2B2UC

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uC00
4HSVA 3TZDA 3I8ZA 3N52A 4CJ2C 1ICWA 2L4NA 2X6LA 2HCCA 1F9SA 1F9PA 2KUMA 4OIKA 2RVLA 4X3SA 4IUTA 1WTRA 1DZ1A 3FDTA 1G91A 2FFKB 2B2UA 3P7JA 5DNFA 1QNKA 1CM9A 1RTNA 2K05A 2RSOA 1WVLA 1NR2A 1EIGA 2B2YA 1B4OA 5E4XA 2MP1A 1BO0A 3MWYW 1ML0D 1AZPA 1G2SA 2FHTA 1IKMA 1KNEA 1IL8A 3IL8A 1HUMA 1MGSA 1CA5A 1DONA 3KBXA 4RA8A 1U4LA 2JP1A 5CBEE 4NW2A 1RJTA 4XT3B 5EPLA 1KNAA 4ZKBB 3H91A 1WTPA 5EJWA 4DN4M 2FINB 4X3TA 5EQ0A 3G7LA 3ONAB 1HA6A 1CA6A 1HHVA 2Q8RE 1QG7A 2XIWA 2NYZD 1G2TA 1PFMA 4HEDA 1VMPA 3FPUB 3KUPA 1BF4A 2J7ZA 2L12A 1JICA 1G6ZA 4IUVA 1BNZA 2B2UC 2EOTA 2K28A 2X6GA 5T1GA 1HRJA 1PLFA 2CVRA 2EPBA 3I3CA 3SVMA 1PFBA 2B2YC 4OIJA 1VMCA 3D6WA 5D65A 4RAUC 1RTOA 1B53A 1MSHA 2L11A 1X32A 2KEDA 2HDLA 2R3ZA 2M2LA 1J9OA 2JYOA 4XT1B 1X3QA 5D14A 2NZ1D 2K03A 2MJ8A 3Q6SA 5EKIA 1ILQA 1NAPA 3LWEA 5COYA 2FJ2A 1WTWA 2VXWA 1EL0A 1SAPA 1RHPA 2RSNA 2IL8A 1ZXTA 2L1BA 2L9HA 3I90A 2DY7A 1DOLA 1ESRA 4ZAIA 5T1IA 2Q8TA 2BDNA 1X3PA 1B50A 3DM1A 2X69A 3GV3A 1BBXC 1E0BA 2KECA 3UI2A 1TVXA 2FMMA 2MGSA 1WTQA 2K1BA 2B2TC 2B2TA 1F9QA 3DEPA 5JJZA 3R93A 2D9UA 2KOLA 5EPJA 3MTSA 1S4ZA 2K04A 1U4PA 2HUGA 1O7YA 5AFWA 1M8AA 1HFGA 5CMDA 2MPMA 1WD1A 4IUPA 1C8CA 4ZKCB 1RODA 1MI2A 4RWSC 1WTVA 1J8IA 4HCSA 2NWGA 4X3KA 1XYIA 1Q3LA 2N88A 1MSGA 2K01A 4MN3A 3TN2A 3GV6A 4MHEA 1ILPA 3DEOA 1QE6A 4ZLTF 1O80A 4CJ0B 1SDFA 1F2LA 1WTOA 2KVMA 4U68A 5E4WC 2N55A 4O42A 1B3AA 2RA4A 1F9RA 2B2WC 5CBAE 2B2WA 1WTXA 3HP3A 1XX8A 1B2TA 1NCVA 1PDQA 2SDFA 4IUQA 4QUCA 1O7ZA 2HDMA 4X3UA 2HCIA 4QUFA 2B2VC 1AZQA 2H1EA 2B2VA 1AP0A 4LMQD 1DOMA 1LV9A 4IURA 4UAIA 2KEEA 1U4MA 4XDXA 1GUWA 3QO2A 2EE1A 1JE4A 1DOKA 4ZK9B 1EQTA 1NR4A 3I91A 5CORA 1WD0A 1EIHA 1HFNA 1HUNA 1EOTA 1PFNA 4CJ1B 1A15A 1U4RA 4IUUA 4R8IA 3F2UA 2DY8A 4HAEA 1IKLA 4R9WA 5EPKA 1SSOA 3IFDA
chains in the Genus database with same CATH superfamily
5JPMC 4JYAQ 1MIUA 2CQAA 4PQXA 2HT1A 3NENA 4IFDH 2CKZB 2Y0SB 4L5SA 2WACA 5DNFA 5FLXE 4RG1A 4OWTB 2OEOA 2BH2A 1C48A 3CF5A 1TWHH 4A4IA 4GNXC 4F8MA 2DJFC 3S16H 3IL8A 2DNCA 1DONA 1EWIA 2F52A 4JBWA 4XXEA 4RKLA 4ZKBB 2NBFA 4RMFA 1RD9D 2UXBQ 3CW2C 4DV2L 3H09A 1BF4A 2F4IA 2EDGA 1SNMA 3R3OA 5T1GA 4K2KA 3BZDB 4LUVA 1QUQA 4JG2A 1J5EL 1DD2A 2AMCB 2QEJC 1IBKL 2O2LD 2PYKA 3S15H 3CD6A 1KL9A 1EOVA 3N6RA 2R3ZA 1I94L 3T1YL 1PRTD 2MJ8A 3H3VC 2LY7A 1CTMA 5BN3A 1TT2A 1YNJD 2IL8A 4A3CH 3ULPA 4DNTB 4L5RC 5LMUQ 1A8VA 4IZ8A 2ASBA 1TWHB 4QQBX 3OMCA 3DM1A 3S16B 4ZUJA 2PQAB 4KHVA 2MGSA 3C1FA 4Q0FA 2QW7A 3KDFA 3OYYA 1F2ZA 2A1AA 4ZKCB 1MI2A 2NB0A 4ABNA 1Q3LA 3D6CA 5LMNL 1STHA 2KVMA 4C3JG 1D1KA 4F88A 5FOBB 2K5DA 1MJEA 1CZGA 3S15B 5CBAE 3RNUA 3PUXA 4KY6A 1HR0Q 4TSSA 4LMQD 1DOMA 4ID6A 1MHWC 2EVBA 4Y7NH 4B3RQ 1RDPD 4KK7A 1S72A 1WD0A 4NXMQ 2RKSA 3JAMc 1I3QH 4YCWA 4R8IA 3MFGA 3BS1A 4KHPQ 4RCOA 3EROA 1W2BA 1EEFD 1Y8PB 4J1MA 1MBYA 3WOFA 5DM73 1SYGA 3PO2H 2NVXB 2V1CC 2BH8A 5NUCA 1JMCA 4LF6Q 2Z6KC 3SXHA 4LF4L 4NB3A 3RLNA 3EIVA 1K8AC 2PI2E 4HJ8A 4A3IH 1OXUA 1D7QA 1QNKA 3HS0C 2RSOA 1WVLA 1NR2A 1R9TH 1S5CD 3OHXC 3CP0A 3I4NH 1Q8IA 5C4XG 1LTAD 1GUTA 1FVIA 4RA8A 1EQQA 1U4LA 2J0TD 1CZWA 2O5JC 2ZXOA 4GZYC 1GHKA 3A8IE 2RDFA 3MZ5A 1ENAA 3BDLA 4MZ9A 4Y7NB 3NXWA 4CDFC 4JOIC 4GKKQ 1AW7A 2JA5H 3FPUB 2PQAA 3D31A 2F0PA 3E5SA 4K0KL 1I3QB 1BNZA 4YWLA 4AQYQ 1EUJA 3A56A 3OIQA 4JVZA 2EPBA 2B2YC 1IBML 2F0OA 3MC0B 3ULJA 3SGIA 1Y1WH 4L6TB 2LXJA 1SE3A 5GROA 5D14A 1ZYRC 5H1SE 4BBRH 1B9MA 1SEBD 4POFA 4A3IB 2OCEA 1KHIA 3I7FA 1X3EA 2E2DC 3Q24A 1ZXTA 1R9TB 3HOXB 1CUKA 4I7ZC 1GKHA 2CH4A 1ASYA 3I4NB 1DM0B 1JE5A 1JCKB 5A2QL 3I4OA 2WB1G 1HNXQ 1KRSA 1X55A 1Z9FA 5HGQA 2R92H 1WTQA 3BG3A 1GUGA 1UE6A 4PMWA 1L1OC 3NK9A 4X64L 3HZXA 2QILA 1VQGA 2F0KA 2EYLA 4LF9L 2EXDA 1K9MC 1WD1A 1KXLA 4YHHL 2KHJA 4PG3A 4JI0L 1RODA 3A0JA 2K6AA 4LNQA 1J8IA 2JA5B 2AWNA 1OO9B 1BKBA 1I4RA 1Z7TA 3DEOA 4QCLA 1O80A 1WTOA 1X54A 5J1ZA 1KD1C 4OHJA 4DR2L 4R1JA 4JI5L 3ERQA 3URYA 1EFID 5JJKA 4DR5L 2VUMH 2NVYH 4A3EG 5M5XH 3SK5A 3TP8A 2C9OA 5JOBA 4N9TA 1QZGA 4CBVA 1STAA 1I4GA 2K52A 5L37A 4BBRB 1U4MA 2WKDA 5C44H 1QILA 1S3OA 3PO3G 1ENCA 2CCZA 3I91A 4DA2A 4LJZC 1V1OA 2G9DA 3NQIA 1HQRD 4HJAA 1VQPA 3CRKC 5C0XJ 2DY8A 2CW0C 2JK8A 3EA6A 4A3MH 4JYAL 2DGYA 1JT8A 3BZKA 3IFDA 2R92B 2R7ZH 1SYBA 1WCMB 3UE1A 1HZ9A 4GLXA 2IHFA 1LACA 4FXKC 3A8JE 1QNUA 4K6DA 1MD2D 4WFN3 2B2UA 3MXPA 1EQVA 3RZOB 2L15A 1KDAA 1LM0A 4J6HA 4HMJA 3J81j 1AZPA 3IKJA 1VQJA 1AFPA 2VUMB 2NVYB 2UXBL 2E2JH 3EJIA 5M5XB 4DN4M 1IYVA 2KHIA 2Q8RE 1I5FA 2XIWA 5C44B 2RBMA 4DR6Q 2BCOA 1L0YB 3HOYG 5C6AA 4N8X1 3E0JA 4CKEA 1Y14B 3KLSX 1RTOA 2H5XA 1GO3E 2F0QA 2HDLA 1I4QA 5KNCA 4DAMA 1AN8A 2N8NA 2PW5A 1K28A 5FO8B 4K5VA 3R8BA 1RIPA 1FL0A 4GLAC 1NAPA 3GD7A 3KF6B 5COYA 2KENA 3NEMA 5LMUL 4A3JG 1DOLA 3TS0A 3L9AX 3JC66 4A3DG 2R93H 4K5XA 5FJ8H 1EYCA 1JB7A 4DR4Q 4FXGC 3HKZE 5IYDH 1ICFB 4JI8Q 2KOLA 2GA4B 2E2JB 1PVOA 2KCMA 4FF4A 2RCFA 2JA6H 2DUDA 2EJFC 5LL6X 1LTGD 2AUKA 3PGZA 4CJ0B 1B44D 1SDFA 4U68A 3MVVA 4CDCC 4JCVE 4KY5A 1HR0L 1L2FA 1TKWB 4APVA 3A7AB 4B3RL 2F1MA 1CK1A 2B63H 1ZEQX 3BVZA 4NXML 4DPGA 1H9KA 2EE1A 1GUOA 1K8GA 5IP9G 4KHPL 1A15A 5D3IB 4I7AA 1Q7YC 1IKLA 2R93B 3I72A 5C4HA 4LF6L 4FP5D 2ZTDA 4IPGA 2B8FA 2K5HA 3U9OA 4WRDA 4BY1G 4A3FH 1JJ2A 1KRTA 1E7ZA 1H9JA 2JA8H 4JI1Q 4RHSA 1TIID 3GTGH 2JA6B 1SR3A 4HCEA 1RTNA 5LMNW 4A3GG 3BYYB 5ELBA 3NUCA 1PH9A 1RL2A 4HJ5A 1Y8OB 3K7AH 3W2DA 4OX9Q 3KF6A 3K81C 2K5WA 5JEAG 2Z9HA 2ZM6Q 1VS0A 2FMCA 2F3VA 2QGQA 4CHTB 3LNNA 4GKKL 1CA6A 4HIDA 1NTGA 5E1FA 1DCZA 4F87A 4QGUA 4AQYL 1PH1A 3NWSA 3J81E 3TS2A 4OIJA 3D6WA 1GHJA 4UP8A 3RMHA 3MEHA 1RF2D 3NE5B 2L11A 4A3FB 1NE3A 1K0RA 3HOZG 1QWYA 1EYGA 1DGSA 4XT1B 2NN6G 2NZ1D 4WORA 5ELOA 5C4JH 5IGGA 3GTGB 4EQNA 2FJ2A 4AYBE 1WTWA 1SAPA 4P72A 4G7ZC 2RSNA 3AU7A 1EFWA 1T5EA 2BE5C 4DV5Q 1X6OA 1HNXL 4DFAA 3S14H 1QVFA 1SNPA 1Q86C 1QVCA 1JB3A 1CQVA 1KLUD 2EYOA 1K3BC 3UI2A 4L8JA 3K7AB 2B2TA 1MJCA 4J15A 4YIJA 2Z8LA 2K04A 2CWAA 1V9PA 1NSNS 3DMUA 3PUWA 1D2BA 4X3KA 3K8AA 3VYRA 5TSSA 3W3AA 1VQFA 2K01A 4S3SA 4ZLTF 1PRTF 4RCNA 2G9HD 4V190 1VQ6A 2IY5B 2N55A 3E3XA 1VQHA 4IUNA 3CQZB 3C3LA 3L2PA 2ZTCA 1NCVA 4A3KH 5ELFA 3I4MG 4A3LG 2KEEA 2NN6I 3ZJYC 1GUWA 5C4JB 1DOKA 3FKIG 1K8OA 5IGBA 2N78A 4K8IA 3VR6A 3F2UA 3T13A 4HAEA 4LAAA 4R9WA 3S14B 4OGQC 4LF5Q 1STBA 1A0IA 4BBSG 1LT3D 2F0VA 3K5OA 4C1NK 1D5MC 4OWWB 1JOOA 1BCPD 3GTMH 3OWFA 1FGUA 1GUSA 2JJQA 1SYFA 2R6GA 4C2MH 3A8KE 3J80L 3S17H 1JJCB 4BWGB 4JI2Q 1PH8A 1GM5A 3FHWA 3HOWB 4JI6Q 3H15A 4A3KB 5EQ0A 3ONAB 3J81L 4TVAB 3UDFA 4EQ5A 2LFNA 4DR6L 2M00A 5JEAJ 1SMYD 4HSPA 2PZTA 2UU9Q 3RZDH 2XRQD 1EU4A 4ME5A 2M2LA 1OXSC 1B7YB 1X3GA 2K03A 1UEBA 2ENBA 5C3WA 5M3FB 5IE8A 2Q2UA 2L9HA 3K0XA 1EZ6A 3C2PA 2XNAC 1Z47A 4DR4L 3EQLC 1Q81C 2NVTH 4JI8L 2PPBC 3CPWA 3DHQA 1EQRA 2IWHA 4KMUC 2D9UA 3PSIA 5JVH3 3GTOB 4A93G 1BVSA 2XTIA 2NWGA 3PQIA 4R4OA 4UHVA 3RZDB 3KJPA 3L7ZC 1WYDA 5GAEC 2OXPA 4X62Q 1O7ZA 3K5NA 3MFYA 1VQMA 2YTXA 2P5ZX 3NELA 2EY5A 1TXYA 1YHQA 1QUQB 1RKNA 4Z9CB 1R4PB 2DNEA 3PUVA 2A69D 3U50C 3DUZA 2J4XA 5IYCG 2Q2IA 5CR3A 2NVTB 2F0GA 3RLFA 4C3JH 4JI1L 5EKLA 2KHSA 5HURA 5IT9E 4BA1I 4UP7A 3J80c 1WTRA 1LLRD 3P20A 4GN4B 1TS5A 1B4OA 2VZAA 1BR9A 4BY7B 3MWYW 2E2HH 1VQ7A 1X9NA 3OSOA 3KDFB 1HR0W 2UUBQ 2RDGA 4OX9L 3J81c 5C3EG 2JP1A 2ZM6L 1VQ9A 1FJGQ 2MO1A 4P2CB 1XJVA 1HTLD 4X3TA 3G7LA 2LS01 5CC4A 3GTQH 1VF7A 1H95A 1FGBD 4G7HC 3VYSA 1NMGA 4AH6A 1SNQA 1PH6A 1PLFA 1NY4A 2CVRA 1LABA 3CC4A 1H9RA 4MTKA 3OPOA 2A6ED 5C4XH 4DR3Q 2CQOA 1HH2P 3OW2A 4EQPA 2VXWA 4DV5L 3JAMi 4YCUA 4MTNA 3I90A 1BBXC 2OWOA 4DK1A 5CV9A 3T53B 1VQLA 4GOPB 2FMMA 1OXTA 2B2TC 4FNFA 4IJHA 1PTOH 3MTSA 3G71A 1KABA 1XTDA 2MPMA 3GTQB 2PNHA 1SFOH 1AH9A 5D3DA 4IQZA 3HKSA 2A5HA 3ULLA 4XYOA 1HA5A 1JJGA 5HY6A 3TN2A 1JWMD 3M85A 3S1MH 1EIYB 1O7LA 5M3MG 4O42A 2VY3A 2F0NA 3TP7A 4Q5VA 5DM63 2RF4A 1CT1D 5GQOA 5KYLA 2HIXA 3MAQA 4R4QA 1CKOA 5EBDA 1EWHA 4QY7A 1EYAA 3BJUA 3HFZB 1JOKA 2K5NA 2K7VA 4R8NA 1TQOA 4KI0A 1LTBD 4H0LC 2LKVA 3RUZA 3PF5A 3TBIB 1A2UA 4LF5L 2WP8J 3G4SA 2WAQB 2JE6I 4A3BG 1HCZA 2IT1A 4F7XA 5KNDA 4CJ2C 2XN9C 3F2CA 3DWPA 1IBLQ 2GVAA 3MA2B 4YCVA 2A68C 1DZ1A 4A3EH 1AE2A 1Y1VG 1CM9A 3STBC 4NXNQ 3CHBD 5GAGC 2Z0SA 3G6JB 3Q0AA 1BO0A 1SYCA 4JI2L 3RN2A 3PO3H 1MGSA 1SE4A 3KLSA 4JI6L 5EGTA 2Y0SE 1STEA 2JEAI 4G4KA 5FLXL 1O78A 1QG7A 4PZ8A 1PFMA 1VMPA 3K6OA 2L12A 1JICA 3F1ZA 1FR3A 4GOPA 1G6ZA 1E2VA 4C1NI 2UU9L 2EOTA 2PQEA 4NDXA 2ZTEA 1LT6D 3CCQA 4FO2A 1SNCA 1X32A 1YHBA 4JW0A 3RN5A 1J9OA 1PFSA 3DWAA 5CV5A 3Q6SA 1C9OA 4K8JA 