA 5IE8A 5GADC 2OTJA 2UUAQ 1WOCA 3CD6A 1SLJA 3S14H 1FGUA 1VQ5A 3KOJA 4LF5L 1KC8C 4DV3Q 3M4QA 4YWMA 4JI3L 4X65L 2YV5A 1KHIA 4DUYQ 3E9HA 2JEAI 4A3IH 3S16H 4BXXG 3HFZB 3EIVA 5JJIA 4LF7Q 1KXLA 1HNXQ 3S17H 4JYAL 1UWVA 3CPWA 4L5TA 4DR2L 2R93H 4AQYQ 2I5MX 1HJPA 3CCUA 1YJNA 1I94L 3F2CA 1Q1EA 2KHIA 3CCVA 2UUAL 1UEBA 2I5HA 1VQDA 2NZOA 1EIYB 4POGA 4OO1I 4B3MQ 3H0GG 1E1TA 5IYCG 4DV3L 3J80c 3RLNA 3PIPA 3PUXA 4DUYL 1N33Q 4IFDI 4QL5A 1QZHA 3KF6B 4B3SQ 4LF7L 1MJCA 3F2BA 5FJ8G 1HNXL 4IO9A 1AE3A 3J7ZC 4AQYL 1VQMA 4A3CH 4A93G 1V9PA 5HY6A 1VQBA 2CWPA 3AFPA 1WI5A 4IJHA 2YYZA 4QGUA 2MNAA 4LF8Q 4BY7G 1Q82C 4HIMA 1Q86C 1PV4A 1GD7A 1A0IA 4R1JA 1N34Q 1K73C 4JBMA 2MO0A 4B3ML 2CKZB 3BZCA 1TXYA 3Q8DA 4HIKA 1IBLQ 3GTQH 3G4SA 1N33L 5IP9H 5GROA 3T1YQ 1AH9A 1CKNA 1I5FA 5C0XJ 3DLLA 4B3SL 1J5EQ 3M3YH 1WCMG 1PH6A 3CMEA 3STBD 3H3VH 2VUMG 3UE1A 4YCUA 4GKJL 3A74A 1X54A 3NEMA 4KHZA 2QGQA 1I3QH 2K5VA 1JB7A 4XIGS 1N34L 1JJCB 4LF8L 2CFMA 3I4NH 4A3LG 4BBSG 4LNQA 1V43A 3KJPA 2R7ZG 3S1RH 1IBLL 1XMQQ 1XNQL 4NXMQ 2RHSB 4C2MH 4A3GH 2OQKA 3PV0A 1PH4A 3M4PA 1IZ6A 2MO1A 1J5EL 1E7ZA 3PF4A 2KCTA 3ICEA 1VS0A 5C4XH 4DV1Q 4OO1G 1N8RC 1UE6A 3STBC 4GLXA 2CQOA 3W5OA 1KD1C 2HHHQ 5C44G 4IFDG 1K9MC 2GVBA 3KF8B 3J81j 1E22A 5LMNQ 1XMQL 3A0JA 4NXML 1UE7A 4DR1Q 2PQAA 2D0OA 1VQPA 1Q7YC 1QZGA 3M7NA 1HH2P 4JI1Q 3PO2G 1T9HA 4YY3Q 1NBWA 3H3VI 1C0AA 4QIWE 1EIFA 2RCNA 2VL6A 4A3MH 1XPRA 3FHWA 5M3MH 1W3SA 3PUZA 2NVQH 3HOWH 4DV0Q 4DV1L 3RNUA 2RF4A 2UXDQ 4OONA 1VQ9A 2R92H 2HHHL 3S2DH 4OX9L 2F4VQ 4DKAC 1OXUA 3HKZG 1S72A 2VS1A 2NZHA 3KDFB 3ULJA 5LMNL 4UPAA 4P72A 1Y14B 2D62A 2N78A 2XGTA 4DR1L 4R4QA 5C0XI 2ID0A 1JE5A 2PI2A 3NBHB 2EIFA 2KHJA 4OWXB 1TWCH 4JI1L 4YY3L 2JEBI 1X3GA 5FLXc 4EQ5A 3PSIA 1SR3A 1PYBA 4GNXC 4O0AA 1K0RA 4NXNQ 4DV0L 1BBUA 1VQGA 2UXDL 1Q1BA 4X64Q 5GQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQL A;  3SGI A;  2BA0 A;  3H15 A;  2UUB Q;  2VNU D;  2B63 G;  2AHO B;  4JG2 A;  4JI7 Q;  2F4V L;  1KL9 A;  1XPO A;  4L5Q A;  3J81 i;  4B3T Q;  4A3C G;  4A3K H;  1LUZ A;  3K7U C;  1Z9F A;  2BH8 A;  1I6H H;  4RMF A;  1NMG A;  1Y1V H;  1RL2 A;  2LXK A;  2WAQ E;  4NXN L;  4DAM A;  5GAG C;  4DV5 Q;  2C35 B;  4X64 L;  3KJO A;  1FL0 A;  2F52 A;  3E0E A;  4DR5 Q;  2UUB L;  4POF A;  1S40 A;  2R7F A;  4JI7 L;  1K3R A;  2N49 A;  2ASB A;  2K4K A;  3UDG A;  1A8V A;  2F3I A;  1ASY A;  2DGY A;  2UXB Q;  1K83 H;  4B3T L;  1TWH H;  4LF9 Q;  1X56 A;  4EX5 A;  2JA6 H;  3I55 A;  4A3E H;  1N9W A;  3ERS X;  5M5X H;  3I4N G;  4AH6 A;  4ME3 A;  4HJA A;  2JA5 H;  1MKH A;  1OXV A;  3PCO B;  2JA8 H;  4DV5 L;  1VQO A;  1KRS A;  4JI5 Q;  5AJ3 Q;  3TS0 A;  4A3G G;  4GLV B;  5K36 G;  4DR5 L;  2VY3 A;  5IYD H;  4BBR H;  4GN3 B;  5IY0 A;  1B70 B;  1LYL A;  1SRU A;  3RZD H;  5C0X G;  4GNX A;  2UXB L;  2LSS A;  1E1O A;  1L1O A;  1SFO H;  3VDY A;  3MXN B;  4LF9 L;  2WP8 J;  3CMA A;  1NJI C;  4DV4 Q;  3HOV H;  3DM3 A;  1L2F A;  1WFQ A;  3GTM H;  3S1M H;  5GAH C;  4PZ8 A;  4JI5 L;  1SE8 A;  3U58 A;  2IT1 A;  2OWO A;  5AJ3 L;  3GTL H;  5M3F H;  1PH5 A;  2PMZ E;  1AE2 A;  1EWI A;  1KRT A;  3KYH C;  1GKH A;  2FXQ A;  3L7Z C;  1CKN B;  3PUW A;  5HGQ A;  3OW2 A;  1Z47 A;  1PH3 A;  1YEZ A;  2R92 G;  4LF4 Q;  3UDX A;  1BKB A;  1P16 A;  4DV4 L;  4BY1 H;  3HOZ G;  3PO3 G;  4MNO A;  2PI2 E;  2WB1 E;  4HJ8 A;  1GM5 A;  4JI0 Q;  3U4V A;  4X6A H;  4KLK A;  3F1Z A;  4XTC S;  2MQH A;  4PZ7 A;  3AEV A;  3T1H Q;  1VQF A;  2A8V A;  4DV6 Q;  1YHQ A;  2ZTE A;  2IX0 A;  3GO5 A;  2AWN A;  4DV7 Q;  1OTC A;  5C3E H;  2L15 A;  2YTX A;  4O2D A;  1PH7 A;  2Z6K C;  4LF4 L;  3K0X A;  4JCV E;  3EN2 A;  1R9T H;  4LUV A;  4JI4 Q;  1JJ2 A;  2EQS A;  2Q2H A;  3I4M G;  3HOX H;  4JI0 L;  1VQ6 A;  4L5R C;  5GAE C;  3L2P A;  4A3K G;  4A3B H;  3T1H L;  5M5W H;  3S1Q H;  1VQJ A;  4DV6 L;  3FKI H;  5IYB H;  3W1G A;  1WYD A;  4AYB E;  4DV7 L;  3EBE A;  1JJG A;  3T1Y L;  2PQA B;  1Y1V G;  4HID A;  1MJE A;  3GTO H;  1CSQ A;  4JI2 Q;  1GVP A;  1V1Q A;  1YHA A;  1U5K A;  3BZK A;  4JI4 L;  4GN4 B;  4A3J H;  1EYG A;  4JV5 Q;  1L1O C;  3G48 A;  4BA1 I;  5C4J H;  2Q2I A;  1VQ8 A;  2BH2 A;  4YCW A;  2JA6 G;  2V1C C;  4A3E G;  3GD7 A;  3CCR A;  3OTO Q;  1PH1 A;  1XMO Q;  2AMC B;  2JA5 G;  3CXC A;  2JA8 G;  1VQC A;  3M9B A;  4UP7 A;  3HOY H;  4IOC A;  4JI2 L;  2AWO A;  1Q8K A;  4JBJ A;  1YIJ A;  3UDI A;  3GTG H;  1TWF H;  3S2H H;  2Y0S E;  1PVO A;  5JJL A;  2R6G A;  4JV5 L;  4A3I G;  4BXX H;  1LTL A;  1X3E A;  4LUZ A;  2Z0S A;  2Z6K A;  3J81 c;  2R93 G;  1EFW A;  2A1A A;  1X65 A;  4TQU S;  2JA7 H;  3HOV G;  2UUC Q;  3OTO L;  4X62 Q;  4GOP C;  1XMO L;  1YHB A;  2HT1 A;  3CP0 A;  3CW2 C;  4DK3 C;  3H0G H;  2VQF Q;  3K80 C;  2E2J H;  4JC0 A;  4LUO A;  2K52 A;  5IYC H;  4BA2 I;  4DPG A;  1CKO A;  1DGS A;  1LM0 A;  4Y7N H;  4DR7 Q;  1N32 Q;  2GN5 A;  2ALY B;  2YTV A;  1YVC A;  5FJ8 H;  3KFU A;  4B3R Q;  1IBM Q;  2E5L Q;  1X55 A;  3CAM A;  4BY1 G;  1VQ4 A;  1PHJ A;  3HOU H;  1NE3 A;  2UUC L;  1VQK A;  4X62 L;  4A93 H;  5E7N A;  4NPS A;  3BJU A;  1Q12 A;  3KLW A;  3CCM A;  5LMN W;  1L0W A;  2QEX A;  2MFI A;  2VQF L;  1YJW A;  2YU9 H;  1JT8 A;  3D0F A;  1EUJ A;  2N3S A;  1VQA A;  1D8L A;  2I5L X;  4DAY B;  1YI2 A;  1P8L A;  2IY5 B;  2KCM A;  1YNX A;  2D0P A;  5IP9 G;  2E2H H;  4DR7 L;  1N32 L;  1M1K C;  1G6P A;  2OQ0 A;  4LFA Q;  4YWK A;  1VCI A;  5C3E G;  4P71 A;  1K8G A;  4A3D H;  5M5Y H;  4TVA B;  1IBM L;  2E5L L;  3TRZ A;  2JK8 A;  4JBW A;  2JQO A;  4PG3 A;  3GTJ H;  4GNX B;  1G51 A;  1E3P A;  2VUM H;  1L1O B;  3AFQ A;  1QUQ A;  3OYY A;  4QJF A;  2ZJR A;  4A3L H;  1XNR Q;  2BA1 A;  3PUY A;  2OTL A;  4BBS H;  4A3B G;  2IHE A;  1J6Q A;  3AQQ A;  3FKI G;  3ULL A;  5IYB G;  4YCV A;  4IOA A;  3FP9 A;  3K8A A;  4GOP A;  2K14 A;  3CCS A;  2H5X