2B2UC

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uC00
4X3TA 4X3SA 1SAPA 5CORA 2IL8A 4ZLTF 1EQTA 2HCCA 5E4XA 1U4RA 5JJZA 2SDFA 4HAEA 2H1EA 1TVXA 4ZKBB 2XIWA 2HUGA 4O42A 1J8IA 1DOKA 3TZDA 1WTQA 2MGSA 3HP3A 2L1BA 1B53A 2L12A 1GUWA 1XX8A 1HHVA 2BDNA 4OIJA 2K1BA 4ZAIA 1QNKA 2RSOA 2DY8A 3KUPA 4QUFA 5D65A 1G6ZA 1ML0D 3D6WA 3I91A 2JYOA 2B2TC 4HCSA 5EPKA 2X69A 1MSGA 1DOMA 1PFNA 1S4ZA 1RTOA 4ZK9B 2FINB 4X3KA 4XT1B 1KNEA 1ICWA 1X32A 1O7ZA 2FFKB 3IFDA 4XT3B 1J9OA 2KUMA 3I90A 2R3ZA 3GV3A 4XDXA 2B2VA 1DONA 1HFNA 1ZXTA 2FJ2A 3I8ZA 3I3CA 3FPUB 2HDMA 3IL8A 1U4LA 2K05A 3UI2A 2KOLA 5CBAE 1X3PA 2J7ZA 2KVMA 1WD0A 3QO2A 2RA4A 3MWYW 5CBEE 2NZ1D 3GV6A 2B2UC 4CJ2C 1WD1A 2K04A 4IUPA 1C8CA 3F2UA 5EPLA 5T1IA 2B2YC 1B50A 2EPBA 1PLFA 1ESRA 1ILQA 1G2SA 1NCVA 1SDFA 1X3QA 2B2UA 3H91A 2MPMA 1HFGA 2KECA 1WTVA 4HEDA 1E0BA 1BBXC 1U4PA 1IKMA 1HRJA 1M8AA 1HUNA 2N55A 1MSHA 4IUVA 5EKIA 3R93A 3G7LA 1MGSA 1B2TA 2KEEA 1HUMA 3MTSA 2K01A 5COYA 1F9SA 1BNZA 5AFWA 2B2WA 1RHPA 2VXWA 4MN3A 1LV9A 1O80A 4IUUA 2L9HA 2N88A 2RVLA 2HDLA 3SVMA 1A15A 1RTNA 1EIGA 1EIHA 1MI2A 5D14A 1F9PA 4RAUC 1PDQA 2EOTA 4U68A 2B2TA 2B2WC 2NWGA 2Q8RE 2K28A 4ZKCB 1XYIA 1B4OA 2CVRA 1AP0A 5CMDA 1F9RA 3LWEA 4MHEA 1IL8A 1WTXA 1BO0A 1F2LA 2L4NA 5E4WC 4NW2A 1G91A 1CM9A 2X6GA 1QE6A 2JP1A 2NYZD 4R9WA 3KBXA 5EQ0A 1PFMA 1DOLA 4IUQA 3DEOA 2HCIA 4UAIA 5DNFA 2KEDA 4HSVA 1HA6A 4OIKA 1JE4A 4DN4M 1U4MA 1DZ1A 1EL0A 1IKLA 1B3AA 3TN2A 1PFBA 4IURA 1QG7A 4RA8A 1VMCA 5T1GA 5EJWA 2B2YA 1F9QA 1WTWA 2RSNA 1JICA 2L11A 1NR4A 2FMMA 4CJ1B 4R8IA 1ILPA 1CA5A 3P7JA 4LMQD 1AZPA 1Q3LA 3FDTA 3Q6SA 2K03A 3DEPA 4X3UA 1AZQA 1NAPA 1WTRA 1CA6A 1WTPA 4CJ0B 1WTOA 2MJ8A 1BF4A 2MP1A 1WVLA 2Q8TA 1VMPA 1RJTA 1G2TA 4RWSC 2FHTA 4IUTA 2B2VC 2M2LA 1NR2A 3DM1A 2DY7A 3ONAB 2D9UA 1SSOA 2EE1A 1KNAA 4QUCA 2X6LA 3N52A 1RODA 5EPJA 1O7YA 1EOTA
chains in the Genus database with same CATH superfamily
1SAPA 4A3DH 1EYAA 3G4SA 2H1EA 4A3IH 2UXBL 1AE3A 1DOKA 4K8IA 4XQQA 1RKNA 1PZKD 2Y0SE 5EBCA 4A3DG 2QCPX 3H3VI 2K1BA 4Q5VA 3OOCA 2JN4A 1LM0A 2K50A 2F0UA 1F77A 5M5WH 3SK8A 1EU3A 1PFNA 2Y0SB 1CKNA 3IKJA 4XQJA 5C4JB 1ESFA 1KNEA 3H94A 5C4ZA 2E5LL 1J9OA 2KUMA 1A63A 4XDXA 4CKCA 5IIFA 1KTKA 2OXPA 4AIMA 4DR3Q 3WOEA 1OTCA 1JB7A 3UI2A 4A3FB 2KVMA 4BXXH 5CBEE 2L55A 2IW3A 3CC2A 2K04A 4GKKQ 5GADC 5EPLA 3CCRA 1N34Q 5M5WB 1TIID 2XN9C 1VQHA 1ESRA 3ERSX 4B3SL 4QMGA 5H1SE 2MPMA 4TSSA 1U4PA 1DD2A 3S1NB 1TWFH 4C1NK 3OW2A 1P8LA 1H9MA 5C44B 4DV3L 3S2DB 4IUNA 4LNQA 4A3IB 2OCEA 4HJ8A 1XNQQ 3BVZA 1EIFA 1FR3A 3K0YA 5IT9c 1AN8A 2A6EC 4K6DA 4ULLA 4GLAC 1YZ6A 3OYYA 3NK9A 4F87A 4DV1L 1XMOL 5E1FA 3QIAA 3PSIA 3RLOA 1A2UA 1V9PA 5KEEA 4CKBA 2LMCB 1GO3E 4KHVA 3CMAA 1VDZA 4OO1I 3E5SA 5KNDA 4YWLA 1STEA 4JCVE 5EJWA 2A6ED 2AHOB 4OEMB 3K80C 1QNUA 1AZQA 3S24A 2B8FA 2QDLA 5DM73 4RWSC 2A69C 5KRUA 3SR1A 2X6LA 2QILA 3R3OA 4YCWA 5E3FA 1O7YA 3SE0A 2UUBQ 4ZLTF 2SOBA 1WI5A 2CW0C 4V190 4BBRB 4FF3A 5ELBA 1HNZL 1TVXA 1GUWA 2DNEA 2CQOA 3OTOQ 4AYBE 1QWYA 4IJHA 4GNXC 2EIFA 2EY5A 2RSOA 4XYQA 4KY6A 2AQ2B 3RN5A 3SHLA 1SXTA 1OXVA 4K5XA 1MSGA 5ISRA 1B3QA 1LTGD 4DR1L 2A19A 1YJ9A 1ICWA 3J81E 3GTMB 3CQZB 1HFNA 2F0HA 4BY7B 4B9WA 1FGUA 5DEHA 4DR5L 1TWFB 1D1KA 3DM3A 4A3LH 1TWCH 3MXGA 4C56C 5IP7H 4NXNQ 1B50A 2D5DA 1ET9A 1XTDA 2QEXA 3MXNA 4YCUA 3G48A 1SMYD 1ZKOA 1M8AA 3K5OA 4A3FH 4KHZA 3U58A 1AH9A 4DNIA 2PZWA 5CC4A 4ALPA 3CCSA 1RF2D 1EIGA 2V1CC 3K6OA 2I0QA 3V2TA 3X3NA 3HOYG 1UE1A 4A3MB 4C2MB 1C4QA 1S5CD 4MHEA 1Q7YC 4NW2A 1G91A 3WOFA 1QE6A 2WP8J 1EWCA 3H3VC 1N36L 2PCFB 1EZ8A 2BH8A 1EEID 4HSVA 3H6MA 1JE4A 1LYLA 1U4MA 1EL0A 3TN2A 1PH6A 2R6GA 4A3DB 1QILA 3K57A 3K0XA 1E3PA 3I72A 1YHAA 2B2YA 5KNCA 1CA5A 1VF5C 1AZPA 3TP7A 2ZJQA 1JB3A 3S17B 5CV6A 2RDGA 3QOJA 2Q8IB 5FLXE 1WVLA 1OXXK 2Z6KC 1CKOA 1G2TA 1Q12A 4PZ7A 2F1MA 2B2VC 2EYOA 3PO3G 2WB1G 2MQHA 3ONAB 1SSOA 4IJLA 4OXPA 4UPAA 3HOUG 1RODA 4F7XA 3AU7A 2BE5C 1PH8A 1U4RA 5C6AA 4HCEA 2F0FA 4ZKBB 1XMQQ 2F0GA 1QVGA 5IWAL 3C3LA 1YNND 2WB1B 1T5EA 3NEMA 3BVMA 1VQNA 4DF7A 4B3TL 2JA5G 5C0XG 4OWTB 1JJ2A 2Q2HA 4XT1B 1E2ZA 1JOQA 5IGGA 3SEBA 2B63B 4XT3B 5HY6A 3FP9A 4JI3L 4BS9A 1JC7A 3GTKB 3EJIA 5E7NA 2F0PA 3RN2A 2WINB 3I8ZA 2JA7G 4HMIA 1PZID 3GTMH 1WD0A 4HR7B 4YHHL 3Q8DA 1R4QB 3PUWA 