2B29A

N-terminal domain of the rpa70 subunit of human replication protein a.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Single-stranded DNA mimicry in the p53 transactivation domain interaction with replication protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b29A00
3D0FA 4QIWE 3CCUA 1EIYB 2CKZB 1BVSA 1EUJA 2ES2A 1N34L 2IT1A 2UUCL 4DV5L 4A3BG 4L5RC 4A3EH 1JMCA 1XMOL 3SGIA 4LFAQ 3K7UC 3HKSA 2F4VL 1AE2A 3KDFA 1XJVA 4OXPA 3M85A 4A4IA 1KQSA 1FGUA 1VQCA 5C4JH 2PI2A 3ULPA 4R4IA 1GKHA 3CPFA 1Z47A 2MO0A 4DR2Q 3J81j 1KAWA 1HZCA 4BA1I 3IRBA 3W1BA 4X64Q 4BBRH 1VQJA 3L0OA 3S24A 1OXUA 3CD6A 3ICEA 4LF5L 2HT1A 4OWXB 4WJ4A 3EN2A 5C4XH 3J80i 2JA5G 2BA0A 3GTOH 4POGA 3S16H 2QEXA 4DR1Q 3H0GG 2KCMA 5C3EH 3T1YL 1M1KC 3CXCA 1QVCA 3RZDH 1VQNA 2B63H 4KHPL 3S15H 4AH6A 1EYGA 2B63G 2VQEL 2E8GA 1KRSA 4B3ML 4AQYL 1WOCA 1P16A 1IBMQ 3S2DH 1YNXA 5JJKA 3DM3A 3I4MG 3AYHB 1QZGA 2KBNA 4OX9Q 3S2HH 1PFSA 3RLOA 1HNWQ 3E9IA 3CCQA 4NB3A 1Q82C 1VQIA 3JAMi 1PVOA 1FJGL 1X54A 2NVTH 4HIKA 5FLXc 2N78A 1IZ6A 3F2BA 1VQ5A 2H5XA 1KRTA 4C2MH 1UE7A 1QVFA 2UUCQ 4A3IH 1GO3E 1N34Q 4DV5Q 1X65A 4JI2L 4GKKQ 1IXRA 4JI3L 4A3IG 1XMOQ 4DR3L 3U50C 3KF8B 3S1RH 2CWPA 1HR0W 4IO9A 2F4VQ 1TWHH 1PH6A 5GQOA 5JEAG 3NENA 4JC0A 4MNOA 4QY7A 1HNXL 3GTPH 2L15A 4UY8C 1SMXA 4HIDA 2KENA 2F52A 3AQQA 1N36L 2R92G 2F3IA 4DAYB 3HOUG 2K4KA 3I7FA 2V1CC 4BY1G 3G4SA 3PO2H 3Q8DA 1MKHA 4R4CA 2AWNA 4LF5Q 4Y52H 1PH1A 3CP0A 3ERSX 2RHSB 4HJAA 1C9OA 2D0OA 4BY7G 4IFDJ 2VZAA 2IX1A 3TQYA 1Y1WG 5IP9H 1OXXK 1VCIA 5LMNW 1PV4A 5FJ8H 3T1YQ 2E2JH 3RZOH 4DUYL 1VQMA 1SFOH 4KHPQ 2EIFA 2VQEQ 2PQAB 4FDBA 2HHHL 2Q2TA 4B3MQ 4AQYQ 2AMCB 3GD7A 3TEHB 4GNXA 5IP7H 4A3CG 4L5TA 1JJGA 4GNXC 3CC4A 5C0XI 1G51A 4NXNL 2B3GA 1NBWA 3NEMA 1Q1EA 2N3SA 1X6OA 4JI8L 1NJIC 4DR4L 3D31A 1YVCA 4IFDI 2I5MX 4JBKA 1FJGQ 1NMGA 1E24A 4A93G 1I5FA 1N33L 4JCVE 2Q2HA 3RLNA 2BH2A 1YHAA 4UP8A 1PH7A 4JV5L 2VUMG 3BZKA 1Y1VH 4JI2Q 4YHHL 2R7ZG 3HKZG 4C3IH 4JI3Q 2NN6I 4L5SA 4DR3Q 4BXXG 4DR7L 4ALPA 4O0AA 4YCUA 4AYBG 1X56A 2R6GA 3GTKH 1Q86C 3U4VA 1HNXQ 2NVYH 1XNRL 1PYSB 4LFBL 2E2IH 3H3VH 3F2DA 1YI2A 1I3QH 1N36Q 4OO1I 1A62A 4DNIA 1VQLA 1QUQA 4C3JH 1SROA 3F2CA 2ZJPA 4UP9A 1CKMA 3J7ZC 1D8LA 1HH2P 2NZHA 2HIXA 3UDGA 1W2BA 2R93H 3PF5A 3GTMH 4GOPA 3K80C 4DUZL 2JA6H 3ULLA 4JBWA 4GOPC 1HR0L 3S17H 2UXDL 3M7NA 2OCEA 1NY4A 4IOCA 4DUYQ 4A3KG 1IBLL 2UU9L 4LF7L 2HHHQ 4LF6L 2VS1A 1JJ2A 3KLWA 2VQFL 4LUZA 4DV6L 2GVAA 4OWTB 1BKBA 1SRUA 2Q2IA 2A8VA 4NXNQ 4A3BH 4JI8Q 3OTOL 4DR4Q 1A63A 1OXTA 1CKNB 3DLLA 3AFPA 1WI5A 1HZBA 3FHWA 1K8GA 4DV1L 1EWIA 5LMNL 4R1JA 1PYBA 1YHBA 1N33Q 2Y0SG 4HJ8A 1TWCH 1XPUA 5IE8A 1MIUA 1K9MC 4JV5Q 3ULJA 4YHHQ 4IOAA 5K36G 2PI2E 1TXYA 4DR7Q 4JI5L 5JJIA 2IHFA 4K0KL 2Z0SA 2WB1E 3HOXG 1G6PA 2WFWA 1LM0A 1SLJA 3HOVG 3BU2A 4IJHA 2JA5H 1X3GA 1XNRQ 1UE1A 4LFBQ 3H0GH 1HZ9A 4AYBE 3A5UA 1PHJA 2K75A 1CUKA 3KDFB 2K52A 1HNZL 1TWAH 3I4MH 2OTJA 5DLQE 5GAHC 1VQEA 2ALYB 4DUZQ 1WJJA 2CWAA 3A0JA 1HR0Q 2E2HH 2UXDQ 4B3TL 2UU9Q 1E3PA 1IBLQ 2YV5A 4X66L 1PH9A 1HJPA 2K5VA 4GLAC 3WWVA 2I0QA 4LF6Q 4LF7Q 1XTDA 3FP9A 1OTCA 5ELOA 4LFCL 4IPCA 2VQFQ 4APVA 4DV6Q 2UUAL 2VNUD 2RF4A 1B8AA 1WCMG 3CPWA 3TREA 3H3VI 2JEAI 4JI4L 3CCVA 3RNUA 3OTOQ 3KJOA 4DV0L 3KYHC 4NXML 2NN6G 4OONA 3OYYA 2JA9A 5LMNQ 4DV1Q 1L0WA 1E1TA 4A3JG 1R9TH 2JJQA 2UXBL 4LUVA 3HFZB 2WAQG 5M5WH 4JI0L 1V9PA 2K5NA 3PO3G 1M90C 3CCRA 2R92H 4A3GG 4UPAA 4OWWB 1MJEA 1OXSC 2JK8A 4BY1H 4JG2A 4JI5Q 3HOUH 5AJ3L 1NTGA 4K0KQ 4OO1G 4PZ8A 4YWLA 1KIXA 2OTLA 4J15A 1K83H 1N9WA 4BY7H 2VW9A 5HY6A 4PMWA 1JB7A 4A3DG 1Y1WH 1CKOA 3A74A 4YWKA 4GKKL 2Z6KA 3E9HA 1W3SA 2Z6KC 3GO5A 4EX5A 4DV3L 1V1QA 3NELA 4RMFA 5FLMG 2PNHA 3RN2A 1KHIA 4HIOA 1J5EL 3KF6A 3H15A 1S40A 1HNZQ 3PF4A 4A3CH 3ER0A 4GN5A 4BBSG 4IPGA 2OWOA 3NBHB 4B3TQ 1I6HH 1J6QA 1TWGH 2K50A 2JA8G 4X66Q 5IYBG 5C44G 1QVGA 4A93H 2YTXA 2YYZA 4P75A 1PH8A 4LFCQ 5IYDG 2UUAQ 3J81c 2N8NA 3FKIG 2ZJRA 2A1AA 2IHEA 1UE6A 3AFQA 1I94L 2VUMH 3PCOB 4JI4Q 2JEBI 2R7ZH 2IX0A 1NMFA 1AE3A 1K0RA 1B70B 1WFQA 1T9HA 2ZTEA 3LGJA 5LMUL 4DV0Q 4BXXH 2UXCL 4L5QA 4GNXB 4NXMQ 4TQUS 2AWOA 1VQAA 1X3FA 4A3MG 1HZAA 3JAMc 5EAYA 1Q7YC 4JI0Q 4NPSA 3PUWA 1IBKL 1SE8A 1GM5A 4DV4L 3RN5A 4EQ5A 1XPOA 4GN4B 5M3FG 2ZTCA 5JEAJ 1Y14B 5GAEC 3CQZH 1L1OA 5AJ3Q 1E22A 3CC2A 1L1OC 1YBYA 4DR5L 2DGYA 3TS0A 1YJNA 3UE0A 1YITA 4LW1A 4JBJA 1VQPA 5M5YH 4PG3A 1UE5A 3GDEA 4DKAC 5IWAL 2PMZE 4LF9L 1KL9A 1VQ6A 4A3KH 1XMQL 2ASBA 1FL0A 3EBEA 4DV3Q 1Q1BA 4O2DA 4DK3C 3GTJH 2QA4A 4IPDA 3PGZA 3W1GA 3L2PA 1J5EQ 3CW2C 4DAMA 4HJ5A 1VQKA 3HOYG 1SR3A 5GAGC 2RCNA 4LWCA 2KHIA 2K5HA 1CSQA 4MTNA 5M3MG 1I50H 2JQOA 1QUQB 3CCLA 4QQBX 3KOJA 1E1OA 3UE1A 4A3FG 4GS3A 5GROA 4YY3L 4JI6L 2AKWB 3CMEA 4P74A 2YTYA 4HJ9A 4GOPB 1PH3A 2ZJQA 1VQ9A 1PH2A 3I4NG 1I94Q 3MEFA 3E0EA 2JA7G 2WP8J 2HIVA 3S1NH 1K3RA 4AIMA 3UDIA 3I56A 4DV7L 1K8AC 1C7YA 2E5LL 5LMUQ 4DR6L 2UXCQ 2MNAA 3PV0A 3HOXH 1VQOA 1VS0A 4POFA 4GLVB 1TWFH 4XTCS 3HOVH 1C0AA 4GKJL 2XGTA 3AEVA 3HKZE 1IBKQ 3PSIA 4KI0A 4DV4Q 1QZHA 3K81C 3MXNB 4X65L 3CC7A 2BA1A 3TRZA 4JI1L 2R7DA 4RG1A 1O7IA 1BBWA 1VQDA 2CCZA 2ATWA 1FVIA 4BA2I 3EIVA 3RLFA 2ZM6L 4DR5Q 4A3EG 4DV2L 2YU9H 3TS2A 3S1QH 1KXLA 2ID0A 4JOIA 4HIMA 1YZ6A 1GVPA 4JOIC 1EFWA 4IPHA 5IWAQ 3CCJA 1K73C 1VQ8A 4LF9Q 2CQOA 1E7ZA 1VQGA 3JC66 5C0XG 2EXDA 1XMQQ 4QGUA 1JJCB 1EQRA 3UDXA 4C3HH 2LXJA 1PH5A 3GTGH 4MZ9A 4H02A 3GTLH 4IFDG 2QGQA 2RHQB 1A0IA 4BBRG 1WCMH 1S72A 1PA6A 4B3SL 3M4OH 1N32L 3CMAA 3J7A5 5C4XG 4P72A 3W5OA 3J81i 3M4PA 3F8TA 1Q81C 3B6YA 1EQQA 4ME3A 2DUDA 5C3EG 1JT8A 2NZOA 2N49A 4YY3Q 4JI6Q 4A3JH 4R4OA 3CCEA 2FXQA 1YHQA 1Q12A 1S3OA 1YIJA 4B3RL 3U58A 4JI7L 3PO3H 3VDYA 3PIPA 2GVBA 1RL2A 1G291 2CFMA 4DV7Q 4A3GH 3I4OA 1VQFA 2E5LQ 4X62L 4DR6Q 3T1HL 3BZCA 3L7ZC 5IY0A 1Z9FA 2Y0SE 1UEBA 1CSPA 3K7AH 1U5KA 1ASZA 1WYDA 1XNQL 4GKJQ 3PIOA 4LNQA 2OQKA 4A3DH 3A5ZB 1IYJB 1Q8KA 1LYLA 4YCWA 5ELNA 1D7QA 4X65Q 2LXKA 1DGSA 4JI1Q 3CF5A 5FLMH 3M9BA 2NVXH 5JJLA 2VY3A 4QJFA 4LF4L 2ZM6Q 1BBUA 4DV2Q 2Q2UA 4BBSH 3STBD 1MJCA 2PQAA 5BR8L 1V43A 4YCVA 4LF8L 2UXBQ 2JA8H 2NVQH 3RR5A 5IYBH 2BH8A 3PUZA 5C44H 3J80c 5C0XJ 4A75A 2LSSA 1IL2A 4JYAL 5IYDH 2EQSA 3FKIH 2MQHA 1LTLA 4KHZA 3PUXA 4YWMA 3PO2G 1N32Q 4B3SQ 4JBMA 3K8AA 2IY5B 3G71A 2UUBL 1OXVA 1B7YB 1XPRA 3GTQH 3S1MH 1YEZA 3M3YH 3K0XA 4DPGA 2ZTDA 2D0PA 5IP9G 3KF6B 4R4QA 3STBC 5FJ8G 3HOWH 1PH4A 2VL6A 3HOWG 4A3MH 1ASYA 3G6EA 2MFIA 3CAMA 2HQLA 3UDFA 4HJ7A 5IP7G 1VQ7A 4JI7Q 4IJLA 4B3RQ 5M3FH 1UWVA 3U4ZA 3G48A 1VQHA 4X62Q 3F1ZA 3T1HQ 2GN5A 2WAQE 1RIPA 2YTVA 1XNQQ 4LFAL 1X55A 1EIFA 4XIGS 3KFUA 4LUOA 1NE3A 1GD7A 2WB1G 5IYCH 1VQ4A 3HOZH 3CCMA 4UP7A 1VQBA 5IYCG 3ZJYC 2KHJA 4DR2L 1U0LA 1X9NA 1Y1VG 4LF4Q 4P73A 1N8RC 4P71A 3HOYH 5H1SE 4X64L 5GADC 1YJ9A 1L2FA 2MO1A 3BJUA 5E7NA 5BR8Q 2R7FA 2D62A 4LF8Q 5HGQA 5M3MH 5J3BA 4Y7NH 3M4QA 2B29A 1Q46A 1L1OB 1AH9A 1X3EA 4DR1L 1P8LA 4PZ7A 4A3FH 3I2ZA 4PZ6A 3KJPA 4JYAQ 2XTIA 2JE6I 1EOVA 4DK6C 2AHOB 4X6AH 1CKNA 2KCTA 3S14H 1IBML 3PUVA 3I4NH 4WJ3M 2UUBQ 2R93G 2I5LX 1YJWA 2JA7H 3OW2A 2JA6G 4KLKA 4OX9L 3PUYA 3HOZG 1HNWL 4R4TA 3I55A 1LUZA 4A76A 2OQ0A 4A3LH 5IT9c 2I5HA 4GN3B 4QL5A 1SN8A 4GLXA 1KC8C 3CCSA 1KD1C 4A3LG 1H95A 1A8VA 1JE5A 4TVAB 2C35B 5M5XH 2A19A 2K14A
chains in the Genus database with same CATH superfamily
4TRDA 3CCUA 3EROA 1BCPC 1BVSA 1EUJA 1IYUA 4DV5L 1B1ZA 1KDAA 1XMOL 3OIQA 4LFAQ 2F4VL 3KDFA 1XJVA 4OXPA 4KMUC 1I4GA 1GUSA 5C4JH 3W2DA 1I4QA 5D65A 3URYA 1EIGA 3HOWB 2CH4W 3IRBA 1RCVD 4IFDH 4X64Q 4BBRH 4A3MB 2RDFA 1OXUA 3ICEA 1SNOA 4WJWA 4WJ4A 2H4OA 3J80i 4DR1Q 3RZDH 2B63H 4KHPL 1EYGA 1KRSA 4AQYL 5C4HA 1P16A 1IBMQ 1YNXA 1WTPA 3D4DA 3I4MG 1V1OA 3HOZB 1AP0A 2KBNA 3RLOA 1HNWQ 5BN4A 2F0OA 3E9IA 3TP5A 2JN4A 2JYOA 4C3IB 5CV5A 1FJGL 1PTOB 1JOKA 3HP3A 1Q8IA 1HTPA 2Q8TA 1KRTA 4PQXA 1UE7A 2UUCQ 1SDFA 1U4LA 2F0EA 4JI2L 1WTQA 1R4PB 3KF8B 3S14B 5EKLA 5JEAG 4MNOA 2EYFA 4FP5D 4QY7A 1RODA 1Z7TA 4HIDA 2K6AA 3S17B 3T16A 3AQQA 2EYPA 2R92G 3HOUG 2K4KA 4BY1G 1SYGA 2V1CC 4K5VA 1MKHA 1LT5D 3HS0C 2RKSA 1Z6HA 2D0OA 3A55A 2E2JH 4DUYL 4FF1A 3I8ZA 2I07B 3T56B 1NAPA 2AMCB 2BCOA 4L5TA 1E2ZA 4NXNL 4K14A 3J7YW 1Q1EA 2N3SA 1X6OA 4JI8L 4E6IA 5FLXE 3A8KE 1TY2A 4IFDI 1E24A 1H9RA 2F0TA 3C2PA 2BOSA 4Q0FA 2KEDA 1YHAA 4UP8A 2L5TA 2KCNA 1Y1VH 3BZKA 3ND9A 2R7ZG 1I4PA 2NN6I 3Q23A 1LTRD 4L5SA 4O0AA 5KNBA 4AYBG 2PZWA 1TR5A 3D3RA 3I4MB 3S2DB 3LWUA 1HNXQ 3D4RA 3SXHA 4OO1I 1I3QH 1VQLA 4C3JH 4S3SA 1JOOA 1W2BA 1CKMA 1HH2P 2NZHA 4RGOS 3PF5A 3GTMH 4R8NA 3MZ5A 4JBWA 1NY4A 4A3KG 2VB2X 1KNEA 4LF6L 2HHHQ 1MBYA 1JJ2A 4DV6L 3TSSA 1JC7A 2PNRC 2GVAA 1BKBA 1MI2A 3GTPB 1BUVT 1F2MA 1H9MA 4A3BH 1MHWC 1S5DD 2R92B 3OTOL 4DR4Q 3HOUB 1A63A 4BY1B 3AFPA 2SEBD 2EYMA 2XSCA 4DV1L 4R1JA 3E6ZX 2K01A 1YHBA 4ZLTF 1TWCH 4O1NA 2PQEA 1MIUA 5IE8A 3ULJA 4RFBA 3T4AC 4IOAA 2PI2E 1K8MA 4DR7Q 2Z0SA 2WB1E 3QIAA 3KLSA 1SLJA 1KLUD 2X69A 3HOVG 4G7OC 3BU2A 5T1IA 4DGZA 5EBCA 4FYDA 1PHJA 4AYBE 5J39A 1DOKA 2F0HA 1B3AA 5CV4A 5FKAC 1V8QA 5ELCA 2OTJA 2WB1B 1VQEA 1WJJA 1CA6A 1HR0Q 1HCZA 3V05A 2XNAC 3BG3A 1IBLQ 4X3UA 4KKUA 1PH9A 1G2TA 1VMCA 4AYBB 1XTDA 2AQ2B 4LF7Q 4LFCL 1DJRD 2F3VA 1SE2A 2B2UC 1D6EC 1WCMG 5EKIA 3CPWA 3GTKB 3CCVA 2KCCA 2E2IB 5I6WA 2PZTA 4NXML 1SAPA 2JA9A 1GHKA 1HHVA 4A3JG 1E1TA 4LUVA 3HFZB 5M5WH 2K5NA 3PO3G 2JA6B 2IJ0A 3CCRA 4BWGB 4JI5Q 4JG2A 4WFN3 5AJ3L 1NTGA 4PZ8A 3BYTB 1KIXA 4BY7H 3OIPA 4GKKL 4GZYC 1ZEQX 3GO5A 3M7GA 4DV3L 1SSOA 1V1QA 1STNA 1KHIA 