A;  4IPD A;  2HIV A;  2DUD A;  4LFA L;  1TWA H;  3L0O A;  3RLO A;  3PIO A;  2VW9 A;  5DLQ E;  1YBY A;  4LF5 Q;  1C9O A;  4R4O A;  3JAM c;  3U4Z A;  4IPG A;  4OXP A;  2ZJP A;  1HR0 W;  3CCJ A;  5C4X G;  3TS2 A;  3AYH B;  4JI8 Q;  1VQL A;  2NVT H;  1YZ6 A;  3I56 A;  3I4O A;  1XNR L;  3CC7 A;  4GKK Q;  2JA9 A;  4DR2 Q;  4DR4 Q;  4WJ3 M;  4OWW B;  3PO2 H;  1PH9 A;  1S3O A;  1VQE A;  2B29 A;  2R7D A;  4MZ9 A;  1NTG A;  2Q2U A;  2WAQ G;  4A3M G;  5JJK A;  3HOY G;  1EOV A;  1CSP A;  5M3M G;  1CUK A;  1X6O A;  2IHF A;  1UE5 A;  3CF5 A;  1C7Y A;  2NVX H;  2UU9 Q;  3TRE A;  3JAM i;  3HOW G;  2K50 A;  1WJJ A;  4GS3 A;  3E9I A;  1XPU A;  4KHP Q;  4JI8 L;  3I2Z A;  3S24 A;  2KBN A;  2QA4 A;  1N36 Q;  4R4I A;  4GKK L;  3UE0 A;  5IP7 H;  1Y1W H;  1G29 1;  4DNI A;  1ASZ A;  2JA7 G;  1VQH A;  4DR4 L;  1VQN A;  4DR3 Q;  1HZ9 A;  4UY8 C;  1U0L A;  2CCZ A;  3LGJ A;  3G71 A;  4IPC A;  3S1N H;  4A76 A;  1QVF A;  2ZTC A;  1QVC A;  1SMX A;  4QY7 A;  3CC2 A;  3CCL A;  2ES2 A;  1JMC A;  4ALP A;  5JEA J;  3CC4 A;  1FJG Q;  1OXS C;  1W2B A;  2UU9 L;  1A62 A;  4HIO A;  4KHP L;  2PNH A;  1TWG H;  4LF6 Q;  4J15 A;  4A3F H;  3PGZ A;  3HKS A;  2B63 H;  1N36 L;  2VQE Q;  1PFS A;  1B8A A;  1FVI A;  2OCE A;  2WFW A;  3D31 A;  1PH2 A;  1K8A C;  4DR3 L;  1Q46 A;  4HJ9 A;  3HOU G;  4GKJ Q;  1I50 H;  3ULP A;  1PYS B;  5J3B A;  3BU2 A;  4K0K Q;  2B3G A;  4DV2 Q;  1XNQ Q;  4IJL A;  1FJG L;  4KI0 A;  1IXR A;  2K5N A;  4LW1 A;  1E24 A;  3KF6 A;  3J80 i;  3CQZ H;  4C3J H;  4DUZ Q;  3CPF A;  2E8G A;  4JOI C;  4X66 Q;  4LF6 L;  3GTK H;  2VQE L;  3U50 C;  1QVG A;  1HNZ Q;  4JBK A;  4A3D G;  1PH8 A;  2LXJ A;  4LWC A;  2RHQ B;  5BR8 Q;  3HKZ E;  3TEH B;  1NY4 A;  5LMU Q;  2JE6 I;  4RG1 A;  2WB1 G;  3M85 A;  1KAW A;  5ELN A;  5FLM H;  5IT9 c;  2EXD A;  1KQS A;  4K0K L;  4Y52 H;  4APV A;  4DV2 L;  1IBK Q;  4DUZ L;  1SRO A;  1NMF A;  4X66 L;  4BBR G;  5IYD G;  2E2I H;  2I0Q A;  1XJV A;  1HNZ L;  3UDF A;  3GTP H;  2YTY A;  3GDE A;  5BR8 L;  1VQ7 A;  4NB3 A;  5LMU L;  3RN5 A;  3MEF A;  4A4I A;  1M90 C;  2IX1 A;  4DR6 Q;  3RZO H;  2AKW B;  4OX9 Q;  1YJ9 A;  1A63 A;  2ZJQ A;  4PMW A;  3WWV A;  1B7Y B;  2UXC Q;  2NN6 I;  3A5U A;  1OXT A;  2CWA A;  4JI6 Q;  4GLA C;  1O7I A;  1CKM A;  1IBK L;  3M4O H;  5M3F G;  3S15 H;  4AYB G;  1HZC A;  1YIT A;  1H95 A;  3B6Y A;  2K75 A;  2N8N A;  1Q81 C;  2ZM6 Q;  3NEN A;  3TQY A;  4YHH Q;  2K5H A;  5IWA Q;  4MTN A;  4DR6 L;  4JOI A;  3HOZ H;  4H02 A;  1XTD A;  3CCE A;  1Y1W G;  5IP7 G;  3PO3 H;  3RN2 A;  2XTI A;  2UXC L;  3JC6 6;  1X9N A;  4BY7 H;  1BBW A;  1EQR A;  4JI6 L;  1QUQ B;  4QQB X;  1SN8 A;  4HJ7 A;  1MIU A;  2KEN A;  4P73 A;  1HZB A;  4YWL A;  3G6E A;  4UP8 A;  1KIX A;  4LFC Q;  3IRB A;  1HZA A;  3A5Z B;  4L5S A;  2ZM6 L;  4GOP B;  5H1S E;  4YHH L;  2GVA A;  2Y0S G;  5IWA L;  1PA6 A;  1WCM H;  5ELO A;  1HR0 Q;  4A3F G;  4B3R L;  1IL2 A;  3KDF A;  1VQI A;  4LFB Q;  4IFD J;  3F8T A;  3I4M H;  3HOX G;  2VZA A;  4P75 A;  2Q2T A;  3ER0 A;  4IPH A;  1IYJ B;  1BVS A;  3F2D A;  1RIP A;  1GO3 E;  3K81 C;  3ZJY C;  2R7Z H;  1X3F A;  3PUV A;  5EAY A;  3RLF A;  4C3I H;  4LFC L;  3I7F A;  4C3H H;  4PZ6 A;  2HIX A;  4GN5 A;  4A75 A;  2ATW A;  3K7A H;  1HNW Q;  3NEL A;  4OWT B;  2JJQ A;  2ZTD A;  2NN6 G;  4P74 A;  5JEA G;  1HR0 L;  1EQQ A;  3RR5 A;  4R4C A;  4X65 Q;  2A19 A;  4JI3 Q;  4LFB L;  3J7A 5;  1D7Q A;  3CCQ A;  4R4T A;  4DK6 C;  4FDB A;  4A3J G;  4HJ5 A;  4UP9 A;  5C44 H;  3PF5 A;  1UE1 A;  4JYA Q;  4AIM A;  2NVY H;  5FLM G;  4WJ4 A;  1OXX K;  1I94 Q;  1HNW L;  3W1B A;  5IE8 A;  5GAD C;  2OTJ A;  2UUA Q;  1WOC A;  3CD6 A;  1SLJ A;  3S14 H;  1FGU A;  1VQ5 A;  3KOJ A;  4LF5 L;  1KC8 C;  4DV3 Q;  3M4Q A;  4YWM A;  4JI3 L;  4X65 L;  2YV5 A;  1KHI A;  4DUY Q;  3E9H A;  2JEA I;  4A3I H;  3S16 H;  4BXX G;  3HFZ B;  3EIV A;  5JJI A;  4LF7 Q;  1KXL A;  1HNX Q;  3S17 H;  4JYA L;  1UWV A;  3CPW A;  4L5T A;  4DR2 L;  2R93 H;  4AQY Q;  2I5M X;  1HJP A;  3CCU A;  1YJN A;  1I94 L;  3F2C A;  1Q1E A;  2KHI A;  3CCV A;  2UUA L;  1UEB A;  2I5H A;  1VQD A;  2NZO A;  1EIY B;  4POG A;  4OO1 I;  4B3M Q;  3H0G G;  1E1T A;  5IYC G;  4DV3 L;  3J80 c;  3RLN A;  3PIP A;  3PUX A;  4DUY L;  1N33 Q;  4IFD I;  4QL5 A;  1QZH A;  3KF6 B;  4B3S Q;  4LF7 L;  1MJC A;  3F2B A;  5FJ8 G;  1HNX L;  4IO9 A;  1AE3 A;  3J7Z C;  4AQY L;  1VQM A;  4A3C H;  4A93 G;  1V9P A;  5HY6 A;  1VQB A;  2CWP A;  3AFP A;  1WI5 A;  4IJH A;  2YYZ A;  4QGU A;  2MNA A;  4LF8 Q;  4BY7 G;  1Q82 C;  4HIM A;  1Q86 C;  1PV4 A;  1GD7 A;  1A0I A;  4R1J A;  1N34 Q;  1K73 C;  4JBM A;  2MO0 A;  4B3M L;  2CKZ B;  3BZC A;  1TXY A;  3Q8D A;  4HIK A;  1IBL Q;  3GTQ H;  3G4S A;  1N33 L;  5IP9 H;  5GRO A;  3T1Y Q;  1AH9 A;  1CKN A;  1I5F A;  5C0X J;  3DLL A;  4B3S L;  1J5E Q;  3M3Y H;  1WCM G;  1PH6 A;  3CME A;  3STB D;  3H3V H;  2VUM G;  3UE1 A;  4YCU A;  4GKJ L;  3A74 A;  1X54 A;  3NEM A;  4KHZ A;  2QGQ A;  1I3Q H;  2K5V A;  1JB7 A;  4XIG S;  1N34 L;  1JJC B;  4LF8 L;  2CFM A;  3I4N H;  4A3L G;  4BBS G;  4LNQ A;  1V43 A;  3KJP A;  2R7Z G;  3S1R H;  1IBL L;  1XMQ Q;  1XNQ L;  4NXM Q;  2RHS B;  4C2M H;  4A3G H;  2OQK A;  3PV0 A;  1PH4 A;  3M4P A;  1IZ6 A;  2MO1 A;  1J5E L;  1E7Z A;  3PF4 A;  2KCT A;  3ICE A;  1VS0 A;  5C4X H;  4DV1 Q;  4OO1 G;  1N8R C;  1UE6 A;  3STB C;  4GLX A;  2CQO A;  3W5O A;  1KD1 C;  2HHH Q;  5C44 G;  4IFD G;  1K9M C;  2GVB A;  3KF8 B;  3J81 j;  1E22 A;  5LMN Q;  1XMQ L;  3A0J A;  4NXM L;  1UE7 A;  4DR1 Q;  2PQA A;  2D0O A;  1VQP A;  1Q7Y C;  1QZG A;  3M7N A;  1HH2 P;  4JI1 Q;  3PO2 G;  1T9H A;  4YY3 Q;  1NBW A;  3H3V I;  1C0A A;  4QIW E;  1EIF A;  2RCN A;  2VL6 A;  4A3M H;  1XPR A;  3FHW A;  5M3M H;  1W3S A;  3PUZ A;  2NVQ H;  3HOW H;  4DV0 Q;  4DV1 L;  3RNU A;  2RF4 A;  2UXD Q;  4OON A;  1VQ9 A;  2R92 H;  2HHH L;  3S2D H;  4OX9 L;  2F4V Q;  4DKA C;  1OXU A;  3HKZ G;  1S72 A;  2VS1 A;  2NZH A;  3KDF B;  3ULJ A;  5LMN L;  4UPA A;  4P72 A;  1Y14 B;  2D62 A;  2N78 A;  2XGT A;  4DR1 L;  4R4Q A;  5C0X I;  2ID0 A;  1JE5 A;  2PI2 A;  3NBH B;  2EIF A;  2KHJ A;  4OWX B;  1TWC H;  4JI1 L;  4YY3 L;  2JEB I;  1X3G A;  5FLX c;  4EQ5 A;  3PSI A;  1SR3 A;  1PYB A;  4GNX C;  4O0A A;  1K0R A;  4NXN Q;  4DV0 L;  1BBU A;  1VQG A;  2UXD L;  1Q1B A;  4X64 Q;  5GQO A; 