2KCCA 4A3EB 3MXNB 3AQQA 4B08A 1VQNA 1RHPA 4XQJA 1S40A 2Q8IB 1NUCA 2MNAA 2EIFA 3RLOA 2F0MA 1E24A 2X69A 2I5LX 3HOYH 4GKJQ 3T56B 3QOLA 3W1BA 5GADC 3PO2B 1C8CA 3QR8A 2KCTA 4OXPA 4LFBQ 1SYDA 3CU7A 3FP9A 2CWPA 1TU2B 1U0LA 4RGOS 5EAYA 4CDDC 4C3IG 1B3AA 4HIMA 2EQSA 1H9SB 3EVQA 4A3JH 4X62L 1XTCD 1XX8A 1P16A 3M3YH 3NWTA 1S5DD 3M7GA 1G291 1SMXA 4A3DH 5E3FA 3EFXD 4HJ7A 5I4DA 4C3HG 1VQBA 2A19A 4XDXA 1LT4D 1STYA 3CCSA 1YVCA 2EYJA 3H94A 2WAQE 1PTOF 4CKCA 2F0WA 1JOQA 1BBUA 4HIKA 1N36Q 4LF7Q 2YTYA 1IHZA 3HOYB 5ELEA 1YJWA 2L4NA 2A6HC 3VYUA 3WWVA 1ZYRD 2HHHQ 4TKOB 2OQKA 1Y1WB 1LYLA 2FFKB 2BA1A 2GN5A 3RD4A 1DYQA 1DXMA 4KD4A 1ML0D 2FHTA 2UUBL 5IYBH 5IP9H 3TP5A 5FLXc 1FJGL 1VQKA 2IX1A 4A3JB 3M3YB 4NW2A 4B3TQ 3MXNA 3H6MA 3S1NH 2EY1A 2F0TA 5EJWA 2M9VA 1YNNC 3V05A 3AFPA 3S1RH 4BY1H 1OXXK 5EKKA 2E2IH 1LUZA 5M9OA 2F0EA 2D0OA 2HQLA 3C46A 1BCPF 4GN5A 1D6EC 4A3GH 1VMCA 4RHRA 4DR3L 1MSHA 2KEDA 4PV1C 1D5ZC 1D1IA 3UDXA 2EY6A 3PIO3 2K33A 1D8LA 4QMGA 4KJOA 5JEAH 3VA5A 3HOVH 1H9SA 3AMUA 4LUZA 1TWFH 3LGJA 4QL5A 2Q8TA 4DV0Q 1XXGA 2CW0D 2QEXA 3CCVA 1YZ6A 2F0UA 3FMCA 3HOXG 3NSWA 3I4NG 5DLQE 2B8GA 3J7AF 2MO0A 1N32Q 3S1NB 4H02A 4A3MB 3M4OH 1PZJD 2R7ZB 1Q90A 3HOZH 4PNYA 3CRLC 2E2IB 4BXXH 2NN6H 3I70A 2MUYA 1JC7A 3HEJA 1ET6A 2AWOA 2EYFA 3HKZG 2B2WA 2JA7G 3CC7A 4B3SQ 4IUQA 2I0QA 5IP7G 5A35A 3CXCA 1XNQQ 3G48A 3ERSX 3NTKA 1LTSD 3ER0A 3HOVB 3D4DA 1HUNA 1EOTA 1PFNA 4CJ1B 3FPPA 1TWFB 3X3NA 3TEHB 3GTJH 3GTKH 2Z6BA 3SK4A 1B1ZA 1EY8A 2YV5A 2V4DA 2EJMA 4U673 1IBLL 4EVOA 4P75A 1PYBA 3CCEA 3ND9A 2X6LA 3U58A 3S2DH 4IO9A 3M4OB 1A63A 4IUTA 1WCMG 4NXNL 1L0XB 2K5QA 1SJED 3K57A 1EY6A 1XPUA 5G3LF 3I4MH 4A3LH 1PZKD 1EYDA 1PRTB 2MP1A 5HGTA 1IKMA 1RCVD 3FKIH 3TDQA 1XPRA 1SE8A 2UXCQ 4M8AA 2FXQA 5C5MA 4DR1Q 1NBWA 2YTVA 4BBSH 3FRPB 2PO4A 3BVMA 1HHVA 3K5MA 1HZCA 2MFIA 4DV4Q 1UE5A 5IGFA 2UUCQ 3GTKB 4HIOA 3S9WA 3PIP3 5BR8Q 5D65A 3TREA 4DK3C 1XMOQ 5IGEA 5LHY1 4DGZA 2RHQB 4QF4A 1PYSB 3GTPH 2I46A 4JI4Q 1CKNB 1F2MA 2IHEA 4JPBW 3LX0A 3PUYA 3I2ZA 3GO5A 2B63B 5IGDA 3I4MB 3W1GA 3FKIB 4GKJL 3AYHB 2PMZB 3WDNA 1K0SA 4Y52H 5CV7A 3A54A 1F9QA 3VYTA 3NTIA 3QOJA 4HJ9A 4OELB 3UE0A 1BQQT 4AYBG 4LFBL 1I4PA 1ZKOA 4KHZA 1ET9A 3QB3A 4IJLA 5C5LA 2JA8B 2SNMA 2BA0A 3Q23A 1EIHA 2KA7A 2SNSA 2K4KA 5IIFA 2RQXA 3M9BA 1XMQQ 2L0CA 4GN3B 4BS9A 1U5KA 4XQNA 1EZ8A 4QUCA 2CHBD 2HCIA 1F77A 4QUFA 1E22A 1QCBD 1LV9A 3D3RA 1Z6HA 3NHHA 2O5IC 2ALYB 1PTOD 4GNXA 3I55A 4A93H 1BBWA 4IUUA 1UUPA 1N36L 3QIAA 4LF7L 2L5TA 3H0GG 2NZHA 3LWUA 4KKTA 2G5DA 3TZDA 1OTCA 2HHHL 1XNRQ 1E2WA 1QOHA 1YITA 5FJ8G 1G91A 1I6VC 4L5TA 3CPFA 1QJOA 2XRSD 3HG9A 5I2YA 2K05A 3KJOA 1A3VA 1TWCH 4FYDA 3F2BA 1VQIA 4JI3Q 1HUMA 1S5BD 3I73A 2VS1A 4B3TL 4DF7A 1ESFA 3V96A 4DUYQ 1IL2A 1I6HH 5IYCH 1CKNA 3HRZC 4DV1Q 3J7ZC 2F0IA 1G8ZD 4LFCQ 1E3PA 4O2DA 4XQQA 2B2UC 3TQYA 4L63B 3I3CA 3TSSA 1PFBA 4HTHA 4HMIA 2NUCA 4ZYSA 2IW3A 5KRUA 3NBHB 1J6QA 5C3EH 4PZ6A 1SMYC 4A3FG 3CC2A 1SN8A 4DUZQ 1K83H 3LWEA 1KIXA 2PMZE 2F0HA 2CFMA 3H3VI 4IPDA 4DV0L 1KQSA 4OO1G 1TWCB 2DY7A 1I4HA 4P71A 1X3PA 1IW7D 3TRZA 1TVXA 1N32L 3TZUA 1I6HB 5JJZA 3R93A 4DV3Q 2K75A 4NPSA 3J80i 2HD3A 1T9HA 3E9HA 4HCSA 3KFUA 2XSCA 2TSSA 5E4WC 4RGNA 3GTMB 2QKIC 3T51B 1B9NA 2B2WC 4B3SL 1PH5A 3JAME 4C2MB 2EYHA 1Y69U 3S17B 4JK1C 1XNQL 1HNWQ 4X3UA 1AZQA 1C7YA 1JORA 4KD3A 2PNRC 2H1EA 4X65Q 4WJ4A 5FK9C 5C3EB 3S1QH 1FYCA 1JE4A 4JBJA 4QJFA 3VR5A 2PZUA 4LW1A 3HOUG 3PIOA 3P1HA 5KEEA 4YY3Q 1I50H 2JSOA 3I8ZA 4JOIA 4C56C 5M3MH 2UXDQ 2N49A 3KF8A 1KLGD 2HCCA 1W6JA 2A69C 2C35B 2O4XA 2HIVA 1T5XD 1VQ4A 5G3LD 4LF8Q 2B2YA 3K58A 4L5QA 1O7IA 3NBHA 1IL8A 2UXCL 1EY5A 4DR1L 1TWGH 2B3GA 4FF3A 1RJTA 4XT3B 5EPLA 4LWCA 2FINB 3MXGA 1HA6A 4A3BH 2ZXPA 3M4PA 2Z4HA 1S5ED 4DV4L 1JWUD 2CH4W 3VR3A 2NYZD 4KY7A 2N3SA 3S1QB 4J8QA 1Q1EA 3HOWG 2UUCL 2VQEQ 2MQHA 1A3UA 5KIXA 1TR5A 5BR8L 3I4LA 1IYJB 2L55A 1L1OA 1Y1VH 3SDZA 4ZQ3A 1K73C 1EY9A 1XMOL 4RAUC 1B53A 1PXUA 5FO9B 1YIJA 1I50B 1QB5D 2JYOA 4JI4L 4WJ3M 1YJ9A 3PV0A 1Q82C 5EKIA 3PUZA 2K32A 2E5LQ 1EL0A 2F3IA 1F2YA 2I07B 3M7NA 2EZVA 1TY2A 5M3FG 3RR5A 1HZAA 2DN8A 5T1IA 1EU3A 4I65A 4R4CA 4XIGS 3MEFA 1STGA 4YWMA 1TWGB 1DJRD 3GP7A 4NMZA 3SK6A 3D4RA 3AFQA 1PH4A 2F03A 5AFWA 1M8AA 5CMDA 5FLMG 2QA4A 3P75A 4C3JB 5IY0A 1WTVA 5JAVA 3JAML 1XMQL 2JEBI 2ZJQA 4CDEC 4X66Q 5IOCA 2I5HA 2RDHA 1Y1VB 2RA4A 3KLRA 1PH2A 1F9RA 3V2TA 4ALPA 1LTTD 1WTXA 2E75C 3D0FA 3ITPA 3I56A 2E2HB 1NNXA 4IALA 2PCFB 2B2VA 4LK1C 1PRTC 2E76C 1PA6A 3FEWX 1YNJC 3KLWA 4ZK9B 1LT5D 3PIPA 3DWQA 3E6ZX 1M1KC 1U4RA 2IPKD 2XVSA 1PH7A 5ELDA 1L0WA 3CCUA 1XNRL 4NP5A 1EY7A 4C3IH 2LMCB 1HZBA 5CYUA 5C4XB 2E8GA 3K5LA 1WJJA 4C3HH 2R7FA 4JI3L 4IOCA 4K14A 1FNUA 1PZID 3UDGA 4N8FA 4DK0A 1Q1BA 3SEBA 4DUYL 3KBXA 4DV1L 3VA7A 4BY7G 5IT9L 5CBEE 5I6YA 1KNAA 2IX0A 2WIIB 5K5PA 4LFCL 3A5UA 1HPCA 1JR0D 1A6XA 1TS2A 4GS3A 1YNXA 4OL7A 2AHOB 3TMEA 4CGYB 1G2TA 1A2TA 3KUPA 1BOSA 1PTOB 2NVXH 5K36G 1E1TA 1SFOB 1LTLA 4DV7Q 3FVQA 5A2QE 4ULLA 2Y0SG 3S1MB 2QDBA 3GTLH 2PW7A 3GDEA 1SJHD 5FKAC 1A62A 2NTSA 1B70B 4DXFA 1X3QA 4O1NA 4C3IB 2D2CC 3EBEA 4DUZL 2RCNA 1NJIC 2F4VQ 2VQFQ 2WB1B 2ICIA 4UY8C 2JQOA 2A74C 4C3HB 2L1BA 3IAYA 1PYWD 4ZAIA 3WOEA 2UUAQ 5IODA 2YU9H 1GD7A 4DAYB 1CHQD 2KECA 5C0XG 1YI2A 1VQCA 1SROA 4PMCA 4DV3L 1M4VA 2PI2A 3B6YA 4JBMA 5EPJA 4JV5Q 3G6EA 3AEVA 1U4PA 1O7YA 2A68D 5I2XA 4IUPA 1PHJA 3STBD 1G51A 4MN3A 5AJ3Q 3K80C 1JQYD 3QG1A 1V1QA 1E2ZA 1F2LA 2OF1A 1BCPB 4KLKA 3CMAA 4TQUS 4FF1A 1CI3M 3X3MA 2Q2TA 1HNWL 1YBYA 3BVGA 2JN4A 4IFDG 3CCMA 1YJNA 2WINB 4X65L 3GTLB 1UE7A 2AKWB 5CV6A 3PO3B 2HDMA 5LL6S 4DKAC 1AP0A 3HOXH 4A76A 1KAAA 2F0FA 2XGTA 3A5ZB 4MIUA 3O13A 1LO5D 1LTRD 2ZT9C 4P74A 3T4AC 5J39A 4GLVB 5EPKA 2YU9B 4YY3L 5DEHA 1Q8KA 3L0OA 1W3SA 2UXDL 5C0XI 2XWJB 4DNIA 2WAQG 4G7OC 2JA7H 1GJXA 4LF8L 5IP7H 2GVBA 1BDOA 5I9OA 1EIGA 5E4XA 5IT9c 1TS4A 4QIWB 1N33Q 1CA5A 2B29A 5J22A 4LUOA 1ENFA 4IFDI 4DNRB 4OEMB 1GUNA 2Z1CA 5KGUA 4A3CG 4UDUC 3CCLA 2VQEL 4DAYA 1G6PA 1TS3A 3K0YA 4LFAQ 1WCMH 2X6GA 5IGCA 1SRUA 3R2IA 3K59A 3CKIB 2I5MX 2WFWA 2WB1E 3RZOH 3HKZB 5KYIA 2KBNA 2E5LL 4DK6C 2JA7B 1N9WA 3EN2A 1EY4A 4A3DB 3S2HH 1STNA 4RGMA 3U4ZA 3U9SA 5KNBA 2F0SA 4YWKA 3OTOQ 1AEXA 3KBGA 4JC0A 1XPOA 2LXKA 3M4QA 2AQ1B 4ZCKA 3D8GA 2A6HD 2HUGA 1N34Q 3CMEA 1KTKA 1BXTA 1V43A 5I9PA 2EYMA 2AQ3B 2N88A 1MSGA 3DLLA 3PO2G 4MHEA 4X66L 1ILPA 4OWXB 2TMPA 4A3IG 2SDFA 1LTID 3BZCA 2B2VC 1WTHA 3SR1A 1YNND 2NTTA 3BYTB 4IFDJ 3E0EA 1CHPD 2VB3X 3S2HB 3S1RB 1W6KA 4BY1B 2VNUD 1FNWA 2EJGC 4KKUA 4HSVA 5ELNA 4AIMA 1GVPA 2JA5G 2OTJA 1ICWA 4A3GB 1D5XC 3T1HQ 4QIWE 1SNDA 4N9PA 5M5YH 2AUJD 1P8LA 4JBKA 1UWVA 4B3MQ 1Y1WG 5M5WH 3AB9A 4PMBA 3HGBA 4BBRG 3ND8A 3OIPA 1Y8NB 3TP6A 5IWAQ 4XTCS 5C4ZA 2BDOA 3H0GH 4MNOA 3OW7A 4DU9A 4DR7Q 2EYPA 4KN7C 1ONLA 2J7ZA 4DV6Q 3OOCA 4AYBB 2R92G 4DV7L 3H3VH 4M1UB 3HOZB 2ZJPA 3Q8DA 1BUVT 2PZWA 1VCIA 2R61A 4FXDA 4HN7A 2OT2A 2B39A 1S5FD 5ELCA 4GNXB 3S24A 2HQEA 2D62A 2F4VL 2NVQH 2EXZA 2VQFL 2D5DA 3KK7A 3F2DA 3UDIA 1VQ8A 5M5YB 1NMFA 2UUAL 2VUMG 2RHSB 2E74C 2LSSA 5M5WB 3GV3A 4GOPC 1E0BA 4WJWA 3PCOB 3GTJB 4JV5L 2QDLA 5C44G 3DEPA 5IYBG 1S4ZA 3SE0A 3H0GB 4ODGA 2SOBA 1HFGA 1VQDA 5CGKA 5AJ3L 3NBIA 1UE1A 4A3MG 1HXYD 3S2DB 4JI7Q 1QE6A 4POGA 2R7ZG 2K50A 2QCPX 4RFBA 3K7UC 2F0JA 4OO1H 3M4YA 3HP3A 1B2TA 1II3A 1V1PB 1B3QA 1CFMA 4FDBA 4FF2A 2NVQB 3QO2A 1UAPA 3L3OC 3IRBA 1EQTA 1HFNA 1XWEA 4H13C 1SE2A 1Q46A 1HNZQ 4BBSB 1IZ6A 4ME3A 2VB2X 1CSQA 4CKBA 3J80E 4K2LA 3HOVG 1Q12A 2F0LA 1X3FA 5J3BA 1UEAB 1VQ5A 5CV4A 1PTOC 3PF4A 1F9SA 1FNVA 1IYUA 5C3XA 3P7JA 3GQBA 4ZUIA 4EGVA 1VF5C 4B9WA 3CQZH 1OXVA 2K5VA 4ZRZA 1KDBA 3GTPB 1N33L 1VQEA 4IPHA 1EWCA 4BXXG 1TY0A 4EX5A 4OONA 1K8MA 2ZJRA 3A7LA 3HOUH 2WV6D 2ZXRA 2ES2A 1SBBB 3CCRA 3MHBA 5GAHC 4DV2Q 4HEDA 2R93G 4LFAL 1EY0A 4KKSA 1E1OA 1HRJA 5IYDG 1J5EQ 3SVMA 5ISRA 4TRDA 2BE5D 4PZ7A 1IBKQ 2WKCA 2JA6G 3ICEA 1VQAA 4RGTA 4KJNA 3Q22A 1IXRA 1BCPC 4A75A 1I94Q 4V0BA 3T1YQ 1MKHA 3QJYA 1ASZA 3R2TA 3OTOL 1ESRA 3HOWH 1V1PA 2OQ0A 3F8TA 2ID0A 3KF8B 3KYHC 3T16A 3BDOA 4HR7B 2K1BA 2B63G 4A93B 2IJ0A 1N34L 3HOUB 1PV4A 2VL6A 4EQOA 1IW7C 3ZYYX 4RKBA 1XYIA 3IFTA 3GV6A 4R4IA 1KDCA 3W5OA 5LMNQ 4UPAA 4K6LA 2JA8G 1QZHA 4P73A 2KQ3A 2K14A 4H44C 5M3FH 2R7DA 3NP8A 3SHLA 2XWBB 1VQOA 4UAIA 1N8RC 3A74A 1WFQA 1X56A 1L1OB 1C0AA 2Z4IA 5FLMH 1C4QA 1X65A 3BDCA 1FD7D 4QB4A 4O0AA 3PMFA 2F0DA 3BU2A 3GTOH 3N52A 2Z6KA 4DAPA 4K5WA 3T1HL 4LF4Q 3A55A 3DM3A 1F9PA 2KUMA 2EY2A 2RVLA 2SEBD 4OIKA 1PMRA 4UP9A 3FDTA 2MHVA 4X3SA 3J81i 3NQTA 2IX3A 3J7AV 4IOAA 4ILWA 2H4OA 4B3ML 5I6WA 4RH6A 3VR4A 1EIFA 1HJPA 4DXGA 1K3RA 1G2SA 1V8QA 1KNEA 1K83B 5FO7B 2A8VA 2AQ2B 4KTAA 1SNOA 5IWAL 2ICEC 2A73B 3MXUA 4OO1I 1CQFA 4G57A 1H9MA 1YEZA 3H91A 1WTPA 4DR7L 3DXJC 2JXMB 3CCJA 2F3WA 1QVGA 3SK8A 4H7BA 4DV6L 3C1EA 4IUVA 4NKLA 1KAWA 2NZOA 4KN4C 3CAMA 2K28A 4K0KQ 5BN5A 2ATWA 1U9RA 1AE3A 3QWNA 5F2DA 1IBMQ 1A3TA 4IPCA 1SXTA 1I4XA 2D0PA 5CV8A 3NPPA 4BY7H 1ILQA 1KC8C 2KJXA 1GXDC 1HTPA 1TWAH 2OTLA 3VDYA 4IN3A 4E6IA 1SYEA 2BDNA 1HQMC 1B50A 4A3KG 2DJGC 5K36H 5JJIA 2QF7A 2KCNA 2YYZA 3OMGA 5EBCA 4X6AH 4X64Q 1WI5A 1JWSD 3J7YW 4LF9Q 4RWSC 5M3MB 3J7A5 4YHHQ 4JI7L 4JI0Q 1VDZA 1GOZA 5JJLA 4B9XA 3OWEB 5DAUA 5E7NA 4KV6A 1B8AA 1WOCA 5JVG3 4BA2I 1PH3A 1UNSA 2C5CA 1YHAA 4FVMA 2A6EC 4DR2Q 4JI5Q 1M90C 1SLJA 4DR5Q 1PDQA 4DAVA 3D4WA 2BOSA 3E9IA 4XYQA 5C0XH 1CSPA 1CKMA 4IURA 2VW9A 2Q2HA 1R4QB 1NR4A 1HNZL 5CORA 1TWAB 5JPNC 2JA9A 3U4VA 3KOJA 4A3BB 1EEID 4R4TA 3VR2A 3NTHA 5BN4A 1SSOA