4A3CH 1O80A 4PMCA 1G8ZD 1LV9A 2F0MA 2Z1CA 3BDLA 3F2UA 1I6HH 1TWGH 2K50A 2JA8G 3K5LA 3SK4A 1DYQA 5C44G 2YTXA 2YYZA 5IYDG 3J81c 1QNUA 2N8NA 3Q24A 2A1AA 1UE6A 3V2TA 4J6HA 5IGCA 3PCOB 1TS5A 2JEBI 1NMFA 1K0RA 2BDNA 1WFQA 1T9HA 4DV0Q 4BXXH 4L5QA 3MFGA 2AWOA 1X3FA 1SYCA 4JI0Q 1H9KA 1IBKL 1GM5A 4DV4L 2WKDA 3I4LA 4QB4A 1PFNA 2R3ZA 5JEAJ 1NUCA 2PW5A 1L1OA 4JW0A 2DGYA 1CM9A 4XXEA 2PYKA 1WCMB 4LW1A 1DM0B 5M5YH 4LF9L 3I72A 2PMZE 1CQFA 2A6HC 2OT2A 3W1GA 1K0SA 3ITPA 4DAMA 4HJ5A 1VQKA 1EFID 3HOYG 3HEJA 1SR3A 2GA4B 2K5HA 2CVRA 1YNJD 5COYA 4G57A 3VA7A 5M3MG 3NSWA 1QUQB 2HCIA 1E1OA 3MTSA 4A3FG 2PMZB 4GS3A 2AKWB 2YTYA 1B3QA 1L0XB 2ZJQA 3I4NG 1I94Q 4RCNA 2JA7G 3OMCA 2LS01 4AIMA 2QDLA 3UDIA 4DV7L 2K5WA 4CJ1B 3S1NH 2UXCQ 5LMUQ 5G3LF 1VS0A 1BO0A 4POFA 4JVZA 1C0AA 2XGTA 1SNCA 1QZHA 3MXNB 2JA8B 1LT6D 2BA1A 3P1HA 1PTOD 2CCZA 1FVIA 4BA2I 1EL0A 3RLFA 4DR5Q 3S1QH 2YU9H 4A93B 4DAPA 2EY5A 1GVPA 3GTQB 5IWAQ 2VUMB 3M3YB 2CQOA 1E7ZA 3JC66 2KHSA 5CGKA 3C46A 1JJCB 1EQRA 4CJ0B 2NUCA 1PH5A 3GTGH 3TP6A 4IFDG 4BBRG 4B3SL 4IUUA 4RHRA 1AZPA 4HSPA 5IGGA 2A74C 4P72A 3J81i 3M4PA 3F8TA 1Q81C 1I6VC 1A3UA 3CQZB 2NZOA 3BS1A 4R4OA 3KF8A 1Q12A 5FO8B 2HD3A 4B3RL 4JI7L 4HR7B 5DAUA 1G291 2CFMA 3KLSX 1STGA 2E5LQ 3SK8A 2RBMA 3L7ZC 3RUZA 3K7AH 2Y0SE 4L63B 1CSPA 1TKWB 1WYDA 2XWBB 5IT9L 3HOYB 1NNXA 3N52A 1S5CD 1EEID 1LYLA 5M3MB 4KKTA 3IFDA 1GJXA 1DGSA 2OEOA 4EQOA 2RDGA 5C6AA 3CF5A 3BZDB 5JJLA 2B39A 3BVGA 2Q8IB 4BBSH 3MWYW 2Y0SB 3I4NB 1F9PA 1A2UA 2NVQH 3MEHA 1DONA 2BE5D 5C0XJ 3K58A 4KHZA 1N32Q 1JWMD 2J0TD 1OXVA 1DD2A 1YEZA 4RGNA 2M2LA 1J9OA 4DPGA 3STBC 2VL6A 2DY8A 4XDXA 3UDFA 1D5ZC 2XVSA 1RF2D 4TSSA 3T1HQ 3HZXA 2RQXA 1RIPA 2YTVA 1QCBD 4LFAL 2NTSA 5CBAE 4XIGS 2F0DA 3KFUA 1NE3A 2A6ED 4K5XA 3NTHA 4ZYSA 4UP7A 5IYCG 1EZ6A 4N9TA 1U0LA 2MHVA 3OOCA 1Y1VG 3Q22A 4P71A 4X64L 5GADC 3KLRA 2MO1A 2TSSA 4DN4M 5E7NA 2FMCA 4LF8Q 2D2CC 5J3BA 3MXPA 2B29A 1Q46A 4IN3A 4DR1L 4PZ7A 3I2ZA 1TIID 3KJPA 4JYAQ 1HUNA 5ISRA 1EOVA 2AHOB 2E75C 3E3XA 4C3JG 2IX3A 1IBML 3PUVA 2E76C 2I5LX 1YJWA 2B2YC 3AMUA 3OW2A 1HNWL 2OQ0A 4WRDA 3U9OA 5IT9c 3JAME 1KD1C 1SN8A 2K03A 1STHA 3CCSA 4FF2A 1H95A 1FNVA 2D5DA 2C35B 3M4YA 4TVAB 3NK9A 1ENCA 1ET6A 2UUCL 2IT1A 4A3BG 1LACA 4A3EH 1JMCA 3SGIA 2K28A 1FGBD 3FKIB 1QNKA 1T5EA 3M85A 1FGUA 2PI2A 3J7AV 5EBDA 2EJGC 4OEMB 1HZCA 1DCZA 3OW7A 1GUGA 1JR0D 1VQJA 2HT1A 3EN2A 2BA0A 3R3OA 2F0LA 4H0LC 1SXTA 2QEXA 2KCMA 5C3EH 1M1KC 2AUJD 1QVCA 3CXCA 1IKMA 3S15H 4AH6A 3MA2B 1EY8A 1B9MA 4DFAA 3AYHB 4ZKBB 1M8AA 1NR4A 3S2HH 1Y1VB 4C1NI 1CHPD 3CCQA 3QG1A 4C2MH 3H91A 4Z9CB 1X65A 1IXRA 4A3IG 3S1RH 5FOBB 2CWPA 1DZ1A 1FNUA 4IO9A 3HG9A 1TWHH 1PH6A 1HNXL 3D6WA 1SMXA 1ONLA 1PRTF 2F52A 3L3OC 1F9QA 3I7FA 1PMRA 4CDDC 1M4VA 3PO2H 4LF5Q 4NDXA 5M5XB 1PH1A 4MIUA 1OO9B 4WORA 4HJAA 4BY7G 4IFDJ 1JOQA 2VZAA 3TQYA 3RZOH 1OXXK 4A3BB 1JE4A 1QJOA 5CYUA 1SFOH 2EIFA 1CTMA 2VQEQ 4B3MQ 2HHHL 2RCFA 4A3CG 2L1BA 1DOLA 3H94A 5C0XI 3A7AB 3NEMA 4DR4L 5HGTA 4JBKA 1NMGA 4IQZA 3H6MA 3RLNA 1TS3A 1PH7A 1HA6A 3IFTA 3VYSA 3TBIB 4CKEA 3HKZG 4CGYB 4JI3Q 3SEBA 1WTHA 4BXXG 4DR3Q 4DR7L 4ALPA 1NR2A 4YCUA 1SYBA 2R6GA 3FVQA 4CJ2C 1Q86C 3U4VA 3H3VH 1S5BD 5E3FA 2NWGA 1N36Q 1QUQA 4IUQA 3F2CA 3BVZA 1SJED 5LHY1 1HR0L 3DWQA 3NWTA 4KY5A 2XN9C 2OCEA 4IOCA 3FPPA 3RMHA 4A3IB 2L4NA 1IBLL 4LF7L 2VS1A 2E74C 2O5JC 3KLWA 4LUZA 2K05A 3BVMA 1SRUA 2Q2IA 1PZJD 3NQTA 3MXNA 1CKNB 4ZUIA 5EPKA 4DK1A 3DLLA 1WI5A 5L37A 2IWHA 3NHHA 3PIP3 1F9SA 4ULLA 3TZDA 1TXYA 4JI5L 5JJIA 2IHFA 1HTLD 1SMYD 2WFWA 1LM0A 5ELEA 1XNRQ 3JAML 4LFBQ 2F0JA 3H0GH 1HZ9A 1I6HB 2NBFA 1CUKA 3DWPA 2K52A 1TWAH 1IHZA 2QKIC 4UHVA 4RAUC 2ALYB 2E2HH 2UXDQ 3A0JA 5C3XA 2UU9Q 1E3PA 3WOFA 3WWVA 4GLAC 4KV6A 3FP9A 5ELOA 2VQFQ 4IPCA 4APVA 1BDOA 2OF1A 2MUYA 3H3VI 2NVYB 2JEAI 4EVOA 1S5FD 1RDPD 1A3VA 4DV0L 3KYHC 4LMQD 5KGUA 5LMNQ 3HRZC 2JJQA 2WAQG 4JI0L 1SNMA 1CI3M 1V9PA 1SEBD 5M5YB 3MFYA 4XQJA 1M90C 3MHBA 5EPJA 4UPAA 2Z4HA 1MJEA 2N55A 4X3KA 1EY6A 3L9AX 4J15A 1K83H 1N9WA 2XRQD 4C56C 1Y1WH 1A2TA 1CKOA 1UNSA 1D1IA 3A74A 2Z6KA 3E9HA 4MN3A 4EX5A 1BCPF 3NELA 4RMFA 4R8IA 4CDFC 1HNZQ 2SNSA 1B44D 4BBSG 4J1MA 2OWOA 4KJNA 4B3TQ 3AB9A 5JPNC 1LTAD 2EY1A 2QCPX 2Z6BA 2UUAQ 5D3IB 4U673 1B4OA 5CV9A 4IUTA 1D2BA 1I94L 1JWUD 2IX0A 3I73A 2ZTEA 2UXCL 5LMUL 4GNXB 4G4KA 1X3PA 5JOBA 3S1QB 2YU9B 3K57A 3JAMc 5EAYA 2KA7A 4NPSA 3PUWA 2PO4A 2F0GA 1D1KA 4H44C 1XPOA 4ZUJA 4N9PA 3VR3A 5GAEC 1JICA 1PLFA 1L1OC 3A56A 4DR5L 3UE0A 1YITA 4K8JA 4OIKA 5IWAL 4PG3A 1UE5A 3GDEA 4DKAC 1IYVA 1VF7A 4K6LA 4O2DA 2RA4A 3CW2C 4OGQC 4RWSC 1R9TB 2RCNA 2A5HA 4LWCA 4H13C 1HRJA 1HPCA 2JQOA 3J7AF 3KK7A 2J4XA 3VYRA 3K59A 3CMEA 4GOPB 2ZXRA 5I2YA 3E0EA 3G7LA 2FINB 2WP8J 5K36H 1K3RA 2E5LL 5CBEE 3HOXH 1VQOA 1YNJC 4BBSB 3AEVA 3DMUA 4KI0A 5FK9C 3K81C 2NVQB 3DEOA 1O7IA 3SHLA 1EY7A 1BBWA 1VQDA 2ATWA 3EIVA 1F77A 4A3EG 1KABA 2ID0A 2RDHA 1EFWA 3CCJA 1VQ8A 5C0XG 1Q3LA 1XMQQ 2R7ZB 2K5DA 4QGUA 1SYFA 4C3HH 1F2LA 4OL7A 3WDNA 4H02A 4CBVA 2L11A 4EGVA 1N32L 1PA6A 2F0SA 2RVLA 4NP5A 5IGBA 2QF7A 2EY2A 1PTOC 4DK0A 1EQQA 5C3EG 4JI6Q 1S3OA 1YIJA 3U58A 1RKNA 3PIPA 4QMGA 4A3GH 4A3KB 1VQFA 4DR6Q 3GQBA 3T1HL 2X6LA 2KVMA 5CV6A 4B9WA 2XRSD 2OQKA 1IYJB 1Q8KA 5ELNA 1CZWA 5FLMH 2NVXH 1FR3A 2VY3A 4IUPA 1BBUA 2JSOA 4DV2Q 1O7YA 3T51B 1RHPA 1V43A 2F0PA 1NCVA 4LF8L 4LK1C 2A73B 3PUZA 4BS9A 4JYAL 2LSSA 5KYLA 3OWEB 3CRKC 3PUXA 1TWFB 4YWMA 3PO2G 3HOVB 3K8AA 5M9OA 3CHBD 1HFGA 1GUWA 4CDEC 1PXUA 4ZQ3A 3HOWH 1I4XA 4JPBW 3DEPA 5CC4A 1PH4A 4A3MH 2K5QA 3X3MA 3G6EA 4QUCA 1X32A 1VQ7A 2BE5C 4IJLA 5M3FH 1W6JA 1LO5D 1VQHA 2M9VA 4X62Q 2GN5A 1A3TA 2VXWA 1XNQQ 1PDQA 2KOLA 1C8CA 1S5ED 5FLXL 3HOZH 3CCMA 2F0NA 3ZJYC 2KHJA 5KRUA 2NTTA 5CR3A 3S15B 4RCOA 5H1SE 4A3JB 3TP7A 1GUNA 5BR8Q 3J80E 2D62A 3PO3B 3Q6SA 4Y7NH 4FNFA 3NQIA 2N88A 1P8LA 4DA2A 2H1EA 3MVVA 1ILPA 5KIXA 5KNDA 2A6EC 2JE6I 4KN4C 3R8BA 3VA5A 4DK6C 1CKNA 3S14H 1FD7D 3Q0AA 5T1GA 4PNYA 4R4TA 3I55A 1LUZA 4A3LH 2I5HA 4GN3B 4QL5A 3NUCA 1I4HA 4GLXA 1KC8C 1JE5A 2KUMA 1TWHB 1YNND 2F0UA 1U4RA 4QIWE 1STEA 1SNQA 2ES2A 1SNDA 1IW7D 4N8X1 4L5RC 5C44B 2HDMA 3PO2B 1PRTB 3K7UC 4HSVA 1PFBA 2F0FA 5CV8A 4RGTA 4U68A 1LTSD 3VYUA 1GKHA 3CPFA 1LTTD 4QIWB 1KAWA 1SFOB 2F0KA 2ZXPA 3W1BA 3QB3A 1GHJA 3S24A 3L0OA 3CD6A 4QF4A 4LF5L 4X3SA 4OWXB 5C4XH 3ONAB 4POGA 3S16H 2IPKD 3H0GG 5ELDA 4NMZA 3I91A 4KY7A 2B63G 2VQEL 2E8GA 4B3ML 3S2DH 1WOCA 5JJKA 5CMDA 3DM3A 1QZGA 1PFSA 2EY6A 4IUVA 1TS4A 2WV6D 2NVTH 5FLXc 5K5PA 2N78A 2EYOA 1GO3E 1N34Q 4JI3L 4A3FB 1EQVA 1H9SB 4DR3L 5G3LD 1HR0W 3E5SA 3H09A 4JC0A 3GTPH 2FMMA 2HCCA 2JA7B 4UY8C 2KENA 1HFNA 1N36L 2F3IA 2B8FA 4DAYB 1ENFA 3G4SA 5NUCA 1R4QB 1EU4A 2CH4A 3CP0A 2RHSB 5F2DA 4OELB 1Y1WG 5IP9H 1VCIA 3T1YQ 1VQMA 2MJ8A 2ICEC 2C5CA 2PQAB 4I65A 4M8AA 4GNXA 3K5MA 5IP7H 2NB0A 3CC4A 5C4JB 2MGSA 1HQMC 1NBWA 4FXDA 3T13A 1NJIC 1EOTA 2I5MX 1X3QA 1MSHA 4BBRB 5C5LA 1I5FA 2G9DA 2Q2HA 1HQRD 5JJZA 1F2YA 4OHJA 2EPBA 3RZDB 2B63B 1EIHA 3GTKH 1XNRL 1AFPA 3VR6A 1PYSB 4LFBL 2E2IH 5LL6S 5FO7B 3F2DA 1A62A 1O78A 1SROA 1AN8A 2QEJC 4UP9A 3J7ZC 2R93H 2HIXA 4Q5VA 3UDGA 4NW2A 2BDOA 4GOPA 3GV3A 3K80C 2JA6H 3VR4A 3ULLA 2UXDL 2CW0D 5EPLA 1AW7A 2UU9L 4IURA 1UUPA 4F7XA 1LTBD 3FDTA 4K8IA 2VQFL 1PYWD 2A8VA 3OHXC 2J7ZA 4RH6A 3FHWA 3A7LA 1K8GA 1EWIA 5LMNL 1G91A 1K83B 1N33Q 4HJ8A 1ZYRD 1Q90A 1XPUA 4JV5Q 4YHHQ 5K36G 2E2JB 3G6JB 1E2VA 2JXMB 3R93A 5TSSA 1SYEA 3HOXG 3SVMA 1G6PA 4EQPA 1BCPB 5D14A 1JWSD 2JA5H 2B8GA 1AEXA 1UE1A 4CKCA 3A5UA 1KDCA 5EQ0A 2K75A 1HNZL 5DLQE 2MPMA 3BYYB 4FXKC 4DUZQ 1C48A 5JAVA 1SMYC 4B3TL 2I46A 2YV5A 3SK5A 2K5VA 4C3HG 1ZKOA 3DUZA 1OTCA 3WOEA 2VNUD 2UUAL 4XYOA 1B8AA 1MD2D 3TREA 2EJFC 1Y8OB 2X6GA 3KJOA 1I3QB 3IL8A 4C3JB 3A8JE 1L0WA 4L6TB 3GTMB 1TQOA 1UAPA 4A3GG 1OXSC 4K0KQ 2LMCB 2PW7A 2OTLA 3CU7A 2VW9A 5HY6A 4P2CB 3E0JA 4ZCKA 4L8JA 2Z6KC 5D3DA 5FLMG 2PNHA 3RN2A 3H15A 1S40A 1A6XA 4RA8A 4B08A 4IPGA 1U9RA 3NBHB 5A35A 1TWCB 1J6QA 2L0CA 4DU9A 4X66Q 5KEEA 3RD4A 4A93H 4P75A 4K6DA 2IHEA 4G7ZC 2VUMH 4JI4Q 1TT2A 1AE3A 3LGJA 4ZAIA 4DF7A 3FMCA 4TQUS 5I2XA 4FXGC 4I7AA 4A3MG 1HZAA 1E2WA 1O7LA 1SE8A 1K8OA 2K33A 4KK7A 3RN5A 2B2WA 4EQ5A 4GN4B 5M3FG 2B2TC 2IL8A 1DOMA 3CQZH 3FEWX 1EYDA 1E22A 3CC2A 2WKCA 4KKSA 4HAEA 3OMGA 4K5WA 3SK6A 4KJOA 3VR2A 2B2VC 2EYHA 1VQ6A 3HOZG 1KL9A 1XMQL 1NSNS 1FL0A 3EBEA 2ASBA 1PRTD 4MTKA 4DK3C 3GTJH 3P75A 3QOLA 1XX8A 3L2PA 1J5EQ 1XWEA 2AQ1B 5M5WB 4MTNA 1I50H 2F4IA 2QDBA 3CCLA 3J81E 3KOJA 3UE1A 5GROA 4JI6L 4P74A 2A69D 5EKKA 5DNFA 4BY7B 3SDZA 4ZKCB 4K2LA 2HIVA 2VB3X 3I56A 4DR6L 2O2LD 3PV0A 4QCLA 1KTKA 4XTCS 3I90A 2WIIB 3HKZE 1SBBB 3PSIA 3SR1A 4O42A 1TWGB 2R7DA 4RG1A 1KXLA 3TS2A 4DV2L 4ME5A 4HIMA 4JOIA 1Y8NB 1WTOA 1K73C 1VQGA 1D5XC 2EXDA 3DM1A 3HKZB 3QO2A 3W3AA 3K5OA 4KD3A 3GTLH 2RHQB 1ESRA 1EY0A 1HUMA 4PMBA 1S72A 1WD0A 3M4OH 3CMAA 3O13A 3J7A5 5M3FB 5C4XG 1WTVA 2K32A 3EFXD 1ENAA 2A68D 2PCFB 2NN6H 4ME3A 2DUDA 1JT8A 1SE4A 2N49A 4HN7A 4YY3Q 2ZXOA 1EYCA 5E4WC 1H9SA 1YHQA 2DNEA 3VDYA 3NWSA 2GVBA 2JP1A 3I4OA 4OO1H 3P7JA 4X62L 3BZCA 5IY0A 1Z9FA 1U5KA 2LKVA 1XNQL 5FO9B 4DAYA 1L0YB 4GKJQ 4A3DH 1KLGD 4HTHA 4X65Q 4Y7NB 3A8IE 1K28A 4JI1Q 4N8FA 3M9BA 2RSNA 3EVQA 4K2KA 2F03A 4QJFA 2ZM6Q 3CRLC 4KD4A 1KDBA 2D9UA 3X3NA 1MJCA 2PQAA 2Z8LA 4FF4A 5BR8L 1BNZA 4YCVA 1KAAA 2UXBQ 3RR5A 1EYAA 5IYBH 3S1NB 4A75A 1IL2A 1CK1A 2EQSA 3FKIH 2IY5B 3G71A 1ET9A 3TDQA 1B7YB 3ND8A 3S1MH 2ZTDA 2D0PA 5IP9G 3KF6B 4R4QA 2WINB 2F0VA 1IKLA 2F0IA 1ASYA 5HURA 