3PO2B 3M85A 4DK1A 2J4XA 2DN8A 5IGEA 3HS0C 2PZTA 1CZGA 4A3LG 1ENFA 2B2UA 3FRPB 1JJGA 3PO2H 4RGMA 4JI7L 5BN5A 4A3GB 1STHA 4DUZQ 4RFBA 1PZJD 1Y1WG 2B3GA 5AJ3L 4LF8Q 1RTNA 3T51B 2SEBD 1RD9D 4B3SQ 1ZEQX 5TSSA 2TSSA 4KY7A 1EU4A 3OWFA 1VQJA 2A6HC 4GKKL 2I5HA 4LF9L 4EQNA 3G6EA 2NVYH 3TS0A 4K8JA 1IBKQ 5IGDA 1SNPA 1V8QA 1M4VA 4DNTB 1E2WA 5G3LD 1PV4A 4JC0A 1KDCA 5IY0A 3GQBA 1Y1WH 1HA6A 2AWOA 2F0SA 1IYJB 2Q2TA 3S1MB 4IURA 4HJ9A 4OHJA 1NNXA 3PO2G 1FD7D 1EQVA 2H4OA 4TQUS 2CCZA 4XQNA 1VQIA 4R4CA 4X3UA 2UUAQ 1PH9A 1G6PA 3H3VH 4HJAA 4HJ7A 4FYDA 1MKHA 4JI7Q 4IUTA 3GTJH 4BBSB 3HZXA 2NN6G 1GD7A 4ABNA 4KKSA 3OMGA 5EPJA 1W3SA 1AEXA 1LO5D 1X65A 4JI5Q 5C0XH 3ULLA 4DV3Q 5NUCA 3M3YB 3GD7A 1BKBA 4DR6Q 2CWAA 4DUYQ 1IW7D 4IPDA 4JBKA 1DCZA 2I07B 2F4IA 4YWMA 1WCMB 2ZXRA 4OO1H 2YU9H 1YI2A 3I3CA 3FPUB 3IL8A 2R7DA 5CBAE 3J80c 1VQGA 4IPHA 2IJ0A 2RA4A 4RKLA 3F2UA 1LTTD 2L5TA 2R7FA 2Y0SG 1OXSC 3E9HA 2OT2A 4FXDA 4BXXG 2LSSA 2KECA 3C1FA 2MUYA 2RDFA 1TU2B 1ONLA 1ZYRC 4LFAL 2ICEC 2K01A 1SE3A 3VYTA 2DUDA 2OF1A 3CQZH 1PA6A 2RVLA 2HDLA 3SVMA 1BUVT 4MNOA 5CV4A 3TREA 2KHSA 4CGYB 1D2BA 1I4QA 2BOSA 2VS1A 1IL8A 3TSSA 3HOYH 2EJMA 2MHVA 4K5VA 2ASBA 2NZHA 1MJCA 4X65L 4DV7L 4A3IG 3DHQA 3H0GB 3RR5A 1PFMA 3UE0A 3IAYA 2AWNA 2CH4W 2HCIA 1PYWD 2NVQH 2EYLA 2BH2A 1ENCA 4A3FG 1E24A 3KLSX 2PI2E 1XNRL 4C3HG 1WTWA 3VYSA 2FMMA 4H0LC 1S40A 1FYCA 3A8KE 3NSWA 2IHFA 1QVFA 1Q3LA 2K03A 3VA7A 2JSOA 2RHQB 1LTSD 1RCVD 3H0GG 4M8AA 1QZHA 2MJ8A 2JA6B 2Q8TA 4XXEA 2O2LD 3GTLB 3HOUB 1MHWC 4BY1G 1GUNA 1VQKA 2L0CA 1K8AC 3DXJC 1Y69U 4LFCL 4NXNL 3GP7A 5M3FB 1ASYA 4PNYA 3BU2A 3GTQB 4C3IG 1HQMC 4Z9CB 2Z1CA 4FVMA 2KJXA 5ELNA 1FNUA 4JG2A 1WTQA 4NXMQ 1EIYB 1PFSA 2JEBI 3JAML 3I4MG 4DAPA 1TWAH 2F52A 1K83H 4PMBA 4DR1Q 3T53B 4ME5A 3T16A 5EPKA 1CHPD 1D8LA 2YTVA 2ATWA 2JA7B 2E2HH 1LTLA 5DLQE 2PZUA 1HA5A 1BCPF 2NBFA 3KDFB 3K59A 3J7YW 1SYGA 2E2HB 4FF4A 4P71A 1N32Q 5LMNW 1HTPA 3PUXA 5CV5A 2LY7A 4KD3A 4G4KA 4ID6A 1EEFD 1KRSA 1TWAB 3LGJA 1JOKA 1P16A 1CI3M 3QOLA 4IUVA 4YWKA 5FO8B 5IOCA 5A35A 5I6WA 1NSNS 4DV0L 4M1UB 4JI3Q 1QZGA 5EGTA 1YJWA 2B2WA 2EJFC 1EY4A 1YNJC 1NE3A 2A69D 5CR3A 5M3FH 1F9PA 1S5ED 2EOTA 4ZKCB 2Q8RE 4L5QA 1A6XA 4DV4Q 4F8MA 4DXGA 2RHSB 5KGUA 1PTOB 4A3KB 1KHIA 3C1EA 3A55A 5C0XJ 1L1OA 3UE1A 2HT1A 3J7A5 4EQPA 1V43A 1CKMA 3K5NA 3CHBD 3CCLA 2EYFA 1YNJD 2BCOA 4PG3A 3EROA 5K5PA 1IYUA 5C4XG 1EY5A 1HNXQ 1F9QA 1JICA 5LMNL 3I55A 2JA8B 3VYUA 1JWSD 1NAPA 4GOPC 1L1OC 1V1PB 3HOYB 2K14A 3D31A 4IN3A 4RGOS 1NR2A 2EE1A 2LXKA 1YNNC 2PQAB 1EIHA 4DR2L 1PH5A 4N9TA 4X3TA 3K8AA 4J15A 4FO2A 1HQRD 4OWWB 2Q2IA 1K3RA 4L8JA 4JV5L 4NDXA 1HPCA 3JAME 3BYYB 4AH6A 1TWHB 3NP8A 4NB3A 3QR8A 2R93B 5FJ8G 2AQ1B 4P75A 1JMCA 1X56A 2B2TC 2D62A 3CCJA 2JK8A 3AB9A 3GTOH 1VQLA 5JAVA 5A2QL 4UP8A 1AE2A 5IT9L 5C4XB 2AQ3B 5LL6S 1D5ZC 3MHBA 2VUMG 2LKVA 2J7ZA 1I4HA 3VR6A 2YU9B 3GV6A 3FPPA 1Y8OB 5D3IB 5KYIA 1WCMH 2GVBA 5GQOA 1SLJA 2E8GA 2ID0A 4QY7A 1A62A 4ZUIA 1G2SA 1WTVA 1N32L 5IYCG 1B1ZA 3U50C 2A74C 3M3YH 1G8ZD 1LUZA 1TT2A 4GNXA 1EYGA 4OX9L 5JOBA 3R93A 1SNMA 4OGQC 4XYOA 1QUQB 1STNA 2Q2UA 4X66L 4KHPL 1JOOA 2L9HA 1BCPB 2N88A 3ERQA 4R4IA 1KAWA 1KABA 1NTGA 2EY6A 3CAMA 4JK1C 4OWXB 1A8VA 2K28A 2UUBL 3I4NH 4A3GG 1XPRA 2BA0A 1K83B 5IP9H 4KK7A 3S15B 1WFQA 1VQDA 4QJFA 2NYZD 2F0VA 3NQIA 1H9SB 2G5DA 3CCQA 1PRTF 2IPKD 5DNFA 3KBGA 3E0EA 3MVVA 3QWNA 4Q0FA 4HIDA 3CRKC 2WACA 2IWHA 2K5VA 3KLSA 1QB5D 4G7OC 1Y1VG 2JA6H 2IX0A 4DV6L 2NB0A 5IWAQ 2HIXA 4LUOA 1EYDA 2FHTA 4JI1Q 2M2LA 1HR0Q 1SYFA 3D6CA 3DM1A 3OPOA 1KDBA 1SNDA 3MFGA 1EQTA 1Z9FA 1LABA 1VF7A 3T13A 1B53A 1L1OB 2HQLA 3CC7A 1JJCB 3BZDB 1GUOA 3A7LA 2K5WA 3BDLA 2JEAI 1II3A 4A3MG 4R4QA 3UDGA 1NUCA 2JYOA 4EQ5A 2X69A 4JI4L 4JI8L 3BZKA 3UDIA 1SN8A 1K73C 1SE4A 1BCPD 2O5JC 1X3PA 1Y1VB 1V1OA 3CU7A 3MA2B 2ENBA 3RD4A 1N34L 3K58A 4A3EB 5IYDH 4IFDJ 1ILQA 1NCVA 2R92H 4AYBB 2WAQB 3BJUA 4BWGB 3P75A 3MTSA 1HZBA 4N8FA 3PQIA 3F8TA 4O0AA 1AW7A 2OTLA 1NJIC 3AEVA 2B2TA 1L0WA 4PQXA 3EBEA 1SNQA 3M4YA 4KI0A 1GOZA 3NTIA 2AMCB 3KOJA 4A3BG 4N8X1 1B9MA 1XTCD 3HEJA 1LTRD 2FXQA 3M4QA 2N3SA 3S17H 3GTGB 3J81i 2WIIB 1VQPA 1IL2A 2JA8H 1DOLA 1VS0A 4A93G 2EY2A 3FKIB 1IW7C 4K6LA 2GN5A 4JI0Q 5FK9C 1BCPC 4DV2L 1UE6A 2F0QA 2XGTA 3RNUA 3O13A 1YJNA 1ILPA 3FHWA 