chains in the Genus database with same CATH topology
5JPMC 2CQAA 4PQXA 4IFDH 2Y0SB 2WACA 5DNFA 5FLXE 2OEOA 1C48A 4F8MA 3IL8A 2DNCA 1DONA 4JBWA 4XXEA 4RKLA 4ZKBB 2NBFA 1RD9D 3H09A 1BF4A 2F4IA 2EDGA 1SNMA 3R3OA 5T1GA 4K2KA 3BZDB 1DD2A 2QEJC 2O2LD 2PYKA 3N6RA 2R3ZA 1PRTD 2MJ8A 3H3VC 2LY7A 1CTMA 5BN3A 1TT2A 1YNJD 2IL8A 4DNTB 4IZ8A 1TWHB 3OMCA 3DM1A 3S16B 4ZUJA 4KHVA 2MGSA 3C1FA 4Q0FA 1F2ZA 4ZKCB 1MI2A 2NB0A 4ABNA 1Q3LA 3D6CA 1STHA 2KVMA 4C3JG 1D1KA 4F88A 5FOBB 2K5DA 1CZGA 3S15B 5CBAE 3PUXA 4KY6A 4TSSA 4LMQD 1DOMA 4ID6A 2EVBA 1RDPD 4KK7A 1WD0A 2RKSA 4R8IA 3MFGA 3BS1A 4RCOA 3EROA 1EEFD 1Y8PB 4J1MA 1MBYA 3WOFA 5DM73 1SYGA 2NVXB 5NUCA 3SXHA 1OXUA 1QNKA 3HS0C 2RSOA 1WVLA 1NR2A 1S5CD 3OHXC 1Q8IA 1LTAD 1GUTA 4RA8A 1U4LA 2J0TD 1CZWA 2O5JC 2ZXOA 4GZYC 1GHKA 3A8IE 2RDFA 3MZ5A 1ENAA 3BDLA 4Y7NB 3NXWA 1AW7A 3FPUB 3D31A 2F0PA 3E5SA 1I3QB 1BNZA 3A56A 3OIQA 2EPBA 2B2YC 2F0OA 3MC0B 4L6TB 1SE3A 5D14A 1ZYRC 1B9MA 1SEBD 4A3IB 2E2DC 3Q24A 1ZXTA 1R9TB 3HOXB 4I7ZC 3I4NB 1DM0B 5A2QL 1JCKB 1WTQA 3BG3A 1GUGA 4PMWA 3NK9A 3HZXA 2QILA 2F0KA 2EYLA 1WD1A 1RODA 2K6AA 1J8IA 2JA5B 2AWNA 1OO9B 1I4RA 1Z7TA 3DEOA 4QCLA 1O80A 1WTOA 5J1ZA 4OHJA 3ERQA 3URYA 1EFID 3SK5A 3TP8A 2C9OA 5JOBA 4N9TA 4CBVA 1STAA 1I4GA 4BBRB 1U4MA 2WKDA 1QILA 1ENCA 3I91A 4DA2A 4LJZC 1V1OA 2G9DA 3NQIA 1HQRD 3CRKC 5C0XJ 2DY8A 2CW0C 3EA6A 3IFDA 2R92B 1SYBA 1WCMB 1LACA 4FXKC 3A8JE 1QNUA 4K6DA 1MD2D 4WFN3 2B2UA 3MXPA 1EQVA 3RZOB 1KDAA 4J6HA 4HMJA 1AZPA 3IKJA 1AFPA 2VUMB 2NVYB 3EJIA 5M5XB 4DN4M 1IYVA 2Q8RE 2XIWA 5C44B 2RBMA 2BCOA 1L0YB 5C6AA 3E0JA 4CKEA 3KLSX 1RTOA 2F0QA 2HDLA 1I4QA 5KNCA 1AN8A 5FO8B 2PW5A 4K5VA 3R8BA 1NAPA 3GD7A 5COYA 1DOLA 3L9AX 4K5XA 1EYCA 4FXGC 2E2JB 2KOLA 2GA4B 4FF4A 2EJFC 5LL6X 1LTGD 2AUKA 4CJ0B 1B44D 1SDFA 4U68A 3MVVA 4KY5A 1TKWB 3A7AB 2F1MA 1CK1A 1ZEQX 3BVZA 1H9KA 2EE1A 1GUOA 1A15A 5D3IB 1IKLA 2R93B 3I72A 5C4HA 4FP5D 2B8FA 3U9OA 4WRDA 1H9JA 4RHSA 1TIID 2JA6B 4HCEA 1RTNA 3BYYB 5ELBA 3NUCA 1Y8OB 3W2DA 2K5WA 5JEAG 2FMCA 2F3VA 4CHTB 3LNNA 1CA6A 5E1FA 1DCZA 4F87A 3NWSA 3J81E 4OIJA 3D6WA 1GHJA 3RMHA 3MEHA 1RF2D 3NE5B 2L11A 4A3FB 1QWYA 4XT1B 2NN6G 2NZ1D 4WORA 5IGGA 3GTGB 4EQNA 2FJ2A 1WTWA 1SAPA 4G7ZC 2RSNA 3AU7A 1T5EA 2BE5C 4DFAA 1SNPA 2EYOA 1JB3A 1CQVA 1KLUD 3UI2A 4L8JA 3K7AB 2B2TA 4YIJA 2Z8LA 2K04A 1NSNS 3DMUA 3PUWA 1D2BA 4X3KA 3VYRA 5TSSA 3W3AA 2K01A 4S3SA 4ZLTF 1PRTF 4RCNA 2G9HD 4V190 2N55A 4IUNA 3CQZB 3C3LA 1NCVA 5ELFA 2KEEA 2NN6I 1GUWA 5C4JB 1DOKA 1K8OA 5IGBA 4K8IA 3VR6A 3F2UA 3T13A 4HAEA 4LAAA 4R9WA 3S14B 4OGQC 1STBA 1LT3D 2F0VA 3K5OA 4C1NK 1D5MC 1JOOA 1BCPD 3OWFA 1GUSA 1SYFA 2R6GA 3J80L 3A8KE 4BWGB 3HOWB 4A3KB 5EQ0A 3ONAB 3J81L 2LFNA 2M00A 5JEAJ 1SMYD 4HSPA 2PZTA 2XRQD 1EU4A 4ME5A 2M2LA 1OXSC 2K03A 5M3FB 2ENBA 5C3WA 2L9HA 1EZ6A 3C2PA 2XNAC 1Z47A 3EQLC 2PPBC 3DHQA 2IWHA 4KMUC 2D9UA 5JVH3 3GTOB 2NWGA 3RZDB 3L7ZC 2OXPA 1O7ZA 3K5NA 3MFYA 2EY5A 1RKNA 4Z9CB 1R4PB 2DNEA 3PUVA 2A69D 3DUZA 2J4XA 5CR3A 2NVTB 2F0GA 3RLFA 5EKLA 2KHSA 5HURA 5IT9E 4BA1I 1WTRA 1LLRD 3P20A 1TS5A 1B4OA 1BR9A 4BY7B 3MWYW 3OSOA 2RDGA 2JP1A 4P2CB 1HTLD 4X3TA 3G7LA 2LS01 5CC4A 1VF7A 1FGBD 4G7HC 3VYSA 1SNQA 1PLFA 2CVRA 1LABA 1H9RA 3OPOA 2A6ED 4EQPA 2VXWA 3I90A 1BBXC 4DK1A 5CV9A 3T53B 2FMMA 1OXTA 2B2TC 4FNFA 1PTOH 3MTSA 1KABA 2MPMA 3GTQB 5D3DA 4IQZA 2A5HA 4XYOA 1HA5A 3TN2A 1JWMD 3M85A 1O7LA 4O42A 3TP7A 2F0NA 4Q5VA 5DM63 1CT1D 5KYLA 3MAQA 5EBDA 1EWHA 1EYAA 1JOKA 2K7VA 4R8NA 1TQOA 4KI0A 1LTBD 4H0LC 2LKVA 3RUZA 3TBIB 1A2UA 2WP8J 2WAQB 2JE6I 1HCZA 2IT1A 4F7XA 5KNDA 4CJ2C 2XN9C 3DWPA 3MA2B 2A68C 1DZ1A 1CM9A 3CHBD 3Q0AA 3G6JB 1BO0A 1SYCA 1MGSA 1SE4A 3KLSA 5EGTA 1STEA 2JEAI 4G4KA 5FLXL 1O78A 1QG7A 1PFMA 1VMPA 3K6OA 2L12A 1JICA 1FR3A 1G6ZA 1E2VA 4C1NI 2EOTA 2PQEA 4NDXA 1LT6D 4FO2A 1SNCA 1X32A 1J9OA 3DWAA 5CV5A 3Q6SA 4K8JA 2KCCA 4A3EB 4B08A 1RHPA 4XQJA 2Q8IB 1NUCA 2F0MA 2X69A 3T56B 3QOLA 3PO2B 1C8CA 1SYDA 3CU7A 1TU2B 4RGOS 4C3IG 1B3AA 1H9SB 3EVQA 1XTCD 1XX8A 3NWTA 1S5DD 3M7GA 1G291 5E3FA 3EFXD 5I4DA 4C3HG 4XDXA 1STYA 1LT4D 2EYJA 3H94A 1PTOF 4CKCA 2F0WA 1JOQA 1IHZA 3HOYB 5ELEA 2L4NA 2A6HC 3VYUA 1ZYRD 4TKOB 1Y1WB 2FFKB 2BA1A 3RD4A 1DYQA 1DXMA 4KD4A 1ML0D 2FHTA 3TP5A 2IX1A 4A3JB 3M3YB 4NW2A 3MXNA 3H6MA 2EY1A 2F0TA 5EJWA 2M9VA 1YNNC 3V05A 1OXXK 5EKKA 5M9OA 2F0EA 3C46A 1BCPF 1D6EC 1VMCA 4RHRA 1MSHA 2KEDA 4PV1C 1D5ZC 1D1IA 2EY6A 3PIO3 2K33A 4QMGA 4KJOA 5JEAH 3VA5A 1H9SA 3AMUA 2Q8TA 1XXGA 2CW0D 2F0UA 3FMCA 3NSWA 3J7AF 2B8GA 3S1NB 4A3MB 1PZJD 2R7ZB 1Q90A 4PNYA 3CRLC 2E2IB 2NN6H 3I70A 2MUYA 1JC7A 3HEJA 1ET6A 2AWOA 2EYFA 2B2WA 4IUQA 5A35A 3NTKA 1LTSD 3HOVB 3D4DA 1HUNA 1EOTA 1PFNA 4CJ1B 3FPPA 1TWFB 3X3NA 3SK4A 1B1ZA 1EY8A 2V4DA 2EJMA 4U673 4EVOA 3ND9A 2X6LA 3M4OB 4IUTA 1L0XB 2K5QA 1SJED 3K57A 1EY6A 5G3LF 1PZKD 1EYDA 1PRTB 2MP1A 5HGTA 1IKMA 1RCVD 3TDQA 4M8AA 5C5MA 1HHVA 3FRPB 2PO4A 3BVMA 3K5MA 5IGFA 3GTKB 3S9WA 3PIP3 5D65A 5IGEA 5LHY1 4DGZA 4QF4A 2I46A 1F2MA 3LX0A 3PUYA 3GO5A 2B63B 5IGDA 3I4MB 3FKIB 2PMZB 3WDNA 5CV7A 3A54A 1F9QA 3VYTA 3NTIA 3QOJA 1BQQT 1I4PA 1ZKOA 4KHZA 1ET9A 3QB3A 5C5LA 2JA8B 2SNMA 2BA0A 3Q23A 1EIHA 2KA7A 2SNSA 5IIFA 2RQXA 2L0CA 4BS9A 4XQNA 1EZ8A 4QUCA 2CHBD 2HCIA 1F77A 4QUFA 1QCBD 1LV9A 3D3RA 1Z6HA 3NHHA 2O5IC 1PTOD 4IUUA 1UUPA 3QIAA 2L5TA 3LWUA 4KKTA 3TZDA 1E2WA 1QOHA 1G91A 1I6VC 5I2YA 1QJOA 2XRSD 3HG9A 2K05A 1A3VA 4FYDA 1HUMA 1S5BD 3I73A 4DF7A 1ESFA 3V96A 3HRZC 2F0IA 1G8ZD 4XQQA 2B2UC 4L63B 3TSSA 3I3CA 1PFBA 4HTHA 4HMIA 2NUCA 4ZYSA 2IW3A 5KRUA 1SMYC 3LWEA 2F0HA 4OO1G 1TWCB 2DY7A 1I4HA 1X3PA 1IW7D 1TVXA 3TZUA 1I6HB 5JJZA 3R93A 4HCSA 2XSCA 2TSSA 5E4WC 4RGNA 3GTMB 2QKIC 3T51B 1B9NA 2B2WC 3JAME 4C2MB 2EYHA 1Y69U 3S17B 4JK1C 4X3UA 1AZQA 1JORA 4KD3A 2PNRC 2H1EA 5FK9C 5C3EB 1FYCA 1JE4A 3VR5A 2PZUA 3P1HA 5KEEA 2JSOA 3I8ZA 4C56C 3KF8A 1KLGD 2HCCA 1W6JA 2A69C 2O4XA 1T5XD 5G3LD 2B2YA 3K58A 3NBHA 1IL8A 1EY5A 4FF3A 1RJTA 4XT3B 5EPLA 2FINB 3MXGA 1HA6A 2Z4HA 2ZXPA 1S5ED 1JWUD 3VR3A 2NYZD 4KY7A 3S1QB 4J8QA 1Q1EA 1A3UA 5KIXA 1TR5A 3I4LA 2L55A 3SDZA 4ZQ3A 1EY9A 4RAUC 1B53A 1PXUA 5FO9B 1I50B 1QB5D 2JYOA 3PV0A 5EKIA 3PUZA 2K32A 1EL0A 1F2YA 2I07B 3M7NA 2EZVA 1TY2A 2DN8A 5T1IA 1EU3A 4I65A 4XIGS 1STGA 1TWGB 1DJRD 3GP7A 4NMZA 3SK6A 3D4RA 2F03A 5AFWA 1M8AA 5CMDA 3P75A 4C3JB 1WTVA 5JAVA 3JAML 2JEBI 5IOCA 2RDHA 1Y1VB 2RA4A 3KLRA 1F9RA 3V2TA 1LTTD 1WTXA 2E75C 2E2HB 3ITPA 4IALA 2PCFB 2B2VA 4LK1C 1PRTC 2E76C 3FEWX 1YNJC 4ZK9B 1LT5D 3DWQA 3E6ZX 1U4RA 2IPKD 2XVSA 5ELDA 4NP5A 1EY7A 2LMCB 5CYUA 5C4XB 3K5LA 4K14A 1FNUA 1PZID 4DK0A 1Q1BA 3SEBA 3KBXA 3VA7A 5IT9L 5CBEE 5I6YA 5K5PA 1KNAA 2IX0A 2WIIB 1HPCA 1JR0D 1A6XA 1TS2A 4OL7A 3TMEA 4CGYB 1G2TA 1A2TA 3KUPA 1BOSA 1PTOB 5K36G 1SFOB 3FVQA 5A2QE 4ULLA 3S1MB 2QDBA 2PW7A 1SJHD 5FKAC 4C3IB 2NTSA 4DXFA 1X3QA 4O1NA 2D2CC 2WB1B 2ICIA 2A74C 4C3HB 2L1BA 3IAYA 1PYWD 4ZAIA 3WOEA 5IODA 1CHQD 2KECA 5C0XG 4PMCA 1M4VA 5EPJA 1U4PA 1O7YA 2A68D 5I2XA 4IUPA 4MN3A 1JQYD 3QG1A 1E2ZA 1F2LA 2OF1A 1BCPB 4FF1A 4TQUS 1CI3M 3X3MA 3BVGA 4IFDG 2WINB 3GTLB 5CV6A 3PO3B 2HDMA 5LL6S 1AP0A 1KAAA 2F0FA 4MIUA 3O13A 1LO5D 1LTRD 2ZT9C 3T4AC 5J39A 5EPKA 2YU9B 5DEHA 5C0XI 2XWJB 4G7OC 1GJXA 5I9OA 1BDOA 1EIGA 5E4XA 1TS4A 4QIWB 1CA5A 5J22A 1ENFA 4IFDI 4DNRB 1GUNA 2Z1CA 5KGUA 4UDUC 4DAYA 1TS3A 3K0YA 2X6GA 5IGCA 3R2IA 3K59A 3CKIB 3HKZB 5KYIA 2JA7B 1EY4A 4A3DB 1STNA 4RGMA 3U9SA 5KNBA 2F0SA 1AEXA 3KBGA 2AQ1B 3D8GA 2A6HD 2HUGA 1KTKA 1BXTA 1V43A 5I9PA 2EYMA 2AQ3B 2N88A 1MSGA 4MHEA 1ILPA 2TMPA 2SDFA 1LTID 2B2VC 3SR1A 1YNND 2NTTA 3BYTB 4IFDJ 1CHPD 2VB3X 3S2HB 3S1RB 1W6KA 4BY1B 2VNUD 1FNWA 2EJGC 4KKUA 4HSVA 