#chains in the Genus database with same CATH topology
 1SYG A;  4WRD A;  1HQR D;  2VNU D;  2AHO B;  2EYL A;  2F4V L;  1PMR A;  2A73 B;  5DAU A;  1JOQ A;  2TMP A;  4A3K H;  1LUZ A;  2MJ8 A;  1B3A A;  1TR5 A;  1TQO A;  2L12 A;  4K8J A;  2LXK A;  5GAG C;  4RWS C;  1YNN D;  2UUB L;  4JI7 L;  1K3R A;  3QB3 A;  3UDG A;  2SOB A;  1BUV T;  2DGY A;  1TWH H;  3OWF A;  5CBA E;  4EX5 A;  5C3E B;  3M3Y B;  5FLX E;  4HJA A;  2F0V A;  3PCO B;  2JA8 H;  4O42 A;  3NQT A;  1MSH A;  4ILW A;  5FLX L;  1GUW A;  1E1O A;  1BCP B;  1L1O A;  3VDY A;  4LF9 L;  1B44 D;  1SE3 A;  4PZ8 A;  4HN7 A;  1ENC A;  5M3F H;  1PH5 A;  2PMZ E;  1DOK A;  1AE2 A;  4KKS A;  1RD9 D;  3TBI B;  3VR2 A;  1BO0 A;  3L7Z C;  5HGQ A;  4A3M B;  3UDX A;  4DV4 L;  1P16 A;  1LO5 D;  4BY1 H;  2WKC A;  3PO3 G;  4JI0 Q;  4HJ8 A;  3U4V A;  4KLK A;  4PZ7 A;  1PZJ D;  1VQF A;  4ZRZ A;  3A8I E;  4DV6 Q;  4ZLT F;  3GO5 A;  1DZ1 A;  4ZUI A;  2JA7 B;  2DNE A;  2YTX A;  2WAC A;  1D2B A;  3CU7 A;  1E2Z A;  3A7A B;  4CDC C;  2KQ3 A;  4JCV E;  3P1H A;  5BN3 A;  4LUV A;  5A2Q E;  1R9T H;  2EQS A;  4JI4 Q;  4L5R C;  1VQJ A;  3FKI H;  1GHJ A;  4OEL B;  5E4W C;  1DOM A;  1WYD A;  1PRT F;  4AYB E;  4DV7 L;  3T1Y L;  3HOU B;  5A2Q L;  4JI2 Q;  4HED A;  4TKO B;  4G4K A;  4A3J H;  1HTP A;  3MZ5 A;  2PMZ B;  3NWS A;  2Q2I A;  1WD0 A;  4HCS A;  1V1P A;  2V1C C;  3E6Z X;  4H13 C;  4A3E G;  3CCR A;  2MGS A;  3GTJ B;  4TRD A;  3CXC A;  1VQC A;  3VYR A;  3MXG A;  1L0Y B;  4IOC A;  1PFN A;  5M5X B;  1Q8K A;  4JBJ A;  3BVZ A;  3NTK A;  3UDI A;  3GTG H;  3S2H H;  1PVO A;  2Y0S E;  2R6G A;  1DOL A;  2B2W C;  1RDP D;  1LTL A;  4HSP A;  4LUZ A;  4BBR B;  4TQU S;  2CVR A;  1XMO L;  2XN9 C;  1YHB A;  1SFO B;  2HT1 A;  3CP0 A;  4DK3 C;  3H0G H;  2VQF Q;  3K80 C;  4H7B A;  1LLR D;  1DGS A;  2GN5 A;  2EYP A;  4RGN A;  3DWQ A;  3C1F A;  3UI2 A;  1H9K A;  2ALY B;  4AYB B;  5FJ8 H;  2EYF A;  3ZYY X;  2E5L Q;  3CAM A;  3VA7 A;  4A93 H;  3KLW A;  2CHB D;  2IPK D;  1IW7 C;  1L0W A;  1JT8 A;  1YJW A;  3PIP 3;  2N3S A;  2E2H H;  2XVS A;  1PFB A;  4OGQ C;  5KEE A;  4FXD A;  3DEP A;  3S1N B;  4A3D H;  5M5Y H;  2IX3 A;  1PFM A;  2JK8 A;  4GNX B;  3HP3 A;  3OYY A;  2B2W A;  4A3L H;  1QIL A;  2Y0S B;  2BA1 A;  2K03 A;  3PUY A;  4A3B G;  4A3F B;  2IHE A;  3AQQ A;  3HOX B;  4IPD A;  2HIV A;  4LJZ C;  4LFA L;  3T16 A;  3PIO A;  1F9S A;  1YBY A;  4LF5 Q;  1JWM D;  2XIW A;  1HR0 W;  4OXP A;  4OO1 H;  3TS2 A;  2JYO A;  4R8I A;  4B9X A;  1XWE A;  5E3F A;  2NVT H;  4GKK Q;  3CC7 A;  1WTR A;  4IUU A;  2NWG A;  2B2Y C;  4DR2 Q;  4DR4 Q;  2PCF B;  1A2T A;  5KND A;  4OWW B;  4ID6 A;  3QJY A;  4GZY C;  5C4J B;  1VQE A;  4MZ9 A;  2Q2U A;  5JJK A;  5M3M G;  1TVX A;  5NUC A;  1QWY A;  1UE5 A;  1C7Y A;  3TRE A;  4GS3 A;  4JI8 L;  3I2Z A;  1F9P A;  2QA4 A;  3UE0 A;  5IP7 H;  4Q0F A;  1G29 1;  4DNI A;  1V1O A;  4ZYS A;  4DR3 Q;  2HCC A;  4ZAI A;  2M00 A;  5ELD A;  2ZTC A;  3CC2 A;  1AZP A;  1JMC A;  2D2C C;  5JEA J;  3CC4 A;  1FJG Q;  2UU9 L;  1A62 A;  4KHP L;  2PNH A;  1B4O A;  2EY6 A;  1STA A;  3PGZ A;  2VQE Q;  2E2J B;  2L4N A;  1Q8I A;  1B8A A;  1PH2 A;  4H44 C;  1GXD C;  3ULP A;  2SNM A;  4IJL A;  4DAP A;  2NN6 H;  2E8G A;  4X66 Q;  2HDM A;  1RCV D;  3QOL A;  1PH8 A;  5BR8 Q;  2RHQ B;  3HKZ E;  3A7L A;  1NY4 A;  3K5O A;  5LMU Q;  3M85 A;  3T53 B;  2K05 A;  5ELN A;  5IT9 c;  1MGS A;  1Y8N B;  2EXD A;  1TY2 A;  3OOC A;  3GQB A;  4KN4 C;  4DUZ L;  1SRO A;  3TN2 A;  5CC4 A;  2E2I H;  3S17 B;  1G6Z A;  3GDE A;  4NB3 A;  1ICF B;  2FJ2 A;  3RN5 A;  2IX1 A;  2AKW B;  1RF2 D;  4OX9 Q;  4EQN A;  2ZJQ A;  4OIK A;  2UXC Q;  1SDF A;  1WTO A;  2CWA A;  2TSS A;  2Z4H A;  1A3T A;  5F2D A;  1H95 A;  3B6Y A;  2K75 A;  3IL8 A;  1UUP A;  3NEN A;  3DWP A;  3RUZ A;  5IWA Q;  4DR6 L;  5IT9 E;  4ZK9 B;  1D1I A;  3PO3 H;  2NVX B;  3JC6 6;  4BY7 H;  1WVL A;  1QUQ B;  4XQN A;  1CT1 D;  2AUJ D;  1HZB A;  2KHS A;  4P73 A;  4UP8 A;  3KLR A;  1KIX A;  4L5S A;  2ZM6 L;  4IQZ A;  1MHW C;  2GVA A;  1SYF A;  5ELO A;  2GA4 B;  3FPU B;  4M1U B;  1PTO D;  1VQI A;  3KDF A;  4IFD J;  2NB0 A;  4L6T B;  2L11 A;  5C3W A;  5AFW A;  4IPH A;  1QG7 A;  1TWG B;  1BVS A;  3NBH A;  3GP7 A;  1H9S A;  3F2D A;  2B63 B;  1GO3 E;  4RCN A;  2R7Z H;  3RLF A;  1CZW A;  3I7F A;  4PZ6 A;  4GN5 A;  1DON A;  1HR0 L;  1HCZ A;  2EY1 A;  1EQQ A;  2Z1C A;  2A19 A;  4P2C B;  3J7A 5;  4J6H A;  4DK6 C;  2K28 A;  4FDB A;  4CJ1 B;  1CFM A;  1UE1 A;  3GTK B;  4AIM A;  1HNW L;  2OEO A;  2C9O A;  5IE8 A;  5IGF A;  4UDU C;  3MTS A;  3S14 H;  2RDG A;  5DM6 3;  1VQ5 A;  4LF5 L;  4N8F A;  4DV3 Q;  2YV5 A;  1KHI A;  2IL8 A;  2JEA I;  4BXX G;  4FNF A;  1NAP A;  2XRQ D;  5EGT A;  1KXL A;  2F0T A;  2DN8 A;  3CPW A;  2JP1 A;  4DR2 L;  4NDX A;  5FOB B;  1O7Y A;  3GTP B;  1YJN A;  1JR0 D;  3F2C A;  3A8J E;  3VR3 A;  1E0B A;  1PTO B;  3E0J A;  4B3M Q;  1E1T A;  1N33 Q;  4DUY L;  3PUX A;  4I7Z C;  2EYH A;  3WOE A;  3TZU A;  3H91 A;  3KF6 B;  1QZH A;  1MJC A;  1I4X A;  1HNX L;  4IO9 A;  5HY6 A;  5J39 A;  1SE2 A;  3AFP A;  4N8X 1;  2I07 B;  4QGU A;  4C1N I;  1Q86 C;  1PV4 A;  1N34 Q;  4IUN A;  4R1J A;  3EJI A;  1F2Y A;  3I3C A;  3Q8D A;  1EQV A;  1IBL Q;  3G4S A;  1BDO A;  1EU3 A;  1AH9 