3A5ZB 1IXRA 2CH4A 3LWUA 1X9NA 1IBMQ 1HZ9A 1JT8A 4A3KH 5IGBA 1E7ZA 2RCNA 5FLMG 1YIJA 1A3UA 1HR0W 2A8VA 3Q0AA 4YCVA 5I2XA 1LLRD 3VA5A 3KJPA 1J5EL 1BBWA 1VQ5A 1PRTB 2NVXH 2D9UA 2GVAA 1SRUA 4GNXB 1SYCA 4PMCA 1SJHD 4J6HA 1WOCA 4F88A 1CQVA 1Q1BA 3FEWX 3IRBA 2XIWA 2UU9L 4YY3Q 2L12A 2R93G 2PQEA 4OIJA 2ZJRA 5C3WA 2WV6D 2R7ZG 3DWPA 3NQTA 1R4PB 4HCSA 1EZ6A 3A8IE 1L2FA 3CC4A 2MO1A 1S4ZA 3JC66 5EKKA 1GUGA 1PTOD 1X54A 1JWMD 3IFDA 3HOXH 5HGQA 1DONA 1EY7A 3GV3A 4DUZL 3CCVA 3J81j 2E2DC 1LTID 4A3JG 1W2BA 3NPPA 1SR3A 3CCEA 4IUPA 4LF5L 1W6JA 4O2DA 1TKWB 2B29A 1IBLQ 4IALA 1EFWA 2PYKA 2EPBA 4K0KL 3J80L 1S72A 2HHHL 2ES2A 3FVQA 3F2CA 1LT6D 4KY5A 1GUSA 2N55A 4GOPA 3CPWA 1I6HH 4A75A 3RZDB 1F9SA 3A54A 4XIGS 5FKAC 2ALYB 1XXGA 4RCOA 1FJGQ 3TQYA 3TBIB 4LF7L 5IE8A 1X3FA 2QDBA 2K33A 3CCMA 4V0BA 1PH4A 3W1BA 4B3RQ 5ELEA 5ELDA 3MXNB 4DV5Q 4KLKA 1KLGD 2L4NA 3MEHA 4YY3L 1Y8PB 2RBMA 3IFTA 2VW9A 1CSQA 1O7LA 2CWPA 5EQ0A 2A1AA 3NTHA 1F2YA 1D7QA 3I73A 1I4PA 3DEOA 1X3EA 4OIKA 1CTMA 4DNRB 3A56A 4A4IA 1EY6A 4DV2Q 1VQ9A 4ILWA 1EWIA 3E9IA 3ZJYC 4R8IA 4KHPQ 1SJED 1PYBA 3ER0A 3SGIA 3A74A 2MO0A 4X62L 5G3LF 4IOCA 1HZAA 1BDOA 4JBMA 4OX9Q 1GXDC 3S16H 5JEAG 1TXYA 4J8QA 2PW7A 2MFIA 4RHRA 4KKUA 2H5XA 4A3CG 4FXGC 4DU9A 5C4HA 1PTOF 3TP8A 3S2DH 4HTHA 1CSPA 3NE5B 3AFQA 3MAQA 3HOWH 3S1NH 1IHZA 1BXTA 5LMUL 1Q81C 4L5RC 2XNAC 3KUPA 3D6WA 4QIWE 2F3IA 2UXCQ 1D5XC 5JJKA 4ZK9B 1CK1A 4KTAA 3KFUA 2Z6KA 2R3ZA 1NMGA 2B2VA 2E2IH 2FJ2A 4UP7A 5BN4A 2B63G 4GKJQ 2K05A 5C44G 5C5MA 4G7HC 1GKHA 1TY2A 3VR2A 2K6AA 1C8CA 1STAA 4MTKA 2XTIA 2HIVA 2NZOA 4LF4L 1S5DD 2B2YC 4AYBG 3S1RB 2WAQG 1X3QA 4DR5Q 3MC0B 1O7IA 4L6TB 3DWAA 1HUNA 1S5FD 2JJQA 1I5FA 2C9OA 2IY5B 2A68C 4IO9A 5IT9E 4BY7H 5IODA 1N8RC 4FDBA 4IQZA 1O80A 4JI4Q 4KN7C 3TS2A 4CKEA 3CW2C 2DJFC 1N33Q 3AFPA 2VUMB 3GTPH 4LF5Q 4BBSH 3K7AB 1Q8KA 3PUZA 3LWEA 3CPFA 4LFBL 1H9RA 1CM9A 4HMJA 2JP1A 1VQ6A 2VQFL 1Z6HA 4UY8C 4Y7NB 2F3WA 3R2IA 1HNZQ 1SFOH 4UAIA 5KNBA 4DN4M 1EY9A 2PI2A 4FF1A 3S1MH 2YTXA 2J0TD 3GO5A 1G51A 2OWOA 1BOSA 2L11A 2WKDA 3M4OH 2EVBA 5M3MB 3FDTA 3NBIA 1Q8IA 4B08A 3BVGA 3PO3B 4RKBA 1BQQT 1KD1C 4FF2A 1KLUD 1PMRA 5ELFA 2K5HA 1A3VA 4LF9Q 1SE8A 4GLXA 2ZXPA 5I9OA 1D6EC 3HOZH 3NENA 2F0NA 2UXDQ 5M3MG 3QG1A 4HAEA 3E3XA 2NVQB 4H44C 3D8GA 3RZDH 2KCNA 1HHVA 2BDNA 1R9TH 1QVCA 5K36G 4DK0A 1PH1A 4BY7G 2JA5B 3TP6A 1IBML 1HJPA 4QUFA 4LJZC 4GLVB 1XWEA 3A7AB 1LT4D 4BBRG 4X3KA 3R2TA 3SXHA 3T56B 1CQFA 2Z4HA 2SNMA 3ICEA 5C44H 4DA2A 1U4LA 2BDOA 5JVH3 4NXML 4OELB 2ZJPA 3VR3A 4DR4Q 2B63H 4J1MA 1EQRA 5C3EH 2NZ1D 1GHKA 1C48A 2UUCQ 1HCZA 4K5WA 3PV0A 4QL5A 3KLWA 1Z47A 4PZ8A 3NWTA 4HEDA 4EGVA 3HOVG 3F2BA 1B8AA 2EYMA 1MGSA 3OSOA 3MEFA 3HOWG 4KD4A 4L5TA 1Q86C 2E2IB 3DWQA 2VXWA 4P2CB 3T1HL 4PV1C 2XRQD 4HJ5A 4IFDG 5LHY1 4TVAB 5D14A 1A0IA 4ZUJA 4A3CH 1B4OA 2CVRA 2NVXB 3RUZA 3WDNA 1F9RA 1MD2D 4L5SA 1BVSA 1PH2A 2DJGC 1EYCA 5E4WC 2V4DA 4EX5A 4U673 3L2PA 3I56A 1I6VC 2KBNA 2R92G 3AMUA 5IYDG 3LNNA 4JYAL 4LFBQ 1FNWA 4HSPA 2RKSA 2K4KA 1U9RA 3CD6A 1UWVA 1ASZA 3L9AX 4DR7L 1VMCA 1XPUA 3FKIH 1HZCA 2RSNA 1NR4A 3W1GA 5I4DA 2QEJC 2VQEQ 1YBYA 3Q6SA 4JYAQ 3TZUA 1CA6A 4LFAQ 5J3BA 2RQXA 1RIPA 3PIO3 5LMNQ 1FNVA 4HN7A 4APVA 5EAYA 2NVTB 4A3MH 2VB2X 4HIKA 4R4OA 2K52A 3NELA 2PPBC 4DXFA 3N52A 4B9XA 3EVQA 1EOTA 4JBJA 2F0KA 1KXLA 4BA1I 2K5DA 2K75A 2KCMA 4DV0Q 4JOIC 4GOPB 4KN4C 4DV5L 2NTSA 4NP5A 3G71A 1CFMA 1QNKA 1Q90A 2ZTCA 1QUQA 2LS01 1LT5D 4A3EH 1U0LA 1B7YB 3PGZA 1EFID 1EWHA 3M9BA 4C3JB 1SROA 3TP5A 1DOMA 2CHBD 4I7AA 4I7ZC 1Y1VH 5IYBG 3L3OC 3K5LA 1STYA 4DR4L 4A3JH 3HOVH 4FP5D 2ZTEA 2R7ZB 1XJVA 4DV1Q 1PHJA 1Q46A 2UXBQ 2HQEA 2AKWB 1M1KC 1TS5A 4ME3A 1I4XA 3S2HH 5FLXc 4Y52H 5M5YH 2IHEA 5M5YB 1I50B 1PLFA 1S5BD 1JWUD 3G6JB 4CDCC 1DYQA 4X66Q 1R9TB 1MSHA 4GZYC 1JR0D 2R7ZH 1I3QB 5COYA 2K5QA 1K3BC 1XPOA 5AFWA 2EDGA 2UUAL 3GTKH 4LAAA 1YVCA 2BE5D 2NUCA 4IUUA 4BBRH 3NHHA 2Z8LA 2EXZA 1MI2A 3HOZB 4RH6A 3L7ZC 4RAUC 1KC8C 3PUYA 2NWGA 4C3JH 2CQAA 4DFAA 1VQCA 4CDFC 1CUKA 1SNCA 1WTXA 4C3JG 1BO0A 2XSCA 5K36H 3STBD 1PRTC 3H15A 1PH3A 2G9HD 4QB4A 3U4VA 4JVZA 3CXCA 1SMXA 5M3MH 5FLMH 1IBKL 3ZYYX 4IUQA 1A2TA 4A3KG 2E5LQ 3HOZG 3BDCA 4TRDA 5I2YA 1DZ1A 1Y8NB 3OW7A 2A5HA 5JEAJ 3MXPA 4RA8A 2E76C 2F3VA 4R4TA 1T5XD 1SNOA 4LMQD 2FMCA 