1ICWA 4A3GB 1D5XC 1SNDA 4N9PA 2AUJD 3AB9A 4PMBA 3HGBA 3ND8A 3OIPA 1Y8NB 3TP6A 4XTCS 5C4ZA 2BDOA 3OW7A 4DU9A 2EYPA 4KN7C 1ONLA 2J7ZA 3OOCA 4AYBB 4M1UB 3HOZB 1BUVT 2PZWA 1VCIA 2R61A 4FXDA 4HN7A 2OT2A 2B39A 1S5FD 5ELCA 2HQEA 2D62A 2EXZA 2D5DA 3KK7A 5M5YB 2E74C 5M5WB 3GV3A 1E0BA 4WJWA 3GTJB 3DEPA 1S4ZA 3SE0A 3H0GB 4ODGA 2SOBA 1HFGA 5CGKA 3NBIA 1HXYD 3S2DB 1QE6A 2QCPX 4RFBA 2F0JA 4OO1H 3M4YA 3HP3A 1B2TA 1II3A 1V1PB 4FF2A 1CFMA 2NVQB 3QO2A 1UAPA 3L3OC 1EQTA 1HFNA 1XWEA 4H13C 1SE2A 4BBSB 2VB2X 4CKBA 3J80E 4K2LA 1Q12A 2F0LA 1UEAB 5CV4A 1PTOC 1F9SA 1FNVA 1IYUA 5C3XA 3P7JA 3GQBA 4ZUIA 4EGVA 1VF5C 4B9WA 1OXVA 4ZRZA 1KDBA 3GTPB 1EWCA 1TY0A 1K8MA 3A7LA 2WV6D 2ZXRA 1SBBB 3MHBA 4HEDA 1EY0A 4KKSA 1HRJA 3SVMA 5ISRA 4TRDA 2BE5D 2WKCA 4RGTA 4KJNA 3Q22A 1BCPC 4V0BA 3QJYA 3R2TA 1ESRA 1V1PA 2ID0A 3T16A 3BDOA 4HR7B 2K1BA 4A93B 2IJ0A 3HOUB 4EQOA 1IW7C 3ZYYX 4RKBA 1XYIA 3IFTA 3GV6A 1KDCA 4K6LA 2KQ3A 4H44C 3NP8A 3SHLA 2XWBB 4UAIA 2Z4IA 1C4QA 3BDCA 4QB4A 1FD7D 3PMFA 2F0DA 3N52A 4DAPA 4K5WA 3A55A 1F9PA 2KUMA 2EY2A 4X3SA 2RVLA 2SEBD 1PMRA 4OIKA 3FDTA 2MHVA 3J7AV 3NQTA 2IX3A 4ILWA 2H4OA 5I6WA 4RH6A 3VR4A 4DXGA 1G2SA 1V8QA 1KNEA 1K83B 5FO7B 2AQ2B 4KTAA 1SNOA 2ICEC 2A73B 3MXUA 4OO1I 1CQFA 4G57A 1H9MA 3H91A 1WTPA 3DXJC 2JXMB 2F3WA 3SK8A 4H7BA 3C1EA 4IUVA 4NKLA 4KN4C 2K28A 5BN5A 1U9RA 3QWNA 5F2DA 1A3TA 1SXTA 1I4XA 5CV8A 3NPPA 1ILQA 2KJXA 1GXDC 1HTPA 4IN3A 4E6IA 1SYEA 2BDNA 1HQMC 1B50A 5K36H 2QF7A 2KCNA 2YYZA 3OMGA 5EBCA 1JWSD 3J7YW 4RWSC 5M3MB 1VDZA 1GOZA 4B9XA 3OWEB 5DAUA 4KV6A 5JVG3 4BA2I 1UNSA 2C5CA 4FVMA 2A6EC 1PDQA 4DAVA 3D4WA 2BOSA 4XYQA 5C0XH 4IURA 1R4QB 1NR4A 5CORA 1TWAB 5JPNC 4A3BB 1EEID 3VR2A 3NTHA 5BN4A 1SSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSV A;  3TZD A;  3I8Z A;  3N52 A;  4CJ2 C;  1ICW A;  2L4N A;  2X6L A;  2HCC A;  1F9S A;  1F9P A;  2KUM A;  4OIK A;  2RVL A;  4X3S A;  4IUT A;  1WTR A;  1DZ1 A;  3FDT A;  1G91 A;  2FFK B;  2B2U A;  3P7J A;  5DNF A;  1QNK A;  1CM9 A;  1RTN A;  2K05 A;  2RSO A;  1WVL A;  1NR2 A;  1EIG A;  2B2Y A;  1B4O A;  5E4X A;  2MP1 A;  1BO0 A;  3MWY W;  1ML0 D;  1AZP A;  1G2S A;  2FHT A;  1IKM A;  1KNE A;  1IL8 A;  3IL8 A;  1HUM A;  1MGS A;  1CA5 A;  1DON A;  3KBX A;  4RA8 A;  1U4L A;  2JP1 A;  5CBE E;  4NW2 A;  1RJT A;  4XT3 B;  5EPL A;  1KNA A;  4ZKB B;  3H91 A;  1WTP A;  5EJW A;  4DN4 M;  2FIN B;  4X3T A;  5EQ0 A;  3G7L A;  3ONA B;  1HA6 A;  1CA6 A;  1HHV A;  2Q8R E;  1QG7 A;  2XIW A;  2NYZ D;  1G2T A;  1PFM A;  4HED A;  1VMP A;  3FPU B;  3KUP A;  1BF4 A;  2J7Z A;  2L12 A;  1JIC A;  1G6Z A;  4IUV A;  1BNZ A;  2B2U C;  2EOT A;  2K28 A;  2X6G A;  5T1G A;  1HRJ A;  1PLF A;  2CVR A;  2EPB A;  3I3C A;  3SVM A;  1PFB A;  2B2Y C;  4OIJ A;  1VMC A;  3D6W A;  5D65 A;  4RAU C;  1RTO A;  1B53 A;  1MSH A;  2L11 A;  1X32 A;  2KED A;  2HDL A;  2R3Z A;  2M2L A;  1J9O A;  2JYO A;  4XT1 B;  1X3Q A;  5D14 A;  2NZ1 D;  2K03 A;  2MJ8 A;  3Q6S A;  5EKI A;  1ILQ A;  1NAP A;  3LWE A;  5COY A;  2FJ2 A;  1WTW A;  2VXW A;  1EL0 A;  1SAP A;  1RHP A;  2RSN A;  2IL8 A;  1ZXT A;  2L1B A;  2L9H A;  3I90 A;  2DY7 A;  1DOL A;  1ESR A;  4ZAI A;  5T1I A;  2Q8T A;  2BDN A;  1X3P A;  1B50 A;  3DM1 A;  2X69 A;  3GV3 A;  1BBX C;  1E0B A;  2KEC A;  3UI2 A;  1TVX A;  2FMM A;  2MGS A;  1WTQ A;  2K1B A;  2B2T C;  2B2T A;  1F9Q A;  3DEP A;  5JJZ A;  3R93 A;  2D9U A;  2KOL A;  5EPJ A;  3MTS A;  1S4Z A;  2K04 A;  1U4P A;  2HUG A;  1O7Y A;  5AFW A;  1M8A A;  1HFG A;  5CMD A;  2MPM A;  1WD1 A;  4IUP A;  1C8C A;  4ZKC B;  1ROD A;  1MI2 A;  4RWS C;  1WTV A;  1J8I A;  4HCS A;  2NWG A;  4X3K A;  1XYI A;  1Q3L A;  2N88 A;  1MSG A;  2K01 A;  4MN3 A;  3TN2 A;  3GV6 A;  4MHE A;  1ILP A;  3DEO A;  1QE6 A;  4ZLT F;  1O80 A;  4CJ0 B;  1SDF A;  1F2L A;  1WTO A;  2KVM A;  4U68 A;  5E4W C;  2N55 A;  4O42 A;  1B3A A;  2RA4 A;  1F9R A;  2B2W C;  5CBA E;  2B2W A;  1WTX A;  3HP3 A;  1XX8 A;  1B2T A;  1NCV A;  1PDQ A;  2SDF A;  4IUQ A;  4QUC A;  1O7Z A;  2HDM A;  4X3U A;  2HCI A;  4QUF A;  2B2V C;  1AZQ A;  2H1E A;  2B2V A;  1AP0 A;  4LMQ D;  1DOM A;  1LV9 A;  4IUR A;  4UAI A;  2KEE A;  1U4M A;  4XDX A;  1GUW A;  3QO2 A;  2EE1 A;  1JE4 A;  1DOK A;  4ZK9 B;  1EQT A;  1NR4 A;  3I91 A;  5COR A;  1WD0 A;  1EIH A;  1HFN A;  1HUN A;  1EOT A;  1PFN A;  4CJ1 B;  1A15 A;  1U4R A;  4IUU A;  4R8I A;  3F2U A;  2DY8 A;  4HAE A;  1IKL A;  4R9W A;  5EPK A;  1SSO A;  3IFD A; 
#chains in the Genus database with same CATH topology
 5JPM C;  4JYA Q;  1MIU A;  2CQA A;  4PQX A;  2HT1 A;  3NEN A;  4IFD H;  2CKZ B;  2Y0S B;  4L5S A;  2WAC A;  5DNF A;  5FLX E;  4RG1 A;  4OWT B;  2OEO A;  2BH2 A;  1C48 A;  3CF5 A;  1TWH H;  4A4I A;  4GNX C;  4F8M A;  2DJF C;  3S16 H;  3IL8 A;  2DNC A;  1DON A;  1EWI A;  2F52 A;  4JBW A;  4XXE A;  4RKL A;  4ZKB B;  2NBF A;  4RMF A;  1RD9 D;  2UXB Q;  3CW2 C;  4DV2 L;  3H09 A;  1BF4 A;  2F4I A;  2EDG A;  1SNM A;  3R3O A;  5T1G A;  4K2K A;  3BZD B;  4LUV A;  1QUQ A;  4JG2 A;  1J5E L;  1DD2 A;  2AMC B;  2QEJ C;  1IBK L;  2O2L D;  2PYK A;  3S15 H;  3CD6 A;  1KL9 A;  1EOV A;  3N6R A;  2R3Z A;  1I94 L;  3T1Y L;  1PRT D;  2MJ8 A;  3H3V C;  2LY7 A;  1CTM A;  5BN3 A;  1TT2 A;  1YNJ D;  2IL8 A;  4A3C H;  3ULP A;  4DNT B;  4L5R C;  5LMU Q;  1A8V A;  4IZ8 A;  2ASB A;  1TWH B;  4QQB X;  3OMC A;  3DM1 A;  3S16 B;  4ZUJ A;  2PQA B;  4KHV A;  2MGS A;  3C1F A;  4Q0F A;  2QW7 A;  3KDF A;  3OYY A;  1F2Z A;  2A1A A;  4ZKC B;  1MI2 A;  2NB0 A;  4ABN A;  1Q3L A;  3D6C A;  5LMN L;  1STH A;  2KVM A;  4C3J G;  1D1K A;  4F88 A;  5FOB B;  2K5D A;  1MJE A;  1CZG A;  3S15 B;  5CBA E;  3RNU A;  3PUX A;  4KY6 A;  1HR0 Q;  4TSS A;  4LMQ D;  1DOM A;  4ID6 A;  1MHW C;  2EVB A;  4Y7N H;  4B3R Q;  1RDP D;  4KK7 A;  1S72 A;  1WD0 A;  4NXM Q;  2RKS A;  3JAM c;  1I3Q H;  4YCW A;  4R8I A;  3MFG A;  3BS1 A;  4KHP Q;  4RCO A;  3ERO A;  1W2B A;  1EEF D;  1Y8P B;  4J1M A;  1MBY A;  3WOF A;  5DM7 3;  1SYG A;  3PO2 H;  2NVX B;  2V1C C;  2BH8 A;  5NUC A;  1JMC A;  4LF6 Q;  2Z6K C;  3SXH A;  4LF4 L;  4NB3 A;  3RLN A;  3EIV A;  1K8A C;  2PI2 E;  4HJ8 A;  4A3I H;  1OXU A;  1D7Q A;  1QNK A;  3HS0 C;  2RSO A;  1WVL A;  1NR2 A;  1R9T H;  1S5C D;  3OHX C;  3CP0 A;  3I4N H;  1Q8I A;  5C4X G;  1LTA D;  1GUT A;  1FVI A;  4RA8 A;  1EQQ A;  1U4L A;  2J0T D;  1CZW A;  2O5J C;  2ZXO A;  4GZY C;  1GHK A;  3A8I E;  2RDF A;  3MZ5 A;  1ENA A;  3BDL A;  4MZ9 A;  4Y7N B;  3NXW A;  4CDF C;  4JOI C;  4GKK Q;  1AW7 A;  2JA5 H;  3FPU B;  2PQA A;  3D31 A;  2F0P A;  3E5S A;  4K0K L;  1I3Q B;  1BNZ A;  4YWL A;  4AQY Q;  1EUJ A;  3A56 A;  3OIQ A;  4JVZ A;  2EPB A;  2B2Y C;  1IBM L;  2F0O A;  3MC0 B;  3ULJ A;  3SGI A;  1Y1W H;  4L6T B;  2LXJ A;  1SE3 A;  5GRO A;  5D14 A;  1ZYR C;  5H1S E;  4BBR H;  1B9M A;  1SEB D;  4POF A;  4A3I B;  2OCE A;  1KHI A;  3I7F A;  1X3E A;  2E2D C;  3Q24 A;  1ZXT A;  1R9T B;  3HOX B;  1CUK A;  4I7Z C;  1GKH A;  2CH4 A;  1ASY A;  3I4N B;  1DM0 B;  1JE5 A;  1JCK B;  5A2Q L;  3I4O A;  2WB1 G;  1HNX Q;  1KRS A;  1X55 A;  1Z9F A;  5HGQ A;  2R92 H;  1WTQ A;  3BG3 A;  1GUG A;  1UE6 A;  4PMW A;  1L1O C;  3NK9 A;  4X64 L;  3HZX A;  2QIL A;  1VQG A;  2F0K A;  2EYL A;  4LF9 L;  2EXD A;  1K9M C;  1WD1 A;  1KXL A;  4YHH L;  2KHJ A;  4PG3 A;  4JI0 L;  1ROD A;  3A0J A;  2K6A A;  4LNQ A;  1J8I A;  2JA5 B;  2AWN A;  1OO9 B;  1BKB A;  1I4R A;  1Z7T A;  3DEO A;  4QCL A;  1O80 A;  1WTO A;  1X54 A;  5J1Z A;  1KD1 C;  4OHJ A;  4DR2 L;  4R1J A;  4JI5 L;  3ERQ A;  3URY A;  1EFI D;  5JJK A;  4DR5 L;  2VUM H;  2NVY H;  4A3E G;  5M5X H;  3SK5 A;  3TP8 A;  2C9O A;  5JOB A;  4N9T A;  1QZG A;  4CBV A;  1STA A;  1I4G A;  2K52 A;  5L37 A;  4BBR B;  1U4M A;  2WKD A;  5C44 H;  1QIL A;  1S3O A;  3PO3 G;  1ENC A;  2CCZ A;  3I91 A;  4DA2 A;  4LJZ C;  1V1O A;  2G9D A;  3NQI A;  1HQR D;  4HJA A;  1VQP A;  3CRK C;  5C0X J;  2DY8 A;  2CW0 C;  2JK8 A;  3EA6 A;  4A3M H;  4JYA L;  2DGY A;  1JT8 A;  3BZK A;  3IFD A;  2R92 B;  2R7Z H;  1SYB A;  1WCM B;  3UE1 A;  1HZ9 A;  4GLX A;  2IHF A;  1LAC A;  4FXK C;  3A8J E;  1QNU A;  4K6D A;  1MD2 D;  4WFN 3;  2B2U A;  3MXP A;  1EQV A;  3RZO B;  2L15 A;  1KDA A;  1LM0 A;  4J6H A;  4HMJ A;  3J81 j;  1AZP A;  3IKJ A;  1VQJ A;  1AFP A;  2VUM B;  2NVY B;  2UXB L;  2E2J H;  3EJI A;  5M5X B;  4DN4 M;  1IYV A;  2KHI A;  2Q8R E;  1I5F A;  2XIW A;  5C44 B;  2RBM A;  4DR6 Q;  2BCO A;  1L0Y B;  3HOY G;  5C6A A;  4N8X 1;  