2WACA 3NPPA 5IP7G 1EU3A 1PZID 3U4ZA 1IL8A 2B2TA 4EQNA 2WAQE 5JVG3 1RTOA 2C9OA 3GTGB 4XT1B 1EIFA 2OXPA 1T5XD 4LUOA 2WB1G 1FNWA 5IYCH 5C4XB 1B50A 2B2VA 1DXMA 1VQBA 2SDFA 1JB3A 4B9XA 3S16B 4LF4Q 1N8RC 4QUFA 1YJ9A 1JORA 2KJXA 2WAQB 3BJUA 2R7FA 5KYIA 3D8GA 3M4QA 1X3EA 1G6ZA 1PFMA 4R9WA 3K7AB 2XTIA 1BCPD 5CORA 2NVTB 4WJ3M 2UUBQ 2R93G 3R2TA 2JA6G 4A76A 1H9JA 4LJZC 1TS2A 2R61A 3DXJC 3K5NA 5M5XH 2FFKB 4ID6A 3D0FA 4LAAA 1GUTA 3GP7A 1EIYB 5EJWA 2CKZB 1MSGA 1N34L 3KUPA 4IALA 2QILA 2P5ZX 4ABNA 3TMEA 3HKSA 4XT3B 3QR8A 1AE2A 3J81L 2Z9HA 2EOTA 4A4IA 1KQSA 1VQCA 3ULPA 1EY4A 3VYTA 4R4IA 3EA6A 2M00A 3IAYA 1Z47A 2CHBD 2MO0A 4CHTB 4DR2Q 4IZ8A 3J81j 1YNNC 4BA1I 3AU7A 2O4XA 3A54A 1IW7C 1CZGA 2JA5G 3GTOH 3T1YL 3MC0B 1VQNA 3KBGA 4V0BA 1F9RA 2DN8A 4RKBA 5EGTA 1GXDC 3C3LA 5IT9E 4OX9Q 4NB3A 1Q82C 1VQIA 3PMFA 3JAMi 1PVOA 5LL6X 1X54A 4H7BA 4HIKA 1ICFB 2QW7A 1IZ6A 3F2BA 1VQ5A 1GUOA 1RJTA 2H5XA 1V1PB 1QVFA 4A3IH 3U9SA 5I9OA 4DV5Q 3NTKA 5I9PA 5E4XA 1XMOQ 3U50C 2F4VQ 1SNPA 2R93B 2MP1A 5GQOA 3NENA 3QOJA 2L15A 3C1FA 3NBHA 3Q8DA 1WD1A 5JPMC 4R4CA 2AWNA 4Y52H 3ERSX 1AZQA 1C9OA 2IX1A 1PV4A 5LMNW 5FJ8H 4KHPQ 1WTXA 5AFWA 4A3EB 4FDBA 2Q2TA 3EQLC 1CFMA 4AQYQ 3TEHB 3GD7A 1JJGA 3I70A 4GNXC 3K6OA 3D6CA 1G51A 1D5MC 2B3GA 3C1EA 1BXTA 5BN3A 3D31A 1YVCA 1FJGQ 1S4ZA 5C5MA 4A93G 1F2ZA 3FRPB 1SYDA 3DWAA 1N33L 4JCVE 2SOBA 4UAIA 2JA5B 3S9WA 4KTAA 4RGMA 2BH2A 4C1NK 4CDCC 1U4MA 4JV5L 4DXFA 2VUMG 4JI2Q 4YHHL 1HA5A 1PTOF 4C3IH 5C3EB 4TKOB 3BDCA 4HMJA 4HCEA 1STBA 1PTOH 1X56A 2NVYH 1EZ8A 3PQIA 3S2HB 1YI2A 1EWHA 4DNIA 1WVLA 3QWNA 1WTWA 3SE0A 3UI2A 2ZJPA 1D8LA 2ICIA 1XYIA 1Y8PB 4DUZL 5J22A 4GOPC 3S17H 4C2MB 3M7NA 5J1ZA 2LFNA 4V190 4DUYQ 3MXGA 2EZVA 3S1RB 1CA5A 4OWTB 1XTCD 4XYQA 4NXNQ 1BOSA 4XQNA 4JI8Q 5C4ZA 1OXTA 4NKLA 1HZBA 3GV6A 5BN5A 1BQQT 5DM73 1PYBA 2CW0C 2Y0SG 1LT3D 2EVBA 1K9MC 1JCKB 3RZOB 4ODGA 4K0KL 3PIO3 2SNMA 3NTIA 2L55A 4M1UB 1K3BC 4IJHA 1MGSA 2KECA 1X3GA 5I4DA 1QILA 1RTNA 1QE6A 3LX0A 3NBIA 1VDZA 3NP8A 4UDUC 1B2TA 3KDFB 2HQEA 1ZYRC 3V96A 3I4MH 2FJ2A 5GAHC 2F0QA 2CWAA 3K0YA 3NE5B 4ZK9B 1LLRD 4X66L 2Q8RE 1HJPA 5IGFA 2I0QA 4LF6Q 1W6KA 4DV6Q 2EXZA 2B2UA 2RF4A 5C3WA 1EY5A 4JI4L 3RNUA 1TVXA 3OTOQ 1U4PA 2F3WA 2NN6G 4OONA 3OYYA 4DV1Q 1II3A 5ELFA 1R9TH 4HEDA 5JEAH 1QB5D 1QWYA 2G5DA 4J8QA 3I3CA 4FO2A 1Y69U 2CQAA 2R92H 3T53B 4OWWB 3HOUH 2JK8A 2XIWA 4BY1H 3GTJB 4OO1G 3D4WA 2KEEA 1LTGD 4YWLA 3BDOA 2AUKA 2ZT9C 4PMWA 1JB7A 4A3DG 4YWKA 1EY9A 1CHQD 1I50B 1W3SA 3FPUB 5JVH3 2IW3A 2K7VA 1FYCA 3HGBA 4HIOA 1J5EL 3KF6A 2E2DC 5A2QE 3ER0A 4GN5A 4ILWA 2KQ3A 2Z4IA 4JK1C 5IYBG 1QVGA 1HXYD 1PH8A 4LFCQ 3OSOA 3FKIG 2ZJRA 3ERQA 3AFQA 1KNAA 5E1FA 3MAQA 2R7ZH 3H0GB 1A15A 1B70B 4NXMQ 2A6HD 1EQTA 2DJFC 1VQAA 1TWAB 1Q7YC 4KY6A 2E2HB 2ZTCA 2B2WC 1Y14B 5IOCA 1B53A 5AJ3Q 1WTRA 4F88A 1JQYD 1GOZA 1YBYA 3VR5A 3GTLB 3TS0A 1YJNA 3M4OB 1B9NA 4JBJA 1VQPA 1CQVA 3PF4A 4GKKQ 5KNCA 1ML0D 4A3KH 5IGDA 4DV3Q 1Q1BA 4RHSA 2QA4A 4IPDA 3PGZA 1J8IA 1SJHD 4KN7C 3QJYA 4HMIA 2NZ1D 5GAGC 2KHIA 2PZUA 3CKIB 1CSQA 2HUGA 2LY7A 4QQBX 3J80L 4YY3L 4HJ9A 5IIFA 3MXUA 1PH3A 1VQ9A 4A3DB 1PRTC 4FVMA 1PH2A 4PV1C 2EDGA 4FF3A 1Y1WB 3MEFA 1LTID 1K8AC 1C7YA 2MNAA 4GLVB 1TWFH 3NXWA 3HOVH 4CKBA 4GKJL 2K04A 1IBKQ 4DV4Q 4X65L 3LWEA 3CC7A 3TRZA 4JI1L 2A69C 2ZM6L 2L12A 4KHVA 1STYA 1YZ6A 4JOIC 5C0XH 3S1MB 2DJGC 4IPHA 4LF9Q 2UXBL 1I4RA 2EE1A 2RSOA 1EWCA 3UDXA 2LXJA 3R2IA 4I7ZC 2L9HA 4MZ9A 1ICWA 1O7ZA 2QGQA 1A0IA 1WCMH 4G7HC 4DXGA 2V4DA 3P20A 3DHQA 2F0WA 3W5OA 1V1PA 3B6YA 1G2SA 3H3VC 1BBXC 4A3JH 3CCEA 2FXQA 4YIJA 3PO3H 3LNNA 3OPOA 3TZUA 1ESFA 1RL2A 3IKJA 4DV7Q 1BR9A 1ASZA 5ELBA 1UEBA 2F1MA 3KBXA 3OWFA 3EJIA 3PIOA 4LNQA 2EYLA 2A68C 3A5ZB 4YCWA 1D7QA 4F8MA 2LXKA 4LF4L 4HCSA 4DNTB 2Q2UA 3STBD 2TMPA 2JA8H 2BH8A 2FHTA 5C44H 3J80c 4DAVA 4F87A 5IYDH 3HOXB 2MQHA 1LTLA 1ILQA 5IGEA 4B3SQ 4JBMA 1PZKD 2PPBC 4XQQA 2EJMA 2UUBL 1EEFD 1XPRA 3GTQH 1STAA 3M3YH 2ENBA 3K0XA 2XWJB 4RKLA 2EYJA 5FJ8G 3HOWG 2HDLA 2MFIA 1VF5C 2HQLA 3CAMA 4HJ7A 4JI7Q 4B3RQ 1LABA 1CT1D 3ZYYX 1UWVA 2NYZD 3TP8A 5A2QL 1SE3A 3G48A 3F1ZA 1LT4D 4C3HB 1BF4A 1X55A 1RD9D 1GD7A 1QG7A 2AQ3B 2DNCA 3N6RA 1UEAB 4IUNA 1VQ4A 3GTOB 1VMPA 4DNRB 4DR2L 2K1BA 1X9NA 2O5IC 4C3IG 4P73A 3HOYH 1L2FA 5HGQA 5M3MH 1TU2B 1AH9A 1L1OB 5DM63 4A3GB 1TY0A 4A3FH 4PZ6A 5IODA 1C4QA 4ZRZA 5I6YA 4X6AH 1ZXTA 2KCTA 5CV7A 4X3TA 3I4NH 2B2YA 2DY7A 3TN2A 2JA7H 4OIJA 1E0BA 4KLKA 4OX9L 3PUYA 2G9HD 2NVXB 5DEHA 4A3LG 1XXGA 1A8VA 1QOHA 4MHEA 2A19A 2K14A
chains in the Genus database with same CATH topology
3D0FA 4QIWE 3CCUA 1EIYB 2CKZB 1BVSA 1EUJA 2ES2A 1N34L 2IT1A 2UUCL 4DV5L 4A3BG 4L5RC 4A3EH 1JMCA 1XMOL 3SGIA 4LFAQ 3K7UC 3HKSA 2F4VL 1AE2A 3KDFA 1XJVA 4OXPA 3M85A 4A4IA 1KQSA 1FGUA 1VQCA 5C4JH 2PI2A 3ULPA 4R4IA 1GKHA 3CPFA 1Z47A 2MO0A 4DR2Q 3J81j 1KAWA 1HZCA 4BA1I 3IRBA 3W1BA 4X64Q 4BBRH 1VQJA 3L0OA 3S24A 1OXUA 3CD6A 3ICEA 4LF5L 2HT1A 4OWXB 4WJ4A 3EN2A 5C4XH 3J80i 2JA5G 2BA0A 3GTOH 4POGA 3S16H 2QEXA 4DR1Q 3H0GG 2KCMA 5C3EH 3T1YL 1M1KC 3CXCA 1QVCA 3RZDH 1VQNA 2B63H 4KHPL 3S15H 4AH6A 1EYGA 2B63G 2VQEL 2E8GA 1KRSA 4B3ML 4AQYL 1WOCA 1P16A 1IBMQ 3S2DH 1YNXA 5JJKA 3DM3A 3I4MG 3AYHB 1QZGA 2KBNA 4OX9Q 3S2HH 1PFSA 3RLOA 1HNWQ 3E9IA 3CCQA 4NB3A 1Q82C 1VQIA 3JAMi 1PVOA 1FJGL 1X54A 2NVTH 4HIKA 5FLXc 2N78A 1IZ6A 3F2BA 1VQ5A 2H5XA 1KRTA 4C2MH 1UE7A 1QVFA 2UUCQ 4A3IH 1GO3E 1N34Q 4DV5Q 1X65A 4JI2L 4GKKQ 1IXRA 4JI3L 4A3IG 1XMOQ 4DR3L 3U50C 3KF8B 3S1RH 2CWPA 1HR0W 4IO9A 2F4VQ 1TWHH 1PH6A 5GQOA 5JEAG 3NENA 4JC0A 4MNOA 4QY7A 1HNXL 3GTPH 2L15A 4UY8C 1SMXA 4HIDA 2KENA 2F52A 3AQQA 1N36L 2R92G 2F3IA 4DAYB 3HOUG 2K4KA 3I7FA 2V1CC 4BY1G 3G4SA 3PO2H 3Q8DA 1MKHA 4R4CA 2AWNA 4LF5Q 4Y52H 1PH1A 3CP0A 3ERSX 2RHSB 4HJAA 1C9OA 2D0OA 4BY7G 4IFDJ 2VZAA 2IX1A 3TQYA 1Y1WG 5IP9H 1OXXK 1VCIA 5LMNW 1PV4A 5FJ8H 3T1YQ 2E2JH 3RZOH 4DUYL 1VQMA 1SFOH 4KHPQ 2EIFA 2VQEQ 2PQAB 4FDBA 2HHHL 2Q2TA 4B3MQ 4AQYQ 2AMCB 3GD7A 3TEHB 4GNXA 5IP7H 4A3CG 4L5TA 1JJGA 4GNXC 3CC4A 5C0XI 1G51A 4NXNL 2B3GA 1NBWA 3NEMA 1Q1EA 2N3SA 1X6OA 4JI8L 1NJIC 4DR4L 3D31A 1YVCA 4IFDI 2I5MX 4JBKA 1FJGQ 1NMGA 1E24A 4A93G 1I5FA 1N33L 4JCVE 2Q2HA 3RLNA 2BH2A 1YHAA 4UP8A 1PH7A 4JV5L 2VUMG 3BZKA 1Y1VH 4JI2Q 4YHHL 2R7ZG 3HKZG 4C3IH 4JI3Q 2NN6I 4L5SA 4DR3Q 4BXXG 4DR7L 4ALPA 4O0AA 4YCUA 4AYBG 1X56A 2R6GA 3GTKH 1Q86C 3U4VA 1HNXQ 2NVYH 1XNRL 1PYSB 4LFBL 2E2IH 3H3VH 3F2DA 1YI2A 1I3QH 1N36Q 4OO1I 1A62A 4DNIA 1VQLA 1QUQA 4C3JH 1SROA 3F2CA 2ZJPA 4UP9A 1CKMA 3J7ZC 1D8LA 1HH2P 2NZHA 2HIXA 3UDGA 1W2BA 2R93H 3PF5A 3GTMH 4GOPA 3K80C 4DUZL 2JA6H 3ULLA 4JBWA 4GOPC 1HR0L 3S17H 2UXDL 3M7NA 2OCEA 1NY4A 4IOCA 4DUYQ 4A3KG 1IBLL 2UU9L 4LF7L 2HHHQ 4LF6L 2VS1A 1JJ2A 3KLWA 2VQFL 4LUZA 4DV6L 2GVAA 4OWTB 1BKBA 1SRUA 2Q2IA 2A8VA 4NXNQ 4A3BH 4JI8Q 3OTOL 4DR4Q 1A63A 1OXTA 1CKNB 3DLLA 3AFPA 1WI5A 1HZBA 3FHWA 1K8GA 4DV1L 1EWIA 5LMNL 4R1JA 1PYBA 1YHBA 1N33Q 2Y0SG 4HJ8A 1TWCH 1XPUA 5IE8A 1MIUA 1K9MC 4JV5Q 3ULJA 4YHHQ 4IOAA 5K36G 2PI2E 1TXYA 4DR7Q 4JI5L 5JJIA 2IHFA 4K0KL 2Z0SA 2WB1E 3HOXG 1G6PA 2WFWA 1LM0A 1SLJA 3HOVG 3BU2A 4IJHA 2JA5H 1X3GA 1XNRQ 1UE1A 4LFBQ 3H0GH 1HZ9A 4AYBE 3A5UA 1PHJA 2K75A 1CUKA 3KDFB 2K52A 1HNZL 1TWAH 3I4MH 2OTJA 5DLQE 5GAHC 1VQEA 2ALYB 4DUZQ 1WJJA 2CWAA 3A0JA 1HR0Q 2E2HH 2UXDQ 4B3TL 2UU9Q 1E3PA 1IBLQ 2YV5A 4X66L 1PH9A 1HJPA 2K5VA 4GLAC 3WWVA 2I0QA 4LF6Q 4LF7Q 1XTDA 3FP9A 1OTCA 5ELOA 4LFCL 4IPCA 2VQFQ 4APVA 4DV6Q 2UUAL 2VNUD 2RF4A 1B8AA 1WCMG 3CPWA 3TREA 3H3VI 2JEAI 4JI4L 3CCVA 3RNUA 3OTOQ 3KJOA 4DV0L 3KYHC 4NXML 2NN6G 4OONA 3OYYA 2JA9A 5LMNQ 4DV1Q 1L0WA 1E1TA 4A3JG 1R9TH 2JJQA 2UXBL 4LUVA 3HFZB 2WAQG 5M5WH 4JI0L 1V9PA 2K5NA 3PO3G 1M90C 3CCRA 2R92H 4A3GG 4UPAA 4OWWB 1MJEA 1OXSC 2JK8A 4BY1H 4JG2A 4JI5Q 3HOUH 5AJ3L 1NTGA 4K0KQ 4OO1G 4PZ8A 4YWLA 1KIXA 2OTLA 4J15A 1K83H 1N9WA 4BY7H 2VW9A 5HY6A 4PMWA 1JB7A 4A3DG 1Y1WH 1CKOA 3A74A 4YWKA 4GKKL 2Z6KA 3E9HA 1W3SA 2Z6KC 3GO5A 4EX5A 4DV3L 1V1QA 3NELA 4RMFA 5FLMG 2PNHA 3RN2A 1KHIA 4HIOA 1J5EL 3KF6A 3H15A 1S40A 1HNZQ 3PF4A 4A3CH 3ER0A 4GN5A 4BBSG 4IPGA 2OWOA 3NBHB 4B3TQ 1I6HH 1J6QA 1TWGH 2K50A 2JA8G 4X66Q 5IYBG 5C44G 1QVGA 4A93H 2YTXA 2YYZA 4P75A 1PH8A 4LFCQ 5IYDG 2UUAQ 3J81c 2N8NA 3FKIG 2ZJRA 2A1AA 2IHEA 1UE6A 3AFQA 1I94L 2VUMH 3PCOB 4JI4Q 2JEBI 2R7ZH 2IX0A 1NMFA 1AE3A 1K0RA 1B70B 1WFQA 1T9HA 2ZTEA 3LGJA 5LMUL 4DV0Q 4BXXH 2UXCL 4L5QA 4GNXB 4NXMQ 4TQUS 2AWOA 1VQAA 1X3FA 4A3MG 1HZAA 3JAMc 5EAYA 1Q7YC 4JI0Q 4NPSA 3PUWA 1IBKL 1SE8A 1GM5A 4DV4L 3RN5A 4EQ5A 1XPOA 4GN4B 5M3FG 2ZTCA 5JEAJ 1Y14B 5GAEC 3CQZH 1L1OA 5AJ3Q 1E22A 3CC2A 1L1OC 1YBYA 4DR5L 2DGYA 3TS0A 1YJNA 3UE0A 1YITA 4LW1A 4JBJA 1VQPA 5M5YH 4PG3A 1UE5A 3GDEA 4DKAC 5IWAL 2PMZE 4LF9L 1KL9A 1VQ6A 4A3KH 1XMQL 2ASBA 1FL0A 3EBEA 4DV3Q 1Q1BA 4O2DA 4DK3C 3GTJH 2QA4A 4IPDA 3PGZA 3W1GA 3L2PA 1J5EQ 3CW2C 4DAMA 4HJ5A 1VQKA 3HOYG 1SR3A 5GAGC 2RCNA 4LWCA 2KHIA 2K5HA 1CSQA 4MTNA 5M3MG 1I50H 2JQOA 1QUQB 3CCLA 4QQBX 3KOJA 1E1OA 3UE1A 4A3FG 4GS3A 5GROA 4YY3L 4JI6L 2AKWB 3CMEA 4P74A 2YTYA 4HJ9A 4GOPB 1PH3A 2ZJQA 1VQ9A 1PH2A 3I4NG 1I94Q 3MEFA 3E0EA 2JA7G 2WP8J 2HIVA 3S1NH 1K3RA 4AIMA 3UDIA 3I56A 4DV7L 1K8AC 1C7YA 2E5LL 5LMUQ 4DR6L 2UXCQ 2MNAA 3PV0A 3HOXH 1VQOA 1VS0A 4POFA 4GLVB 1TWFH 4XTCS 3HOVH 1C0AA 4GKJL 2XGTA 3AEVA 3HKZE 1IBKQ 3PSIA 4KI0A 4DV4Q 1QZHA 3K81C 3MXNB 4X65L 3CC7A 2BA1A 3TRZA 4JI1L 2R7DA 4RG1A 1O7IA 1BBWA 1VQDA 2CCZA 2ATWA 1FVIA 4BA2I 3EIVA 3RLFA 2ZM6L 4DR5Q 4A3EG 4DV2L 2YU9H 3TS2A 