5AJ3Q 4LUZA 1ET6A 1VQ4A 1PRTD 2JA8G 1C0AA 2A73B 2OQKA 3HKSA 1TR5A 4X65Q 4A76A 1YNXA 3CMEA 4KV6A 2DY7A 4CDEC 4X64L 3GTPB 1SYDA 3KF6B 5FJ8H 2F0IA 3RLNA 1IBLL 4DR2Q 5IYBH 5FO7B 5CORA 2HCCA 5ELOA 3TMEA 1N33L 3J81c 1LTBD 3CRLC 3QB3A 3TEHB 1GUTA 4UDUC 4O42A 4DV7Q 1UUPA 4A3EG 5BR8L 1H9SA 1TS3A 2JA9A 4BBSG 4PZ6A 3FMCA 1K28A 1UEAB 3JAMi 4GN4B 4UP9A 4DK6C 4B3TQ 3PF4A 1RTOA 2QW7A 1O7ZA 2FFKB 1KIXA 4EQOA 1ZXTA 1B44D 4HIMA 3P20A 3PIP3 3D3RA 5C4XH 4NMZA 1HH2P 4LUVA 1A3TA 3MWYW 4QQBX 2F0MA 3UDXA 2JQOA 4H7BA 3KDFA 3ULJA 3URYA 1SDFA 3W2DA 4AQYL 1AFPA 1G291 2UXCL 2KA7A 3FKIG 3MXUA 1J5EQ 4DR6L 1TWHH 3H09A 1NBWA 2IX3A 1VQOA 4P74A 3UDFA 2KEEA 1HUMA 3EQLC 1VQBA 4WRDA 4MN3A 1K0RA 4DKAC 3J7AV 1HTLD 3C46A 1WJJA 5GAEC 1KL9A 1PDQA 1XYIA 1AP0A 2F0TA 2NN6I 3E0JA 5I6YA 3CP0A 4RMFA 4POGA 3BS1A 2F4VQ 1F2LA 2ZTDA 3KK7A 2D2CC 5BN3A 2X6GA 3VR4A 5CV8A 4IFDH 2R61A 2WB1E 1LTAD 4JI2L 1ZYRD 1D1IA 4X62Q 5DM63 1YHQA 5CYUA 1VQEA 3RMHA 1EQQA 1B3AA 2EZVA 1L0XB 1HNWQ 3PF5A 4BY1B 2QKIC 5L37A 2ZM6Q 1Z7TA 5JEAH 5IGCA 1QG7A 3ULPA 4R8NA 4EVOA 4CJ1B 1YHBA 3P7JA 1OXUA 2F0LA 3F2DA 2CW0D 1PTOH 4LF6Q 4CHTB 5JVG3 5C3EG 4BA2I 3U9SA 3TRZA 3KLRA 2EXDA 3F1ZA 2VL6A 2K7VA 2VNUD 3SK5A 3SK4A 1M90C 3JAMc 1EY0A 2UUCL 5JJZA 2SDFA 3S1QH 1PYSB 2EYPA 1RDPD 1O78A 2HUGA 1SFOB 4RCNA 3NBHB 2L1BA 3A0JA 1I6HB 4JI6L 2PNRC 4P73A 3S15H 1E1TA 5D65A 3CCUA 1KAAA 1G6ZA 3K7AH 2P5ZX 2HHHQ 1QOHA 4C3IB 4JI0L 5JPMC 3U9OA 2ZM6L 4K0KQ 4L63B 3PMFA 3KF6A 4LF8L 3RZOH 5A2QE 2QF7A 4QF4A 4C3HB 1JORA 1B9NA 4KJNA 4YHHQ 2VY3A 3ND9A 5M9OA 1UE7A 1SMYC 1HXYD 4C3HH 3CF5A 3RZOB 1WD1A 1KDAA 5FO9B 2UXDL 5HURA 5FOBB 5GROA 3Q22A 3S1RH 3KF8B 5EBDA 1N9WA 2XWBB 3M7GA 1LT3D 1E0BA 4WJ3M 3NUCA 5EKIA 2WAQE 4HIOA 3A5UA 4DV6Q 3HOXG 5DAUA 4LW1A 4PMWA 3BZCA 1ICFB 3S1QB 1GHJA 1MIUA 2MNAA 3HGBA 4DGZA 3GTQH 3K7UC 5C4JH 3I70A 3R8BA 4DAYB 1DM0B 1SBBB 4QGUA 2R93H 4WFN3 3S9WA 3HOWB 4POFA 3KBXA 2IX1A 5J22A 1DGSA 3HKZB 2PMZB 1B70B 5I9PA 5FLXL 1PFBA 5T1GA 2VZAA 1GJXA 3S14B 3Q23A 3NBHA 5CV7A 3S16B 1PVOA 3DEPA 1EOVA 1WTRA 1ENAA 4GN3B 1Q1EA 2VQEL 1WTOA 4RG1A 1N36Q 5F2DA 4X6AH 4K14A 4G57A 3QJYA 3BDOA 4JI5L 1V1QA 1OO9B 4WJ4A 1K8GA 2VB3X 3S14H 3OMCA 4DAMA 1RL2A 3EA6A 4LF4Q 4CJ0B 3EN2A 4X3SA 1T9HA 4E6IA 1K8OA 4O1NA 4JOIA 2DGYA 3TDQA 3SK6A 5M3FG 4A93B 2TMPA 1GM5A 3ND8A 2O4XA 3TZDA 2MGSA 3HP3A 4A3BH 4GKJL 3NWSA 2KCCA 1F2MA 1D5MC 3PUVA 2K32A 4H13C 4LWCA 1SYBA 4ZCKA 4FNFA 1SE2A 2DY8A 4FXKC 1FVIA 5C3XA 5LL6X 1ML0D 4JBWA 3I4MB 1SEBD 2C35B 4P72A 1I94L 1I4RA 1I94Q 2FINB 4RHSA 2D0PA 1STBA 2E2JB 1Q82C 1BBUA 2HDMA 1X6OA 3DMUA 2N49A 2C5CA 4JV5Q 2B2UC 1NMFA 3J7ZC 5T1IA 4I65A 4K2LA 2L15A 2PMZE 2N8NA 1BBXC 2CKZB 1IKMA 3V05A 3AYHB 1PH7A 1VQ8A 2CFMA 2SNSA 1KQSA 3STBC 2D0OA 3HOXB 1HNXL 4S3SA 2EQSA 5JJIA 2AUJD 2BA1A 1TY0A 2DNCA 1CKNB 5GAGC 4C3IH 3Q24A 4GN5A 3GTJB 5EKLA 1BR9A 4C1NI 3OTOL 4JI1L 1HR0L 1UAPA 2F0WA 1X55A 5CGKA 4B3MQ 1WTHA 2KEDA 2EJGC 5C5LA 1TWGH 2LXJA 3I2ZA 3HG9A 3J80E 2NTTA 3OWEB 1J6QA 2E74C 3KF8A 4IPCA 4R1JA 1TWGB 3HRZC 1E22A 1Y1WB 5C0XI 1EUJA 1FJGL 3T1YQ 1Y14B 3GTLH 4WORA 2JA6G 1DXMA 4B3ML 3OIPA 2NVYB 2KENA 1VMPA 3M4PA 2VQFQ 1XMQL 2XWJB 4YIJA 1JCKB 3K81C 1NY4A 3RLFA 4QUCA 4TKOB 3E6ZX 1H95A 1GVPA 4JI2Q 2KHJA 1J8IA 2M9VA 2PNHA 4DK3C 4RGTA 1XX8A 3PIOA 3GTGH 4WJWA 4ZRZA 3I4NG 4A3GH 1VQMA 1FGBD 4OONA 4KMUC 5JPNC 4G7ZC 3I91A 1E1OA 4DAYA 1JQYD 1X3GA 2K5NA 3S2HB 1QCBD 2HD3A 3VYRA 4KJOA 1FL0A 1X32A 2A6HD 1LACA 3I90A 1KRTA 4JI6Q 4A3JB 4ZYSA 4MIUA 2E2JH 1VQFA 3BG3A 1TS4A 1YEZA 2UU9Q 2KQ3A 2OEOA 4DV4L 2R92B 3PIPA 1WCMG 2EYHA 4QIWB 3KJOA 5M5XB 4OO1G 1H9JA 5JJLA 5M5XH 1PXUA 4ZQ3A 1HFGA 3T1HQ 4JW0A 2I5MX 1SYEA 1H9KA 4DPGA 3J7AF 3P1HA 4A3BB 3BYTB 3J80i 2YV5A 4A93H 2EYJA 3A8JE 2XVSA 4NPSA 3N6RA 2Z9HA 4IZ8A 3OHXC 1EY8A 3AQQA 4IPGA 1XNRQ 1IZ6A 4U68A 3SDZA 2N78A 2WKCA 1UEBA 1UE5A 3NXWA 2F03A 3C2PA 2WFWA 4DAVA 2NN6H 5BR8Q 5IGFA 4UHVA 3HKZG 4KKTA 1MJEA 2AUKA 5IP7G 4NKLA 1MBYA 4MTNA 5HGTA 3HFZB 1UNSA 2PQAA 3LX0A 4X64Q 1TQOA 1CHQD 3W5OA 3M7NA 2F0JA 4N9PA 2QGQA 2B8GA 4QCLA 3CKIB 2YYZA 3DUZA 1CT1D 3HKZE 4C2MH 1C7YA 4AQYQ 1KNAA 2PO4A 1STGA 5KYLA 2KHIA 4XTCS 4LFCQ 4B3RL 5J1ZA 2IL8A 5E4XA 2QA4A 1K9MC 4LF7Q 2F0EA 3I4LA 3B6YA 1OXTA 1QJOA 1JE5A 2G9DA 4ZAIA 2I46A 3EIVA 3V96A 2Z6BA 