3E0J A;  4CKE A;  1Y14 B;  3KLS X;  1RTO A;  2H5X A;  1GO3 E;  2F0Q A;  2HDL A;  1I4Q A;  5KNC A;  4DAM A;  1AN8 A;  2N8N A;  2PW5 A;  1K28 A;  5FO8 B;  4K5V A;  3R8B A;  1RIP A;  1FL0 A;  4GLA C;  1NAP A;  3GD7 A;  3KF6 B;  5COY A;  2KEN A;  3NEM A;  5LMU L;  4A3J G;  1DOL A;  3TS0 A;  3L9A X;  3JC6 6;  4A3D G;  2R93 H;  4K5X A;  5FJ8 H;  1EYC A;  1JB7 A;  4DR4 Q;  4FXG C;  3HKZ E;  5IYD H;  1ICF B;  4JI8 Q;  2KOL A;  2GA4 B;  2E2J B;  1PVO A;  2KCM A;  4FF4 A;  2RCF A;  2JA6 H;  2DUD A;  2EJF C;  5LL6 X;  1LTG D;  2AUK A;  3PGZ A;  4CJ0 B;  1B44 D;  1SDF A;  4U68 A;  3MVV A;  4CDC C;  4JCV E;  4KY5 A;  1HR0 L;  1L2F A;  1TKW B;  4APV A;  3A7A B;  4B3R L;  2F1M A;  1CK1 A;  2B63 H;  1ZEQ X;  3BVZ A;  4NXM L;  4DPG A;  1H9K A;  2EE1 A;  1GUO A;  1K8G A;  5IP9 G;  4KHP L;  1A15 A;  5D3I B;  4I7A A;  1Q7Y C;  1IKL A;  2R93 B;  3I72 A;  5C4H A;  4LF6 L;  4FP5 D;  2ZTD A;  4IPG A;  2B8F A;  2K5H A;  3U9O A;  4WRD A;  4BY1 G;  4A3F H;  1JJ2 A;  1KRT A;  1E7Z A;  1H9J A;  2JA8 H;  4JI1 Q;  4RHS A;  1TII D;  3GTG H;  2JA6 B;  1SR3 A;  4HCE A;  1RTN A;  5LMN W;  4A3G G;  3BYY B;  5ELB A;  3NUC A;  1PH9 A;  1RL2 A;  4HJ5 A;  1Y8O B;  3K7A H;  3W2D A;  4OX9 Q;  3KF6 A;  3K81 C;  2K5W A;  5JEA G;  2Z9H A;  2ZM6 Q;  1VS0 A;  2FMC A;  2F3V A;  2QGQ A;  4CHT B;  3LNN A;  4GKK L;  1CA6 A;  4HID A;  1NTG A;  5E1F A;  1DCZ A;  4F87 A;  4QGU A;  4AQY L;  1PH1 A;  3NWS A;  3J81 E;  3TS2 A;  4OIJ A;  3D6W A;  1GHJ A;  4UP8 A;  3RMH A;  3MEH A;  1RF2 D;  3NE5 B;  2L11 A;  4A3F B;  1NE3 A;  1K0R A;  3HOZ G;  1QWY A;  1EYG A;  1DGS A;  4XT1 B;  2NN6 G;  2NZ1 D;  4WOR A;  5ELO A;  5C4J H;  5IGG A;  3GTG B;  4EQN A;  2FJ2 A;  4AYB E;  1WTW A;  1SAP A;  4P72 A;  4G7Z C;  2RSN A;  3AU7 A;  1EFW A;  1T5E A;  2BE5 C;  4DV5 Q;  1X6O A;  1HNX L;  4DFA A;  3S14 H;  1QVF A;  1SNP A;  1Q86 C;  1QVC A;  1JB3 A;  1CQV A;  1KLU D;  2EYO A;  1K3B C;  3UI2 A;  4L8J A;  3K7A B;  2B2T A;  1MJC A;  4J15 A;  4YIJ A;  2Z8L A;  2K04 A;  2CWA A;  1V9P A;  1NSN S;  3DMU A;  3PUW A;  1D2B A;  4X3K A;  3K8A A;  3VYR A;  5TSS A;  3W3A A;  1VQF A;  2K01 A;  4S3S A;  4ZLT F;  1PRT F;  4RCN A;  2G9H D;  4V19 0;  1VQ6 A;  2IY5 B;  2N55 A;  3E3X A;  1VQH A;  4IUN A;  3CQZ B;  3C3L A;  3L2P A;  2ZTC A;  1NCV A;  4A3K H;  5ELF A;  3I4M G;  4A3L G;  2KEE A;  2NN6 I;  3ZJY C;  1GUW A;  5C4J B;  1DOK A;  3FKI G;  1K8O A;  5IGB A;  2N78 A;  4K8I A;  3VR6 A;  3F2U A;  3T13 A;  4HAE A;  4LAA A;  4R9W A;  3S14 B;  4OGQ C;  4LF5 Q;  1STB A;  1A0I A;  4BBS G;  1LT3 D;  2F0V A;  3K5O A;  4C1N K;  1D5M C;  4OWW B;  1JOO A;  1BCP D;  3GTM H;  3OWF A;  1FGU A;  1GUS A;  2JJQ A;  1SYF A;  2R6G A;  4C2M H;  3A8K E;  3J80 L;  3S17 H;  1JJC B;  4BWG B;  4JI2 Q;  1PH8 A;  1GM5 A;  3FHW A;  3HOW B;  4JI6 Q;  3H15 A;  4A3K B;  5EQ0 A;  3ONA B;  3J81 L;  4TVA B;  3UDF A;  4EQ5 A;  2LFN A;  4DR6 L;  2M00 A;  5JEA J;  1SMY D;  4HSP A;  2PZT A;  2UU9 Q;  3RZD H;  2XRQ D;  1EU4 A;  4ME5 A;  2M2L A;  1OXS C;  1B7Y B;  1X3G A;  2K03 A;  1UEB A;  2ENB A;  5C3W A;  5M3F B;  5IE8 A;  2Q2U A;  2L9H A;  3K0X A;  1EZ6 A;  3C2P A;  2XNA C;  1Z47 A;  4DR4 L;  3EQL C;  1Q81 C;  2NVT H;  4JI8 L;  2PPB C;  3CPW A;  3DHQ A;  1EQR A;  2IWH A;  4KMU C;  2D9U A;  3PSI A;  5JVH 3;  3GTO B;  4A93 G;  1BVS A;  2XTI A;  2NWG A;  3PQI A;  4R4O A;  4UHV A;  3RZD B;  3KJP A;  3L7Z C;  1WYD A;  5GAE C;  2OXP A;  4X62 Q;  1O7Z A;  3K5N A;  3MFY A;  1VQM A;  2YTX A;  2P5Z X;  3NEL A;  2EY5 A;  1TXY A;  1YHQ A;  1QUQ B;  1RKN A;  4Z9C B;  1R4P B;  2DNE A;  3PUV A;  2A69 D;  3U50 C;  3DUZ A;  2J4X A;  5IYC G;  2Q2I A;  5CR3 A;  2NVT B;  2F0G A;  3RLF A;  4C3J H;  4JI1 L;  5EKL A;  2KHS A;  5HUR A;  5IT9 E;  4BA1 I;  4UP7 A;  3J80 c;  1WTR A;  1LLR D;  3P20 A;  4GN4 B;  1TS5 A;  1B4O A;  2VZA A;  1BR9 A;  4BY7 B;  3MWY W;  2E2H H;  1VQ7 A;  1X9N A;  3OSO A;  3KDF B;  1HR0 W;  2UUB Q;  2RDG A;  4OX9 L;  3J81 c;  5C3E G;  2JP1 A;  2ZM6 L;  1VQ9 A;  1FJG Q;  2MO1 A;  4P2C B;  1XJV A;  1HTL D;  4X3T A;  3G7L A;  2LS0 1;  5CC4 A;  3GTQ H;  1VF7 A;  1H95 A;  1FGB D;  4G7H C;  3VYS A;  1NMG A;  4AH6 A;  1SNQ A;  1PH6 A;  1PLF A;  1NY4 A;  2CVR A;  1LAB A;  3CC4 A;  1H9R A;  4MTK A;  3OPO A;  2A6E D;  5C4X H;  4DR3 Q;  2CQO A;  1HH2 P;  3OW2 A;  4EQP A;  2VXW A;  4DV5 L;  3JAM i;  4YCU A;  4MTN A;  3I90 A;  1BBX C;  2OWO A;  4DK1 A;  5CV9 A;  3T53 B;  1VQL A;  4GOP B;  2FMM A;  1OXT A;  2B2T C;  4FNF A;  4IJH A;  1PTO H;  3MTS A;  3G71 A;  1KAB A;  1XTD A;  2MPM A;  3GTQ B;  2PNH A;  1SFO H;  1AH9 A;  5D3D A;  4IQZ A;  3HKS A;  2A5H A;  3ULL A;  4XYO A;  1HA5 A;  1JJG A;  5HY6 A;  3TN2 A;  1JWM D;  3M85 A;  3S1M H;  1EIY B;  1O7L A;  5M3M G;  4O42 A;  2VY3 A;  2F0N A;  3TP7 A;  4Q5V A;  5DM6 3;  2RF4 A;  1CT1 D;  5GQO A;  5KYL A;  2HIX A;  3MAQ A;  4R4Q A;  1CKO A;  5EBD A;  1EWH A;  4QY7 A;  1EYA A;  3BJU A;  3HFZ B;  1JOK A;  2K5N A;  2K7V A;  4R8N A;  1TQO A;  4KI0 A;  1LTB D;  4H0L C;  2LKV A;  3RUZ A;  3PF5 A;  3TBI B;  1A2U A;  4LF5 L;  2WP8 J;  3G4S A;  2WAQ B;  2JE6 I;  4A3B G;  1HCZ A;  2IT1 A;  4F7X A;  5KND A;  4CJ2 C;  2XN9 C;  3F2C A;  3DWP A;  1IBL Q;  2GVA A;  3MA2 B;  4YCV A;  2A68 C;  1DZ1 A;  4A3E H;  1AE2 A;  1Y1V G;  1CM9 A;  3STB C;  4NXN Q;  3CHB D;  5GAG C;  2Z0S A;  3G6J B;  3Q0A A;  1BO0 A;  1SYC A;  4JI2 L;  3RN2 A;  3PO3 H;  1MGS A;  1SE4 A;  3KLS A;  4JI6 L;  5EGT A;  2Y0S E;  1STE A;  2JEA I;  4G4K A;  5FLX L;  1O78 A;  1QG7 A;  4PZ8 A;  1PFM A;  1VMP A;  3K6O A;  2L12 A;  1JIC A;  3F1Z A;  1FR3 A;  4GOP A;  1G6Z A;  1E2V A;  4C1N I;  2UU9 L;  2EOT A;  2PQE A;  4NDX A;  2ZTE A;  1LT6 D;  3CCQ A;  4FO2 A;  1SNC A;  1X32 A;  1YHB A;  4JW0 A;  3RN5 A;  1J9O A;  1PFS A;  3DWA A;  5CV5 A;  3Q6S A;  1C9O A;  4K8J A;  2KCC A;  4A3E B;  3MXN B;  3AQQ A;  4B08 A;  1VQN A;  1RHP A;  4XQJ A;  1S40 A;  2Q8I B;  1NUC A;  2MNA A;  2EIF A;  3RLO A;  2F0M A;  1E24 A;  2X69 A;  2I5L X;  3HOY H;  4GKJ Q;  3T56 B;  3QOL A;  3W1B A;  5GAD C;  3PO2 B;  1C8C A;  3QR8 A;  2KCT A;  4OXP A;  4LFB Q;  1SYD A;  3CU7 A;  3FP9 A;  2CWP A;  1TU2 B;  1U0L A;  4RGO S;  5EAY A;  4CDD C;  4C3I G;  1B3A A;  4HIM A;  2EQS A;  1H9S B;  3EVQ A;  4A3J H;  4X62 L;  1XTC D;  1XX8 A;  1P16 A;  3M3Y H;  3NWT A;  1S5D D;  3M7G A;  1G29 1;  1SMX A;  4A3D H;  5E3F A;  3EFX D;  4HJ7 A;  5I4D A;  4C3H G;  1VQB A;  2A19 A;  4XDX A;  1LT4 D;  1STY A;  3CCS A;  1YVC A;  2EYJ A;  3H94 A;  2WAQ E;  1PTO F;  4CKC A;  2F0W A;  1JOQ A;  1BBU A;  4HIK A;  1N36 Q;  4LF7 Q;  2YTY A;  1IHZ A;  3HOY B;  5ELE A;  1YJW A;  2L4N A;  2A6H C;  3VYU A;  3WWV A;  1ZYR D;  2HHH Q;  4TKO B;  2OQK A;  1Y1W B;  1LYL A;  2FFK B;  2BA1 A;  2GN5 A;  3RD4 A;  1DYQ A;  1DXM A;  4KD4 A;  1ML0 D;  2FHT A;  2UUB L;  5IYB H;  5IP9 H;  3TP5 A;  5FLX c;  1FJG L;  1VQK A;  2IX1 A;  4A3J B;  3M3Y B;  4NW2 A;  4B3T Q;  3MXN A;  3H6M A;  3S1N H;  2EY1 A;  2F0T A;  5EJW A;  2M9V A;  1YNN C;  3V05 A;  3AFP A;  3S1R H;  4BY1 H;  1OXX K;  5EKK A;  2E2I H;  1LUZ A;  5M9O A;  2F0E A;  2D0O A;  2HQL A;  3C46 A;  1BCP F;  4GN5 A;  1D6E C;  4A3G H;  1VMC A;  4RHR A;  4DR3 L;  1MSH A;  2KED A;  4PV1 C;  1D5Z C;  1D1I A;  3UDX A;  2EY6 A;  3PIO 3;  2K33 A;  1D8L A;  4QMG A;  4KJO A;  5JEA H;  3VA5 A;  3HOV H;  1H9S A;  3AMU A;  4LUZ A;  1TWF H;  3LGJ A;  4QL5 A;  2Q8T A;  4DV0 Q;  1XXG A;  2CW0 D;  2QEX A;  3CCV A;  1YZ6 A;  2F0U A;  3FMC A;  3HOX G;  3NSW A;  3I4N G;  5DLQ E;  2B8G A;  3J7A F;  2MO0 A;  1N32 Q;  3S1N B;  4H02 A;  4A3M B;  3M4O H;  1PZJ D;  2R7Z B;  1Q90 A;  3HOZ H;  4PNY A;  3CRL C;  2E2I B;  4BXX H;  2NN6 H;  3I70 A;  2MUY A;  1JC7 A;  3HEJ A;  1ET6 A;  2AWO A;  2EYF A;  3HKZ G;  2B2W A;  2JA7 G;  3CC7 A;  4B3S Q;  4IUQ A;  2I0Q A;  5IP7 G;  5A35 A;  3CXC A;  1XNQ Q;  3G48 A;  3ERS X;  3NTK A;  1LTS D;  3ER0 A;  3HOV B;  3D4D A;  1HUN A;  1EOT A;  1PFN A;  4CJ1 B;  3FPP A;  1TWF B;  3X3N A;  3TEH B;  3GTJ H;  3GTK H;  2Z6B A;  3SK4 A;  1B1Z A;  1EY8 A;  2YV5 A;  2V4D A;  2EJM A;  4U67 3;  1IBL L;  4EVO A;  4P75 A;  1PYB A;  3CCE A;  3ND9 A;  2X6L A;  3U58 A;  3S2D H;  4IO9 A;  3M4O B;  1A63 A;  4IUT A;  1WCM G;  4NXN L;  1L0X B;  2K5Q A;  1SJE D;  3K57 A;  1EY6 A;  1XPU A;  5G3L F;  3I4M H;  4A3L H;  1PZK D;  1EYD A;  1PRT B;  2MP1 A;  5HGT A;  1IKM A;  1RCV D;  3FKI H;  3TDQ A;  1XPR A;  