A;  2D9U A;  1U4L A;  3CME A;  3STB D;  2VUM G;  3I91 A;  5CBE E;  5DNF A;  3NEM A;  4OL7 A;  1I3Q H;  2K5V A;  1JB7 A;  3I4N H;  1XXG A;  3SK4 A;  1V43 A;  2J4X A;  1A3U A;  3I4M B;  5C3X A;  2EJG C;  4A3G H;  5K36 H;  3PV0 A;  4A3K B;  1CI3 M;  3M4P A;  4KD3 A;  3PF4 A;  3KBG A;  3OW7 A;  2SDF A;  1HA5 A;  2CW0 D;  1UE6 A;  2PZT A;  3STB C;  3X3M A;  2MHV A;  1KD1 C;  1PDQ A;  1MSG A;  3VR5 A;  1JE4 A;  1ZXT A;  1J9O A;  3KF8 B;  4G57 A;  1E22 A;  5LMN Q;  3I72 A;  2ICE C;  4NXM L;  1HUM A;  5COY A;  4DR1 Q;  2PQA A;  2BDN A;  2A74 C;  3L9A X;  3D3R A;  3PIO 3;  3HZX A;  5I6W A;  1EFI D;  2RCN A;  5IGC A;  5C4Z A;  5M3M H;  2F03 A;  1W3S A;  3C46 A;  4DV1 L;  2RF4 A;  2JA8 B;  2R92 H;  1YNJ D;  2HHH L;  4OX9 L;  2F4V Q;  2CW0 C;  2EOT A;  1CM9 A;  2NZH A;  3DM1 A;  3ND8 A;  4P72 A;  2D62 A;  1LT3 D;  2N78 A;  3S16 B;  3SK8 A;  4DF7 A;  1RJT A;  2EIF A;  4KKU A;  2R93 B;  2F4I A;  1ZKO A;  5IGE A;  4PQX A;  1JB3 A;  2L1B A;  2HQL A;  2BA0 A;  2A6E C;  2UUB Q;  4JI7 Q;  4JG2 A;  1EEF D;  1YNJ C;  2VB2 X;  2BH8 A;  4BY1 B;  4DAM A;  1GUN A;  1Y1V H;  2C35 B;  3FMC A;  3E0E A;  1S40 A;  2R7F A;  2Z4I A;  2N49 A;  3GTQ B;  1AN8 A;  2K4K A;  4IZ8 A;  4QF4 A;  5CV4 A;  1A8V A;  4LF9 Q;  2BE5 C;  2L55 A;  4G7O C;  1N9W A;  3ERS X;  4ME3 A;  1VF5 C;  2F3V A;  4DAY A;  1OXV A;  1R9T B;  2DY7 A;  1NSN S;  5CV7 A;  1VQO A;  3T4A C;  1KRS A;  3TS0 A;  4DN4 M;  5IY0 A;  1SRU A;  5C0X G;  3MXN B;  2WP8 J;  3CMA A;  2A69 D;  1NJI C;  4DV4 Q;  3HOV H;  3K58 A;  1L2F A;  5ISR A;  3GTM H;  5GAH C;  4JI5 L;  3U58 A;  5AJ3 L;  2KOL A;  3G7L A;  5I4D A;  1HXY D;  2RSO A;  3KYH C;  1H9J A;  3NUC A;  1CKN B;  3PUW A;  1C48 A;  1PH3 A;  2F0D A;  3HOZ G;  3SHL A;  4MNO A;  2PI2 E;  3GTG B;  3ITP A;  1EQT A;  3AEV A;  3IAY A;  1YHQ A;  1BXT A;  4DV7 Q;  2CH4 A;  3RMH A;  1HTL D;  3WOF A;  4XDX A;  4OIJ A;  3KLS X;  4CJ2 C;  3OMC A;  4K14 A;  1TWC B;  5KIX A;  4ODG A;  3D4R A;  3EN2 A;  5KGU A;  2F0M A;  1LT5 D;  1FNU A;  2Q8I B;  3HRZ C;  4F7X A;  3L2P A;  3T1H L;  4QMG A;  5IYB H;  1NR2 A;  1MBY A;  3W1G A;  3V05 A;  4HAE A;  3EBE A;  2XRS D;  2K5W A;  4HID A;  3GTO H;  4FXK C;  1CSQ A;  5IOD A;  1ZYR C;  1B50 A;  3BZK A;  5KYL A;  1QB5 D;  1EYG A;  2E2H B;  2BH2 A;  2M2L A;  2JA6 G;  4KJO A;  2LKV A;  2O5J C;  5EPJ A;  4A3D B;  1KDC A;  1XMO Q;  2JA5 G;  3KUP A;  2DJF C;  2C5C A;  2JA6 B;  3M9B A;  4UP7 A;  3HOY H;  3P7J A;  4S3S A;  4ME5 A;  1LTB D;  4DAV A;  4JV5 L;  4A3I G;  1PXU A;  4BXX H;  4CBV A;  3Q23 A;  4G7Z C;  2RBM A;  2Z0S A;  1EFW A;  1X65 A;  1ICW A;  4J1M A;  4GOP C;  1F2Z A;  2JSO A;  1H9R A;  2PZW A;  2B8F A;  2QKI C;  4JC0 A;  4FF4 A;  2K52 A;  1HFG A;  4DPG A;  1CKO A;  4BA2 I;  3S1M B;  2ENB A;  1SBB B;  2B8G A;  3K6O A;  3GTL B;  2YTV A;  1YVC A;  3QG1 A;  2N88 A;  1GJX A;  1VQ4 A;  1NE3 A;  1X3P A;  2UUC L;  1ROD A;  3EA6 A;  4DK1 A;  2MFI A;  2YU9 H;  3D0F A;  5LL6 S;  1VQA A;  2I5L X;  2IY5 B;  1LT6 D;  1JQY D;  2B39 A;  1N32 L;  3R93 A;  3K5L A;  1G6P A;  1FNV A;  4LFA Q;  5C3E G;  5KNC A;  3AU7 A;  4U68 A;  1F77 A;  4KD4 A;  4TVA B;  4JBW A;  2JQO A;  2VUM H;  3BS1 A;  3H3V C;  2XWJ B;  3OWE B;  1L1O B;  3H6M A;  3NXW A;  5CMD A;  3FP9 A;  4GOP A;  2LMC B;  2H5X A;  3DWA A;  1TWA H;  3L0O A;  5M5W B;  5DLQ E;  3S1Q B;  3JAM c;  3KK7 A;  4K2K A;  1PZK D;  3CCJ A;  3AYH B;  4JI8 Q;  1VQL A;  1YZ6 A;  4UHV A;  3BVG A;  2JA9 A;  1PH9 A;  1CK1 A;  2FIN B;  4A3M G;  4RFB A;  3TP7 A;  1CUK A;  3BZD B;  2HUG A;  2UU9 Q;  2K50 A;  1WJJ A;  3E5S A;  1Y69 U;  4KHP Q;  1CQV A;  5DM7 3;  1C8C A;  1Y1W H;  1QOH A;  1TWF B;  1BBX C;  2E2I B;  2JA7 G;  1VQH A;  4UY8 C;  3W3A A;  4IPC A;  3OSO A;  1HA6 A;  4CKE A;  3M7G A;  3ONA B;  4ALP A;  4ULL A;  2PW7 A;  3Q6S A;  1S5F D;  4YIJ A;  3VYT A;  1G8Z D;  1MI2 A;  1VDZ A;  1PFS A;  2PZU A;  3FVQ A;  5IGD A;  2WFW A;  3D31 A;  3HOU G;  4HJ9 A;  1I50 H;  1DXM A;  3D4W A;  1W6J A;  2DY8 A;  1V1P B;  1PYS B;  3BU2 A;  3C3L A;  1XNQ Q;  4KI0 A;  4LW1 A;  5FK9 C;  3J80 i;  4DUZ Q;  4C3J H;  3CQZ H;  4LF6 L;  4BY7 B;  3CPF A;  4JOI C;  4N9T A;  2AUK A;  3U50 C;  4IUT A;  4JBK A;  4NP5 A;  3EFX D;  4X3U A;  2MP1 A;  2JE6 I;  5FLM H;  4Y52 H;  5D14 A;  4APV A;  4XXE A;  1OO9 B;  1CQF A;  4BBR G;  4BBS B;  2I0Q A;  1HNZ L;  2R7Z B;  3ND9 A;  5J22 A;  2Z6B A;  1VQ7 A;  1WTQ A;  1AEX A;  3T56 B;  3MEF A;  1M90 C;  4DR6 Q;  1YJ9 A;  1IW7 D;  1B7Y B;  3A8K E;  2NN6 I;  3LWE A;  1O7I A;  1TKW B;  2XWB B;  1IBK L;  3M4O H;  4AYB G;  1YIT A;  1HRJ A;  2LY7 A;  1Q81 C;  2ZM6 Q;  1D5X C;  3PO2 B;  3TQY A;  1RTO A;  4DA2 A;  2F0H A;  4JOI A;  3HOZ H;  4K5W A;  5EPK A;  4HJ7 A;  1MIU A;  3G6E A;  1X3Q A;  3K57 A;  3A5Z B;  5H1S E;  3DXJ C;  4YHH L;  2OF1 A;  2Y0S G;  1PA6 A;  1HR0 Q;  1WCM H;  4A3F G;  3P75 A;  3F8T A;  4RA8 A;  3HOX G;  4CDD C;  2Q2T A;  1IYJ B;  4HMJ A;  2K7V A;  1RIP A;  1SND A;  3VR4 A;  1X3F A;  4C3I H;  4LFC L;  2ATW A;  1GHK A;  2HIX A;  1HNW Q;  5D3I B;  5HGT A;  2JJQ A;  3MXP A;  5JOB A;  4R4T A;  4KMU C;  4HJ5 A;  5JJZ A;  3IKJ A;  4UP9 A;  5C44 H;  3PF5 A;  1TS4 A;  1LTR D;  1F2L A;  4C56 C;  3W1B A;  2OTJ A;  1WOC A;  2K5Q A;  4RGM A;  1SLJ A;  3CD6 A;  1FGU A;  1HFN A;  3I4N B;  1KC8 C;  1EZ6 A;  4JI3 L;  4DK0 A;  4DUY Q;  3E9H A;  5IGB A;  1IYU A;  4A3I H;  3HFZ B;  1G2T A;  3SEB A;  1HNX Q;  4JYA L;  1UWV A;  2QEJ C;  3R8B A;  1DCZ A;  1HJP A;  1Y8P B;  1I94 L;  5FO9 B;  5JVG 3;  3CCV A;  3M4Y A;  1PRT D;  2NZO A;  4POG A;  2EYM A;  4B08 A;  3RZO B;  5ELB A;  4IFD I;  4LK1 C;  3J80 c;  4XQJ A;  1F9R A;  1SSO A;  2WIN B;  3S15 B;  1EY6 A;  3F2B A;  1K0S A;  1XTC D;  2F1M A;  3J7Z C;  2RCF A;  3TP5 A;  2F0Q A;  4IJH A;  3MEH A;  