1WYDA 4JI8Q 2F0DA 3I4NB 2OQ0A 3T4AC 2M00A 1TWCB 2RCFA 2ZT9C 1HNWL 4DUYL 5C3EB 3EFXD 1S3OA 3W3AA 1L0YB 3I7FA 3NTKA 3X3MA 1I3QH 1XMOQ 1C9OA 2F0OA 5J39A 1U5KA 2KOLA 3QO2A 2JA7H 4CJ2C 3D4WA 3OIQA 2JE6I 2PW5A 1I50H 1W6KA 3DLLA 2YTYA 1TS2A 1K8MA 5ELCA 4IFDI 3H91A 3KYHC 1I4GA 1XNQL 2JA5H 1PTOC 2IT1A 4GS3A 3G7LA 1B2TA 3HOVB 3MFYA 1V1PA 4K2KA 1BNZA 5GAHC 1RHPA 3ITPA 1LV9A 3T1YL 1VQAA 5D3DA 2KCTA 1A15A 1E2VA 3I4OA 2Z0SA 1YITA 2GA4B 5IP9G 3GTOB 1CZWA 2B2WC 1HRJA 4CBVA 4H02A 2LFNA 3J81L 2I5LX 3I4MH 5CMDA 3HOUH 3VDYA 3WWVA 3PO3H 5CV9A 5KIXA 4DR3L 4R9WA 2O5IC 3PCOB 4LF6L 2OTJA 3M4OB 2RDHA 4LK1C 2B39A 1VCIA 4MZ9A 4IOAA 1DJRD 1IKLA 3K5MA 2EY1A 3GDEA 4BY1H 1K0SA 1IYVA 3D4RA 5IYCH 3VR5A 1VQ7A 2E75C 3U4ZA 3L0OA 5LMUQ 2RF4A 2ICIA 3H0GH 3MZ5A 2NVTH 4Y7NH 1WTPA 2Z4IA 1BF4A 1F2ZA 2MP1A 3D4DA 4ODGA 4JPBW 1RJTA 4RGNA 4OL7A 4CDDC 2ZXOA 4DR7Q 2F4VL 2A68D 2VUMH 2JXMB 2XRSD 3D0FA
chains in the Genus database with same CATH topology
1SAPA 1EYAA 2H1EA 1DOKA 4K8IA 4XQQA 1RKNA 1PZKD 5EBCA 2QCPX 2K1BA 4Q5VA 3OOCA 2F0UA 1F77A 3SK8A 1EU3A 1PFNA 2Y0SB 3IKJA 4XQJA 5C4JB 1ESFA 1KNEA 3H94A 5C4ZA 1J9OA 2KUMA 4XDXA 4CKCA 5IIFA 1KTKA 2OXPA 3WOEA 3UI2A 4A3FB 2KVMA 5CBEE 2L55A 2IW3A 2K04A 5EPLA 5M5WB 1TIID 2XN9C 1ESRA 4QMGA 2MPMA 4TSSA 1U4PA 1DD2A 3S1NB 4C1NK 1H9MA 5C44B 3S2DB 4IUNA 4A3IB 3BVZA 1FR3A 3K0YA 1AN8A 2A6EC 4K6DA 4ULLA 3NK9A 4F87A 5E1FA 3QIAA 5KEEA 1A2UA 4CKBA 2LMCB 4KHVA 4OO1I 1VDZA 3E5SA 5KNDA 1STEA 5EJWA 2A6ED 1QNUA 1AZQA 2B8FA 5DM73 4RWSC 2A69C 5KRUA 3SR1A 2X6LA 2QILA 3R3OA 5E3FA 3SE0A 1O7YA 4ZLTF 2SOBA 2CW0C 4V190 4BBRB 4FF3A 5ELBA 1TVXA 1GUWA 2DNEA 1QWYA 2EY5A 2RSOA 4XYQA 4KY6A 2AQ2B 3SHLA 1SXTA 1OXVA 4K5XA 1MSGA 5ISRA 1LTGD 1ICWA 3J81E 3GTMB 3CQZB 1HFNA 2F0HA 4BY7B 4B9WA 5DEHA 1TWFB 1D1KA 3MXGA 4C56C 1B50A 2D5DA 1ET9A 3MXNA 1SMYD 1ZKOA 1M8AA 3K5OA 4KHZA 2PZWA 5CC4A 1RF2D 1EIGA 3K6OA 3V2TA 3X3NA 4A3MB 4C2MB 1C4QA 1S5CD 4MHEA 4NW2A 1G91A 3WOFA 1QE6A 2WP8J 1EWCA 3H3VC 2PCFB 1EZ8A 1EEID 4HSVA 3H6MA 1JE4A 1U4MA 1EL0A 3TN2A 2R6GA 4A3DB 1QILA 3K57A 3I72A 5KNCA 2B2YA 1CA5A 1VF5C 1AZPA 3TP7A 1JB3A 3S17B 5CV6A 2RDGA 3QOJA 2Q8IB 5FLXE 1WVLA 1OXXK 1G2TA 1Q12A 2F1MA 2B2VC 2EYOA 3ONAB 1SSOA 1RODA 4F7XA 3AU7A 2BE5C 1U4RA 5C6AA 4HCEA 2F0FA 4ZKBB 2F0GA 3C3LA 1YNND 2WB1B 1T5EA 3BVMA 4DF7A 5C0XG 4XT1B 1E2ZA 1JOQA 5IGGA 3SEBA 2B63B 4XT3B 4BS9A 1JC7A 3GTKB 3EJIA 2F0PA 2WINB 3I8ZA 4HMIA 1PZID 1WD0A 4HR7B 1R4QB 3PUWA 3PO2B 3M85A 4DK1A 2J4XA 2DN8A 5IGEA 3HS0C 2PZTA 1CZGA 1ENFA 2B2UA 3FRPB 4RGMA 4A3GB 5BN5A 1STHA 4RFBA 1PZJD 1RTNA 3T51B 2SEBD 1RD9D 1ZEQX 5TSSA 2TSSA 4KY7A 1EU4A 3OWFA 2A6HC 4EQNA 4K8JA 5IGDA 1SNPA 1V8QA 1M4VA 4DNTB 1E2WA 5G3LD 1KDCA 3GQBA 1HA6A 2AWOA 2F0SA 3S1MB 4IURA 4OHJA 1FD7D 1EQVA 2H4OA 4TQUS 4XQNA 4X3UA 4FYDA 4IUTA 4BBSB 3HZXA 2NN6G 4ABNA 4KKSA 3OMGA 5EPJA 1AEXA 1LO5D 5C0XH 5NUCA 3M3YB 3GD7A 1IW7D 1DCZA 2I07B 2F4IA 1WCMB 2ZXRA 4OO1H 3I3CA 3FPUB 3IL8A 5CBAE 2IJ0A 2RA4A 4RKLA 3F2UA 1LTTD 2L5TA 1OXSC 2OT2A 4FXDA 2KECA 3C1FA 2MUYA 2RDFA 1TU2B 1ONLA 1ZYRC 2ICEC 2K01A 1SE3A 3VYTA 2OF1A 2RVLA 2HDLA 3SVMA 1BUVT 5CV4A 2KHSA 4CGYB 1D2BA 1I4QA 2BOSA 3TSSA 1IL8A 2EJMA 2MHVA 4K5VA 3DHQA 3H0GB 3IAYA 1PFMA 2AWNA 2HCIA 1PYWD 2EYLA 1ENCA 3KLSX 4C3HG 1WTWA 3VYSA 2FMMA 4H0LC 1FYCA 3A8KE 3NSWA 1Q3LA 2K03A 3VA7A 2JSOA 4M8AA 1LTSD 1RCVD 2MJ8A 2JA6B 2Q8TA 4XXEA 2O2LD 3GTLB 3HOUB 1GUNA 2L0CA 3DXJC 1Y69U 5M3FB 3GP7A 4PNYA 3GTQB 4C3IG 1HQMC 4Z9CB 2Z1CA 4FVMA 2KJXA 1FNUA 1WTQA 2JEBI 3JAML 4DAPA 4PMBA 3T53B 4ME5A 3T16A 5EPKA 1CHPD 2JA7B 2PZUA 1HA5A 1BCPF 2NBFA 3K59A 3J7YW 1SYGA 2E2HB 4FF4A 1HTPA 3PUXA 5CV5A 2LY7A 4KD3A 4G4KA 4ID6A 1EEFD 1TWAB 1JOKA 1CI3M 3QOLA 4IUVA 5FO8B 5IOCA 5A35A 5I6WA 1NSNS 4M1UB 5EGTA 2B2WA 2EJFC 1EY4A 1YNJC 2A69D 5CR3A 1F9PA 1S5ED 2EOTA 4ZKCB 2Q8RE 1A6XA 4F8MA 4DXGA 5KGUA 1PTOB 4A3KB 3C1EA 3A55A 5C0XJ 4EQPA 1V43A 3K5NA 3CHBD 2EYFA 1YNJD 2BCOA 3EROA 5K5PA 1IYUA 1EY5A 1F9QA 1JICA 2JA8B 3VYUA 1JWSD 1NAPA 1V1PB 3HOYB 3D31A 4IN3A 4RGOS 1NR2A 2EE1A 1YNNC 1EIHA 4N9TA 4X3TA 4FO2A 1HQRD 4L8JA 4NDXA 1HPCA 3JAME 3BYYB 1TWHB 3NP8A 2R93B 2AQ1B 2B2TC 2D62A 3AB9A 5JAVA 5A2QL 5IT9L 5C4XB 2AQ3B 5LL6S 1D5ZC 3MHBA 2LKVA 2J7ZA 1I4HA 3VR6A 2YU9B 3GV6A 3FPPA 1Y8OB 5D3IB 