1SE8 A;  2UXC Q;  4M8A A;  2FXQ A;  5C5M A;  4DR1 Q;  1NBW A;  2YTV A;  4BBS H;  3FRP B;  2PO4 A;  3BVM A;  1HHV A;  3K5M A;  1HZC A;  2MFI A;  4DV4 Q;  1UE5 A;  5IGF A;  2UUC Q;  3GTK B;  4HIO A;  3S9W A;  3PIP 3;  5BR8 Q;  5D65 A;  3TRE A;  4DK3 C;  1XMO Q;  5IGE A;  5LHY 1;  4DGZ A;  2RHQ B;  4QF4 A;  1PYS B;  3GTP H;  2I46 A;  4JI4 Q;  1CKN B;  1F2M A;  2IHE A;  4JPB W;  3LX0 A;  3PUY A;  3I2Z A;  3GO5 A;  2B63 B;  5IGD A;  3I4M B;  3W1G A;  3FKI B;  4GKJ L;  3AYH B;  2PMZ B;  3WDN A;  1K0S A;  4Y52 H;  5CV7 A;  3A54 A;  1F9Q A;  3VYT A;  3NTI A;  3QOJ A;  4HJ9 A;  4OEL B;  3UE0 A;  1BQQ T;  4AYB G;  4LFB L;  1I4P A;  1ZKO A;  4KHZ A;  1ET9 A;  3QB3 A;  4IJL A;  5C5L A;  2JA8 B;  2SNM A;  2BA0 A;  3Q23 A;  1EIH A;  2KA7 A;  2SNS A;  2K4K A;  5IIF A;  2RQX A;  3M9B A;  1XMQ Q;  2L0C A;  4GN3 B;  4BS9 A;  1U5K A;  4XQN A;  1EZ8 A;  4QUC A;  2CHB D;  2HCI A;  1F77 A;  4QUF A;  1E22 A;  1QCB D;  1LV9 A;  3D3R A;  1Z6H A;  3NHH A;  2O5I C;  2ALY B;  1PTO D;  4GNX A;  3I55 A;  4A93 H;  1BBW A;  4IUU A;  1UUP A;  1N36 L;  3QIA A;  4LF7 L;  2L5T A;  3H0G G;  2NZH A;  3LWU A;  4KKT A;  2G5D A;  3TZD A;  1OTC A;  2HHH L;  1XNR Q;  1E2W A;  1QOH A;  1YIT A;  5FJ8 G;  1G91 A;  1I6V C;  4L5T A;  3CPF A;  1QJO A;  2XRS D;  3HG9 A;  5I2Y A;  2K05 A;  3KJO A;  1A3V A;  1TWC H;  4FYD A;  3F2B A;  1VQI A;  4JI3 Q;  1HUM A;  1S5B D;  3I73 A;  2VS1 A;  4B3T L;  4DF7 A;  1ESF A;  3V96 A;  4DUY Q;  1IL2 A;  1I6H H;  5IYC H;  1CKN A;  3HRZ C;  4DV1 Q;  3J7Z C;  2F0I A;  1G8Z D;  4LFC Q;  1E3P A;  4O2D A;  4XQQ A;  2B2U C;  3TQY A;  4L63 B;  3I3C A;  3TSS A;  1PFB A;  4HTH A;  4HMI A;  2NUC A;  4ZYS A;  2IW3 A;  5KRU A;  3NBH B;  1J6Q A;  5C3E H;  4PZ6 A;  1SMY C;  4A3F G;  3CC2 A;  1SN8 A;  4DUZ Q;  1K83 H;  3LWE A;  1KIX A;  2PMZ E;  2F0H A;  2CFM A;  3H3V I;  4IPD A;  4DV0 L;  1KQS A;  4OO1 G;  1TWC B;  2DY7 A;  1I4H A;  4P71 A;  1X3P A;  1IW7 D;  3TRZ A;  1TVX A;  1N32 L;  3TZU A;  1I6H B;  5JJZ A;  3R93 A;  4DV3 Q;  2K75 A;  4NPS A;  3J80 i;  2HD3 A;  1T9H A;  3E9H A;  4HCS A;  3KFU A;  2XSC A;  2TSS A;  5E4W C;  4RGN A;  3GTM B;  2QKI C;  3T51 B;  1B9N A;  2B2W C;  4B3S L;  1PH5 A;  3JAM E;  4C2M B;  2EYH A;  1Y69 U;  3S17 B;  4JK1 C;  1XNQ L;  1HNW Q;  4X3U A;  1AZQ A;  1C7Y A;  1JOR A;  4KD3 A;  2PNR C;  2H1E A;  4X65 Q;  4WJ4 A;  5FK9 C;  5C3E B;  3S1Q H;  1FYC A;  1JE4 A;  4JBJ A;  4QJF A;  3VR5 A;  2PZU A;  4LW1 A;  3HOU G;  3PIO A;  3P1H A;  5KEE A;  4YY3 Q;  1I50 H;  2JSO A;  3I8Z A;  4JOI A;  4C56 C;  5M3M H;  2UXD Q;  2N49 A;  3KF8 A;  1KLG D;  2HCC A;  1W6J A;  2A69 C;  2C35 B;  2O4X A;  2HIV A;  1T5X D;  1VQ4 A;  5G3L D;  4LF8 Q;  2B2Y A;  3K58 A;  4L5Q A;  1O7I A;  3NBH A;  1IL8 A;  2UXC L;  1EY5 A;  4DR1 L;  1TWG H;  2B3G A;  4FF3 A;  1RJT A;  4XT3 B;  5EPL A;  4LWC A;  2FIN B;  3MXG A;  1HA6 A;  4A3B H;  2ZXP A;  3M4P A;  2Z4H A;  1S5E D;  4DV4 L;  1JWU D;  2CH4 W;  3VR3 A;  2NYZ D;  4KY7 A;  2N3S A;  3S1Q B;  4J8Q A;  1Q1E A;  3HOW G;  2UUC L;  2VQE Q;  2MQH A;  1A3U A;  5KIX A;  1TR5 A;  5BR8 L;  3I4L A;  1IYJ B;  2L55 A;  1L1O A;  1Y1V H;  3SDZ A;  4ZQ3 A;  1K73 C;  1EY9 A;  1XMO L;  4RAU C;  1B53 A;  1PXU A;  5FO9 B;  1YIJ A;  1I50 B;  1QB5 D;  2JYO A;  4JI4 L;  4WJ3 M;  1YJ9 A;  3PV0 A;  1Q82 C;  5EKI A;  3PUZ A;  2K32 A;  2E5L Q;  1EL0 A;  2F3I A;  1F2Y A;  2I07 B;  3M7N A;  2EZV A;  1TY2 A;  5M3F G;  3RR5 A;  1HZA A;  2DN8 A;  5T1I A;  1EU3 A;  4I65 A;  4R4C A;  4XIG S;  3MEF A;  1STG A;  4YWM A;  1TWG B;  1DJR D;  3GP7 A;  4NMZ A;  3SK6 A;  3D4R A;  3AFQ A;  1PH4 A;  2F03 A;  5AFW A;  1M8A A;  5CMD A;  5FLM G;  2QA4 A;  3P75 A;  4C3J B;  5IY0 A;  1WTV A;  5JAV A;  3JAM L;  1XMQ L;  2JEB I;  2ZJQ A;  4CDE C;  4X66 Q;  5IOC A;  2I5H A;  2RDH A;  1Y1V B;  2RA4 A;  3KLR A;  1PH2 A;  1F9R A;  3V2T A;  4ALP A;  1LTT D;  1WTX A;  2E75 C;  3D0F A;  3ITP A;  3I56 A;  2E2H B;  1NNX A;  4IAL A;  2PCF B;  2B2V A;  4LK1 C;  1PRT C;  2E76 C;  1PA6 A;  3FEW X;  1YNJ C;  3KLW A;  4ZK9 B;  1LT5 D;  3PIP A;  3DWQ A;  3E6Z X;  1M1K C;  1U4R A;  2IPK D;  2XVS A;  1PH7 A;  5ELD A;  1L0W A;  3CCU A;  1XNR L;  4NP5 A;  1EY7 A;  4C3I H;  2LMC B;  1HZB A;  5CYU A;  5C4X B;  2E8G A;  3K5L A;  1WJJ A;  4C3H H;  2R7F A;  4JI3 L;  4IOC A;  4K14 A;  1FNU A;  1PZI D;  3UDG A;  4N8F A;  4DK0 A;  1Q1B A;  3SEB A;  4DUY L;  3KBX A;  4DV1 L;  3VA7 A;  4BY7 G;  5IT9 L;  5CBE E;  5I6Y A;  1KNA A;  2IX0 A;  2WII B;  5K5P A;  4LFC L;  3A5U A;  1HPC A;  1JR0 D;  1A6X A;  1TS2 A;  4GS3 A;  1YNX A;  4OL7 A;  2AHO B;  3TME A;  4CGY B;  1G2T A;  1A2T A;  3KUP A;  1BOS A;  1PTO B;  2NVX H;  5K36 G;  1E1T A;  1SFO B;  1LTL A;  4DV7 Q;  3FVQ A;  5A2Q E;  4ULL A;  2Y0S G;  3S1M B;  2QDB A;  3GTL H;  2PW7 A;  3GDE A;  1SJH D;  5FKA C;  1A62 A;  2NTS A;  1B70 B;  4DXF A;  1X3Q A;  4O1N A;  4C3I B;  2D2C C;  3EBE A;  4DUZ L;  2RCN A;  1NJI C;  2F4V Q;  2VQF Q;  2WB1 B;  2ICI A;  4UY8 C;  2JQO A;  2A74 C;  4C3H B;  2L1B A;  3IAY A;  1PYW D;  4ZAI A;  3WOE A;  2UUA Q;  5IOD A;  2YU9 H;  1GD7 A;  4DAY B;  1CHQ D;  2KEC A;  5C0X G;  1YI2 A;  1VQC A;  1SRO A;  4PMC A;  4DV3 L;  1M4V A;  2PI2 A;  3B6Y A;  4JBM A;  5EPJ A;  4JV5 Q;  3G6E A;  3AEV A;  1U4P A;  1O7Y A;  2A68 D;  5I2X A;  4IUP A;  1PHJ A;  3STB D;  1G51 A;  4MN3 A;  5AJ3 Q;  3K80 C;  1JQY D;  3QG1 A;  1V1Q A;  1E2Z A;  1F2L A;  2OF1 A;  1BCP B;  4KLK A;  3CMA A;  4TQU S;  4FF1 A;  1CI3 M;  3X3M A;  2Q2T A;  1HNW L;  1YBY A;  3BVG A;  2JN4 A;  4IFD G;  3CCM A;  1YJN A;  2WIN B;  4X65 L;  3GTL B;  1UE7 A;  2AKW B;  5CV6 A;  3PO3 B;  2HDM A;  5LL6 S;  4DKA C;  1AP0 A;  3HOX H;  4A76 A;  1KAA A;  2F0F A;  2XGT A;  3A5Z B;  4MIU A;  3O13 A;  1LO5 D;  1LTR D;  2ZT9 C;  4P74 A;  3T4A C;  5J39 A;  4GLV B;  5EPK A;  2YU9 B;  4YY3 L;  5DEH A;  1Q8K A;  3L0O A;  1W3S A;  2UXD L;  5C0X I;  2XWJ B;  4DNI A;  2WAQ G;  4G7O C;  2JA7 H;  1GJX A;  4LF8 L;  5IP7 H;  2GVB A;  1BDO A;  5I9O A;  1EIG A;  5E4X A;  5IT9 c;  1TS4 A;  4QIW B;  1N33 Q;  1CA5 A;  2B29 A;  5J22 A;  4LUO A;  1ENF A;  4IFD I;  4DNR B;  4OEM B;  1GUN A;  2Z1C A;  5KGU A;  4A3C G;  4UDU C;  3CCL A;  2VQE L;  4DAY A;  1G6P A;  1TS3 A;  3K0Y A;  4LFA Q;  1WCM H;  2X6G A;  5IGC A;  1SRU A;  3R2I A;  3K59 A;  3CKI B;  2I5M X;  2WFW A;  2WB1 E;  3RZO H;  3HKZ B;  5KYI A;  2KBN A;  2E5L L;  4DK6 C;  2JA7 B;  1N9W A;  3EN2 A;  1EY4 A;  4A3D B;  3S2H H;  1STN A;  4RGM A;  3U4Z A;  3U9S A;  5KNB A;  2F0S A;  4YWK A;  3OTO Q;  1AEX A;  3KBG A;  4JC0 A;  1XPO A;  2LXK A;  3M4Q A;  2AQ1 B;  4ZCK A;  3D8G A;  2A6H D;  2HUG A;  1N34 Q;  3CME A;  1KTK A;  1BXT A;  1V43 A;  5I9P A;  2EYM A;  2AQ3 B;  2N88 A;  1MSG A;  3DLL A;  3PO2 G;  4MHE A;  4X66 L;  1ILP A;  4OWX B;  2TMP A;  4A3I G;  2SDF A;  1LTI D;  3BZC A;  2B2V C;  1WTH A;  3SR1 A;  1YNN D;  2NTT A;  3BYT B;  4IFD J;  3E0E A;  1CHP D;  2VB3 X;  3S2H B;  3S1R B;  1W6K A;  4BY1 B;  2VNU D;  1FNW A;  2EJG C;  4KKU A;  4HSV A;  5ELN A;  4AIM A;  1GVP A;  2JA5 G;  2OTJ A;  1ICW A;  4A3G B;  1D5X C;  3T1H Q;  4QIW E;  1SND A;  4N9P A;  5M5Y H;  2AUJ D;  1P8L A;  4JBK A;  1UWV A;  4B3M Q;  1Y1W G;  5M5W H;  3AB9 A;  4PMB A;  3HGB A;  4BBR G;  3ND8 A;  3OIP A;  1Y8N B;  3TP6 A;  5IWA Q;  4XTC S;  5C4Z A;  2BDO A;  3H0G H;  4MNO A;  3OW7 A;  4DU9 A;  4DR7 Q;  2EYP A;  4KN7 C;  1ONL A;  2J7Z A;  4DV6 Q;  3OOC A;  4AYB B;  2R92 G;  4DV7 L;  3H3V H;  4M1U B;  3HOZ B;  2ZJP A;  3Q8D A;  1BUV T;  2PZW A;  1VCI A;  2R61 A;  4FXD A;  4HN7 A;  2OT2 A;  2B39 A;  1S5F D;  5ELC A;  4GNX B;  3S24 A;  2HQE A;  2D62 A;  2F4V L;  2NVQ H;  2EXZ A;  2VQF L;  2D5D A;  3KK7 A;  3F2D A;  3UDI A;  1VQ8 A;  5M5Y B;  1NMF A;  2UUA L;  2VUM G;  2RHS B;  2E74 C;  2LSS A;  5M5W B;  3GV3 A;  4GOP C;  1E0B A;  4WJW A;  3PCO B;  3GTJ B;  4JV5 L;  2QDL A;  5C44 G;  3DEP A;  5IYB G;  1S4Z A;  3SE0 A;  3H0G B;  4ODG A;  2SOB A;  1HFG A;  1VQD A;  5CGK A;  5AJ3 L;  3NBI A;  1UE1 A;  4A3M G;  1HXY D;  3S2D B;  4JI7 Q;  1QE6 A;  4POG A;  2R7Z G;  2K50 A;  2QCP X;  4RFB A;  3K7U C;  2F0J A;  4OO1 H;  3M4Y A;  3HP3 A;  1B2T A;  1II3 A;  1V1P B;  1B3Q A;  1CFM A;  4FDB A;  4FF2 A;  2NVQ B;  3QO2 A;  1UAP A;  3L3O C;  3IRB A;  1EQT A;  1HFN A;  1XWE A;  4H13 C;  1SE2 A;  1Q46 A;  1HNZ Q;  4BBS B;  1IZ6 A;  4ME3 A;  2VB2 X;  1CSQ A;  4CKB A;  3J80 E;  4K2L A;  3HOV