3S1QH 1KXLA 2ID0A 4JOIA 4HIMA 1YZ6A 1GVPA 4JOIC 1EFWA 4IPHA 5IWAQ 3CCJA 1K73C 1VQ8A 4LF9Q 2CQOA 1E7ZA 1VQGA 3JC66 5C0XG 2EXDA 1XMQQ 4QGUA 1JJCB 1EQRA 3UDXA 4C3HH 2LXJA 1PH5A 3GTGH 4MZ9A 4H02A 3GTLH 4IFDG 2QGQA 2RHQB 1A0IA 4BBRG 1WCMH 1S72A 1PA6A 4B3SL 3M4OH 1N32L 3CMAA 3J7A5 5C4XG 4P72A 3W5OA 3J81i 3M4PA 3F8TA 1Q81C 3B6YA 1EQQA 4ME3A 2DUDA 5C3EG 1JT8A 2NZOA 2N49A 4YY3Q 4JI6Q 4A3JH 4R4OA 3CCEA 2FXQA 1YHQA 1Q12A 1S3OA 1YIJA 4B3RL 3U58A 4JI7L 3PO3H 3VDYA 3PIPA 2GVBA 1RL2A 1G291 2CFMA 4DV7Q 4A3GH 3I4OA 1VQFA 2E5LQ 4X62L 4DR6Q 3T1HL 3BZCA 3L7ZC 5IY0A 1Z9FA 2Y0SE 1UEBA 1CSPA 3K7AH 1U5KA 1ASZA 1WYDA 1XNQL 4GKJQ 3PIOA 4LNQA 2OQKA 4A3DH 3A5ZB 1IYJB 1Q8KA 1LYLA 4YCWA 5ELNA 1D7QA 4X65Q 2LXKA 1DGSA 4JI1Q 3CF5A 5FLMH 3M9BA 2NVXH 5JJLA 2VY3A 4QJFA 4LF4L 2ZM6Q 1BBUA 4DV2Q 2Q2UA 4BBSH 3STBD 1MJCA 2PQAA 5BR8L 1V43A 4YCVA 4LF8L 2UXBQ 2JA8H 2NVQH 3RR5A 5IYBH 2BH8A 3PUZA 5C44H 3J80c 5C0XJ 4A75A 2LSSA 1IL2A 4JYAL 5IYDH 2EQSA 3FKIH 2MQHA 1LTLA 4KHZA 3PUXA 4YWMA 3PO2G 1N32Q 4B3SQ 4JBMA 3K8AA 2IY5B 3G71A 2UUBL 1OXVA 1B7YB 1XPRA 3GTQH 3S1MH 1YEZA 3M3YH 3K0XA 4DPGA 2ZTDA 2D0PA 5IP9G 3KF6B 4R4QA 3STBC 5FJ8G 3HOWH 1PH4A 2VL6A 3HOWG 4A3MH 1ASYA 3G6EA 2MFIA 3CAMA 2HQLA 3UDFA 4HJ7A 5IP7G 1VQ7A 4JI7Q 4IJLA 4B3RQ 5M3FH 1UWVA 3U4ZA 3G48A 1VQHA 4X62Q 3F1ZA 3T1HQ 2GN5A 2WAQE 1RIPA 2YTVA 1XNQQ 4LFAL 1X55A 1EIFA 4XIGS 3KFUA 4LUOA 1NE3A 1GD7A 2WB1G 5IYCH 1VQ4A 3HOZH 3CCMA 4UP7A 1VQBA 5IYCG 3ZJYC 2KHJA 4DR2L 1U0LA 1X9NA 1Y1VG 4LF4Q 4P73A 1N8RC 4P71A 3HOYH 5H1SE 4X64L 5GADC 1YJ9A 1L2FA 2MO1A 3BJUA 5E7NA 5BR8Q 2R7FA 2D62A 4LF8Q 5HGQA 5M3MH 5J3BA 4Y7NH 3M4QA 2B29A 1Q46A 1L1OB 1AH9A 1X3EA 4DR1L 1P8LA 4PZ7A 4A3FH 3I2ZA 4PZ6A 3KJPA 4JYAQ 2XTIA 2JE6I 1EOVA 4DK6C 2AHOB 4X6AH 1CKNA 2KCTA 3S14H 1IBML 3PUVA 3I4NH 4WJ3M 2UUBQ 2R93G 2I5LX 1YJWA 2JA7H 3OW2A 2JA6G 4KLKA 4OX9L 3PUYA 3HOZG 1HNWL 4R4TA 3I55A 1LUZA 4A76A 2OQ0A 4A3LH 5IT9c 2I5HA 4GN3B 4QL5A 1SN8A 4GLXA 1KC8C 3CCSA 1KD1C 4A3LG 1H95A 1A8VA 1JE5A 4TVAB 2C35B 5M5XH 2A19A 2K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0F A;  4QIW E;  3CCU A;  1EIY B;  2CKZ B;  1BVS A;  1EUJ A;  2ES2 A;  1N34 L;  2IT1 A;  2UUC L;  4DV5 L;  4A3B G;  4L5R C;  4A3E H;  1JMC A;  1XMO L;  3SGI A;  4LFA Q;  3K7U C;  3HKS A;  2F4V L;  1AE2 A;  3KDF A;  1XJV A;  4OXP A;  3M85 A;  4A4I A;  1KQS A;  1FGU A;  1VQC A;  5C4J H;  2PI2 A;  3ULP A;  4R4I A;  1GKH A;  3CPF A;  1Z47 A;  2MO0 A;  4DR2 Q;  3J81 j;  1KAW A;  1HZC A;  4BA1 I;  3IRB A;  3W1B A;  4X64 Q;  4BBR H;  1VQJ A;  3L0O A;  3S24 A;  1OXU A;  3CD6 A;  3ICE A;  4LF5 L;  2HT1 A;  4OWX B;  4WJ4 A;  3EN2 A;  5C4X H;  3J80 i;  2JA5 G;  2BA0 A;  3GTO H;  4POG A;  3S16 H;  2QEX A;  4DR1 Q;  3H0G G;  2KCM A;  5C3E H;  3T1Y L;  1M1K C;  3CXC A;  1QVC A;  3RZD H;  1VQN A;  2B63 H;  4KHP L;  3S15 H;  4AH6 A;  1EYG A;  2B63 G;  2VQE L;  2E8G A;  1KRS A;  4B3M L;  4AQY L;  1WOC A;  1P16 A;  1IBM Q;  3S2D H;  1YNX A;  5JJK A;  3DM3 A;  3I4M G;  3AYH B;  1QZG A;  2KBN A;  4OX9 Q;  3S2H H;  1PFS A;  3RLO A;  1HNW Q;  3E9I A;  3CCQ A;  4NB3 A;  1Q82 C;  1VQI A;  3JAM i;  1PVO A;  1FJG L;  1X54 A;  2NVT H;  4HIK A;  5FLX c;  2N78 A;  1IZ6 A;  3F2B A;  1VQ5 A;  2H5X A;  1KRT A;  4C2M H;  1UE7 A;  1QVF A;  2UUC Q;  4A3I H;  1GO3 E;  1N34 Q;  4DV5 Q;  1X65 A;  4JI2 L;  4GKK Q;  1IXR A;  4JI3 L;  4A3I G;  1XMO Q;  4DR3 L;  3U50 C;  3KF8 B;  3S1R H;  2CWP A;  1HR0 W;  4IO9 A;  2F4V Q;  1TWH H;  1PH6 A;  5GQO A;  5JEA G;  3NEN A;  4JC0 A;  4MNO A;  4QY7 A;  1HNX L;  3GTP H;  2L15 A;  4UY8 C;  1SMX A;  4HID A;  2KEN A;  2F52 A;  3AQQ A;  1N36 L;  2R92 G;  2F3I A;  4DAY B;  3HOU G;  2K4K A;  3I7F A;  2V1C C;  4BY1 G;  3G4S A;  3PO2 H;  3Q8D A;  1MKH A;  4R4C A;  2AWN A;  4LF5 Q;  4Y52 H;  1PH1 A;  3CP0 A;  3ERS X;  2RHS B;  4HJA A;  1C9O A;  2D0O A;  4BY7 G;  4IFD J;  2VZA A;  2IX1 A;  3TQY A;  1Y1W G;  5IP9 H;  1OXX K;  1VCI A;  5LMN W;  1PV4 A;  5FJ8 H;  3T1Y Q;  2E2J H;  3RZO H;  4DUY L;  1VQM A;  1SFO H;  4KHP Q;  2EIF A;  2VQE Q;  2PQA B;  4FDB A;  2HHH L;  2Q2T A;  4B3M Q;  4AQY Q;  2AMC B;  3GD7 A;  3TEH B;  4GNX A;  5IP7 H;  4A3C G;  4L5T A;  1JJG A;  4GNX C;  3CC4 A;  5C0X I;  1G51 A;  4NXN L;  2B3G A;  1NBW A;  3NEM A;  1Q1E A;  2N3S A;  1X6O A;  4JI8 L;  1NJI C;  4DR4 L;  3D31 A;  1YVC A;  4IFD I;  2I5M X;  4JBK A;  1FJG Q;  1NMG A;  1E24 A;  4A93 G;  1I5F A;  1N33 L;  4JCV E;  2Q2H A;  3RLN A;  2BH2 A;  1YHA A;  4UP8 A;  1PH7 A;  4JV5 L;  2VUM G;  3BZK A;  1Y1V H;  4JI2 Q;  4YHH L;  2R7Z G;  3HKZ G;  4C3I H;  4JI3 Q;  2NN6 I;  4L5S A;  4DR3 Q;  4BXX G;  4DR7 L;  4ALP A;  4O0A A;  4YCU A;  4AYB G;  1X56 A;  2R6G A;  3GTK H;  1Q86 C;  3U4V A;  1HNX Q;  2NVY H;  1XNR L;  1PYS B;  4LFB L;  2E2I H;  3H3V H;  3F2D A;  1YI2 A;  1I3Q H;  1N36 Q;  4OO1 I;  1A62 A;  4DNI A;  1VQL A;  1QUQ A;  4C3J H;  1SRO A;  3F2C A;  2ZJP A;  4UP9 A;  1CKM A;  3J7Z C;  1D8L A;  1HH2 P;  2NZH A;  2HIX A;  3UDG A;  1W2B A;  2R93 H;  3PF5 A;  3GTM H;  4GOP A;  3K80 C;  4DUZ L;  2JA6 H;  3ULL A;  4JBW A;  4GOP C;  1HR0 L;  3S17 H;  2UXD L;  3M7N A;  2OCE A;  1NY4 A;  4IOC A;  4DUY Q;  4A3K G;  1IBL L;  2UU9 L;  4LF7 L;  2HHH Q;  4LF6 L;  2VS1 A;  1JJ2 A;  3KLW A;  2VQF L;  4LUZ A;  4DV6 L;  2GVA A;  4OWT B;  1BKB A;  1SRU A;  2Q2I A;  2A8V A;  4NXN Q;  4A3B H;  4JI8 Q;  3OTO L;  4DR4 Q;  1A63 A;  1OXT A;  1CKN B;  3DLL A;  3AFP A;  1WI5 A;  1HZB A;  3FHW A;  1K8G A;  4DV1 L;  1EWI A;  5LMN L;  4R1J A;  1PYB A;  1YHB A;  1N33 Q;  2Y0S G;  4HJ8 A;  1TWC H;  1XPU A;  5IE8 A;  1MIU A;  1K9M C;  4JV5 Q;  3ULJ A;  4YHH Q;  4IOA A;  5K36 G;  2PI2 E;  1TXY A;  4DR7 Q;  4JI5 L;  5JJI A;  2IHF A;  4K0K L;  2Z0S A;  2WB1 E;  3HOX G;  1G6P A;  2WFW A;  1LM0 A;  1SLJ A;  3HOV G;  3BU2 A;  4IJH A;  2JA5 H;  1X3G A;  1XNR Q;  1UE1 A;  4LFB Q;  3H0G H;  1HZ9 A;  4AYB E;  3A5U A;  1PHJ A;  2K75 A;  1CUK A;  3KDF B;  2K52 A;  1HNZ L;  1TWA H;  3I4M H;  2OTJ A;  5DLQ E;  5GAH C;  1VQE A;  2ALY B;  4DUZ Q;  1WJJ A;  2CWA A;  3A0J A;  1HR0 Q;  2E2H H;  2UXD Q;  4B3T L;  2UU9 Q;  1E3P A;  1IBL Q;  2YV5 A;  4X66 L;  1PH9 A;  1HJP A;  2K5V A;  4GLA C;  3WWV A;  2I0Q A;  4LF6 Q;  4LF7 Q;  1XTD A;  3FP9 A;  1OTC A;  5ELO A;  4LFC L;  4IPC A;  2VQF Q;  4APV A;  4DV6 Q;  2UUA L;  2VNU D;  2RF4 A;  1B8A A;  1WCM G;  3CPW A;  3TRE A;  3H3V I;  2JEA I;  4JI4 L;  3CCV A;  3RNU A;  3OTO Q;  3KJO A;  4DV0 L;  3KYH C;  4NXM L;  2NN6 G;  4OON A;  3OYY A;  2JA9 A;  5LMN Q;  4DV1 Q;  1L0W A;  1E1T A;  4A3J G;  1R9T H;  2JJQ A;  2UXB L;  4LUV A;  3HFZ B;  2WAQ G;  5M5W H;  4JI0 L;  1V9P A;  2K5N A;  3PO3 G;  1M90 C;  3CCR A;  2R92 H;  4A3G G;  4UPA A;  4OWW B;  1MJE A;  1OXS C;  2JK8 A;  4BY1 H;  4JG2 A;  4JI5 Q;  3HOU H;  5AJ3 L;  1NTG A;  4K0K Q;  4OO1 G;  4PZ8 A;  4YWL A;  1KIX A;  2OTL A;  4J15 A;  1K83 H;  1N9W A;  4BY7 H;  2VW9 A;  5HY6 A;  4PMW A;  1JB7 A;  4A3D G;  1Y1W H;  1CKO A;  3A74 A;  4YWK A;  4GKK L;  2Z6K A;  3E9H A;  1W3S A;  2Z6K C;  3GO5 A;  4EX5 A;  4DV3 L;  1V1Q A;  3NEL A;  4RMF A;  5FLM G;  2PNH A;  3RN2 A;  1KHI A;  4HIO A;  1J5E L;  3KF6 A;  3H15 A;  1S40 A;  1HNZ Q;  3PF4 A;  4A3C H;  3ER0 A;  4GN5 A;  4BBS G;  4IPG A;  2OWO A;  3NBH B;  4B3T Q;  1I6H H;  1J6Q A;  1TWG H;  2K50 A;  2JA8 G;  4X66 Q;  5IYB G;  5C44 G;  1QVG A;  4A93 H;  2YTX A;  2YYZ A;  4P75 A;  1PH8 A;  4LFC Q;  5IYD G;  2UUA Q;  3J81 c;  2N8N A;  3FKI G;  2ZJR A;  2A1A A;  2IHE A;  1UE6 A;  3AFQ A;  1I94 L;  2VUM H;  3PCO B;  4JI4 Q;  2JEB I;  2R7Z H;  2IX0 A;  1NMF A;  1AE3 A;  1K0R A;  1B70 B;  1WFQ A;  1T9H A;  2ZTE A;  3LGJ A;  5LMU L;  4DV0 Q;  4BXX H;  2UXC L;  4L5Q A;  4GNX B;  4NXM Q;  4TQU S;  2AWO A;  1VQA A;  1X3F A;  4A3M G;  1HZA A;  3JAM c;  5EAY A;  1Q7Y C;  4JI0 Q;  4NPS A;  3PUW A;  1IBK L;  1SE8 A;  1GM5 A;  4DV4 L;  3RN5 A;  4EQ5 A;  1XPO A;  4GN4 B;  5M3F G;  2ZTC A;  5JEA J;  1Y14 B;  5GAE C;  3CQZ H;  1L1O A;  5AJ3 Q;  1E22 A;  3CC2 A;  1L1O C;  1YBY A;  4DR5 L;  2DGY A;  3TS0 A;  1YJN A;  3UE0 A;  1YIT A;  4LW1 A;  4JBJ A;  1VQP A;  5M5Y H;  4PG3 A;  1UE5 A;  3GDE A;  4DKA C;  5IWA L;  2PMZ E;  4LF9 L;  1KL9 A;  1VQ6 A;  4A3K H;  1XMQ L;  2ASB A;  1FL0 A;  3EBE A;  4DV3 Q;  1Q1B A;  4O2D A;  4DK3 C;  3GTJ H;  2QA4 A;  4IPD A;  3PGZ A;  3W1G A;  3L2P A;  1J5E Q;  3CW2 C;  4DAM A;  4HJ5 A;  1VQK A;  3HOY G;  1SR3 A;  5GAG C;  2RCN A;  4LWC A;  2KHI A;  2K5H A;  1CSQ A;  4MTN A;  5M3M G;  1I50 H;  2JQO A;  1QUQ B;  3CCL A;  4QQB X;  3KOJ A;  1E1O A;  3UE1 A;  4A3F G;  4GS3 A;  5GRO A;  4YY3 L;  4JI6 L;  2AKW B;  3CME A;  4P74 A;  2YTY A;  4HJ9 A;  4GOP B;  1PH3 A;  2ZJQ A;  1VQ9 A;  1PH2 A;  3I4N G;  1I94 Q;  3MEF A;  3E0E A;  2JA7 G;  2WP8 J;  2HIV A;  3S1N H;  1K3R A;  4AIM A;  3UDI A;  3I56 A;  4DV7 L;  1K8A C;  1C7Y A;  2E5L L;  5LMU Q;  4DR6 L;  2UXC Q;  2MNA A;  3PV0 A;  3HOX H;  1VQO A;  1VS0 A;  4POF A;  4GLV B;  1TWF H;  4XTC S;  3HOV H;  1C0A A;  4GKJ L;  2XGT A;  3AEV A;  3HKZ E;  1IBK Q;  3PSI A;  4KI0 A;  4DV4 Q;  1QZH A;  3K81 C;  3MXN B;  4X65 L;  3CC7 A;  2BA1 A;  3TRZ A;  4JI1 L;  2R7D A;  4RG1 A;  1O7I A;  1BBW A;  1VQD A;  2CCZ A;  2ATW A;  1FVI A;  4BA2 I;  3EIV A;  3RLF A;  2ZM6 L;  4DR5 Q;  4A3E G;  4DV2 L;  2YU9 H;  3TS2 A;  3S1Q H;  1KXL