5KYIA 2ID0A 4ZUIA 1G2SA 1WTVA 1B1ZA 2A74C 1G8ZD 1TT2A 5JOBA 3R93A 1SNMA 4OGQC 4XYOA 1STNA 1JOOA 2L9HA 1BCPB 2N88A 3ERQA 1KABA 2EY6A 4JK1C 2K28A 2BA0A 1K83B 4KK7A 3S15B 2NYZD 2F0VA 3NQIA 1H9SB 1PRTF 2IPKD 5DNFA 3KBGA 3MVVA 3QWNA 4Q0FA 3CRKC 2WACA 2IWHA 3KLSA 1QB5D 4G7OC 2IX0A 2NB0A 1EYDA 2FHTA 2M2LA 1SYFA 3D6CA 3DM1A 3OPOA 1KDBA 1SNDA 3MFGA 1EQTA 1LABA 1VF7A 3T13A 1B53A 3BZDB 1GUOA 3A7LA 2K5WA 3BDLA 2JEAI 1II3A 1NUCA 2JYOA 2X69A 1SE4A 1BCPD 2O5JC 1X3PA 1Y1VB 1V1OA 3CU7A 3MA2B 2ENBA 3RD4A 3K58A 4A3EB 4IFDJ 1ILQA 1NCVA 4AYBB 2WAQB 4BWGB 3P75A 3MTSA 1AW7A 2B2TA 4PQXA 1SNQA 3M4YA 4KI0A 1GOZA 3NTIA 1B9MA 1XTCD 3HEJA 1LTRD 3GTGB 2WIIB 1DOLA 2EY2A 3FKIB 1IW7C 4K6LA 5FK9C 1BCPC 2F0QA 3O13A 1ILPA 3LWUA 5IGBA 1A3UA 3Q0AA 5I2XA 1LLRD 3VA5A 1PRTB 2D9UA 1SYCA 4PMCA 1SJHD 4J6HA 4F88A 1CQVA 1Q1BA 3FEWX 2XIWA 2L12A 2PQEA 4OIJA 5C3WA 2WV6D 3DWPA 3NQTA 1R4PB 4HCSA 1EZ6A 3A8IE 1S4ZA 5EKKA 1GUGA 1PTOD 1JWMD 3IFDA 1DONA 1EY7A 3GV3A 2E2DC 1LTID 3NPPA 4IUPA 1W6JA 1TKWB 4IALA 2PYKA 2EPBA 3J80L 3FVQA 1LT6D 4KY5A 1GUSA 2N55A 3RZDB 1F9SA 3A54A 4XIGS 5FKAC 1XXGA 4RCOA 3TBIB 2QDBA 2K33A 4V0BA 5ELEA 5ELDA 1KLGD 2L4NA 3MEHA 1Y8PB 2RBMA 3IFTA 5EQ0A 1O7LA 3NTHA 1F2YA 3I73A 1I4PA 3DEOA 4OIKA 1CTMA 4DNRB 3A56A 1EY6A 4ILWA 4R8IA 1SJED 5G3LF 1BDOA 1GXDC 5JEAG 4J8QA 2PW7A 4RHRA 4KKUA 4FXGC 4DU9A 5C4HA 1PTOF 3TP8A 4HTHA 3NE5B 3MAQA 1IHZA 1BXTA 2XNAC 3KUPA 3D6WA 1D5XC 4ZK9B 1CK1A 4KTAA 2R3ZA 2B2VA 2FJ2A 5BN4A 2K05A 5C5MA 4G7HC 1TY2A 3VR2A 2K6AA 1C8CA 1STAA 1S5DD 2B2YC 3S1RB 1X3QA 3MC0B 4L6TB 3DWAA 1HUNA 1S5FD 2C9OA 2A68C 5IT9E 5IODA 4IQZA 1O80A 4KN7C 4CKEA 2VUMB 3K7AB 3PUZA 3LWEA 1H9RA 1CM9A 4HMJA 2JP1A 1Z6HA 4Y7NB 2F3WA 3R2IA 4UAIA 5KNBA 4DN4M 1EY9A 4FF1A 2J0TD 3GO5A 1BOSA 2L11A 2WKDA 2EVBA 5M3MB 3FDTA 3NBIA 1Q8IA 4B08A 3BVGA 3PO3B 4RKBA 1BQQT 4FF2A 1KLUD 1PMRA 5ELFA 1A3VA 2ZXPA 5I9OA 1D6EC 2F0NA 3QG1A 4HAEA 2NVQB 4H44C 3D8GA 2KCNA 1HHVA 2BDNA 5K36G 4DK0A 2JA5B 3TP6A 4QUFA 4LJZC 1XWEA 3A7AB 1LT4D 4X3KA 3R2TA 3SXHA 3T56B 1CQFA 2Z4HA 2SNMA 4DA2A 1U4LA 2BDOA 5JVH3 3VR3A 4J1MA 2NZ1D 1GHKA 1C48A 1HCZA 4K5WA 3PV0A 1Z47A 3NWTA 4HEDA 4EGVA 2EYMA 1MGSA 3OSOA 4KD4A 2E2IB 3DWQA 2VXWA 4P2CB 4PV1C 2XRQD 4IFDG 5LHY1 5D14A 4ZUJA 1B4OA 2CVRA 2NVXB 3RUZA 3WDNA 1F9RA 1MD2D 1EYCA 5E4WC 2V4DA 4U673 1I6VC 3AMUA 3LNNA 1FNWA 2RKSA 4HSPA 1U9RA 3L9AX 1VMCA 2RSNA 1NR4A 5I4DA 2QEJC 3Q6SA 3TZUA 1CA6A 2RQXA 3PIO3 1FNVA 4HN7A 2NVTB 2VB2X 2PPBC 4DXFA 3N52A 4B9XA 3EVQA 1EOTA 2F0KA 4BA1I 2K5DA 4KN4C 2NTSA 4NP5A 1CFMA 1QNKA 1Q90A 2LS01 1LT5D 1EFID 1EWHA 4C3JB 3TP5A 1DOMA 2CHBD 4I7ZC 3L3OC 3K5LA 1STYA 4FP5D 2R7ZB 2HQEA 1TS5A 1I4XA 5M5YB 1I50B 1PLFA 1S5BD 1JWUD 3G6JB 1DYQA 1R9TB 1MSHA 4GZYC 1JR0D 1I3QB 5COYA 2K5QA 5AFWA 2EDGA 4LAAA 2BE5D 2NUCA 4IUUA 3NHHA 3HOZB 2EXZA 1MI2A 2Z8LA 4RH6A 3L7ZC 4RAUC 3PUYA 2NWGA 2CQAA 4DFAA 1SNCA 1WTXA 4C3JG 1BO0A 2XSCA 5K36H 1PRTC 2G9HD 4QB4A 3ZYYX 4IUQA 1A2TA 3BDCA 4TRDA 5I2YA 1DZ1A 1Y8NB 3OW7A 2A5HA 5JEAJ 3MXPA 4RA8A 2E76C 2F3VA 1T5XD 1SNOA 4LMQD 2FMCA 1ET6A 1PRTD 2A73B 1TR5A 4KV6A 2DY7A 3GTPB 1SYDA 2F0IA 5FO7B 5CORA 2HCCA 3TMEA 1LTBD 3CRLC 3QB3A 1GUTA 4UDUC 4O42A 1UUPA 1H9SA 1TS3A 3FMCA 1UEAB 1RTOA 1O7ZA 2FFKB 4EQOA 1ZXTA 1B44D 3P20A 3PIP3 3D3RA 4NMZA 1A3TA 3MWYW 2F0MA 4H7BA 3URYA 1SDFA 3W2DA 1AFPA 1G291 2KA7A 3MXUA 3H09A 2IX3A 2KEEA 1HUMA 3EQLC 4WRDA 4MN3A 3J7AV 1HTLD 3C46A 1PDQA 1XYIA 1AP0A 2F0TA 2NN6I 3E0JA 5I6YA 3BS1A 1F2LA 3KK7A 2D2CC 5BN3A 2X6GA 3VR4A 5CV8A 4IFDH 2R61A 1LTAD 1ZYRD 1D1IA 5DM63 5CYUA 3RMHA 1B3AA 2EZVA 1L0XB 4BY1B 2QKIC 1Z7TA 5JEAH 5IGCA 1QG7A 4R8NA 4EVOA 4CJ1B 3P7JA 1OXUA 2F0LA 2CW0D 1PTOH 4CHTB 5JVG3 4BA2I 3U9SA 3KLRA 2K7VA 2VNUD 3SK5A 3SK4A 1EY0A 5JJZA 2SDFA 2EYPA 1RDPD 1O78A 2HUGA 1SFOB 4RCNA 2L1BA 1I6HB 2PNRC 5D65A 1KAAA 1G6ZA 1QOHA 4C3IB 5JPMC 3U9OA 4L63B 3PMFA 5A2QE 2QF7A 4QF4A 4C3HB 1JORA 1B9NA 4KJNA 3ND9A 5M9OA 1SMYC 1HXYD 3RZOB 1WD1A 1KDAA 5FO9B 5HURA 5FOBB 3Q22A 5EBDA 2XWBB 3M7GA 1LT3D 1E0BA 3NUCA 5EKIA 5DAUA 4PMWA 3S1QB 1GHJA 3HGBA 4DGZA 3I70A 3R8BA 1DM0B 1SBBB 4WFN3 3S9WA 3HOWB 3KBXA 2IX1A 5J22A 3HKZB 2PMZB 5I9PA 5FLXL 1PFBA 5T1GA 1GJXA 3S14B 3Q23A 3NBHA 5CV7A 3S16B 3DEPA 1WTRA 1ENAA 1Q1EA 1WTOA 5F2DA 4K14A 4G57A 3QJYA 3BDOA 