1Q82 C;  4JBM A;  2R92 B;  1K73 C;  2MO0 A;  2CKZ B;  3BZC A;  1PRT C;  4WJW A;  2PO4 A;  1BQQ T;  1U9R A;  2QDL A;  2F0G A;  4B3S L;  4RHS A;  3M3Y H;  5IOC A;  3NP8 A;  3H3V H;  3UE1 A;  1B53 A;  3A74 A;  4KHZ A;  2QGQ A;  4XIG S;  1JJC B;  2E74 C;  3J80 E;  1XNQ L;  1STG A;  2B2U C;  4NXM Q;  2RHS B;  1IZ6 A;  4DGZ A;  3J7A F;  4C3H B;  2NTT A;  1BOS A;  4DV1 Q;  1N8R C;  3J80 L;  1Y1V B;  4GLX A;  2HHH Q;  4F87 A;  3W5O A;  4XYO A;  1LTI D;  3J81 j;  4KY7 A;  4CKC A;  1A3V A;  3L3O C;  2D0O A;  3G6J B;  1Q7Y C;  3M7N A;  1D5M C;  1T9H A;  4QIW E;  4A3M H;  1CHQ D;  1SXT A;  2NVY B;  2B2V C;  4HTH A;  1F2M A;  1XPR A;  5E1F A;  2VXW A;  2F0E A;  4XYQ A;  3S2D H;  3VA5 A;  4DKA C;  1OXU A;  3HKZ G;  3KDF B;  3ULJ A;  1RKN A;  4UPA A;  1WD1 A;  3AB9 A;  2HQE A;  1Y14 B;  1SNP A;  1A15 A;  2K1B A;  1JCK B;  2ID0 A;  3HKZ B;  3NBH B;  2KHJ A;  1H9S B;  4YY3 L;  2JEB I;  2NBF A;  4EQ5 A;  5IT9 L;  1SR3 A;  3HOV B;  1K0R A;  2B2U A;  5KRU A;  2KCN A;  2H1E A;  1EWH A;  3H15 A;  2B63 G;  2BOS A;  1BNZ A;  1XPO A;  1O7Z A;  4L5Q A;  3J81 i;  1EY0 A;  4A3C G;  3K7U C;  1Z9F A;  1WTP A;  4X3T A;  2WAQ E;  4NXN L;  2EY2 A;  2F52 A;  5EKL A;  1KDB A;  4POF A;  2B2V A;  2F3I A;  1K83 H;  1FD7 D;  2KA7 A;  3OPO A;  4RH6 A;  2RA4 A;  4QIW B;  4B3T L;  1AP0 A;  2CH4 W;  4A3E H;  5M5X H;  2AQ3 B;  3MC0 B;  3K0Y A;  1MKH A;  4B9W A;  4DV5 L;  4JI5 Q;  3FEW X;  5AJ3 Q;  1GUG A;  1QJO A;  2VY3 A;  4DR5 L;  4BBR H;  2HCI A;  4GN3 B;  2L9H A;  2UXB L;  4C2M B;  1SFO H;  2I46 A;  3MFY A;  4L8J A;  4F88 A;  4CDF C;  5KYI A;  4U67 3;  5C4X B;  3I90 A;  2HDL A;  3NBI A;  1EL0 A;  1SE8 A;  2IT1 A;  1AZQ A;  1S5C D;  1EWI A;  1EY8 A;  1KRT A;  1SJE D;  3OW2 A;  2WAQ B;  3HOY B;  3HOW B;  2WB1 E;  2NVQ B;  4V0B A;  3F1Z A;  1GUO A;  4XTC S;  2E75 C;  1S5D D;  3D6C A;  2EJF C;  4K6L A;  4RGO S;  3T1H Q;  2A8V A;  2IX0 A;  4PMB A;  3K5N A;  5C6A A;  1WTX A;  1ILQ A;  1Y8O B;  1PH7 A;  1VF7 A;  2Z6K C;  4LF4 L;  5FO7 B;  1JJ2 A;  3NE5 B;  1EYD A;  3I4M G;  3HOX H;  5GAE C;  2KEE A;  4A3K G;  4A3B H;  1TII D;  2FFK B;  1WTW A;  5JAV A;  1JJG A;  1HUN A;  2PQA B;  4KTA A;  3FRP B;  1GVP A;  1U5K A;  4GN4 B;  2PPB C;  2YU9 B;  4JV5 Q;  3N6R A;  5G3L F;  5C4J H;  4YCW A;  1KLU D;  3ERQ A;  5I9P A;  1I4Q A;  2BDO A;  2AMC B;  1TWH B;  2JA8 G;  1S5E D;  4FO2 A;  3J7Y W;  2WB1 B;  4BS9 A;  1C4Q A;  5C5L A;  2A6E D;  2F0O A;  1YIJ A;  2X69 A;  2Z6K A;  3J81 c;  2R93 G;  1TWA B;  2A1A A;  2F0U A;  5J1Z A;  2UUC Q;  3R3O A;  3OTO L;  1L0X B;  3CW2 C;  2V4D A;  1E2V A;  2E2J H;  2RQX A;  2K6A A;  4C1N K;  4DNR B;  1LTS D;  1WTV A;  1LM0 A;  4Y7N H;  1N32 Q;  4ZKB B;  5M3F B;  2BE5 D;  3KFU A;  1B1Z A;  4Q5V A;  1X55 A;  3ERO A;  4BY1 G;  1PHJ A;  4X3S A;  1VQK A;  4ZQ3 A;  2R3Z A;  5E7N A;  4X62 L;  4DNT B;  1Q12 A;  1SYE A;  1U4M A;  4N9P A;  2IJ0 A;  3CCM A;  5LMN W;  1FYC A;  1T5X D;  1EUJ A;  4HCE A;  4DAY B;  1D8L A;  4G7H C;  1P8L A;  3VYU A;  2KCM A;  5IP9 G;  2D0P A;  2QF7 A;  4DR7 L;  1M1K C;  2OQ0 A;  1D5Z C;  1VCI A;  3J81 E;  4P71 A;  3C1E A;  3D4D A;  3MWY W;  1IBM L;  1E3P A;  4TSS A;  3AFQ A;  2OTL A;  1KDA A;  4MN3 A;  5JVH 3;  3FKI G;  2F0P A;  4YCV A;  4IOA A;  2EZV A;  3I4L A;  2K14 A;  1BCP F;  1Q3L A;  2DUD A;  4K8I A;  1I6V C;  2KVM A;  2VW9 A;  1SMY C;  3H09 A;  3FKI B;  1KAA A;  1G91 A;  3U4Z A;  4IPG A;  4HR7 B;  1UAP A;  1XNR L;  3I4O A;  3CQZ B;  5EJW A;  2D5D A;  4A3J B;  1K8O A;  4WJ3 M;  1S3O A;  5E4X A;  1EIG A;  2R7D A;  1NTG A;  2J7Z A;  1TU2 B;  1X6O A;  2IHF A;  3V96 A;  3CF5 A;  2NVX H;  3JAM i;  2F3W A;  3BYT B;  2L5T A;  5CGK A;  2G5D A;  2KBN A;  1EIH A;  5EPL A;  4DXF A;  3S2H B;  3NK9 A;  1ASZ A;  1A2U A;  1VQN A;  1SAP A;  2CCZ A;  3LGJ A;  1KTK A;  3KLS A;  4Z9C B;  2QW7 A;  3G71 A;  1STB A;  4A76 A;  1QVF A;  4QY7 A;  1SMX A;  2ES2 A;  2XSC A;  1ZYR D;  1W2B A;  2ICI A;  1LTT D;  1TWG H;  4LF6 Q;  4J15 A;  2A68 C;  3HKS A;  2B63 H;  1N36 L;  1SNQ A;  3H0G B;  1U4P A;  1PLF A;  2OCE A;  1J8I A;  1SYB A;  1K8A C;  5C4H A;  4GKJ Q;  2QIL A;  1HHV A;  5J3B A;  2F0W A;  4A93 B;  2B3G A;  1IXR A;  3GTK H;  3WDN A;  5TSS A;  1HNZ Q;  4A3D G;  1SNM A;  3TEH B;  2WV6 D;  4RG1 A;  1SE4 A;  1KAW A;  1JC7 A;  5M5Y B;  2PQE A;  4K0K L;  4DV2 L;  1IBK Q;  3MA2 B;  1PYW D;  5IYD G;  3IFT A;  3UDF A;  4IUP A;  3GTP H;  4LAA A;  5K5P A;  4QUF A;  5CV5 A;  1FGB D;  3SR1 A;  1JOK A;  4PMW A;  1DD2 A;  3A5U A;  1OXT A;  4JK1 C;  1LV9 A;  2NVT B;  5C44 B;  2VB3 X;  1ZEQ X;  4EQP A;  4DU9 A;  3HGB A;  4H0L C;  4QCL A;  1QNU A;  4YHH Q;  1M4V A;  5T1G A;  1XTD A;  4CHT B;  5IP7 G;  1JOO A;  5I6Y A;  1X9N A;  3LNN A;  4JI6 L;  3S9W A;  1LAB A;  3MVV A;  4QQB X;  4CGY B;  4YWL A;  1STH A;  5FO8 B;  4LFC Q;  2NTS A;  3IRB A;  1HZA A;  4GOP B;  1EY7 A;  2F0S A;  5CV8 A;  1IL2 A;  5ELF A;  1LTA D;  3I4M H;  1ENA A;  2VZA A;  4P75 A;  3ER0 A;  5IIF A;  4KN7 C;  3K81 C;  1U4R A;  3TRZ A;  4A75 A;  3K7A H;  2A6H C;  4OWT B;  1BCP C;  2ZTD A;  1QNK A;  2F0I A;  2NN6 G;  4P74 A;  5JEA G;  4NMZ A;  3SXH A;  4JI3 Q;  4LFB L;  3CCQ A;  3CHB D;  1B9N A;  4J8Q A;  4JYA Q;  4K2L A;  4QB4 A;  1TS2 A;  5T1I A;  4WJ4 A;  1OXX K;  1I94 Q;  2J0T D;  3KOJ A;  1MD2 D;  3M4Q A;  4X65 L;  1YNN C;  2L0C A;  2HD3 A;  5EBD A;  3FPP A;  3S16 H;  2KUM A;  3EIV A;  5JJI A;  3O13 A;  2R93 H;  3U9S A;  4IN3 A;  2IW3 A;  2KHI A;  2RVL A;  3Q24 A;  1UEB A;  1LAC A;  2I5H A;  2UUA L;  1VQD A;  3W2D A;  3JAM E;  4OO1 I;  3TSS A;  1CZG A;  4NKL A;  1JWS D;  5IYC G;  3TZD A;  3DHQ A;  1A6X A;  4EQO A;  3QO2 A;  4B3S Q;  4LF7 L;  5I2X A;  3DMU A;  2EJM A;  1XYI A;  4AQY L;  1VQM A;  3NTI A;  3A56 A;  1QE6 A;  3JAM L;  1WI5 A;  2YYZ A;  