A;  2ID0 A;  4JOI A;  4HIM A;  1YZ6 A;  1GVP A;  4JOI C;  1EFW A;  4IPH A;  5IWA Q;  3CCJ A;  1K73 C;  1VQ8 A;  4LF9 Q;  2CQO A;  1E7Z A;  1VQG A;  3JC6 6;  5C0X G;  2EXD A;  1XMQ Q;  4QGU A;  1JJC B;  1EQR A;  3UDX A;  4C3H H;  2LXJ A;  1PH5 A;  3GTG H;  4MZ9 A;  4H02 A;  3GTL H;  4IFD G;  2QGQ A;  2RHQ B;  1A0I A;  4BBR G;  1WCM H;  1S72 A;  1PA6 A;  4B3S L;  3M4O H;  1N32 L;  3CMA A;  3J7A 5;  5C4X G;  4P72 A;  3W5O A;  3J81 i;  3M4P A;  3F8T A;  1Q81 C;  3B6Y A;  1EQQ A;  4ME3 A;  2DUD A;  5C3E G;  1JT8 A;  2NZO A;  2N49 A;  4YY3 Q;  4JI6 Q;  4A3J H;  4R4O A;  3CCE A;  2FXQ A;  1YHQ A;  1Q12 A;  1S3O A;  1YIJ A;  4B3R L;  3U58 A;  4JI7 L;  3PO3 H;  3VDY A;  3PIP A;  2GVB A;  1RL2 A;  1G29 1;  2CFM A;  4DV7 Q;  4A3G H;  3I4O A;  1VQF A;  2E5L Q;  4X62 L;  4DR6 Q;  3T1H L;  3BZC A;  3L7Z C;  5IY0 A;  1Z9F A;  2Y0S E;  1UEB A;  1CSP A;  3K7A H;  1U5K A;  1ASZ A;  1WYD A;  1XNQ L;  4GKJ Q;  3PIO A;  4LNQ A;  2OQK A;  4A3D H;  3A5Z B;  1IYJ B;  1Q8K A;  1LYL A;  4YCW A;  5ELN A;  1D7Q A;  4X65 Q;  2LXK A;  1DGS A;  4JI1 Q;  3CF5 A;  5FLM H;  3M9B A;  2NVX H;  5JJL A;  2VY3 A;  4QJF A;  4LF4 L;  2ZM6 Q;  1BBU A;  4DV2 Q;  2Q2U A;  4BBS H;  3STB D;  1MJC A;  2PQA A;  5BR8 L;  1V43 A;  4YCV A;  4LF8 L;  2UXB Q;  2JA8 H;  2NVQ H;  3RR5 A;  5IYB H;  2BH8 A;  3PUZ A;  5C44 H;  3J80 c;  5C0X J;  4A75 A;  2LSS A;  1IL2 A;  4JYA L;  5IYD H;  2EQS A;  3FKI H;  2MQH A;  1LTL A;  4KHZ A;  3PUX A;  4YWM A;  3PO2 G;  1N32 Q;  4B3S Q;  4JBM A;  3K8A A;  2IY5 B;  3G71 A;  2UUB L;  1OXV A;  1B7Y B;  1XPR A;  3GTQ H;  3S1M H;  1YEZ A;  3M3Y H;  3K0X A;  4DPG A;  2ZTD A;  2D0P A;  5IP9 G;  3KF6 B;  4R4Q A;  3STB C;  5FJ8 G;  3HOW H;  1PH4 A;  2VL6 A;  3HOW G;  4A3M H;  1ASY A;  3G6E A;  2MFI A;  3CAM A;  2HQL A;  3UDF A;  4HJ7 A;  5IP7 G;  1VQ7 A;  4JI7 Q;  4IJL A;  4B3R Q;  5M3F H;  1UWV A;  3U4Z A;  3G48 A;  1VQH A;  4X62 Q;  3F1Z A;  3T1H Q;  2GN5 A;  2WAQ E;  1RIP A;  2YTV A;  1XNQ Q;  4LFA L;  1X55 A;  1EIF A;  4XIG S;  3KFU A;  4LUO A;  1NE3 A;  1GD7 A;  2WB1 G;  5IYC H;  1VQ4 A;  3HOZ H;  3CCM A;  4UP7 A;  1VQB A;  5IYC G;  3ZJY C;  2KHJ A;  4DR2 L;  1U0L A;  1X9N A;  1Y1V G;  4LF4 Q;  4P73 A;  1N8R C;  4P71 A;  3HOY H;  5H1S E;  4X64 L;  5GAD C;  1YJ9 A;  1L2F A;  2MO1 A;  3BJU A;  5E7N A;  5BR8 Q;  2R7F A;  2D62 A;  4LF8 Q;  5HGQ A;  5M3M H;  5J3B A;  4Y7N H;  3M4Q A;  2B29 A;  1Q46 A;  1L1O B;  1AH9 A;  1X3E A;  4DR1 L;  1P8L A;  4PZ7 A;  4A3F H;  3I2Z A;  4PZ6 A;  3KJP A;  4JYA Q;  2XTI A;  2JE6 I;  1EOV A;  4DK6 C;  2AHO B;  4X6A H;  1CKN A;  2KCT A;  3S14 H;  1IBM L;  3PUV A;  3I4N H;  4WJ3 M;  2UUB Q;  2R93 G;  2I5L X;  1YJW A;  2JA7 H;  3OW2 A;  2JA6 G;  4KLK A;  4OX9 L;  3PUY A;  3HOZ G;  1HNW L;  4R4T A;  3I55 A;  1LUZ A;  4A76 A;  2OQ0 A;  4A3L H;  5IT9 c;  2I5H A;  4GN3 B;  4QL5 A;  1SN8 A;  4GLX A;  1KC8 C;  3CCS A;  1KD1 C;  4A3L G;  1H95 A;  1A8V A;  1JE5 A;  4TVA B;  2C35 B;  5M5X H;  2A19 A;  2K14 A; 
#chains in the Genus database with same CATH topology
 4TRD A;  3CCU A;  3ERO A;  1BCP C;  1BVS A;  1EUJ A;  1IYU A;  4DV5 L;  1B1Z A;  1KDA A;  1XMO L;  3OIQ A;  4LFA Q;  2F4V L;  3KDF A;  1XJV A;  4OXP A;  4KMU C;  1I4G A;  1GUS A;  5C4J H;  3W2D A;  1I4Q A;  5D65 A;  3URY A;  1EIG A;  3HOW B;  2CH4 W;  3IRB A;  1RCV D;  4IFD H;  4X64 Q;  4BBR H;  4A3M B;  2RDF A;  1OXU A;  3ICE A;  1SNO A;  4WJW A;  4WJ4 A;  2H4O A;  3J80 i;  4DR1 Q;  3RZD H;  2B63 H;  4KHP L;  1EYG A;  1KRS A;  4AQY L;  5C4H A;  1P16 A;  1IBM Q;  1YNX A;  1WTP A;  3D4D A;  3I4M G;  1V1O A;  3HOZ B;  1AP0 A;  2KBN A;  3RLO A;  1HNW Q;  5BN4 A;  2F0O A;  3E9I A;  3TP5 A;  2JN4 A;  2JYO A;  4C3I B;  5CV5 A;  1FJG L;  1PTO B;  1JOK A;  3HP3 A;  1Q8I A;  1HTP A;  2Q8T A;  1KRT A;  4PQX A;  1UE7 A;  2UUC Q;  1SDF A;  1U4L A;  2F0E A;  4JI2 L;  1WTQ A;  1R4P B;  3KF8 B;  3S14 B;  5EKL A;  5JEA G;  4MNO A;  2EYF A;  4FP5 D;  4QY7 A;  1ROD A;  1Z7T A;  4HID A;  2K6A A;  3S17 B;  3T16 A;  3AQQ A;  2EYP A;  2R92 G;  3HOU G;  2K4K A;  4BY1 G;  1SYG A;  2V1C C;  4K5V A;  1MKH A;  1LT5 D;  3HS0 C;  2RKS A;  1Z6H A;  2D0O A;  3A55 A;  2E2J H;  4DUY L;  4FF1 A;  3I8Z A;  2I07 B;  3T56 B;  1NAP A;  2AMC B;  2BCO A;  4L5T A;  1E2Z A;  4NXN L;  4K14 A;  3J7Y W;  1Q1E A;  2N3S A;  1X6O A;  4JI8 L;  4E6I A;  5FLX E;  3A8K E;  1TY2 A;  4IFD I;  1E24 A;  1H9R A;  2F0T A;  3C2P A;  2BOS A;  4Q0F A;  2KED A;  1YHA A;  4UP8 A;  2L5T A;  2KCN A;  1Y1V H;  3BZK A;  3ND9 A;  2R7Z G;  1I4P A;  2NN6 I;  3Q23 A;  1LTR D;  4L5S A;  4O0A A;  5KNB A;  4AYB G;  2PZW A;  1TR5 A;  3D3R A;  3I4M B;  3S2D B;  3LWU A;  1HNX Q;  3D4R A;  3SXH A;  4OO1 I;  1I3Q H;  1VQL A;  4C3J H;  4S3S A;  1JOO A;  1W2B A;  1CKM A;  1HH2 P;  2NZH A;  4RGO S;  3PF5 A;  3GTM H;  4R8N A;  3MZ5 A;  4JBW A;  1NY4 A;  4A3K G;  2VB2 X;  1KNE A;  4LF6 L;  2HHH Q;  1MBY A;  1JJ2 A;  4DV6 L;  3TSS A;  1JC7 A;  2PNR C;  2GVA A;  1BKB A;  1MI2 A;  3GTP B;  1BUV T;  1F2M A;  1H9M A;  4A3B H;  1MHW C;  1S5D D;  2R92 B;  3OTO L;  4DR4 Q;  3HOU B;  1A63 A;  4BY1 B;  3AFP A;  2SEB D;  2EYM A;  2XSC A;  4DV1 L;  4R1J A;  3E6Z X;  2K01 A;  1YHB A;  4ZLT F;  1TWC H;  4O1N A;  2PQE A;  1MIU A;  5IE8 A;  3ULJ A;  4RFB A;  3T4A C;  4IOA A;  2PI2 E;  1K8M A;  4DR7 Q;  2Z0S A;  2WB1 E;  3QIA A;  3KLS A;  1SLJ A;  1KLU D;  2X69 A;  3HOV G;  4G7O C;  3BU2 A;  5T1I A;  4DGZ A;  5EBC A;  4FYD A;  1PHJ A;  4AYB E;  5J39 A;  1DOK A;  2F0H A;  1B3A A;  5CV4 A;  5FKA C;  1V8Q A;  5ELC A;  2OTJ A;  2WB1 B;  1VQE A;  1WJJ A;  1CA6 A;  1HR0 Q;  1HCZ A;  3V05 A;  2XNA C;  3BG3 A;  1IBL Q;  4X3U A;  4KKU A;  1PH9 A;  1G2T A;  1VMC A;  4AYB B;  1XTD A;  2AQ2 B;  4LF7 Q;  4LFC L;  1DJR D;  2F3V A;  1SE2 A;  2B2U C;  1D6E C;  1WCM G;  5EKI A;  3CPW A;  3GTK B;  3CCV A;  2KCC A;  2E2I B;  5I6W A;  2PZT A;  4NXM L;  1SAP A;  2JA9 A;  1GHK A;  1HHV A;  4A3J G;  1E1T A;  4LUV A;  3HFZ B;  5M5W H;  2K5N A;  3PO3 G;  2JA6 B;  2IJ0 A;  3CCR A;  4BWG B;  4JI5 Q;  4JG2 A;  4WFN 3;  5AJ3 L;  1NTG A;  4PZ8 A;  3BYT B;  1KIX A;  4BY7 H;  3OIP A;  4GKK L;  4GZY C;  1ZEQ X;  3GO5 A;  3M7G A;  4DV3 L;  1SSO A;  1V1Q A;  1STN A;  1KHI A;  4A3C H;  1O80 A;  4PMC A;  1G8Z D;  1LV9 A;  2F0M A;  2Z1C A;  3BDL A;  3F2U A;  1I6H H;  1TWG H;  2K50 A;  2JA8 G;  3K5L A;  3SK4 A;  1DYQ A;  5C44 G;  2YTX A;  2YYZ A;  5IYD G;  3J81 c;  1QNU A;  2N8N A;  3Q24 A;  2A1A A;  1UE6 A;  3V2T A;  4J6H A;  5IGC A;  3PCO B;  1TS5 A;  2JEB I;  1NMF A;  1K0R A;  2BDN A;  1WFQ A;  1T9H A;  4DV0 Q;  4BXX H;  4L5Q A;  3MFG A;  2AWO A;  1X3F A;  1SYC A;  4JI0 Q;  1H9K A;  1IBK L;  1GM5 A;  4DV4 L;  2WKD A;  3I4L A;  4QB4 A;  1PFN A;  2R3Z A;  5JEA J;  1NUC A;  2PW5 A;  1L1O A;  4JW0 A;  2DGY A;  1CM9 A;  4XXE A;  2PYK A;  1WCM B;  4LW1 A;  1DM0 B;  5M5Y H;  4LF9 L;  3I72 A;  2PMZ E;  1CQF A;  2A6H C;  2OT2 A;  3W1G A;  1K0S A;  3ITP A;  4DAM A;  4HJ5 A;  1VQK A;  1EFI D;  3HOY G;  3HEJ A;  1SR3 A;  2GA4 B;  2K5H A;  2CVR A;  1YNJ D;  5COY A;  4G57 A;  3VA7 A;  5M3M G;  3NSW A;  1QUQ B;  2HCI A;  1E1O A;  3MTS A;  4A3F G;  2PMZ B;  4GS3 A;  2AKW B;  2YTY A;  1B3Q A;  1L0X B;  2ZJQ A;  3I4N G;  1I94 Q;  4RCN A;  2JA7 G;  3OMC A;  2LS0 1;  4AIM A;  2QDL A;  3UDI A;  4DV7 L;  2K5W A;  4CJ1 B;  3S1N H;  2UXC Q;  5LMU Q;  5G3L F;  1VS0 A;  1BO0 A;  4POF A;  4JVZ A;  1C0A A;  2XGT A;  1SNC A;  1QZH A;  3MXN B;  2JA8 B;  1LT6 D;  2BA1 A;  3P1H A;  1PTO D;  2CCZ A;  1FVI A;  4BA2 I;  1EL0 A;  3RLF A;  4DR5 Q;  3S1Q H;  2YU9 H;  4A93 B;  4DAP A;  2EY5 A;  1GVP A;  3GTQ B;  5IWA Q;  2VUM B;  3M3Y B;  2CQO A;  1E7Z A;  3JC6 6;  2KHS A;  5CGK A;  3C46 A;  1JJC B;  1EQR A;  4CJ0 B;  2NUC A;  1PH5 A;  3GTG H;  3TP6 A;  4IFD G;  4BBR G;  4B3S L;  4IUU A;  4RHR A;  1AZP A;  4HSP A;  5IGG A;  2A74 C;  4P72 A;  3J81 i;  3M4P A;  3F8T A;  1Q81 C;  1I6V C;  1A3U A;  3CQZ B;  2NZO A;  3BS1 A;  4R4O A;  3KF8 A;  1Q12 A;  5FO8 B;  2HD3 A;  4B3R L;  4JI7 L;  4HR7 B;  5DAU A;  1G29 1;  2CFM A;  3KLS X;  1STG A;  2E5L Q;  3SK8 A;  2RBM A;  3L7Z C;  3RUZ A;  3K7A H;  2Y0S E;  4L63 B;  1CSP A;  1TKW B;  1WYD A;  2XWB B;  5IT9 L;  3HOY B;  1NNX A;  3N52 A;  1S5C D;  1EEI D;  1LYL A;  5M3M B;  4KKT A;  3IFD A;  1GJX A;  1DGS A;  2OEO A;  4EQO A;  2RDG A;  5C6A A;  3CF5 A;  3BZD B;  5JJL A;  2B39 A;  3BVG A;  2Q8I B;  4BBS H;  3MWY W;  2Y0S B;  3I4N B;  1F9P A;  1A2U A;  2NVQ H;  3MEH A;  1DON A;  2BE5 D;  5C0X J;  3K58 A;  4KHZ A;  1N32 Q;  1JWM D;  2J0T D;  1OXV A;  1DD2 A;  1YEZ A;  4RGN A;  2M2L A;  1J9O A;  4DPG A;  3STB C;  2VL6 A;  2DY8 A;  4XDX A;  3UDF A;  1D5Z C;  2XVS A;  1RF2 D;  4TSS A;  3T1H Q;  3HZX A;  2RQX A;  1RIP A;  2YTV A;  1QCB D;  4LFA L;  2NTS A;  5CBA E;  4XIG S;  2F0D A;  3KFU A;  1NE3 A;  2A6E D;  4K5X A;  3NTH A;  4ZYS A;  4UP7 A;  5IYC G;  1EZ6 A;  4N9T A;  1U0L A;  2MHV A;  3OOC A;  1Y1V G;  3Q22 A;  4P71 A;  4X64 L;  5GAD C;  3KLR A;  2MO1 A;  2TSS A;  4DN4 M;  5E7N A;  2FMC A;  4LF8 Q;  2D2C C;  5J3B A;  3MXP A;  2B29 A;  1Q46 A;  4IN3 A;  4DR1 L;  4PZ7 A;  3I2Z A;  1TII D;  3KJP A;  4JYA Q;  1HUN A;  5ISR A;  1EOV A;  2AHO B;  2E75 C;  3E3X A;  4C3J G;  2IX3 A;  1IBM L;  3PUV A;  2E76 C;  2I5L X;  1YJW A;  