1OO9B 2VB3X 3OMCA 3EA6A 4CJ0B 4X3SA 4E6IA 1K8OA 4O1NA 3TDQA 3SK6A 4A93B 2TMPA 3ND8A 2O4XA 3TZDA 2MGSA 3HP3A 3NWSA 2KCCA 1F2MA 1D5MC 3PUVA 2K32A 4H13C 1SYBA 4FNFA 1SE2A 2DY8A 4FXKC 5C3XA 5LL6X 1ML0D 3I4MB 4JBWA 1SEBD 1I4RA 2FINB 4RHSA 1STBA 2E2JB 2HDMA 3DMUA 2C5CA 2B2UC 5T1IA 4I65A 4K2LA 1BBXC 1IKMA 3V05A 2SNSA 3HOXB 4S3SA 2AUJD 2BA1A 1TY0A 2DNCA 3Q24A 3GTJB 5EKLA 1BR9A 4C1NI 1UAPA 2F0WA 5CGKA 2KEDA 2EJGC 5C5LA 3HG9A 3J80E 2NTTA 3OWEB 3KF8A 2E74C 1TWGB 3HRZC 1Y1WB 5C0XI 4WORA 1DXMA 3OIPA 2NVYB 1VMPA 2XWJB 4YIJA 1JCKB 3RLFA 4QUCA 4TKOB 3E6ZX 1J8IA 2M9VA 4RGTA 1XX8A 4WJWA 4ZRZA 1FGBD 4KMUC 5JPNC 4G7ZC 3I91A 4DAYA 1JQYD 3S2HB 1QCBD 3VYRA 4KJOA 1X32A 2A6HD 1LACA 3I90A 4A3JB 4ZYSA 4MIUA 3BG3A 1TS4A 2KQ3A 2OEOA 2R92B 2EYHA 5M5XB 4QIWB 4OO1G 1H9JA 1PXUA 4ZQ3A 1HFGA 1SYEA 1H9KA 3J7AF 3P1HA 4A3BB 3BYTB 2EYJA 3A8JE 2XVSA 3N6RA 4IZ8A 3OHXC 1EY8A 4U68A 3SDZA 2WKCA 3NXWA 2F03A 3C2PA 4DAVA 2NN6H 5IGFA 4KKTA 2AUKA 4NKLA 1MBYA 5HGTA 1UNSA 3LX0A 1TQOA 1CHQD 3M7NA 2F0JA 4N9PA 2B8GA 4QCLA 3CKIB 2YYZA 3DUZA 1CT1D 1KNAA 2PO4A 1STGA 5KYLA 4XTCS 5J1ZA 2IL8A 5E4XA 2F0EA 3I4LA 1OXTA 1QJOA 2G9DA 4ZAIA 2I46A 3V96A 2F0DA 3I4NB 3T4AC 2M00A 1TWCB 2ZT9C 5C3EB 3EFXD 3W3AA 1L0YB 3NTKA 3X3MA 2F0OA 5J39A 2KOLA 3QO2A 4CJ2C 3D4WA 3OIQA 2JE6I 2PW5A 1W6KA 1TS2A 1K8MA 5ELCA 4IFDI 3H91A 1I4GA 1PTOC 2IT1A 3G7LA 1B2TA 3HOVB 3MFYA 1V1PA 4K2KA 1BNZA 1RHPA 3ITPA 1LV9A 5D3DA 1A15A 1E2VA 2GA4B 1HRJA 3GTOB 1CZWA 2B2WC 4CBVA 2LFNA 3J81L 5CMDA 5CV9A 5KIXA 4R9WA 2O5IC 3M4OB 2RDHA 4LK1C 2B39A 1VCIA 1DJRD 1IKLA 3K5MA 2EY1A 1IYVA 3D4RA 3VR5A 2E75C 2ICIA 3MZ5A 1WTPA 2Z4IA 1BF4A 1F2ZA 2MP1A 3D4DA 4ODGA 1RJTA 4RGNA 4OL7A 2ZXOA 2A68D 2JXMB 2XRSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3T A;  4X3S A;  1SAP A;  5COR A;  2IL8 A;  4ZLT F;  1EQT A;  2HCC A;  5E4X A;  1U4R A;  5JJZ A;  2SDF A;  4HAE A;  2H1E A;  1TVX A;  4ZKB B;  2XIW A;  2HUG A;  4O42 A;  1J8I A;  1DOK A;  3TZD A;  1WTQ A;  2MGS A;  3HP3 A;  2L1B A;  1B53 A;  2L12 A;  1GUW A;  1XX8 A;  1HHV A;  2BDN A;  4OIJ A;  2K1B A;  4ZAI A;  1QNK A;  2RSO A;  2DY8 A;  3KUP A;  4QUF A;  5D65 A;  1G6Z A;  1ML0 D;  3D6W A;  3I91 A;  2JYO A;  2B2T C;  4HCS A;  5EPK A;  2X69 A;  1MSG A;  1DOM A;  1PFN A;  1S4Z A;  1RTO A;  4ZK9 B;  2FIN B;  4X3K A;  4XT1 B;  1KNE A;  1ICW A;  1X32 A;  1O7Z A;  2FFK B;  3IFD A;  4XT3 B;  1J9O A;  2KUM A;  3I90 A;  2R3Z A;  3GV3 A;  4XDX A;  2B2V A;  1DON A;  1HFN A;  1ZXT A;  2FJ2 A;  3I8Z A;  3I3C A;  3FPU B;  2HDM A;  3IL8 A;  1U4L A;  2K05 A;  3UI2 A;  2KOL A;  5CBA E;  1X3P A;  2J7Z A;  2KVM A;  1WD0 A;  3QO2 A;  2RA4 A;  3MWY W;  5CBE E;  2NZ1 D;  3GV6 A;  2B2U C;  4CJ2 C;  1WD1 A;  2K04 A;  4IUP A;  1C8C A;  3F2U A;  5EPL A;  5T1I A;  2B2Y C;  1B50 A;  2EPB A;  1PLF A;  1ESR A;  1ILQ A;  1G2S A;  1NCV A;  1SDF A;  1X3Q A;  2B2U A;  3H91 A;  2MPM A;  1HFG A;  2KEC A;  1WTV A;  4HED A;  1E0B A;  1BBX C;  1U4P A;  1IKM A;  1HRJ A;  1M8A A;  1HUN A;  2N55 A;  1MSH A;  4IUV A;  5EKI A;  3R93 A;  3G7L A;  1MGS A;  1B2T A;  2KEE A;  1HUM A;  3MTS A;  2K01 A;  5COY A;  1F9S A;  1BNZ A;  5AFW A;  2B2W A;  1RHP A;  2VXW A;  4MN3 A;  1LV9 A;  1O80 A;  4IUU A;  2L9H A;  2N88 A;  2RVL A;  2HDL A;  3SVM A;  1A15 A;  1RTN A;  1EIG A;  1EIH A;  1MI2 A;  5D14 A;  1F9P A;  4RAU C;  1PDQ A;  2EOT A;  4U68 A;  2B2T A;  2B2W C;  2NWG A;  2Q8R E;  2K28 A;  4ZKC B;  1XYI A;  1B4O A;  2CVR A;  1AP0 A;  5CMD A;  1F9R A;  3LWE A;  4MHE A;  1IL8 A;  1WTX A;  1BO0 A;  1F2L A;  2L4N A;  5E4W C;  4NW2 A;  1G91 A;  1CM9 A;  2X6G A;  1QE6 A;  2JP1 A;  2NYZ D;  4R9W A;  3KBX A;  5EQ0 A;  1PFM A;  1DOL A;  4IUQ A;  3DEO A;  2HCI A;  4UAI A;  5DNF A;  2KED A;  4HSV A;  1HA6 A;  4OIK A;  1JE4 A;  4DN4 M;  1U4M A;  1DZ1 A;  1EL0 A;  1IKL A;  1B3A A;  3TN2 A;  1PFB A;  4IUR A;  1QG7 A;  4RA8 A;  1VMC A;  5T1G A;  5EJW A;  2B2Y A;  1F9Q A;  1WTW A;  2RSN A;  1JIC A;  2L11 A;  1NR4 A;  2FMM A;  4CJ1 B;  4R8I A;  1ILP A;  1CA5 A;  3P7J A;  4LMQ D;  1AZP A;  1Q3L A;  3FDT A;  3Q6S A;  2K03 A;  3DEP A;  4X3U A;  1AZQ A;  1NAP A;  1WTR A;  1CA6 A;  1WTP A;  4CJ0 B;  1WTO A;  2MJ8 A;  1BF4 A;  2MP1 A;  1WVL A;  2Q8T A;  1VMP A;  1RJT A;  1G2T A;  4RWS C;  2FHT A;  4IUT A;  2B2V C;  2M2L A;  1NR2 A;  3DM1 A;  2DY7 A;  3ONA B;  2D9U A;  1SSO A;  2EE1 A;  1KNA A;  4QUC A;  2X6L A;  3N52 A;  1ROD A;  5EPJ A;  1O7Y A;  1EOT A; 