G;  1Q12 A;  2F0L A;  1X3F A;  5J3B A;  1UEA B;  1VQ5 A;  5CV4 A;  1PTO C;  3PF4 A;  1F9S A;  1FNV A;  1IYU A;  5C3X A;  3P7J A;  3GQB A;  4ZUI A;  4EGV A;  1VF5 C;  4B9W A;  3CQZ H;  1OXV A;  2K5V A;  4ZRZ A;  1KDB A;  3GTP B;  1N33 L;  1VQE A;  4IPH A;  1EWC A;  4BXX G;  1TY0 A;  4EX5 A;  4OON A;  1K8M A;  2ZJR A;  3A7L A;  3HOU H;  2WV6 D;  2ZXR A;  2ES2 A;  1SBB B;  3CCR A;  3MHB A;  5GAH C;  4DV2 Q;  4HED A;  2R93 G;  4LFA L;  1EY0 A;  4KKS A;  1E1O A;  1HRJ A;  5IYD G;  1J5E Q;  3SVM A;  5ISR A;  4TRD A;  2BE5 D;  4PZ7 A;  1IBK Q;  2WKC A;  2JA6 G;  3ICE A;  1VQA A;  4RGT A;  4KJN A;  3Q22 A;  1IXR A;  1BCP C;  4A75 A;  1I94 Q;  4V0B A;  3T1Y Q;  1MKH A;  3QJY A;  1ASZ A;  3R2T A;  3OTO L;  1ESR A;  3HOW H;  1V1P A;  2OQ0 A;  3F8T A;  2ID0 A;  3KF8 B;  3KYH C;  3T16 A;  3BDO A;  4HR7 B;  2K1B A;  2B63 G;  4A93 B;  2IJ0 A;  1N34 L;  3HOU B;  1PV4 A;  2VL6 A;  4EQO A;  1IW7 C;  3ZYY X;  4RKB A;  1XYI A;  3IFT A;  3GV6 A;  4R4I A;  1KDC A;  3W5O A;  5LMN Q;  4UPA A;  4K6L A;  2JA8 G;  1QZH A;  4P73 A;  2KQ3 A;  2K14 A;  4H44 C;  5M3F H;  2R7D A;  3NP8 A;  3SHL A;  2XWB B;  1VQO A;  4UAI A;  1N8R C;  3A74 A;  1WFQ A;  1X56 A;  1L1O B;  1C0A A;  2Z4I A;  5FLM H;  1C4Q A;  1X65 A;  3BDC A;  1FD7 D;  4QB4 A;  4O0A A;  3PMF A;  2F0D A;  3BU2 A;  3GTO H;  3N52 A;  2Z6K A;  4DAP A;  4K5W A;  3T1H L;  4LF4 Q;  3A55 A;  3DM3 A;  1F9P A;  2KUM A;  2EY2 A;  2RVL A;  2SEB D;  4OIK A;  1PMR A;  4UP9 A;  3FDT A;  2MHV A;  4X3S A;  3J81 i;  3NQT A;  2IX3 A;  3J7A V;  4IOA A;  4ILW A;  2H4O A;  4B3M L;  5I6W A;  4RH6 A;  3VR4 A;  1EIF A;  1HJP A;  4DXG A;  1K3R A;  1G2S A;  1V8Q A;  1KNE A;  1K83 B;  5FO7 B;  2A8V A;  2AQ2 B;  4KTA A;  1SNO A;  5IWA L;  2ICE C;  2A73 B;  3MXU A;  4OO1 I;  1CQF A;  4G57 A;  1H9M A;  1YEZ A;  3H91 A;  1WTP A;  4DR7 L;  3DXJ C;  2JXM B;  3CCJ A;  2F3W A;  1QVG A;  3SK8 A;  4H7B A;  4DV6 L;  3C1E A;  4IUV A;  4NKL A;  1KAW A;  2NZO A;  4KN4 C;  3CAM A;  2K28 A;  4K0K Q;  5BN5 A;  2ATW A;  1U9R A;  1AE3 A;  3QWN A;  5F2D A;  1IBM Q;  1A3T A;  4IPC A;  1SXT A;  1I4X A;  2D0P A;  5CV8 A;  3NPP A;  4BY7 H;  1ILQ A;  1KC8 C;  2KJX A;  1GXD C;  1HTP A;  1TWA H;  2OTL A;  3VDY A;  4IN3 A;  4E6I A;  1SYE A;  2BDN A;  1HQM C;  1B50 A;  4A3K G;  2DJG C;  5K36 H;  5JJI A;  2QF7 A;  2KCN A;  2YYZ A;  3OMG A;  5EBC A;  4X6A H;  4X64 Q;  1WI5 A;  1JWS D;  3J7Y W;  4LF9 Q;  4RWS C;  5M3M B;  3J7A 5;  4YHH Q;  4JI7 L;  4JI0 Q;  1VDZ A;  1GOZ A;  5JJL A;  4B9X A;  3OWE B;  5DAU A;  5E7N A;  4KV6 A;  1B8A A;  1WOC A;  5JVG 3;  4BA2 I;  1PH3 A;  1UNS A;  2C5C A;  1YHA A;  4FVM A;  2A6E C;  4DR2 Q;  4JI5 Q;  1M90 C;  1SLJ A;  4DR5 Q;  1PDQ A;  4DAV A;  3D4W A;  2BOS A;  3E9I A;  4XYQ A;  5C0X H;  1CSP A;  1CKM A;  4IUR A;  2VW9 A;  2Q2H A;  1R4Q B;  1NR4 A;  1HNZ L;  5COR A;  1TWA B;  5JPN C;  2JA9 A;  3U4V A;  3KOJ A;  4A3B B;  1EEI D;  4R4T A;  3VR2 A;  3NTH A;  5BN4 A;  1SSO A; 
#chains in the Genus database with same CATH homology
 5JPM C;  2CQA A;  4PQX A;  4IFD H;  2Y0S B;  2WAC A;  5DNF A;  5FLX E;  2OEO A;  1C48 A;  4F8M A;  3IL8 A;  2DNC A;  1DON A;  4JBW A;  4XXE A;  4RKL A;  4ZKB B;  2NBF A;  1RD9 D;  3H09 A;  1BF4 A;  2F4I A;  2EDG A;  1SNM A;  3R3O A;  5T1G A;  4K2K A;  3BZD B;  1DD2 A;  2QEJ C;  2O2L D;  2PYK A;  3N6R A;  2R3Z A;  1PRT D;  2MJ8 A;  3H3V C;  2LY7 A;  1CTM A;  5BN3 A;  1TT2 A;  1YNJ D;  2IL8 A;  4DNT B;  4IZ8 A;  1TWH B;  3OMC A;  3DM1 A;  3S16 B;  4ZUJ A;  4KHV A;  2MGS A;  3C1F A;  4Q0F A;  1F2Z A;  4ZKC B;  1MI2 A;  2NB0 A;  4ABN A;  1Q3L A;  3D6C A;  1STH A;  2KVM A;  4C3J G;  1D1K A;  4F88 A;  5FOB B;  2K5D A;  1CZG A;  3S15 B;  5CBA E;  3PUX A;  4KY6 A;  4TSS A;  4LMQ D;  1DOM A;  4ID6 A;  2EVB A;  1RDP D;  4KK7 A;  1WD0 A;  2RKS A;  4R8I A;  3MFG A;  3BS1 A;  4RCO A;  3ERO A;  1EEF D;  1Y8P B;  4J1M A;  1MBY A;  3WOF A;  5DM7 3;  1SYG A;  2NVX B;  5NUC A;  3SXH A;  1OXU A;  1QNK A;  3HS0 C;  2RSO A;  1WVL A;  1NR2 A;  1S5C D;  3OHX C;  1Q8I A;  1LTA D;  1GUT A;  4RA8 A;  1U4L A;  2J0T D;  1CZW A;  2O5J C;  2ZXO A;  4GZY C;  1GHK A;  3A8I E;  2RDF A;  3MZ5 A;  1ENA A;  3BDL A;  4Y7N B;  3NXW A;  1AW7 A;  3FPU B;  3D31 A;  2F0P A;  3E5S A;  1I3Q B;  1BNZ A;  3A56 A;  3OIQ A;  2EPB A;  2B2Y C;  2F0O A;  3MC0 B;  4L6T B;  1SE3 A;  5D14 A;  1ZYR C;  1B9M A;  1SEB D;  4A3I B;  2E2D C;  3Q24 A;  1ZXT A;  1R9T B;  3HOX B;  4I7Z C;  3I4N B;  1DM0 B;  5A2Q L;  1JCK B;  1WTQ A;  3BG3 A;  1GUG A;  4PMW A;  3NK9 A;  3HZX A;  2QIL A;  2F0K A;  2EYL A;  1WD1 A;  1ROD A;  2K6A A;  1J8I A;  2JA5 B;  2AWN A;  1OO9 B;  1I4R A;  1Z7T A;  3DEO A;  4QCL A;  1O80 A;  1WTO A;  5J1Z A;  4OHJ A;  3ERQ A;  3URY A;  1EFI D;  3SK5 A;  3TP8 A;  2C9O A;  5JOB A;  4N9T A;  4CBV A;  1STA A;  1I4G A;  4BBR B;  1U4M A;  2WKD A;  1QIL A;  1ENC A;  3I91 A;  4DA2 A;  4LJZ C;  1V1O A;  2G9D A;  3NQI A;  1HQR D;  3CRK C;  5C0X J;  2DY8 A;  2CW0 C;  3EA6 A;  3IFD A;  2R92 B;  1SYB A;  1WCM B;  1LAC A;  4FXK C;  3A8J E;  1QNU A;  4K6D A;  1MD2 D;  4WFN 3;  2B2U A;  3MXP A;  1EQV A;  3RZO B;  1KDA A;  4J6H A;  4HMJ A;  1AZP A;  3IKJ A;  1AFP A;  2VUM B;  2NVY B;  3EJI A;  5M5X B;  4DN4 M;  1IYV A;  2Q8R E;  2XIW A;  5C44 B;  2RBM A;  2BCO A;  1L0Y B;  5C6A A;  3E0J A;  4CKE A;  3KLS X;  1RTO A;  2F0Q A;  2HDL A;  1I4Q A;  5KNC A;  1AN8 A;  5FO8 B;  2PW5 A;  4K5V A;  3R8B A;  1NAP A;  3GD7 A;  5COY A;  1DOL A;  3L9A X;  4K5X A;  1EYC A;  4FXG C;  2E2J B;  2KOL A;  2GA4 B;  4FF4 A;  2EJF C;  5LL6 X;  1LTG D;  2AUK A;  4CJ0 B;  1B44 D;  1SDF A;  4U68 A;  3MVV A;  4KY5 A;  1TKW B;  3A7A B;  2F1M A;  1CK1 A;  1ZEQ X;  3BVZ A;  1H9K A;  2EE1 A;  1GUO A;  1A15 A;  5D3I B;  1IKL A;  2R93 B;  3I72 A;  5C4H A;  4FP5 D;  2B8F A;  3U9O A;  4WRD A;  1H9J A;  4RHS A;  1TII D;  2JA6 B;  4HCE A;  1RTN A;  3BYY B;  5ELB A;  3NUC A;  1Y8O B;  3W2D A;  2K5W A;  5JEA G;  2FMC A;  2F3V A;  4CHT B;  3LNN A;  1CA6 A;  5E1F A;  1DCZ A;  4F87 A;  3NWS A;  3J81 E;  4OIJ A;  3D6W A;  1GHJ A;  3RMH A;  3MEH A;  1RF2 D;  3NE5 B;  2L11 A;  4A3F B;  1QWY A;  4XT1 B;  2NN6 G;  2NZ1 D;  4WOR A;  5IGG A;  3GTG B;  4EQN A;  2FJ2 A;  1WTW A;  1SAP A;  4G7Z C;  2RSN A;  3AU7 A;  1T5E A;  2BE5 C;  4DFA A;  1SNP A;  2EYO A;  1JB3 A;  1CQV A;  1KLU D;  3UI2 A;  4L8J A;  3K7A B;  2B2T A;  4YIJ A;  2Z8L A;  2K04 A;  1NSN S;  3DMU A;  3PUW A;  1D2B A;  4X3K A;  3VYR A;  5TSS A;  3W3A A;  2K01 A;  4S3S A;  4ZLT F;  1PRT F;  4RCN A;  2G9H D;  4V19 0;  2N55 A;  4IUN A;  3CQZ B;  3C3L A;  1NCV A;  5ELF A;  2KEE A;  2NN6 I;  1GUW A;  5C4J B;  1DOK A;  1K8O A;  5IGB A;  4K8I A;  3VR6 A;  3F2U A;  3T13 A;  4HAE A;  4LAA A;  4R9W A;  3S14 B;  4OGQ C;  1STB A;  1LT3 D;  2F0V A;  3K5O A;  4C1N K;  1D5M C;  1JOO A;  1BCP D;  3OWF A;  1GUS A;  1SYF A;  2R6G A;  3J80 L;  3A8K E;  4BWG B;  3HOW B;  4A3K B;  5EQ0 A;  3ONA B;  3J81 L;  2LFN A;  2M00 A;  5JEA J;  1SMY D;  4HSP A;  2PZT A;  2XRQ D;  1EU4 A;  4ME5 A;  2M2L A;  1OXS C;  2K03 A;  5M3F B;  2ENB A;  5C3W A;  2L9H A;  1EZ6 A;  3C2P A;  2XNA C;  1Z47 A;  3EQL C;  2PPB C;  3DHQ A;  2IWH A;  4KMU C;  2D9U A;  5JVH 3;  3GTO B;  2NWG A;  3RZD B;  3L7Z C;  2OXP A;  1O7Z A;  3K5N A;  3MFY A;  2EY5 A;  1RKN A;  4Z9C B;  1R4P B;  2DNE A;  3PUV A;  2A69 D;  3DUZ A;  2J4X A;  5CR3 A;  2NVT B;  2F0G A;  3RLF A;  5EKL A;  2KHS A;  5HUR A;  5IT9 E;  4BA1 I;  1WTR A;  1LLR D;  3P20 A;  1TS5 A;  1B4O A;  1BR9 A;  4BY7 B;  3MWY W;  3OSO A;  2RDG A;  2JP1 A;  4P2C B;  1HTL D;  4X3T A;  3G7L A;  2LS0 1;  5CC4 A;  1VF7 A;  1FGB D;  4G7H C;  3VYS A;  1SNQ A;  1PLF A;  2CVR A;  1LAB A;  1H9R A;  3OPO A;  2A6E D;  4EQP A;  2VXW A;  3I90 A;  1BBX C;  4DK1 A;  5CV9 A;  3T53 B;  2FMM A;  1OXT A;  2B2T C;  4FNF A;  1PTO H;  3MTS A;  1KAB A;  2MPM A;  3GTQ B;  5D3D A;  4IQZ A;  2A5H A;  4XYO A;  1HA5 A;  3TN2 A;  1JWM D;  3M85 A;  1O7L A;  4O42 A;  3TP7 A;  2F0N A;  4Q5V A;  5DM6 3;  1CT1 D;  5KYL A;  3MAQ A;  5EBD A;  1EWH A;  1EYA A;  1JOK A;  2K7V A;  4R8N A;  1TQO A;  4KI0 A;  1LTB D;  4H0L C;  2LKV A;  3RUZ A;  3TBI B;  1A2U A;  2WP8 J;  2WAQ B;  2JE6 I;  1HCZ A;  2IT1 A;  4F7X A;  5KND A;  4CJ2 C;  2XN9 C;  3DWP A;  3MA2 B;  2A68 C;  1DZ1 A;  1CM9 A;  3CHB D;  3Q0A A;  3G6J B;  1BO0 A;  1SYC A;  1MGS A;  1SE4 A;  3KLS A;  5EGT A;  1STE A;  2JEA I;  4G4K