2B2Y C;  3AMU A;  3OW2 A;  1HNW L;  2OQ0 A;  4WRD A;  3U9O A;  5IT9 c;  3JAM E;  1KD1 C;  1SN8 A;  2K03 A;  1STH A;  3CCS A;  4FF2 A;  1H95 A;  1FNV A;  2D5D A;  2C35 B;  3M4Y A;  4TVA B;  3NK9 A;  1ENC A;  1ET6 A;  2UUC L;  2IT1 A;  4A3B G;  1LAC A;  4A3E H;  1JMC A;  3SGI A;  2K28 A;  1FGB D;  3FKI B;  1QNK A;  1T5E A;  3M85 A;  1FGU A;  2PI2 A;  3J7A V;  5EBD A;  2EJG C;  4OEM B;  1HZC A;  1DCZ A;  3OW7 A;  1GUG A;  1JR0 D;  1VQJ A;  2HT1 A;  3EN2 A;  2BA0 A;  3R3O A;  2F0L A;  4H0L C;  1SXT A;  2QEX A;  2KCM A;  5C3E H;  1M1K C;  2AUJ D;  1QVC A;  3CXC A;  1IKM A;  3S15 H;  4AH6 A;  3MA2 B;  1EY8 A;  1B9M A;  4DFA A;  3AYH B;  4ZKB B;  1M8A A;  1NR4 A;  3S2H H;  1Y1V B;  4C1N I;  1CHP D;  3CCQ A;  3QG1 A;  4C2M H;  3H91 A;  4Z9C B;  1X65 A;  1IXR A;  4A3I G;  3S1R H;  5FOB B;  2CWP A;  1DZ1 A;  1FNU A;  4IO9 A;  3HG9 A;  1TWH H;  1PH6 A;  1HNX L;  3D6W A;  1SMX A;  1ONL A;  1PRT F;  2F52 A;  3L3O C;  1F9Q A;  3I7F A;  1PMR A;  4CDD C;  1M4V A;  3PO2 H;  4LF5 Q;  4NDX A;  5M5X B;  1PH1 A;  4MIU A;  1OO9 B;  4WOR A;  4HJA A;  4BY7 G;  4IFD J;  1JOQ A;  2VZA A;  3TQY A;  3RZO H;  1OXX K;  4A3B B;  1JE4 A;  1QJO A;  5CYU A;  1SFO H;  2EIF A;  1CTM A;  2VQE Q;  4B3M Q;  2HHH L;  2RCF A;  4A3C G;  2L1B A;  1DOL A;  3H94 A;  5C0X I;  3A7A B;  3NEM A;  4DR4 L;  5HGT A;  4JBK A;  1NMG A;  4IQZ A;  3H6M A;  3RLN A;  1TS3 A;  1PH7 A;  1HA6 A;  3IFT A;  3VYS A;  3TBI B;  4CKE A;  3HKZ G;  4CGY B;  4JI3 Q;  3SEB A;  1WTH A;  4BXX G;  4DR3 Q;  4DR7 L;  4ALP A;  1NR2 A;  4YCU A;  1SYB A;  2R6G A;  3FVQ A;  4CJ2 C;  1Q86 C;  3U4V A;  3H3V H;  1S5B D;  5E3F A;  2NWG A;  1N36 Q;  1QUQ A;  4IUQ A;  3F2C A;  3BVZ A;  1SJE D;  5LHY 1;  1HR0 L;  3DWQ A;  3NWT A;  4KY5 A;  2XN9 C;  2OCE A;  4IOC A;  3FPP A;  3RMH A;  4A3I B;  2L4N A;  1IBL L;  4LF7 L;  2VS1 A;  2E74 C;  2O5J C;  3KLW A;  4LUZ A;  2K05 A;  3BVM A;  1SRU A;  2Q2I A;  1PZJ D;  3NQT A;  3MXN A;  1CKN B;  4ZUI A;  5EPK A;  4DK1 A;  3DLL A;  1WI5 A;  5L37 A;  2IWH A;  3NHH A;  3PIP 3;  1F9S A;  4ULL A;  3TZD A;  1TXY A;  4JI5 L;  5JJI A;  2IHF A;  1HTL D;  1SMY D;  2WFW A;  1LM0 A;  5ELE A;  1XNR Q;  3JAM L;  4LFB Q;  2F0J A;  3H0G H;  1HZ9 A;  1I6H B;  2NBF A;  1CUK A;  3DWP A;  2K52 A;  1TWA H;  1IHZ A;  2QKI C;  4UHV A;  4RAU C;  2ALY B;  2E2H H;  2UXD Q;  3A0J A;  5C3X A;  2UU9 Q;  1E3P A;  3WOF A;  3WWV A;  4GLA C;  4KV6 A;  3FP9 A;  5ELO A;  2VQF Q;  4IPC A;  4APV A;  1BDO A;  2OF1 A;  2MUY A;  3H3V I;  2NVY B;  2JEA I;  4EVO A;  1S5F D;  1RDP D;  1A3V A;  4DV0 L;  3KYH C;  4LMQ D;  5KGU A;  5LMN Q;  3HRZ C;  2JJQ A;  2WAQ G;  4JI0 L;  1SNM A;  1CI3 M;  1V9P A;  1SEB D;  5M5Y B;  3MFY A;  4XQJ A;  1M90 C;  3MHB A;  5EPJ A;  4UPA A;  2Z4H A;  1MJE A;  2N55 A;  4X3K A;  1EY6 A;  3L9A X;  4J15 A;  1K83 H;  1N9W A;  2XRQ D;  4C56 C;  1Y1W H;  1A2T A;  1CKO A;  1UNS A;  1D1I A;  3A74 A;  2Z6K A;  3E9H A;  4MN3 A;  4EX5 A;  1BCP F;  3NEL A;  4RMF A;  4R8I A;  4CDF C;  1HNZ Q;  2SNS A;  1B44 D;  4BBS G;  4J1M A;  2OWO A;  4KJN A;  4B3T Q;  3AB9 A;  5JPN C;  1LTA D;  2EY1 A;  2QCP X;  2Z6B A;  2UUA Q;  5D3I B;  4U67 3;  1B4O A;  5CV9 A;  4IUT A;  1D2B A;  1I94 L;  1JWU D;  2IX0 A;  3I73 A;  2ZTE A;  2UXC L;  5LMU L;  4GNX B;  4G4K A;  1X3P A;  5JOB A;  3S1Q B;  2YU9 B;  3K57 A;  3JAM c;  5EAY A;  2KA7 A;  4NPS A;  3PUW A;  2PO4 A;  2F0G A;  1D1K A;  4H44 C;  1XPO A;  4ZUJ A;  4N9P A;  3VR3 A;  5GAE C;  1JIC A;  1PLF A;  1L1O C;  3A56 A;  4DR5 L;  3UE0 A;  1YIT A;  4K8J A;  4OIK A;  5IWA L;  4PG3 A;  1UE5 A;  3GDE A;  4DKA C;  1IYV A;  1VF7 A;  4K6L A;  4O2D A;  2RA4 A;  3CW2 C;  4OGQ C;  4RWS C;  1R9T B;  2RCN A;  2A5H A;  4LWC A;  4H13 C;  1HRJ A;  1HPC A;  2JQO A;  3J7A F;  3KK7 A;  2J4X A;  3VYR A;  3K59 A;  3CME A;  4GOP B;  2ZXR A;  5I2Y A;  3E0E A;  3G7L A;  2FIN B;  2WP8 J;  5K36 H;  1K3R A;  2E5L L;  5CBE E;  3HOX H;  1VQO A;  1YNJ C;  4BBS B;  3AEV A;  3DMU A;  4KI0 A;  5FK9 C;  3K81 C;  2NVQ B;  3DEO A;  1O7I A;  3SHL A;  1EY7 A;  1BBW A;  1VQD A;  2ATW A;  3EIV A;  1F77 A;  4A3E G;  1KAB A;  2ID0 A;  2RDH A;  1EFW A;  3CCJ A;  1VQ8 A;  5C0X G;  1Q3L A;  1XMQ Q;  2R7Z B;  2K5D A;  4QGU A;  1SYF A;  4C3H H;  1F2L A;  4OL7 A;  3WDN A;  4H02 A;  4CBV A;  2L11 A;  4EGV A;  1N32 L;  1PA6 A;  2F0S A;  2RVL A;  4NP5 A;  5IGB A;  2QF7 A;  2EY2 A;  1PTO C;  4DK0 A;  1EQQ A;  5C3E G;  4JI6 Q;  1S3O A;  1YIJ A;  3U58 A;  1RKN A;  3PIP A;  4QMG A;  4A3G H;  4A3K B;  1VQF A;  4DR6 Q;  3GQB A;  3T1H L;  2X6L A;  2KVM A;  5CV6 A;  4B9W A;  2XRS D;  2OQK A;  1IYJ B;  1Q8K A;  5ELN A;  1CZW A;  5FLM H;  2NVX H;  1FR3 A;  2VY3 A;  4IUP A;  1BBU A;  2JSO A;  4DV2 Q;  1O7Y A;  3T51 B;  1RHP A;  1V43 A;  2F0P A;  1NCV A;  4LF8 L;  4LK1 C;  2A73 B;  3PUZ A;  4BS9 A;  4JYA L;  2LSS A;  5KYL A;  3OWE B;  3CRK C;  3PUX A;  1TWF B;  4YWM A;  3PO2 G;  3HOV B;  3K8A A;  5M9O A;  3CHB D;  1HFG A;  1GUW A;  4CDE C;  1PXU A;  4ZQ3 A;  3HOW H;  1I4X A;  4JPB W;  3DEP A;  5CC4 A;  1PH4 A;  4A3M H;  2K5Q A;  3X3M A;  3G6E A;  4QUC A;  1X32 A;  1VQ7 A;  2BE5 C;  4IJL A;  5M3F H;  1W6J A;  1LO5 D;  1VQH A;  2M9V A;  4X62 Q;  2GN5 A;  1A3T A;  2VXW A;  1XNQ Q;  1PDQ A;  2KOL A;  1C8C A;  1S5E D;  5FLX L;  3HOZ H;  3CCM A;  2F0N A;  3ZJY C;  2KHJ A;  5KRU A;  2NTT A;  5CR3 A;  3S15 B;  4RCO A;  5H1S E;  4A3J B;  3TP7 A;  1GUN A;  5BR8 Q;  3J80 E;  2D62 A;  3PO3 B;  3Q6S A;  4Y7N H;  4FNF A;  3NQI A;  2N88 A;  1P8L A;  4DA2 A;  2H1E A;  3MVV A;  1ILP A;  5KIX A;  5KND A;  2A6E C;  2JE6 I;  4KN4 C;  3R8B A;  3VA5 A;  4DK6 C;  1CKN A;  3S14 H;  1FD7 D;  3Q0A A;  5T1G A;  4PNY A;  4R4T A;  3I55 A;  1LUZ A;  4A3L H;  2I5H A;  4GN3 B;  4QL5 A;  3NUC A;  1I4H A;  4GLX A;  1KC8 C;  1JE5 A;  2KUM A;  1TWH B;  1YNN D;  2F0U A;  1U4R A;  4QIW E;  1STE A;  1SNQ A;  2ES2 A;  1SND A;  1IW7 D;  4N8X 1;  4L5R C;  5C44 B;  2HDM A;  3PO2 B;  1PRT B;  3K7U C;  4HSV A;  1PFB A;  2F0F A;  5CV8 A;  4RGT A;  4U68 A;  1LTS D;  3VYU A;  1GKH A;  3CPF A;  1LTT D;  4QIW B;  1KAW A;  1SFO B;  2F0K A;  2ZXP A;  3W1B A;  3QB3 A;  1GHJ A;  3S24 A;  3L0O A;  3CD6 A;  4QF4 A;  4LF5 L;  4X3S A;  4OWX B;  5C4X H;  3ONA B;  4POG A;  3S16 H;  2IPK D;  3H0G G;  5ELD A;  4NMZ A;  3I91 A;  4KY7 A;  2B63 G;  2VQE L;  2E8G A;  4B3M L;  3S2D H;  1WOC A;  5JJK A;  5CMD A;  3DM3 A;  1QZG A;  1PFS A;  2EY6 A;  4IUV A;  1TS4 A;  2WV6 D;  2NVT H;  5FLX c;  5K5P A;  2N78 A;  2EYO A;  1GO3 E;  1N34 Q;  4JI3 L;  4A3F B;  1EQV A;  1H9S B;  4DR3 L;  5G3L D;  1HR0 W;  3E5S A;  3H09 A;  4JC0 A;  3GTP H;  2FMM A;  2HCC A;  2JA7 B;  4UY8 C;  2KEN A;  1HFN A;  1N36 L;  2F3I A;  2B8F A;  4DAY B;  1ENF A;  3G4S A;  5NUC A;  1R4Q B;  1EU4 A;  2CH4 A;  3CP0 A;  2RHS B;  5F2D A;  4OEL B;  1Y1W G;  5IP9 H;  1VCI A;  3T1Y Q;  1VQM A;  2MJ8 A;  2ICE C;  2C5C A;  2PQA B;  4I65 A;  4M8A A;  4GNX A;  3K5M A;  5IP7 H;  2NB0 A;  3CC4 A;  5C4J B;  2MGS A;  1HQM C;  1NBW A;  4FXD A;  3T13 A;  1NJI C;  1EOT A;  2I5M X;  1X3Q A;  1MSH A;  4BBR B;  5C5L A;  1I5F A;  2G9D A;  2Q2H A;  1HQR D;  5JJZ A;  1F2Y A;  4OHJ A;  2EPB A;  3RZD B;  2B63 B;  1EIH A;  3GTK H;  1XNR L;  1AFP A;  3VR6 A;  1PYS B;  4LFB L;  2E2I H;  5LL6 S;  5FO7 B;  3F2D A;  1A62 A;  1O78 A;  1SRO A;  1AN8 A;  2QEJ C;  4UP9 A;  3J7Z C;  2R93 H;  2HIX A;  4Q5V A;  3UDG A;  4NW2 A;  2BDO A;  4GOP A;  3GV3 A;  3K80 C;  2JA6 H;  3VR4 A;  3ULL A;  2UXD L;  2CW0 D;  5EPL A;  1AW7 A;  2UU9 L;  4IUR A;  1UUP A;  4F7X A;  1LTB D;  3FDT A;  4K8I A;  2VQF L;  1PYW D;  2A8V A;  3OHX C;  2J7Z A;  4RH6 A;  3FHW A;  3A7L A;  1K8G A;  1EWI A;  5LMN L;  1G91 A;  1K83 B;  1N33 Q;  4HJ8 A;  1ZYR D;  1Q90 A;  1XPU A;  4JV5 Q;  4YHH Q;  5K36 G;  2E2J B;  3G6J B;  1E2V A;  2JXM B;  3R93 A;  5TSS A;  1SYE A;  3HOX G;  3SVM A;  1G6P A;  4EQP A;  1BCP B;  5D14 A;  1JWS D;  2JA5 H;  2B8G A;  1AEX A;  1UE1 A;  4CKC A;  3A5U A;  1KDC A;  5EQ0 A;  2K75 A;  1HNZ L;  5DLQ E;  2MPM A;  3BYY B;  4FXK C;  4DUZ Q;  1C48 A;  5JAV A;  1SMY C;  4B3T L;  2I46 A;  2YV5 A;  3SK5 A;  2K5V A;  4C3H G;  1ZKO A;  3DUZ A;  1OTC A;  3WOE A;  2VNU D;  2UUA L;  4XYO A;  1B8A A;  1MD2 D;  3TRE A;  2EJF C;  1Y8O B;  2X6G A;  3KJO A;  1I3Q B;  3IL8 A;  4C3J B;  3A8J E;  1L0W A;  4L6T B;  3GTM B;  1TQO A;  1UAP A;  4A3G G;  1OXS C;  4K0K Q;  2LMC B;  2PW7 A;  2OTL A;  3CU7 A;  2VW9 A;  5HY6 A;  4P2C B;  3E0J A;  4ZCK A;  4L8J A;  2Z6K C;  5D3D A;  5FLM G;  2PNH A;  3RN2 A;  3H15 A;  1S40 A;  1A6X A;  4RA8 A;  4B08 A;  4IPG A;  1U9R A;  3NBH B;  5A35 A;  1TWC B;  1J6Q A;  2L0C A;  4DU9 A;  4X66 Q;  5KEE A;  3RD4 A;  4A93 H;  4P75 A;  4K6D A;  2IHE A;  4G7Z C;  2VUM H;  4JI4 Q;  1TT2 A;  1AE3 A;  3LGJ A;  4ZAI A;  4DF7 A;  3FMC A;  4TQU S;  5I2X A;  4FXG C;  4I7A A;  4A3M G;  1HZA A;  1E2W A;  1O7L A;  1SE8 A;  1K8O A;  2K33 A;  4KK7 A;  3RN5 A;  2B2W A;  4EQ5 A;  4GN4 B;  5M3F G;  2B2T C;  2IL8 A;  1DOM A;  3CQZ H;  3FEW X;  1EYD A;  1E22 A;  3CC2 A;  2WKC A;  4KKS A;  4HAE A;  3OMG A;  4K5W A;  3SK6 A;  4KJO A;  3VR2 A;  2B2V C;  2EYH A;  1VQ6 A;  3HOZ G;  1KL9 A;  1XMQ L;  1NSN S;  1FL0 A;  3EBE A;  2ASB A;  1PRT D;  4MTK A;  4DK3 C;  3GTJ H;  3P75 A;  3QOL A;  1XX8 A;  3L2P A;  1J5E