2MNA A;  4BY7 G;  1R4Q B;  4HIM A;  1A0I A;  1FNW A;  1JIC A;  3BDC A;  4L63 B;  3S2D B;  4WOR A;  4HIK A;  1TXY A;  3GTQ H;  5EQ0 A;  3PO3 B;  5IP9 H;  4FF2 A;  5C0X J;  3DLL A;  4IUQ A;  1F9Q A;  1O78 A;  4RGT A;  2IWH A;  2JN4 A;  4RHR A;  5I9O A;  4GKJ L;  2LFN A;  4LF8 L;  1ESF A;  2CFM A;  1I4G A;  4K6D A;  4BBS G;  2PYK A;  3KJP A;  2M9V A;  2R7Z G;  3S1R H;  4PNY A;  5ELC A;  1I4H A;  2O2L D;  1PH4 A;  3EVQ A;  4UAI A;  1J5E L;  5L37 A;  5C0X H;  4FVM A;  3ICE A;  2Q8T A;  1EYA A;  1EY5 A;  4IFD G;  1KNA A;  2GVB A;  2K33 A;  2PNR C;  1XMQ L;  1B9M A;  3PO2 G;  1QZG A;  1K83 B;  1HH2 P;  5CR3 A;  4YY3 Q;  4PV1 C;  3H3V I;  1C0A A;  1I4P A;  4A3E B;  3OIP A;  5KNB A;  4KY5 A;  1EZ8 A;  3GV3 A;  3MXU A;  4OON A;  4MTK A;  1VQ9 A;  3S14 B;  1S72 A;  2VS1 A;  4ZUJ A;  3H94 A;  4JI1 L;  1TWC H;  1B2T A;  1PYB A;  4GNX C;  4NXN Q;  4DV0 L;  1BBU A;  1VQG A;  2UXD L;  1Q1B A;  1XPU A;  1JWU D;  3SGI A;  1KL9 A;  1IHZ A;  2WII B;  5BN5 A;  4B3T Q;  1ESR A;  1NR4 A;  4RMF A;  1I6H H;  1NMG A;  4DV5 Q;  1RL2 A;  1RTN A;  4X64 L;  2KEC A;  3KJO A;  1FL0 A;  4DR5 Q;  3IFD A;  4CJ0 B;  2FHT A;  4PMC A;  2ASB A;  2DNC A;  1II3 A;  3MFG A;  1ASY A;  2ZT9 C;  2UXB Q;  4FF3 A;  1X56 A;  5M9O A;  2JA6 H;  3I55 A;  2EXZ A;  4FXG C;  2B2T C;  3OIQ A;  3U9O A;  1ET9 A;  1RHP A;  4AH6 A;  3I4N G;  1D6E C;  2JA5 H;  4CDE C;  3BYY B;  4BWG B;  1I3Q B;  4A3G G;  4GLV B;  5K36 G;  5IYD H;  4A3B B;  3NSW A;  5EBC A;  1B70 B;  1LYL A;  1HPC A;  3RZD H;  2RDF A;  4GNX A;  4IUV A;  2F0J A;  2LSS A;  4A3G B;  1PTO F;  1S4Z A;  3DM3 A;  1ONL A;  1WFQ A;  5I2Y A;  3S1M H;  1H9M A;  3GV6 A;  2OWO A;  3GTL H;  3I73 A;  2NUC A;  1XX8 A;  1GKH A;  2ZXP A;  2KJX A;  1KNE A;  2FXQ A;  4ABN A;  1CHP D;  1Z47 A;  1YEZ A;  2R92 G;  4LF4 Q;  4HSV A;  1BKB A;  3MHB A;  5M3M B;  1SEB D;  1NNX A;  5LHY 1;  1GM5 A;  4X6A H;  2MQH A;  2ZXR A;  5JPM C;  2B2T A;  2K01 A;  2ZTE A;  4JW0 A;  2G9H D;  2AWN A;  5BN4 A;  4EGV A;  1OTC A;  5C3E H;  2L15 A;  4O2D A;  2MPM A;  3E3X A;  2ZXO A;  3K0X A;  1S5B D;  2Q2H A;  4JI0 L;  1VQ6 A;  3QIA A;  2F0F A;  4Y7N B;  5M5W H;  5CYU A;  1TT2 A;  3T13 A;  3S1Q H;  4DV6 L;  4C3H G;  3DUZ A;  1SNO A;  3P20 A;  1GUS A;  4X3K A;  2B2Y A;  5DEH A;  4RKB A;  1MJE A;  1Y1V G;  4F8M A;  2PW5 A;  5JEA H;  1YHA A;  1V1Q A;  1GUT A;  2EYO A;  1PRT B;  4JI4 L;  4IUR A;  3G48 A;  4BA1 I;  1PZI D;  3T51 B;  1VQ8 A;  3V2T A;  1QCB D;  3GD7 A;  3TDQ A;  4XQQ A;  3OTO Q;  1PH1 A;  4R8N A;  2E76 C;  4JI2 L;  2AWO A;  5EKI A;  1STY A;  3EQL C;  1TWF H;  3K59 A;  5JJL A;  1EU4 A;  4O1N A;  1X3E A;  1IKM A;  5JPN C;  2JA7 H;  3HOV G;  2KED A;  4X62 Q;  3NQI A;  1CA5 A;  1IYV A;  4LMQ D;  3VYS A;  3PQI A;  4LUO A;  2JXM B;  5IYC H;  1I4R A;  3GTM B;  4DR7 Q;  5COR A;  5LL6 X;  2DJG C;  4B3R Q;  1IBM Q;  1STN A;  3HOU H;  2O5I C;  4I65 A;  4NPS A;  3BJU A;  2OXP A;  4DXG A;  1AW7 A;  3F2U A;  3LWU A;  4FF1 A;  4IAL A;  2QEX A;  2VQF L;  1TY0 A;  1YI2 A;  1CTM A;  1YNX A;  2K32 A;  4YWK A;  1VMC A;  1K8G A;  4KK7 A;  1M8A A;  2E5L L;  3GTJ H;  2BCO A;  4PG3 A;  1G51 A;  3J7A V;  1QUQ A;  4QJF A;  2ZJR A;  1XNR Q;  4BBS H;  1V8Q A;  2MUY A;  1J6Q A;  5IYB G;  3ULL A;  3K5M A;  3BG3 A;  3K8A A;  3CCS A;  1UEA B;  3CRL C;  3RLO A;  2QCP X;  4KY6 A;  1C9O A;  4R4O A;  2ZJP A;  5C4X G;  1BF4 A;  1ILP A;  2EDG A;  3GTO B;  4IFD H;  1B3Q A;  1PTO C;  1Z7T A;  1LT4 D;  1TS3 A;  2QDB A;  4KV6 A;  3I56 A;  4R9W A;  2R61 A;  3PO2 H;  2Z9H A;  4RAU C;  2B29 A;  2F0L A;  3I8Z A;  1NUC A;  2WAQ G;  3HOY G;  1EOV A;  1CSP A;  2E2D C;  3HOW G;  1KLG D;  3E9I A;  3S24 A;  1N36 Q;  1FR3 A;  4R4I A;  1D1K A;  3TP8 A;  4GKK L;  2RKS A;  4DR4 L;  1HZ9 A;  5A35 A;  1U0L A;  2XNA C;  2SEB D;  4DFA A;  3S1N H;  1QVC A;  3SK5 A;  3CCL A;  4HMI A;  2RSN A;  1OXS C;  4HIO A;  3KBX A;  1HQM C;  4A3F H;  1FVI A;  2O4X A;  1Q46 A;  5C5M A;  4DR3 L;  5EKK A;  4XT3 B;  4K0K Q;  1WTH A;  4DV2 Q;  1FJG L;  2K5N A;  1E24 A;  3KF6 A;  3QR8 A;  4RKL A;  2EY5 A;  2VQE L;  3SE0 A;  1GOZ A;  1QVG A;  1SNC A;  2LXJ A;  4LWC A;  4XT1 B;  1CA6 A;  2WB1 G;  3X3N A;  2H4O A;  3TP6 A;  1KQS A;  2VUM B;  4KJN A;  1NMF A;  4X66 L;  1XJV A;  3NHH A;  1EOT A;  2YTY A;  5BR8 L;  3K7A B;  1DYQ A;  1SJH D;  5LMU L;  4A4I A;  3RZO H;  1A63 A;  3WWV A;  1O7L A;  1T5E A;  1VMP A;  4K5V A;  4JVZ A;  3NPP A;  4V19 0;  4JI6 Q;  4KKT A;  4GLA C;  1CKM A;  2EPB A;  3FDT A;  2F0N A;  5M3F G;  1K28 A;  3D8G A;  3CKI B;  1G2S A;  1HZC A;  4MHE A;  3S15 H;  3BDO A;  4K5X A;  2N8N A;  2G9D A;  2K5H A;  4FP5 D;  4MTN A;  2K5D A;  3BVM A;  4I7A A;  3KF8 A;  3QWN A;  4H02 A;  3CCE A;  1Y1W G;  3RN2 A;  2XTI A;  2UXC L;  1W6K A;  1BBW A;  1EQR A;  1X32 A;  1SYC A;  1SN8 A;  2KEN A;  1Y1W B;  1SMY D;  2X6L A;  5IWA L;  1AFP A;  4B3R L;  2Q8R E;  5ELE A;  4MIU A;  1SYD A;  4LFB Q;  3LX0 A;  3A55 A;  3NTH A;  2EVB A;  2P5Z X;  2NYZ D;  3D6W A;  3ZJY C;  5EAY A;  3PUV A;  3J81 L;  4C3H H;  3S17 H;  3NEL A;  1EY9 A;  1I50 B;  3OHX C;  1NCV A;  1LTG D;  4EVO A;  5CV6 A;  4C3J G;  3RR5 A;  4R4C A;  4X65 Q;  1D7Q A;  2X6G A;  4A3J G;  3A54 A;  3OMG A;  4C3J B;  1ENF A;  2NVY H;  5FLM G;  1K8M A;  2RDH A;  1R4P B;  5GAD C;  2UUA Q;  1EY4 A;  2EYJ A;  4OEM B;  5D3D A;  1EYC A;  2WKD A;  2A68 D;  3HS0 C;  4JPB W;  4YWM A;  3Q0A A;  5D65 A;  3S1R B;  4LF7 Q;  4ZKC B;  2AQ1 B;  3SDZ A;  1EEI D;  4L5T A;  5CV9 A;  1ML0 D;  2I5M X;  4AQY Q;  4KHV A;  3CCU A;  2FMM A;  3SVM A;  1Q1E A;  4RCO A;  2FMC A;  1EIY B;  3H0G G;  3TME A;  4DV3 L;  3PIP A;  3RLN A;  1DJR D;  3RD4 A;  4QL5 A;  3R2I A;  3MXN A;  3N52 A;  3M4O B;  5G3L D;  2LS0 1;  4WFN 3;  5FJ8 G;  4FYD A;  1AE3 A;  3NWT A;  4A3C H;  