A;  5FLX L;  1O78 A;  1QG7 A;  1PFM A;  1VMP A;  3K6O A;  2L12 A;  1JIC A;  1FR3 A;  1G6Z A;  1E2V A;  4C1N I;  2EOT A;  2PQE A;  4NDX A;  1LT6 D;  4FO2 A;  1SNC A;  1X32 A;  1J9O A;  3DWA A;  5CV5 A;  3Q6S A;  4K8J A;  2KCC A;  4A3E B;  4B08 A;  1RHP A;  4XQJ A;  2Q8I B;  1NUC A;  2F0M A;  2X69 A;  3T56 B;  3QOL A;  3PO2 B;  1C8C A;  1SYD A;  3CU7 A;  1TU2 B;  4RGO S;  4C3I G;  1B3A A;  1H9S B;  3EVQ A;  1XTC D;  1XX8 A;  3NWT A;  1S5D D;  3M7G A;  1G29 1;  5E3F A;  3EFX D;  5I4D A;  4C3H G;  4XDX A;  1STY A;  1LT4 D;  2EYJ A;  3H94 A;  1PTO F;  4CKC A;  2F0W A;  1JOQ A;  1IHZ A;  3HOY B;  5ELE A;  2L4N A;  2A6H C;  3VYU A;  1ZYR D;  4TKO B;  1Y1W B;  2FFK B;  2BA1 A;  3RD4 A;  1DYQ A;  1DXM A;  4KD4 A;  1ML0 D;  2FHT A;  3TP5 A;  2IX1 A;  4A3J B;  3M3Y B;  4NW2 A;  3MXN A;  3H6M A;  2EY1 A;  2F0T A;  5EJW A;  2M9V A;  1YNN C;  3V05 A;  1OXX K;  5EKK A;  5M9O A;  2F0E A;  3C46 A;  1BCP F;  1D6E C;  1VMC A;  4RHR A;  1MSH A;  2KED A;  4PV1 C;  1D5Z C;  1D1I A;  2EY6 A;  3PIO 3;  2K33 A;  4QMG A;  4KJO A;  5JEA H;  3VA5 A;  1H9S A;  3AMU A;  2Q8T A;  1XXG A;  2CW0 D;  2F0U A;  3FMC A;  3NSW A;  3J7A F;  2B8G A;  3S1N B;  4A3M B;  1PZJ D;  2R7Z B;  1Q90 A;  4PNY A;  3CRL C;  2E2I B;  2NN6 H;  3I70 A;  2MUY A;  1JC7 A;  3HEJ A;  1ET6 A;  2AWO A;  2EYF A;  2B2W A;  4IUQ A;  5A35 A;  3NTK A;  1LTS D;  3HOV B;  3D4D A;  1HUN A;  1EOT A;  1PFN A;  4CJ1 B;  3FPP A;  1TWF B;  3X3N A;  3SK4 A;  1B1Z A;  1EY8 A;  2V4D A;  2EJM A;  4U67 3;  4EVO A;  3ND9 A;  2X6L A;  3M4O B;  4IUT A;  1L0X B;  2K5Q A;  1SJE D;  3K57 A;  1EY6 A;  5G3L F;  1PZK D;  1EYD A;  1PRT B;  2MP1 A;  5HGT A;  1IKM A;  1RCV D;  3TDQ A;  4M8A A;  5C5M A;  1HHV A;  3FRP B;  2PO4 A;  3BVM A;  3K5M A;  5IGF A;  3GTK B;  3S9W A;  3PIP 3;  5D65 A;  5IGE A;  5LHY 1;  4DGZ A;  4QF4 A;  2I46 A;  1F2M A;  3LX0 A;  3PUY A;  3GO5 A;  2B63 B;  5IGD A;  3I4M B;  3FKI B;  2PMZ B;  3WDN A;  5CV7 A;  3A54 A;  1F9Q A;  3VYT A;  3NTI A;  3QOJ A;  1BQQ T;  1I4P A;  1ZKO A;  4KHZ A;  1ET9 A;  3QB3 A;  5C5L A;  2JA8 B;  2SNM A;  2BA0 A;  3Q23 A;  1EIH A;  2KA7 A;  2SNS A;  5IIF A;  2RQX A;  2L0C A;  4BS9 A;  4XQN A;  1EZ8 A;  4QUC A;  2CHB D;  2HCI A;  1F77 A;  4QUF A;  1QCB D;  1LV9 A;  3D3R A;  1Z6H A;  3NHH A;  2O5I C;  1PTO D;  4IUU A;  1UUP A;  3QIA A;  2L5T A;  3LWU A;  4KKT A;  3TZD A;  1E2W A;  1QOH A;  1G91 A;  1I6V C;  5I2Y A;  1QJO A;  2XRS D;  3HG9 A;  2K05 A;  1A3V A;  4FYD A;  1HUM A;  1S5B D;  3I73 A;  4DF7 A;  1ESF A;  3V96 A;  3HRZ C;  2F0I A;  1G8Z D;  4XQQ A;  2B2U C;  4L63 B;  3TSS A;  3I3C A;  1PFB A;  4HTH A;  4HMI A;  2NUC A;  4ZYS A;  2IW3 A;  5KRU A;  1SMY C;  3LWE A;  2F0H A;  4OO1 G;  1TWC B;  2DY7 A;  1I4H A;  1X3P A;  1IW7 D;  1TVX A;  3TZU A;  1I6H B;  5JJZ A;  3R93 A;  4HCS A;  2XSC A;  2TSS A;  5E4W C;  4RGN A;  3GTM B;  2QKI C;  3T51 B;  1B9N A;  2B2W C;  3JAM E;  4C2M B;  2EYH A;  1Y69 U;  3S17 B;  4JK1 C;  4X3U A;  1AZQ A;  1JOR A;  4KD3 A;  2PNR C;  2H1E A;  5FK9 C;  5C3E B;  1FYC A;  1JE4 A;  3VR5 A;  2PZU A;  3P1H A;  5KEE A;  2JSO A;  3I8Z A;  4C56 C;  3KF8 A;  1KLG D;  2HCC A;  1W6J A;  2A69 C;  2O4X A;  1T5X D;  5G3L D;  2B2Y A;  3K58 A;  3NBH A;  1IL8 A;  1EY5 A;  4FF3 A;  1RJT A;  4XT3 B;  5EPL A;  2FIN B;  3MXG A;  1HA6 A;  2Z4H A;  2ZXP A;  1S5E D;  1JWU D;  3VR3 A;  2NYZ D;  4KY7 A;  3S1Q B;  4J8Q A;  1Q1E A;  1A3U A;  5KIX A;  1TR5 A;  3I4L A;  2L55 A;  3SDZ A;  4ZQ3 A;  1EY9 A;  4RAU C;  1B53 A;  1PXU A;  5FO9 B;  1I50 B;  1QB5 D;  2JYO A;  3PV0 A;  5EKI A;  3PUZ A;  2K32 A;  1EL0 A;  1F2Y A;  2I07 B;  3M7N A;  2EZV A;  1TY2 A;  2DN8 A;  5T1I A;  1EU3 A;  4I65 A;  4XIG S;  1STG A;  1TWG B;  1DJR D;  3GP7 A;  4NMZ A;  3SK6 A;  3D4R A;  2F03 A;  5AFW A;  1M8A A;  5CMD A;  3P75 A;  4C3J B;  1WTV A;  5JAV A;  3JAM L;  2JEB I;  5IOC A;  2RDH A;  1Y1V B;  2RA4 A;  3KLR A;  1F9R A;  3V2T A;  1LTT D;  1WTX A;  2E75 C;  2E2H B;  3ITP A;  4IAL A;  2PCF B;  2B2V A;  4LK1 C;  1PRT C;  2E76 C;  3FEW X;  1YNJ C;  4ZK9 B;  1LT5 D;  3DWQ A;  3E6Z X;  1U4R A;  2IPK D;  2XVS A;  5ELD A;  4NP5 A;  1EY7 A;  2LMC B;  5CYU A;  5C4X B;  3K5L A;  4K14 A;  1FNU A;  1PZI D;  4DK0 A;  1Q1B A;  3SEB A;  3KBX A;  3VA7 A;  5IT9 L;  5CBE E;  5I6Y A;  5K5P A;  1KNA A;  2IX0 A;  2WII B;  1HPC A;  1JR0 D;  1A6X A;  1TS2 A;  4OL7 A;  3TME A;  4CGY B;  1G2T A;  1A2T A;  3KUP A;  1BOS A;  1PTO B;  5K36 G;  1SFO B;  3FVQ A;  5A2Q E;  4ULL A;  3S1M B;  2QDB A;  2PW7 A;  1SJH D;  5FKA C;  4C3I B;  2NTS A;  4DXF A;  1X3Q A;  4O1N A;  2D2C C;  2WB1 B;  2ICI A;  2A74 C;  4C3H B;  2L1B A;  3IAY A;  1PYW D;  4ZAI A;  3WOE A;  5IOD A;  1CHQ D;  2KEC A;  5C0X G;  4PMC A;  1M4V A;  5EPJ A;  1U4P A;  1O7Y A;  2A68 D;  5I2X A;  4IUP A;  4MN3 A;  1JQY D;  3QG1 A;  1E2Z A;  1F2L A;  2OF1 A;  1BCP B;  4FF1 A;  4TQU S;  1CI3 M;  3X3M A;  3BVG A;  4IFD G;  2WIN B;  3GTL B;  5CV6 A;  3PO3 B;  2HDM A;  5LL6 S;  1AP0 A;  1KAA A;  2F0F A;  4MIU A;  3O13 A;  1LO5 D;  1LTR D;  2ZT9 C;  3T4A C;  5J39 A;  5EPK A;  2YU9 B;  5DEH A;  5C0X I;  2XWJ B;  4G7O C;  1GJX A;  5I9O A;  1BDO A;  1EIG A;  5E4X A;  1TS4 A;  4QIW B;  1CA5 A;  5J22 A;  1ENF A;  4IFD I;  4DNR B;  1GUN A;  2Z1C A;  5KGU A;  4UDU C;  4DAY A;  1TS3 A;  3K0Y A;  2X6G A;  5IGC A;  3R2I A;  3K59 A;  3CKI B;  3HKZ B;  5KYI A;  2JA7 B;  1EY4 A;  4A3D B;  1STN A;  4RGM A;  3U9S A;  5KNB A;  2F0S A;  1AEX A;  3KBG A;  2AQ1 B;  3D8G A;  2A6H D;  2HUG A;  1KTK A;  1BXT A;  1V43 A;  5I9P A;  2EYM A;  2AQ3 B;  2N88 A;  1MSG A;  4MHE A;  1ILP A;  2TMP A;  2SDF A;  1LTI D;  2B2V C;  3SR1 A;  1YNN D;  2NTT A;  3BYT B;  4IFD J;  1CHP D;  2VB3 X;  3S2H B;  3S1R B;  1W6K A;  4BY1 B;  2VNU D;  1FNW A;  2EJG C;  4KKU A;  4HSV A;  1ICW A;  4A3G B;  1D5X C;  1SND A;  4N9P A;  2AUJ D;  3AB9 A;  4PMB A;  3HGB A;  3ND8 A;  3OIP A;  1Y8N B;  3TP6 A;  4XTC S;  5C4Z A;  2BDO A;  3OW7 A;  4DU9 A;  2EYP A;  4KN7 C;  1ONL A;  2J7Z A;  3OOC A;  4AYB B;  4M1U B;  3HOZ B;  1BUV T;  2PZW A;  1VCI A;  2R61 A;  4FXD A;  4HN7 A;  2OT2 A;  2B39 A;  1S5F D;  5ELC A;  2HQE A;  2D62 A;  2EXZ A;  2D5D A;  3KK7 A;  5M5Y B;  2E74 C;  5M5W B;  3GV3 A;  1E0B A;  4WJW A;  3GTJ B;  3DEP A;  1S4Z A;  3SE0 A;  3H0G B;  4ODG A;  2SOB A;  1HFG A;  5CGK A;  3NBI A;  1HXY D;  3S2D B;  1QE6 A;  2QCP X;  4RFB A;  2F0J A;  4OO1 H;  3M4Y A;  3HP3 A;  1B2T A;  1II3 A;  1V1P B;  4FF2 A;  1CFM A;  2NVQ B;  3QO2 A;  1UAP A;  3L3O C;  1EQT A;  1HFN A;  1XWE A;  4H13 C;  1SE2 A;  4BBS B;  2VB2 X;  4CKB A;  3J80 E;  4K2L A;  1Q12 A;  2F0L A;  1UEA B;  5CV4 A;  1PTO C;  1F9S A;  1FNV A;  1IYU A;  5C3X A;  3P7J A;  3GQB A;  4ZUI A;  4EGV A;  1VF5 C;  4B9W A;  1OXV A;  4ZRZ A;  1KDB A;  3GTP B;  1EWC A;  1TY0 A;  1K8M A;  3A7L A;  2WV6 D;  2ZXR A;  1SBB B;  3MHB A;  4HED A;  1EY0 A;  4KKS A;  1HRJ A;  3SVM A;  5ISR A;  4TRD A;  2BE5 D;  2WKC A;  4RGT A;  4KJN A;  3Q22 A;  1BCP C;  4V0B A;  3QJY A;  3R2T A;  1ESR A;  1V1P A;  2ID0 A;  3T16 A;  3BDO A;  4HR7 B;  2K1B A;  4A93 B;  2IJ0 A;  3HOU B;  4EQO A;  1IW7 C;  3ZYY X;  4RKB A;  1XYI A;  3IFT A;  3GV6 A;  1KDC A;  4K6L A;  2KQ3 A;  4H44 C;  3NP8 A;  3SHL A;  2XWB B;  4UAI A;  2Z4I A;  1C4Q A;  3BDC A;  4QB4 A;  1FD7 D;  3PMF A;  2F0D A;  3N52 A;  4DAP A;  4K5W A;  3A55 A;  1F9P A;  2KUM A;  2EY2 A;  4X3S A;  2RVL A;  2SEB D;  1PMR A;  4OIK A;  3FDT A;  2MHV A;  3J7A V;  3NQT A;  2IX3 A;  4ILW A;  2H4O A;  5I6W A;  4RH6 A;  3VR4 A;  4DXG A;  1G2S A;  1V8Q A;  1KNE A;  1K83 B;  5FO7 B;  2AQ2 B;  4KTA A;  1SNO A;  2ICE C;  2A73 B;  3MXU A;  4OO1 I;  1CQF A;  4G57 A;  1H9M A;  3H91 A;  1WTP A;  3DXJ C;  2JXM B;  2F3W A;  3SK8 A;  4H7B A;  3C1E A;  4IUV A;  4NKL A;  4KN4 C;  2K28 A;  5BN5 A;  1U9R A;  3QWN A;  5F2D A;  1A3T A;  1SXT A;  1I4X A;  5CV8 A;  3NPP A;  1ILQ A;  2KJX A;  1GXD C;  1HTP A;  4IN3 A;  4E6I A;  1SYE A;  2BDN A;  1HQM C;  1B50 A;  5K36 H;  2QF7 A;  2KCN A;  2YYZ A;  3OMG A;  5EBC A;  1JWS D;  3J7Y W;  4RWS C;  5M3M B;  1VDZ A;  1GOZ A;  4B9X A;  3OWE B;  5DAU A;  4KV6 A;  5JVG 3;  4BA2 I;  1UNS A;  2C5C A;  4FVM A;  2A6E C;  1PDQ A;  4DAV A;  3D4W A;  2BOS A;  4XYQ A;  5C0X H;  4IUR A;  1R4Q B;  1NR4 A;  5COR A;  1TWA B;  5JPN C;  4A3B B;  1EEI D;  3VR2 A;  3NTH A;  5BN4 A;  1SSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...