Q;  1XWE A;  2AQ1 B;  5M5W B;  4MTN A;  1I50 H;  2F4I A;  2QDB A;  3CCL A;  3J81 E;  3KOJ A;  3UE1 A;  5GRO A;  4JI6 L;  4P74 A;  2A69 D;  5EKK A;  5DNF A;  4BY7 B;  3SDZ A;  4ZKC B;  4K2L A;  2HIV A;  2VB3 X;  3I56 A;  4DR6 L;  2O2L D;  3PV0 A;  4QCL A;  1KTK A;  4XTC S;  3I90 A;  2WII B;  3HKZ E;  1SBB B;  3PSI A;  3SR1 A;  4O42 A;  1TWG B;  2R7D A;  4RG1 A;  1KXL A;  3TS2 A;  4DV2 L;  4ME5 A;  4HIM A;  4JOI A;  1Y8N B;  1WTO A;  1K73 C;  1VQG A;  1D5X C;  2EXD A;  3DM1 A;  3HKZ B;  3QO2 A;  3W3A A;  3K5O A;  4KD3 A;  3GTL H;  2RHQ B;  1ESR A;  1EY0 A;  1HUM A;  4PMB A;  1S72 A;  1WD0 A;  3M4O H;  3CMA A;  3O13 A;  3J7A 5;  5M3F B;  5C4X G;  1WTV A;  2K32 A;  3EFX D;  1ENA A;  2A68 D;  2PCF B;  2NN6 H;  4ME3 A;  2DUD A;  1JT8 A;  1SE4 A;  2N49 A;  4HN7 A;  4YY3 Q;  2ZXO A;  1EYC A;  5E4W C;  1H9S A;  1YHQ A;  2DNE A;  3VDY A;  3NWS A;  2GVB A;  2JP1 A;  3I4O A;  4OO1 H;  3P7J A;  4X62 L;  3BZC A;  5IY0 A;  1Z9F A;  1U5K A;  2LKV A;  1XNQ L;  5FO9 B;  4DAY A;  1L0Y B;  4GKJ Q;  4A3D H;  1KLG D;  4HTH A;  4X65 Q;  4Y7N B;  3A8I E;  1K28 A;  4JI1 Q;  4N8F A;  3M9B A;  2RSN A;  3EVQ A;  4K2K A;  2F03 A;  4QJF A;  2ZM6 Q;  3CRL C;  4KD4 A;  1KDB A;  2D9U A;  3X3N A;  1MJC A;  2PQA A;  2Z8L A;  4FF4 A;  5BR8 L;  1BNZ A;  4YCV A;  1KAA A;  2UXB Q;  3RR5 A;  1EYA A;  5IYB H;  3S1N B;  4A75 A;  1IL2 A;  1CK1 A;  2EQS A;  3FKI H;  2IY5 B;  3G71 A;  1ET9 A;  3TDQ A;  1B7Y B;  3ND8 A;  3S1M H;  2ZTD A;  2D0P A;  5IP9 G;  3KF6 B;  4R4Q A;  2WIN B;  2F0V A;  1IKL A;  2F0I A;  1ASY A;  5HUR A;  2WAC A;  3NPP A;  5IP7 G;  1EU3 A;  1PZI D;  3U4Z A;  1IL8 A;  2B2T A;  4EQN A;  2WAQ E;  5JVG 3;  1RTO A;  2C9O A;  3GTG B;  4XT1 B;  1EIF A;  2OXP A;  1T5X D;  4LUO A;  2WB1 G;  1FNW A;  5IYC H;  5C4X B;  1B50 A;  2B2V A;  1DXM A;  1VQB A;  2SDF A;  1JB3 A;  4B9X A;  3S16 B;  4LF4 Q;  1N8R C;  4QUF A;  1YJ9 A;  1JOR A;  2KJX A;  2WAQ B;  3BJU A;  2R7F A;  5KYI A;  3D8G A;  3M4Q A;  1X3E A;  1G6Z A;  1PFM A;  4R9W A;  3K7A B;  2XTI A;  1BCP D;  5COR A;  2NVT B;  4WJ3 M;  2UUB Q;  2R93 G;  3R2T A;  2JA6 G;  4A76 A;  1H9J A;  4LJZ C;  1TS2 A;  2R61 A;  3DXJ C;  3K5N A;  5M5X H;  2FFK B;  4ID6 A;  3D0F A;  4LAA A;  1GUT A;  3GP7 A;  1EIY B;  5EJW A;  2CKZ B;  1MSG A;  1N34 L;  3KUP A;  4IAL A;  2QIL A;  2P5Z X;  4ABN A;  3TME A;  3HKS A;  4XT3 B;  3QR8 A;  1AE2 A;  3J81 L;  2Z9H A;  2EOT A;  4A4I A;  1KQS A;  1VQC A;  3ULP A;  1EY4 A;  3VYT A;  4R4I A;  3EA6 A;  2M00 A;  3IAY A;  1Z47 A;  2CHB D;  2MO0 A;  4CHT B;  4DR2 Q;  4IZ8 A;  3J81 j;  1YNN C;  4BA1 I;  3AU7 A;  2O4X A;  3A54 A;  1IW7 C;  1CZG A;  2JA5 G;  3GTO H;  3T1Y L;  3MC0 B;  1VQN A;  3KBG A;  4V0B A;  1F9R A;  2DN8 A;  4RKB A;  5EGT A;  1GXD C;  3C3L A;  5IT9 E;  4OX9 Q;  4NB3 A;  1Q82 C;  1VQI A;  3PMF A;  3JAM i;  1PVO A;  5LL6 X;  1X54 A;  4H7B A;  4HIK A;  1ICF B;  2QW7 A;  1IZ6 A;  3F2B A;  1VQ5 A;  1GUO A;  1RJT A;  2H5X A;  1V1P B;  1QVF A;  4A3I H;  3U9S A;  5I9O A;  4DV5 Q;  3NTK A;  5I9P A;  5E4X A;  1XMO Q;  3U50 C;  2F4V Q;  1SNP A;  2R93 B;  2MP1 A;  5GQO A;  3NEN A;  3QOJ A;  2L15 A;  3C1F A;  3NBH A;  3Q8D A;  1WD1 A;  5JPM C;  4R4C A;  2AWN A;  4Y52 H;  3ERS X;  1AZQ A;  1C9O A;  2IX1 A;  1PV4 A;  5LMN W;  5FJ8 H;  4KHP Q;  1WTX A;  5AFW A;  4A3E B;  4FDB A;  2Q2T A;  3EQL C;  1CFM A;  4AQY Q;  3TEH B;  3GD7 A;  1JJG A;  3I70 A;  4GNX C;  3K6O A;  3D6C A;  1G51 A;  1D5M C;  2B3G A;  3C1E A;  1BXT A;  5BN3 A;  3D31 A;  1YVC A;  1FJG Q;  1S4Z A;  5C5M A;  4A93 G;  1F2Z A;  3FRP B;  1SYD A;  3DWA A;  1N33 L;  4JCV E;  2SOB A;  4UAI A;  2JA5 B;  3S9W A;  4KTA A;  4RGM A;  2BH2 A;  4C1N K;  4CDC C;  1U4M A;  4JV5 L;  4DXF A;  2VUM G;  4JI2 Q;  4YHH L;  1HA5 A;  1PTO F;  4C3I H;  5C3E B;  4TKO B;  3BDC A;  4HMJ A;  4HCE A;  1STB A;  1PTO H;  1X56 A;  2NVY H;  1EZ8 A;  3PQI A;  3S2H B;  1YI2 A;  1EWH A;  4DNI A;  1WVL A;  3QWN A;  1WTW A;  3SE0 A;  3UI2 A;  2ZJP A;  1D8L A;  2ICI A;  1XYI A;  1Y8P B;  4DUZ L;  5J22 A;  4GOP C;  3S17 H;  4C2M B;  3M7N A;  5J1Z A;  2LFN A;  4V19 0;  4DUY Q;  3MXG A;  2EZV A;  3S1R B;  1CA5 A;  4OWT B;  1XTC D;  4XYQ A;  4NXN Q;  1BOS A;  4XQN A;  4JI8 Q;  5C4Z A;  1OXT A;  4NKL A;  1HZB A;  3GV6 A;  5BN5 A;  1BQQ T;  5DM7 3;  1PYB A;  2CW0 C;  2Y0S G;  1LT3 D;  2EVB A;  1K9M C;  1JCK B;  3RZO B;  4ODG A;  4K0K L;  3PIO 3;  2SNM A;  3NTI A;  2L55 A;  4M1U B;  1K3B C;  4IJH A;  1MGS A;  2KEC A;  1X3G A;  5I4D A;  1QIL A;  1RTN A;  1QE6 A;  3LX0 A;  3NBI A;  1VDZ A;  3NP8 A;  4UDU C;  1B2T A;  3KDF B;  2HQE A;  1ZYR C;  3V96 A;  3I4M H;  2FJ2 A;  5GAH C;  2F0Q A;  2CWA A;  3K0Y A;  3NE5 B;  4ZK9 B;  1LLR D;  4X66 L;  2Q8R E;  1HJP A;  5IGF A;  2I0Q A;  4LF6 Q;  1W6K A;  4DV6 Q;  2EXZ A;  2B2U A;  2RF4 A;  5C3W A;  1EY5 A;  4JI4 L;  3RNU A;  1TVX A;  3OTO Q;  1U4P A;  2F3W A;  2NN6 G;  4OON A;  3OYY A;  4DV1 Q;  1II3 A;  5ELF A;  1R9T H;  4HED A;  5JEA H;  1QB5 D;  1QWY A;  2G5D A;  4J8Q A;  3I3C A;  4FO2 A;  1Y69 U;  2CQA A;  2R92 H;  3T53 B;  4OWW B;  3HOU H;  2JK8 A;  2XIW A;  4BY1 H;  3GTJ B;  4OO1 G;  3D4W A;  2KEE A;  1LTG D;  4YWL A;  3BDO A;  2AUK A;  2ZT9 C;  4PMW A;  1JB7 A;  4A3D G;  4YWK A;  1EY9 A;  1CHQ D;  1I50 B;  1W3S A;  3FPU B;  5JVH 3;  2IW3 A;  2K7V A;  1FYC A;  3HGB A;  4HIO A;  1J5E L;  3KF6 A;  2E2D C;  5A2Q E;  3ER0 A;  4GN5 A;  4ILW A;  2KQ3 A;  2Z4I A;  4JK1 C;  5IYB G;  1QVG A;  1HXY D;  1PH8 A;  4LFC Q;  3OSO A;  3FKI G;  2ZJR A;  3ERQ A;  3AFQ A;  1KNA A;  5E1F A;  3MAQ A;  2R7Z H;  3H0G B;  1A15 A;  1B70 B;  4NXM Q;  2A6H D;  1EQT A;  2DJF C;  1VQA A;  1TWA B;  1Q7Y C;  4KY6 A;  2E2H B;  2ZTC A;  2B2W C;  1Y14 B;  5IOC A;  1B53 A;  5AJ3 Q;  1WTR A;  4F88 A;  1JQY D;  1GOZ A;  1YBY A;  3VR5 A;  3GTL B;  3TS0 A;  1YJN A;  3M4O B;  1B9N A;  4JBJ A;  1VQP A;  1CQV A;  3PF4 A;  4GKK Q;  5KNC A;  1ML0 D;  4A3K H;  5IGD A;  4DV3 Q;  1Q1B A;  4RHS A;  2QA4 A;  4IPD A;  3PGZ A;  1J8I A;  1SJH D;  4KN7 C;  3QJY A;  4HMI A;  2NZ1 D;  5GAG C;  2KHI A;  2PZU A;  3CKI B;  1CSQ A;  2HUG A;  2LY7 A;  4QQB X;  3J80 L;  4YY3 L;  4HJ9 A;  5IIF A;  3MXU A;  1PH3 A;  1VQ9 A;  4A3D B;  1PRT C;  4FVM A;  1PH2 A;  4PV1 C;  2EDG A;  4FF3 A;  1Y1W B;  3MEF A;  1LTI D;  1K8A C;  1C7Y A;  2MNA A;  4GLV B;  1TWF H;  3NXW A;  3HOV H;  4CKB A;  4GKJ L;  2K04 A;  1IBK Q;  4DV4 Q;  4X65 L;  3LWE A;  3CC7 A;  3TRZ A;  4JI1 L;  2A69 C;  2ZM6 L;  2L12 A;  4KHV A;  1STY A;  1YZ6 A;  4JOI C;  5C0X H;  3S1M B;  2DJG C;  4IPH A;  4LF9 Q;  2UXB L;  1I4R A;  2EE1 A;  2RSO A;  1EWC A;  3UDX A;  2LXJ A;  3R2I A;  4I7Z C;  2L9H A;  4MZ9 A;  1ICW A;  1O7Z A;  2QGQ A;  1A0I A;  1WCM H;  4G7H C;  4DXG A;  2V4D A;  3P20 A;  3DHQ A;  2F0W A;  3W5O A;  1V1P A;  3B6Y A;  1G2S A;  3H3V C;  1BBX C;  4A3J H;  3CCE A;  2FXQ A;  4YIJ A;  3PO3 H;  3LNN A;  3OPO A;  3TZU A;  1ESF A;  1RL2 A;  3IKJ A;  4DV7 Q;  1BR9 A;  1ASZ A;  5ELB A;  1UEB A;  2F1M A;  3KBX A;  3OWF A;  3EJI A;  3PIO A;  4LNQ A;  2EYL A;  2A68 C;  3A5Z B;  4YCW A;  1D7Q A;  4F8M A;  2LXK A;  4LF4 L;  4HCS A;  4DNT B;  2Q2U A;  3STB D;  2TMP A;  2JA8 H;  2BH8 A;  2FHT A;  5C44 H;  3J80 c;  4DAV A;  4F87 A;  5IYD H;  3HOX B;  2MQH A;  1LTL A;  1ILQ A;  5IGE A;  4B3S Q;  4JBM A;  1PZK D;  2PPB C;  4XQQ A;  2EJM A;  2UUB L;  1EEF D;  1XPR A;  3GTQ H;  1STA A;  3M3Y H;  2ENB A;  3K0X A;  2XWJ B;  4RKL A;  2EYJ A;  5FJ8 G;  3HOW G;  2HDL A;  2MFI A;  1VF5 C;  2HQL A;  3CAM A;  4HJ7 A;  4JI7 Q;  4B3R Q;  1LAB A;  1CT1 D;  3ZYY X;  1UWV A;  2NYZ D;  3TP8 A;  5A2Q L;  1SE3 A;  3G48 A;  3F1Z A;  1LT4 D;  4C3H B;  1BF4 A;  1X55 A;  1RD9 D;  1GD7 A;  1QG7 A;  2AQ3 B;  2DNC A;  3N6R A;  1UEA B;  4IUN A;  1VQ4 A;  3GTO B;  1VMP A;  4DNR B;  4DR2 L;  2K1B A;  1X9N A;  2O5I C;  4C3I G;  4P73 A;  3HOY H;  1L2F A;  5HGQ A;  5M3M H;  1TU2 B;  1AH9 A;  1L1O B;  5DM6 3;  4A3G B;  1TY0 A;  4A3F H;  4PZ6 A;  5IOD A;  1C4Q A;  4ZRZ A;  5I6Y A;  4X6A H;  1ZXT A;  2KCT A;  5CV7 A;  4X3T A;  3I4N H;  2B2Y A;  2DY7 A;  3TN2 A;  2JA7 H;  4OIJ A;  1E0B A;  4KLK A;  4OX9 L;  3PUY A;  2G9H D;  2NVX B;  5DEH A;  4A3L G;  1XXG A;  1A8V A;  1QOH A;  4MHE A;  2A19 A;  2K14 A; 
#chains in the Genus database with same CATH homology