4A93 G;  1IKL A;  1V9P A;  1VQB A;  3DEO A;  2CWP A;  2SNS A;  1E2W A;  2A69 C;  4LF8 Q;  1GD7 A;  1IL8 A;  2AQ2 B;  4B3M L;  3HOZ B;  1JOR A;  1Z6H A;  1N33 L;  1STE A;  5GRO A;  3T1Y Q;  1CKN A;  1I5F A;  2A5H A;  2EE1 A;  4M8A A;  1EWC A;  2Z8L A;  1J5E Q;  2NZ1 D;  1WCM G;  1PH6 A;  1O80 A;  2OT2 A;  5FKA C;  4YCU A;  1X54 A;  3CRK C;  3I70 A;  4A3L G;  1N34 L;  4ZCK A;  1WCM B;  4LNQ A;  1IBL L;  1XMQ Q;  4C3I G;  3C2P A;  4C2M H;  2OQK A;  2K04 A;  4E6I A;  3HEJ A;  2MO1 A;  4CKB A;  1E7Z A;  5IGG A;  4C3I B;  2KCT A;  2F0K A;  1VS0 A;  5C4X H;  4OO1 G;  1TS5 A;  2KCC A;  3SK6 A;  1I6H B;  1PTO H;  2CQO A;  1Q90 A;  5C44 G;  3AMU A;  1K9M C;  3QOJ A;  1K3B C;  2N55 A;  3A0J A;  4QUC A;  3URY A;  1UE7 A;  1DM0 B;  3R2T A;  1VQP A;  4JI1 Q;  1NBW A;  1EIF A;  2VL6 A;  3FHW A;  3PUZ A;  2NVQ H;  3HOW H;  4DV0 Q;  2JA5 B;  3Q22 A;  3RNU A;  2UXD Q;  4OHJ A;  3MAQ A;  2CQA A;  4NW2 A;  3VR6 A;  5LMN L;  3RZD B;  1BR9 A;  4A3I B;  2XGT A;  4DR1 L;  4R4Q A;  5C0X I;  3BDL A;  5HUR A;  1JE5 A;  2PI2 A;  3PMF A;  1KAB A;  2A6H D;  1BCP D;  1ET6 A;  4OWX B;  3HG9 A;  1X3G A;  5FLX c;  3PSI A;  1UNS A;  4O0A A;  1L1O C;  4X64 Q;  5GQO A; 
#chains in the Genus database with same CATH homology
 2HQL A;  3SGI A;  2BA0 A;  3H15 A;  2UUB Q;  2VNU D;  2B63 G;  2AHO B;  4JG2 A;  4JI7 Q;  2F4V L;  1KL9 A;  1XPO A;  4L5Q A;  3J81 i;  4B3T Q;  4A3C G;  4A3K H;  1LUZ A;  3K7U C;  1Z9F A;  2BH8 A;  1I6H H;  4RMF A;  1NMG A;  1Y1V H;  1RL2 A;  2LXK A;  2WAQ E;  4NXN L;  4DAM A;  5GAG C;  4DV5 Q;  2C35 B;  4X64 L;  3KJO A;  1FL0 A;  2F52 A;  3E0E A;  4DR5 Q;  2UUB L;  4POF A;  1S40 A;  2R7F A;  4JI7 L;  1K3R A;  2N49 A;  2ASB A;  2K4K A;  3UDG A;  1A8V A;  2F3I A;  1ASY A;  2DGY A;  2UXB Q;  1K83 H;  4B3T L;  1TWH H;  4LF9 Q;  1X56 A;  4EX5 A;  2JA6 H;  3I55 A;  4A3E H;  1N9W A;  3ERS X;  5M5X H;  3I4N G;  4AH6 A;  4ME3 A;  4HJA A;  2JA5 H;  1MKH A;  1OXV A;  3PCO B;  2JA8 H;  4DV5 L;  1VQO A;  1KRS A;  4JI5 Q;  5AJ3 Q;  3TS0 A;  4A3G G;  4GLV B;  5K36 G;  4DR5 L;  2VY3 A;  5IYD H;  4BBR H;  4GN3 B;  5IY0 A;  1B70 B;  1LYL A;  1SRU A;  3RZD H;  5C0X G;  4GNX A;  2UXB L;  2LSS A;  1E1O A;  1L1O A;  1SFO H;  3VDY A;  3MXN B;  4LF9 L;  2WP8 J;  3CMA A;  1NJI C;  4DV4 Q;  3HOV H;  3DM3 A;  1L2F A;  1WFQ A;  3GTM H;  3S1M H;  5GAH C;  4PZ8 A;  4JI5 L;  1SE8 A;  3U58 A;  2IT1 A;  2OWO A;  5AJ3 L;  3GTL H;  5M3F H;  1PH5 A;  2PMZ E;  1AE2 A;  1EWI A;  1KRT A;  3KYH C;  1GKH A;  2FXQ A;  3L7Z C;  1CKN B;  3PUW A;  5HGQ A;  3OW2 A;  1Z47 A;  1PH3 A;  1YEZ A;  2R92 G;  4LF4 Q;  3UDX A;  1BKB A;  1P16 A;  4DV4 L;  4BY1 H;  3HOZ G;  3PO3 G;  4MNO A;  2PI2 E;  2WB1 E;  4HJ8 A;  1GM5 A;  4JI0 Q;  3U4V A;  4X6A H;  4KLK A;  3F1Z A;  4XTC S;  2MQH A;  4PZ7 A;  3AEV A;  3T1H Q;  1VQF A;  2A8V A;  4DV6 Q;  1YHQ A;  2ZTE A;  2IX0 A;  3GO5 A;  2AWN A;  4DV7 Q;  1OTC A;  5C3E H;  2L15 A;  2YTX A;  4O2D A;  1PH7 A;  2Z6K C;  4LF4 L;  3K0X A;  4JCV E;  3EN2 A;  1R9T H;  4LUV A;  4JI4 Q;  1JJ2 A;  2EQS A;  2Q2H A;  3I4M G;  3HOX H;  4JI0 L;  1VQ6 A;  4L5R C;  5GAE C;  3L2P A;  4A3K G;  4A3B H;  3T1H L;  5M5W H;  3S1Q H;  1VQJ A;  4DV6 L;  3FKI H;  5IYB H;  3W1G A;  1WYD A;  4AYB E;  4DV7 L;  3EBE A;  1JJG A;  3T1Y L;  2PQA B;  1Y1V G;  4HID A;  1MJE A;  3GTO H;  1CSQ A;  4JI2 Q;  1GVP A;  1V1Q A;  1YHA A;  1U5K A;  3BZK A;  4JI4 L;  4GN4 B;  4A3J H;  1EYG A;  4JV5 Q;  1L1O C;  3G48 A;  4BA1 I;  5C4J H;  2Q2I A;  1VQ8 A;  2BH2 A;  4YCW A;  2JA6 G;  2V1C C;  4A3E G;  3GD7 A;  3CCR A;  3OTO Q;  1PH1 A;  1XMO Q;  2AMC B;  2JA5 G;  3CXC A;  2JA8 G;  1VQC A;  3M9B A;  4UP7 A;  3HOY H;  4IOC A;  4JI2 L;  2AWO A;  1Q8K A;  4JBJ A;  1YIJ A;  3UDI A;  3GTG H;  1TWF H;  3S2H H;  2Y0S E;  1PVO A;  5JJL A;  2R6G A;  4JV5 L;  4A3I G;  4BXX H;  1LTL A;  1X3E A;  4LUZ A;  2Z0S A;  2Z6K A;  3J81 c;  2R93 G;  1EFW A;  2A1A A;  1X65 A;  4TQU S;  2JA7 H;  3HOV G;  2UUC Q;  3OTO L;  4X62 Q;  4GOP C;  1XMO L;  1YHB A;  2HT1 A;  3CP0 A;  3CW2 C;  4DK3 C;  3H0G H;  2VQF Q;  3K80 C;  2E2J H;  4JC0 A;  4LUO A;  2K52 A;  5IYC H;  4BA2 I;  4DPG A;  1CKO A;  1DGS A;  1LM0 A;  4Y7N H;  4DR7 Q;  1N32 Q;  2GN5 A;  2ALY B;  2YTV A;  1YVC A;  5FJ8 H;  3KFU A;  4B3R Q;  1IBM Q;  2E5L Q;  1X55 A;  3CAM A;  4BY1 G;  1VQ4 A;  1PHJ A;  3HOU H;  1NE3 A;  2UUC L;  1VQK A;  4X62 L;  4A93 H;  5E7N A;  4NPS A;  3BJU A;  1Q12 A;  3KLW A;  3CCM A;  5LMN W;  1L0W A;  2QEX A;  2MFI A;  2VQF L;  1YJW A;  2YU9 H;  1JT8 A;  3D0F A;  1EUJ A;  2N3S A;  1VQA A;  1D8L A;  2I5L X;  4DAY B;  1YI2 A;  1P8L A;  2IY5 B;  2KCM A;  1YNX A;  2D0P A;  5IP9 G;  2E2H H;  4DR7 L;  1N32 L;  1M1K C;  1G6P A;  2OQ0 A;  4LFA Q;  4YWK A;  1VCI A;  5C3E G;  4P71 A;  1K8G A;  4A3D H;  5M5Y H;  4TVA B;  1IBM L;  2E5L L;  3TRZ A;  2JK8 A;  4JBW A;  2JQO A;  4PG3 A;  3GTJ H;  4GNX B;  1G51 A;  1E3P A;  2VUM H;  1L1O B;  3AFQ A;  1QUQ A;  3OYY A;  4QJF A;  2ZJR A;  4A3L H;  1XNR Q;  2BA1 A;  3PUY A;  2OTL A;  4BBS H;  4A3B G;  2IHE A;  1J6Q A;  3AQQ A;  3FKI G;  3ULL A;  5IYB G;  4YCV A;  4IOA A;  3FP9 A;  3K8A A;  4GOP A;  2K14 A;  3CCS A;  2H5X A;  4IPD A;  2HIV A;  2DUD A;  4LFA L;  1TWA H;  3L0O A;  3RLO A;  3PIO A;  2VW9 A;  5DLQ E;  1YBY A;  4LF5 Q;  1C9O A;  4R4O A;  3JAM c;  3U4Z A;  4IPG A;  4OXP A;  2ZJP A;  1HR0 W;  3CCJ A;  5C4X G;  3TS2 A;  3AYH B;  4JI8 Q;  1VQL A;  2NVT H;  1YZ6 A;  3I56 A;  3I4O A;  1XNR L;  3CC7 A;  4GKK Q;  2JA9 A;  4DR2 Q;  4DR4 Q;  4WJ3 M;  4OWW B;  3PO2 H;  1PH9 A;  1S3O A;  1VQE A;  2B29 A;  2R7D A;  4MZ9 A;  1NTG A;  2Q2U A;  2WAQ G;  4A3M G;  5JJK A;  3HOY G;  1EOV A;  1CSP A;  5M3M G;  1CUK A;  1X6O A;  2IHF A;  1UE5 A;  3CF5 A;  1C7Y A;  2NVX H;  2UU9 