 3D0F A;  4QIW E;  3CCU A;  1EIY B;  2CKZ B;  1BVS A;  1EUJ A;  2ES2 A;  1N34 L;  2IT1 A;  2UUC L;  4DV5 L;  4A3B G;  4L5R C;  4A3E H;  1JMC A;  1XMO L;  3SGI A;  4LFA Q;  3K7U C;  3HKS A;  2F4V L;  1AE2 A;  3KDF A;  1XJV A;  4OXP A;  3M85 A;  4A4I A;  1KQS A;  1FGU A;  1VQC A;  5C4J H;  2PI2 A;  3ULP A;  4R4I A;  1GKH A;  3CPF A;  1Z47 A;  2MO0 A;  4DR2 Q;  3J81 j;  1KAW A;  1HZC A;  4BA1 I;  3IRB A;  3W1B A;  4X64 Q;  4BBR H;  1VQJ A;  3L0O A;  3S24 A;  1OXU A;  3CD6 A;  3ICE A;  4LF5 L;  2HT1 A;  4OWX B;  4WJ4 A;  3EN2 A;  5C4X H;  3J80 i;  2JA5 G;  2BA0 A;  3GTO H;  4POG A;  3S16 H;  2QEX A;  4DR1 Q;  3H0G G;  2KCM A;  5C3E H;  3T1Y L;  1M1K C;  3CXC A;  1QVC A;  3RZD H;  1VQN A;  2B63 H;  4KHP L;  3S15 H;  4AH6 A;  1EYG A;  2B63 G;  2VQE L;  2E8G A;  1KRS A;  4B3M L;  4AQY L;  1WOC A;  1P16 A;  1IBM Q;  3S2D H;  1YNX A;  5JJK A;  3DM3 A;  3I4M G;  3AYH B;  1QZG A;  2KBN A;  4OX9 Q;  3S2H H;  1PFS A;  3RLO A;  1HNW Q;  3E9I A;  3CCQ A;  4NB3 A;  1Q82 C;  1VQI A;  3JAM i;  1PVO A;  1FJG L;  1X54 A;  2NVT H;  4HIK A;  5FLX c;  2N78 A;  1IZ6 A;  3F2B A;  1VQ5 A;  2H5X A;  1KRT A;  4C2M H;  1UE7 A;  1QVF A;  2UUC Q;  4A3I H;  1GO3 E;  1N34 Q;  4DV5 Q;  1X65 A;  4JI2 L;  4GKK Q;  1IXR A;  4JI3 L;  4A3I G;  1XMO Q;  4DR3 L;  3U50 C;  3KF8 B;  3S1R H;  2CWP A;  1HR0 W;  4IO9 A;  2F4V Q;  1TWH H;  1PH6 A;  5GQO A;  5JEA G;  3NEN A;  4JC0 A;  4MNO A;  4QY7 A;  1HNX L;  3GTP H;  2L15 A;  4UY8 C;  1SMX A;  4HID A;  2KEN A;  2F52 A;  3AQQ A;  1N36 L;  2R92 G;  2F3I A;  4DAY B;  3HOU G;  2K4K A;  3I7F A;  2V1C C;  4BY1 G;  3G4S A;  3PO2 H;  3Q8D A;  1MKH A;  4R4C A;  2AWN A;  4LF5 Q;  4Y52 H;  1PH1 A;  3CP0 A;  3ERS X;  2RHS B;  4HJA A;  1C9O A;  2D0O A;  4BY7 G;  4IFD J;  2VZA A;  2IX1 A;  3TQY A;  1Y1W G;  5IP9 H;  1OXX K;  1VCI A;  5LMN W;  1PV4 A;  5FJ8 H;  3T1Y Q;  2E2J H;  3RZO H;  4DUY L;  1VQM A;  1SFO H;  4KHP Q;  2EIF A;  2VQE Q;  2PQA B;  4FDB A;  2HHH L;  2Q2T A;  4B3M Q;  4AQY Q;  2AMC B;  3GD7 A;  3TEH B;  4GNX A;  5IP7 H;  4A3C G;  4L5T A;  1JJG A;  4GNX C;  3CC4 A;  5C0X I;  1G51 A;  4NXN L;  2B3G A;  1NBW A;  3NEM A;  1Q1E A;  2N3S A;  1X6O A;  4JI8 L;  1NJI C;  4DR4 L;  3D31 A;  1YVC A;  4IFD I;  2I5M X;  4JBK A;  1FJG Q;  1NMG A;  1E24 A;  4A93 G;  1I5F A;  1N33 L;  4JCV E;  2Q2H A;  3RLN A;  2BH2 A;  1YHA A;  4UP8 A;  1PH7 A;  4JV5 L;  2VUM G;  3BZK A;  1Y1V H;  4JI2 Q;  4YHH L;  2R7Z G;  3HKZ G;  4C3I H;  4JI3 Q;  2NN6 I;  4L5S A;  4DR3 Q;  4BXX G;  4DR7 L;  4ALP A;  4O0A A;  4YCU A;  4AYB G;  1X56 A;  2R6G A;  3GTK H;  1Q86 C;  3U4V A;  1HNX Q;  2NVY H;  1XNR L;  1PYS B;  4LFB L;  2E2I H;  3H3V H;  3F2D A;  1YI2 A;  1I3Q H;  1N36 Q;  4OO1 I;  1A62 A;  4DNI A;  1VQL A;  1QUQ A;  4C3J H;  1SRO A;  3F2C A;  2ZJP A;  4UP9 A;  1CKM A;  3J7Z C;  1D8L A;  1HH2 P;  2NZH A;  2HIX A;  3UDG A;  1W2B A;  2R93 H;  3PF5 A;  3GTM H;  4GOP A;  3K80 C;  4DUZ L;  2JA6 H;  3ULL A;  4JBW A;  4GOP C;  1HR0 L;  3S17 H;  2UXD L;  3M7N A;  2OCE A;  1NY4 A;  4IOC A;  4DUY Q;  4A3K G;  1IBL L;  2UU9 L;  4LF7 L;  2HHH Q;  4LF6 L;  2VS1 A;  1JJ2 A;  3KLW A;  2VQF L;  4LUZ A;  4DV6 L;  2GVA A;  4OWT B;  1BKB A;  1SRU A;  2Q2I A;  2A8V A;  4NXN Q;  4A3B H;  4JI8 Q;  3OTO L;  4DR4 Q;  1A63 A;  1OXT A;  1CKN B;  3DLL A;  3AFP A;  1WI5 A;  1HZB A;  3FHW A;  1K8G A;  4DV1 L;  1EWI A;  5LMN L;  4R1J A;  1PYB A;  1YHB A;  1N33 Q;  2Y0S G;  4HJ8 A;  1TWC H;  1XPU A;  5IE8 A;  1MIU A;  1K9M C;  4JV5 Q;  3ULJ A;  4YHH Q;  4IOA A;  5K36 G;  2PI2 E;  1TXY A;  4DR7 Q;  4JI5 L;  5JJI A;  2IHF A;  4K0K L;  2Z0S A;  2WB1 E;  3HOX G;  1G6P A;  2WFW A;  1LM0 A;  1SLJ A;  3HOV G;  3BU2 A;  4IJH A;  2JA5 H;  1X3G A;  1XNR Q;  1UE1 A;  4LFB Q;  3H0G H;  1HZ9 A;  4AYB E;  3A5U A;  1PHJ A;  2K75 A;  1CUK A;  3KDF B;  2K52 A;  1HNZ L;  1TWA H;  3I4M H;  2OTJ A;  5DLQ E;  5GAH C;  1VQE A;  2ALY B;  4DUZ Q;  1WJJ A;  2CWA A;  3A0J A;  1HR0 Q;  2E2H H;  2UXD Q;  4B3T L;  2UU9 Q;  1E3P A;  1IBL Q;  2YV5 A;  4X66 L;  1PH9 A;  1HJP A;  2K5V A;  4GLA C;  3WWV A;  2I0Q A;  4LF6 Q;  4LF7 Q;  1XTD A;  3FP9 A;  1OTC A;  5ELO A;  4LFC L;  4IPC A;  2VQF Q;  4APV A;  4DV6 Q;  2UUA L;  2VNU D;  2RF4 A;  1B8A A;  1WCM G;  3CPW A;  3TRE A;  3H3V I;  2JEA I;  4JI4 L;  3CCV A;  3RNU A;  3OTO Q;  3KJO A;  4DV0 L;  3KYH C;  4NXM L;  2NN6 G;  4OON A;  3OYY A;  2JA9 A;  5LMN Q;  4DV1 Q;  1L0W A;  1E1T A;  4A3J G;  1R9T H;  2JJQ A;  2UXB L;  4LUV A;  3HFZ B;  2WAQ G;  5M5W H;  4JI0 L;  1V9P A;  2K5N A;  3PO3 G;  1M90 C;  3CCR A;  2R92 H;  4A3G G;  4UPA A;  4OWW B;  1MJE A;  1OXS C;  2JK8 A;  4BY1 H;  4JG2 A;  4JI5 Q;  3HOU H;  5AJ3 L;  1NTG A;  4K0K Q;  4OO1 G;  4PZ8 A;  4YWL A;  1KIX A;  2OTL A;  4J15 A;  1K83 H;  1N9W A;  4BY7 H;  2VW9 A;  5HY6 A;  4PMW A;  1JB7 A;  4A3D G;  1Y1W H;  1CKO A;  3A74 A;  4YWK A;  4GKK L;  2Z6K A;  3E9H A;  1W3S A;  2Z6K C;  3GO5 A;  4EX5 A;  4DV3 L;  1V1Q A;  3NEL A;  4RMF A;  5FLM G;  2PNH A;  3RN2 A;  1KHI A;  4HIO A;  1J5E L;  3KF6 A;  3H15 A;  1S40 A;  1HNZ Q;  3PF4 A;  4A3C H;  3ER0 A;  4GN5 A;  4BBS G;  4IPG A;  2OWO A;  3NBH B;  4B3T Q;  1I6H H;  1J6Q A;  1TWG H;  2K50 A;  2JA8 G;  4X66 Q;  5IYB G;  5C44 G;  1QVG A;  4A93 H;  2YTX A;  2YYZ A;  4P75 A;  1PH8 A;  4LFC Q;  5IYD G;  2UUA Q;  3J81 c;  2N8N A;  3FKI G;  2ZJR A;  2A1A A;  2IHE A;  1UE6 A;  3AFQ A;  1I94 L;  2VUM H;  3PCO B;  4JI4 Q;  2JEB I;  2R7Z H;  2IX0 A;  1NMF A;  1AE3 A;  1K0R A;  1B70 B;  1WFQ A;  1T9H A;  2ZTE A;  3LGJ A;  5LMU L;  4DV0 Q;  4BXX H;  2UXC L;  4L5Q A;  4GNX B;  4NXM Q;  4TQU S;  2AWO A;  1VQA A;  1X3F A;  4A3M G;  1HZA A;  3JAM c;  5EAY A;  1Q7Y C;  4JI0 Q;  4NPS A;  3PUW A;  1IBK L;  1SE8 A;  1GM5 A;  4DV4 L;  3RN5 A;  4EQ5 A;  1XPO A;  4GN4 B;  5M3F G;  2ZTC A;  5JEA J;  1Y14 B;  5GAE C;  3CQZ H;  1L1O A;  5AJ3 Q;  1E22 A;  3CC2 A;  1L1O C;  1YBY A;  4DR5 L;  2DGY A;  3TS0 A;  1YJN A;  3UE0 A;  1YIT A;  4LW1 A;  4JBJ A;  1VQP A;  5M5Y H;  4PG3 A;  1UE5 A;  3GDE A;  4DKA C;  5IWA L;  2PMZ E;  4LF9 L;  1KL9 A;  1VQ6 A;  4A3K H;  1XMQ L;  2ASB A;  1FL0 A;  3EBE A;  4DV3 Q;  1Q1B A;  4O2D A;  4DK3 C;  3GTJ H;  2QA4 A;  4IPD A;  3PGZ A;  3W1G A;  3L2P A;  1J5E Q;  3CW2 C;  4DAM A;  4HJ5 A;  1VQK A;  3HOY G;  1SR3 A;  5GAG C;  2RCN A;  4LWC A;  2KHI A;  2K5H A;  1CSQ A;  4MTN A;  5M3M G;  1I50 H;  2JQO A;  1QUQ B;  3CCL A;  4QQB X;  3KOJ A;  1E1O A;  3UE1 A;  4A3F G;  4GS3 A;  5GRO A;  4YY3 L;  4JI6 L;  2AKW B;  3CME A;  4P74 A;  2YTY A;  4HJ9 A;  4GOP B;  1PH3 A;  2ZJQ A;  1VQ9 A;  1PH2 A;  3I4N G;  1I94 Q;  3MEF A;  3E0E A;  2JA7 G;  2WP8 J;  2HIV A;  3S1N H;  1K3R A;  4AIM A;  3UDI A;  3I56 A;  4DV7 L;  1K8A C;  1C7Y A;  2E5L L;  5LMU Q;  4DR6 L;  2UXC Q;  2MNA A;  3PV0 A;  3HOX H;  1VQO A;  1VS0 A;  4POF A;  4GLV B;  1TWF H;  4XTC S;  3HOV H;  1C0A A;  4GKJ L;  2XGT A;  3AEV A;  3HKZ E;  1IBK Q;  3PSI A;  4KI0 A;  4DV4 Q;  1QZH A;  3K81 C;  3MXN B;  4X65 L;  3CC7 A;  2BA1 A;  3TRZ A;  4JI1 L;  2R7D A;  4RG1 A;  1O7I A;  1BBW A;  1VQD A;  2CCZ A;  2ATW A;  1FVI A;  4BA2 I;  3EIV A;  3RLF A;  2ZM6 L;  4DR5 Q;  4A3E G;  4DV2 L;  2YU9 H;  3TS2 A;  3S1Q H;  1KXL A;  2ID0 A;  4JOI A;  4HIM A;  1YZ6 A;  1GVP A;  4JOI C;  1EFW A;  4IPH A;  5IWA Q;  3CCJ A;  1K73 C;  1VQ8 A;  4LF9 Q;  2CQO A;  1E7Z A;  1VQG A;  3JC6 6;  5C0X G;  2EXD A;  1XMQ Q;  4QGU A;  1JJC B;  1EQR A;  3UDX A;  4C3H H;  2LXJ A;  1PH5 A;  3GTG H;  4MZ9 A;  4H02 A;  3GTL H;  4IFD G;  2QGQ A;  2RHQ B;  1A0I A;  4BBR G;  1WCM H;  1S72 A;  1PA6 A;  4B3S L;  3M4O H;  1N32 L;  3CMA A;  3J7A 5;  5C4X G;  4P72 A;  3W5O A;  3J81 i;  3M4P A;  3F8T A;  1Q81 C;  3B6Y A;  1EQQ A;  4ME3 A;  2DUD A;  5C3E G;  1JT8 A;  2NZO A;  2N49 A;  4YY3 Q;  4JI6 Q;  4A3J H;  4R4O A;  3CCE A;  2FXQ A;  1YHQ A;  1Q12 A;  1S3O A;  1YIJ A;  4B3R L;  3U58 A;  4JI7 L;  3PO3 H;  3VDY A;  3PIP A;  2GVB A;  1RL2 A;  1G29 1;  2CFM A;  4DV7 Q;  4A3G H;  3I4O A;  1VQF A;  2E5L Q;  4X62 L;  4DR6 Q;  3T1H L;  3BZC A;  3L7Z C;  5IY0 A;  1Z9F A;  2Y0S E;  1UEB A;  1CSP A;  3K7A H;  1U5K A;  1ASZ A;  1WYD A;  1XNQ L;  4GKJ Q;  3PIO A;  4LNQ A;  2OQK A;  4A3D H;  3A5Z B;  1IYJ B;  1Q8K A;  1LYL A;  4YCW A;  5ELN A;  1D7Q A;  4X65 Q;  2LXK A;  1DGS A;  4JI1 Q;  3CF5 A;  5FLM H;  3M9B A;  2NVX H;  5JJL A;  2VY3 A;  4QJF A;  4LF4 L;  2ZM6 Q;  1BBU A;  4DV2 Q;  2Q2U A;  4BBS H;  3STB D;  1MJC A;  2PQA A;  5BR8 L;  1V43 A;  4YCV A;  4LF8 L;  2UXB Q;  2JA8 H;  2NVQ H;  3RR5 A;  5IYB H;  2BH8 A;  3PUZ A;  5C44 H;  3J80 c;  5C0X J;  4A75 A;  2LSS A;  1IL2 A;  4JYA L;  5IYD H;  2EQS A;  3FKI H;  2MQH A;  1LTL A;  4KHZ A;  3PUX A;  4YWM A;  3PO2 G;  1N32 Q;  4B3S Q;  4JBM A;  3K8A A;  2IY5 B;  3G71 A;  2UUB L;  1OXV A;  1B7Y B;  1XPR A;  3GTQ H;  3S1M H;  1YEZ A;  3M3Y H;  3K0X A;  4DPG A;  2ZTD A;  2D0P A;  5IP9 G;  3KF6 B;  4R4Q A;  3STB C;  5FJ8 G;  3HOW H;  1PH4 A;  2VL6 A;  3HOW G;  4A3M H;  1ASY A;  3G6E A;  2MFI A;  3CAM A;  2HQL A;  3UDF A;  4HJ7 A;  5IP7 G;  1VQ7 A;  4JI7 Q;  4IJL A;  4B3R Q;  5M3F H;  1UWV A;  3U4Z A;  3G48 A;  1VQH A;  4X62 Q;  3F1Z A;  3T1H Q;  2GN5 A;  2WAQ E;  1RIP A;  2YTV A;  1XNQ Q;  4LFA L;  1X55 A;  1EIF A;  4XIG S;  3KFU A;  4LUO A;  1NE3 A;  1GD7 A;  2WB1 G;  5IYC H;  1VQ4 A;  3HOZ H;  3CCM A;  4UP7 A;  1VQB A;  5IYC G;  3ZJY C;  2KHJ A;  4DR2 L;  1U0L A;  1X9N A;  1Y1V G;  4LF4 Q;  4P73 A;  1N8R C;  4P71 A;  3HOY H;  5H1S E;  4X64 L;  5GAD C;  1YJ9 A;  1L2F A;  2MO1 A;  3BJU A;  5E7N A;  5BR8 Q;  2R7F A;  2D62 A;  4LF8 Q;  5HGQ A;  5M3M H;  5J3B A;  4Y7N H;  3M4Q A;  2B29 A;  1Q46 A;  1L1O B;  1AH9 A;  1X3E A;  4DR1 L;  1P8L A;  4PZ7 A;  4A3F H;  3I2Z A;  4PZ6 A;  3KJP A;  4JYA Q;  2XTI A;  2JE6 I;  1EOV A;  4DK6 C;  2AHO B;  4X6A H;  1CKN A;  2KCT A;  3S14 H;  1IBM L;  3PUV A;  3I4N H;  4WJ3 M;  2UUB Q;  2R93 G;  2I5L X;  1YJW A;  2JA7 H;  3OW2 A;  2JA6 G;  4KLK A;  4OX9 L;  3PUY A;  3HOZ G;  1HNW L;  4R4T A;  3I55 A;  1LUZ A;  4A76 A;  2OQ0 A;  4A3L H;  5IT9 c;  2I5H A;  4GN3 B;  4QL5 A;  1SN8 A;  4GLX A;  1KC8 C;  3CCS A;  1KD1 C;  4A3L G;  1H95 A;  1A8V A;  1JE5 A;  4TVA B;  2C35 B;  5M5X H;  2A19 A;  2K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...