Q;  3TRE A;  3JAM i;  3HOW G;  2K50 A;  1WJJ A;  4GS3 A;  3E9I A;  1XPU A;  4KHP Q;  4JI8 L;  3I2Z A;  3S24 A;  2KBN A;  2QA4 A;  1N36 Q;  4R4I A;  4GKK L;  3UE0 A;  5IP7 H;  1Y1W H;  1G29 1;  4DNI A;  1ASZ A;  2JA7 G;  1VQH A;  4DR4 L;  1VQN A;  4DR3 Q;  1HZ9 A;  4UY8 C;  1U0L A;  2CCZ A;  3LGJ A;  3G71 A;  4IPC A;  3S1N H;  4A76 A;  1QVF A;  2ZTC A;  1QVC A;  1SMX A;  4QY7 A;  3CC2 A;  3CCL A;  2ES2 A;  1JMC A;  4ALP A;  5JEA J;  3CC4 A;  1FJG Q;  1OXS C;  1W2B A;  2UU9 L;  1A62 A;  4HIO A;  4KHP L;  2PNH A;  1TWG H;  4LF6 Q;  4J15 A;  4A3F H;  3PGZ A;  3HKS A;  2B63 H;  1N36 L;  2VQE Q;  1PFS A;  1B8A A;  1FVI A;  2OCE A;  2WFW A;  3D31 A;  1PH2 A;  1K8A C;  4DR3 L;  1Q46 A;  4HJ9 A;  3HOU G;  4GKJ Q;  1I50 H;  3ULP A;  1PYS B;  5J3B A;  3BU2 A;  4K0K Q;  2B3G A;  4DV2 Q;  1XNQ Q;  4IJL A;  1FJG L;  4KI0 A;  1IXR A;  2K5N A;  4LW1 A;  1E24 A;  3KF6 A;  3J80 i;  3CQZ H;  4C3J H;  4DUZ Q;  3CPF A;  2E8G A;  4JOI C;  4X66 Q;  4LF6 L;  3GTK H;  2VQE L;  3U50 C;  1QVG A;  1HNZ Q;  4JBK A;  4A3D G;  1PH8 A;  2LXJ A;  4LWC A;  2RHQ B;  5BR8 Q;  3HKZ E;  3TEH B;  1NY4 A;  5LMU Q;  2JE6 I;  4RG1 A;  2WB1 G;  3M85 A;  1KAW A;  5ELN A;  5FLM H;  5IT9 c;  2EXD A;  1KQS A;  4K0K L;  4Y52 H;  4APV A;  4DV2 L;  1IBK Q;  4DUZ L;  1SRO A;  1NMF A;  4X66 L;  4BBR G;  5IYD G;  2E2I H;  2I0Q A;  1XJV A;  1HNZ L;  3UDF A;  3GTP H;  2YTY A;  3GDE A;  5BR8 L;  1VQ7 A;  4NB3 A;  5LMU L;  3RN5 A;  3MEF A;  4A4I A;  1M90 C;  2IX1 A;  4DR6 Q;  3RZO H;  2AKW B;  4OX9 Q;  1YJ9 A;  1A63 A;  2ZJQ A;  4PMW A;  3WWV A;  1B7Y B;  2UXC Q;  2NN6 I;  3A5U A;  1OXT A;  2CWA A;  4JI6 Q;  4GLA C;  1O7I A;  1CKM A;  1IBK L;  3M4O H;  5M3F G;  3S15 H;  4AYB G;  1HZC A;  1YIT A;  1H95 A;  3B6Y A;  2K75 A;  2N8N A;  1Q81 C;  2ZM6 Q;  3NEN A;  3TQY A;  4YHH Q;  2K5H A;  5IWA Q;  4MTN A;  4DR6 L;  4JOI A;  3HOZ H;  4H02 A;  1XTD A;  3CCE A;  1Y1W G;  5IP7 G;  3PO3 H;  3RN2 A;  2XTI A;  2UXC L;  3JC6 6;  1X9N A;  4BY7 H;  1BBW A;  1EQR A;  4JI6 L;  1QUQ B;  4QQB X;  1SN8 A;  4HJ7 A;  1MIU A;  2KEN A;  4P73 A;  1HZB A;  4YWL A;  3G6E A;  4UP8 A;  1KIX A;  4LFC Q;  3IRB A;  1HZA A;  3A5Z B;  4L5S A;  2ZM6 L;  4GOP B;  5H1S E;  4YHH L;  2GVA A;  2Y0S G;  5IWA L;  1PA6 A;  1WCM H;  5ELO A;  1HR0 Q;  4A3F G;  4B3R L;  1IL2 A;  3KDF A;  1VQI A;  4LFB Q;  4IFD J;  3F8T A;  3I4M H;  3HOX G;  2VZA A;  4P75 A;  2Q2T A;  3ER0 A;  4IPH A;  1IYJ B;  1BVS A;  3F2D A;  1RIP A;  1GO3 E;  3K81 C;  3ZJY C;  2R7Z H;  1X3F A;  3PUV A;  5EAY A;  3RLF A;  4C3I H;  4LFC L;  3I7F A;  4C3H H;  4PZ6 A;  2HIX A;  4GN5 A;  4A75 A;  2ATW A;  3K7A H;  1HNW Q;  3NEL A;  4OWT B;  2JJQ A;  2ZTD A;  2NN6 G;  4P74 A;  5JEA G;  1HR0 L;  1EQQ A;  3RR5 A;  4R4C A;  4X65 Q;  2A19 A;  4JI3 Q;  4LFB L;  3J7A 5;  1D7Q A;  3CCQ A;  4R4T A;  4DK6 C;  4FDB A;  4A3J G;  4HJ5 A;  4UP9 A;  5C44 H;  3PF5 A;  1UE1 A;  4JYA Q;  4AIM A;  2NVY H;  5FLM G;  4WJ4 A;  1OXX K;  1I94 Q;  1HNW L;  3W1B A;  5IE8 A;  5GAD C;  2OTJ A;  2UUA Q;  1WOC A;  3CD6 A;  1SLJ A;  3S14 H;  1FGU A;  1VQ5 A;  3KOJ A;  4LF5 L;  1KC8 C;  4DV3 Q;  3M4Q A;  4YWM A;  4JI3 L;  4X65 L;  2YV5 A;  1KHI A;  4DUY Q;  3E9H A;  2JEA I;  4A3I H;  3S16 H;  4BXX G;  3HFZ B;  3EIV A;  5JJI A;  4LF7 Q;  1KXL A;  1HNX Q;  3S17 H;  4JYA L;  1UWV A;  3CPW A;  4L5T A;  4DR2 L;  2R93 H;  4AQY Q;  2I5M X;  1HJP A;  3CCU A;  1YJN A;  1I94 L;  3F2C A;  1Q1E A;  2KHI A;  3CCV A;  2UUA L;  1UEB A;  2I5H A;  1VQD A;  2NZO A;  1EIY B;  4POG A;  4OO1 I;  4B3M Q;  3H0G G;  1E1T A;  5IYC G;  4DV3 L;  3J80 c;  3RLN A;  3PIP A;  3PUX A;  4DUY L;  1N33 Q;  4IFD I;  4QL5 A;  1QZH A;  3KF6 B;  4B3S Q;  4LF7 L;  1MJC A;  3F2B A;  5FJ8 G;  1HNX L;  4IO9 A;  1AE3 A;  3J7Z C;  4AQY L;  1VQM A;  4A3C H;  4A93 G;  1V9P A;  5HY6 A;  1VQB A;  2CWP A;  3AFP A;  1WI5 A;  4IJH A;  2YYZ A;  4QGU A;  2MNA A;  4LF8 Q;  4BY7 G;  1Q82 C;  4HIM A;  1Q86 C;  1PV4 A;  1GD7 A;  1A0I A;  4R1J A;  1N34 Q;  1K73 C;  4JBM A;  2MO0 A;  4B3M L;  2CKZ B;  3BZC A;  1TXY A;  3Q8D A;  4HIK A;  1IBL Q;  3GTQ H;  3G4S A;  1N33 L;  5IP9 H;  5GRO A;  3T1Y Q;  1AH9 A;  1CKN A;  1I5F A;  5C0X J;  3DLL A;  4B3S L;  1J5E Q;  3M3Y H;  1WCM G;  1PH6 A;  3CME A;  3STB D;  3H3V H;  2VUM G;  3UE1 A;  4YCU A;  4GKJ L;  3A74 A;  1X54 A;  3NEM A;  4KHZ A;  2QGQ A;  1I3Q H;  2K5V A;  1JB7 A;  4XIG S;  1N34 L;  1JJC B;  4LF8 L;  2CFM A;  3I4N H;  4A3L G;  4BBS G;  4LNQ A;  1V43 A;  3KJP A;  2R7Z G;  3S1R H;  1IBL L;  1XMQ Q;  1XNQ L;  4NXM Q;  2RHS B;  4C2M H;  4A3G H;  2OQK A;  3PV0 A;  1PH4 A;  3M4P A;  1IZ6 A;  2MO1 A;  1J5E L;  1E7Z A;  3PF4 A;  2KCT A;  3ICE A;  1VS0 A;  5C4X H;  4DV1 Q;  4OO1 G;  1N8R C;  1UE6 A;  3STB C;  4GLX A;  2CQO A;  3W5O A;  1KD1 C;  2HHH Q;  5C44 G;  4IFD G;  1K9M C;  2GVB A;  3KF8 B;  3J81 j;  1E22 A;  5LMN Q;  1XMQ L;  3A0J A;  4NXM L;  1UE7 A;  4DR1 Q;  2PQA A;  2D0O A;  1VQP A;  1Q7Y C;  1QZG A;  3M7N A;  1HH2 P;  4JI1 Q;  3PO2 G;  1T9H A;  4YY3 Q;  1NBW A;  3H3V I;  1C0A A;  4QIW E;  1EIF A;  2RCN A;  2VL6 A;  4A3M H;  1XPR A;  3FHW A;  5M3M H;  1W3S A;  3PUZ A;  2NVQ H;  3HOW H;  4DV0 Q;  4DV1 L;  3RNU A;  2RF4 A;  2UXD Q;  4OON A;  1VQ9 A;  2R92 H;  2HHH L;  3S2D H;  4OX9 L;  2F4V Q;  4DKA C;  1OXU A;  3HKZ G;  1S72 A;  2VS1 A;  2NZH A;  3KDF B;  3ULJ A;  5LMN L;  4UPA A;  4P72 A;  1Y14 B;  2D62 A;  2N78 A;  2XGT A;  4DR1 L;  4R4Q A;  5C0X I;  2ID0 A;  1JE5 A;  2PI2 A;  3NBH B;  2EIF A;  2KHJ A;  4OWX B;  1TWC H;  4JI1 L;  4YY3 L;  2JEB I;  1X3G A;  5FLX c;  4EQ5 A;  3PSI A;  1SR3 A;  1PYB A;  4GNX C;  4O0A A;  1K0R A;  4NXN Q;  4DV0 L;  1BBU A;  1VQG A;  2UXD L;  1Q1B A;  4X64 Q;  5GQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...