#chains in the Genus database with same CATH topology
 1SAP A;  4A3D H;  1EYA A;  3G4S A;  2H1E A;  4A3I H;  2UXB L;  1AE3 A;  1DOK A;  4K8I A;  4XQQ A;  1RKN A;  1PZK D;  2Y0S E;  5EBC A;  4A3D G;  2QCP X;  3H3V I;  2K1B A;  4Q5V A;  3OOC A;  2JN4 A;  1LM0 A;  2K50 A;  2F0U A;  1F77 A;  5M5W H;  3SK8 A;  1EU3 A;  1PFN A;  2Y0S B;  1CKN A;  3IKJ A;  4XQJ A;  5C4J B;  1ESF A;  1KNE A;  3H94 A;  5C4Z A;  2E5L L;  1J9O A;  2KUM A;  1A63 A;  4XDX A;  4CKC A;  5IIF A;  1KTK A;  2OXP A;  4AIM A;  4DR3 Q;  3WOE A;  1OTC A;  1JB7 A;  3UI2 A;  4A3F B;  2KVM A;  4BXX H;  5CBE E;  2L55 A;  2IW3 A;  3CC2 A;  2K04 A;  4GKK Q;  5GAD C;  5EPL A;  3CCR A;  1N34 Q;  5M5W B;  1TII D;  2XN9 C;  1VQH A;  1ESR A;  3ERS X;  4B3S L;  4QMG A;  5H1S E;  2MPM A;  4TSS A;  1U4P A;  1DD2 A;  3S1N B;  1TWF H;  4C1N K;  3OW2 A;  1P8L A;  1H9M A;  5C44 B;  4DV3 L;  3S2D B;  4IUN A;  4LNQ A;  4A3I B;  2OCE A;  4HJ8 A;  1XNQ Q;  3BVZ A;  1EIF A;  1FR3 A;  3K0Y A;  5IT9 c;  1AN8 A;  2A6E C;  4K6D A;  4ULL A;  4GLA C;  1YZ6 A;  3OYY A;  3NK9 A;  4F87 A;  4DV1 L;  1XMO L;  5E1F A;  3QIA A;  3PSI A;  3RLO A;  1A2U A;  1V9P A;  5KEE A;  4CKB A;  2LMC B;  1GO3 E;  4KHV A;  3CMA A;  1VDZ A;  4OO1 I;  3E5S A;  5KND A;  4YWL A;  1STE A;  4JCV E;  5EJW A;  2A6E D;  2AHO B;  4OEM B;  3K80 C;  1QNU A;  1AZQ A;  3S24 A;  2B8F A;  2QDL A;  5DM7 3;  4RWS C;  2A69 C;  5KRU A;  3SR1 A;  2X6L A;  2QIL A;  3R3O A;  4YCW A;  5E3F A;  1O7Y A;  3SE0 A;  2UUB Q;  4ZLT F;  2SOB A;  1WI5 A;  2CW0 C;  4V19 0;  4BBR B;  4FF3 A;  5ELB A;  1HNZ L;  1TVX A;  1GUW A;  2DNE A;  2CQO A;  3OTO Q;  4AYB E;  1QWY A;  4IJH A;  4GNX C;  2EIF A;  2EY5 A;  2RSO A;  4XYQ A;  4KY6 A;  2AQ2 B;  3RN5 A;  3SHL A;  1SXT A;  1OXV A;  4K5X A;  1MSG A;  5ISR A;  1B3Q A;  1LTG D;  4DR1 L;  2A19 A;  1YJ9 A;  1ICW A;  3J81 E;  3GTM B;  3CQZ B;  1HFN A;  2F0H A;  4BY7 B;  4B9W A;  1FGU A;  5DEH A;  4DR5 L;  1TWF B;  1D1K A;  3DM3 A;  4A3L H;  1TWC H;  3MXG A;  4C56 C;  5IP7 H;  4NXN Q;  1B50 A;  2D5D A;  1ET9 A;  1XTD A;  2QEX A;  3MXN A;  4YCU A;  3G48 A;  1SMY D;  1ZKO A;  1M8A A;  3K5O A;  4A3F H;  4KHZ A;  3U58 A;  1AH9 A;  4DNI A;  2PZW A;  5CC4 A;  4ALP A;  3CCS A;  1RF2 D;  1EIG A;  2V1C C;  3K6O A;  2I0Q A;  3V2T A;  3X3N A;  3HOY G;  1UE1 A;  4A3M B;  4C2M B;  1C4Q A;  1S5C D;  4MHE A;  1Q7Y C;  4NW2 A;  1G91 A;  3WOF A;  1QE6 A;  2WP8 J;  1EWC A;  3H3V C;  1N36 L;  2PCF B;  1EZ8 A;  2BH8 A;  1EEI D;  4HSV A;  3H6M A;  1JE4 A;  1LYL A;  1U4M A;  1EL0 A;  3TN2 A;  1PH6 A;  2R6G A;  4A3D B;  1QIL A;  3K57 A;  3K0X A;  1E3P A;  3I72 A;  1YHA A;  2B2Y A;  5KNC A;  1CA5 A;  1VF5 C;  1AZP A;  3TP7 A;  2ZJQ A;  1JB3 A;  3S17 B;  5CV6 A;  2RDG A;  3QOJ A;  2Q8I B;  5FLX E;  1WVL A;  1OXX K;  2Z6K C;  1CKO A;  1G2T A;  1Q12 A;  4PZ7 A;  2F1M A;  2B2V C;  2EYO A;  3PO3 G;  2WB1 G;  2MQH A;  3ONA B;  1SSO A;  4IJL A;  4OXP A;  4UPA A;  3HOU G;  1ROD A;  4F7X A;  3AU7 A;  2BE5 C;  1PH8 A;  1U4R A;  5C6A A;  4HCE A;  2F0F A;  4ZKB B;  1XMQ Q;  2F0G A;  1QVG A;  5IWA L;  3C3L A;  1YNN D;  2WB1 B;  1T5E A;  3NEM A;  3BVM A;  1VQN A;  4DF7 A;  4B3T L;  2JA5 G;  5C0X G;  4OWT B;  1JJ2 A;  2Q2H A;  4XT1 B;  1E2Z A;  1JOQ A;  5IGG A;  3SEB A;  2B63 B;  4XT3 B;  5HY6 A;  3FP9 A;  4JI3 L;  4BS9 A;  1JC7 A;  3GTK B;  3EJI A;  5E7N A;  2F0P A;  3RN2 A;  2WIN B;  3I8Z A;  2JA7 G;  4HMI A;  1PZI D;  3GTM H;  1WD0 A;  4HR7 B;  4YHH L;  3Q8D A;  1R4Q B;  3PUW A;  3PO2 B;  3M85 A;  4DK1 A;  2J4X A;  2DN8 A;  5IGE A;  3HS0 C;  2PZT A;  1CZG A;  4A3L G;  1ENF A;  2B2U A;  3FRP B;  1JJG A;  3PO2 H;  4RGM A;  4JI7 L;  5BN5 A;  4A3G B;  1STH A;  4DUZ Q;  4RFB A;  1PZJ D;  1Y1W G;  2B3G A;  5AJ3 L;  4LF8 Q;  1RTN A;  3T51 B;  2SEB D;  1RD9 D;  4B3S Q;  1ZEQ X;  5TSS A;  2TSS A;  4KY7 A;  1EU4 A;  3OWF A;  1VQJ A;  2A6H C;  4GKK L;  2I5H A;  4LF9 L;  4EQN A;  3G6E A;  2NVY H;  3TS0 A;  4K8J A;  1IBK Q;  5IGD A;  1SNP A;  1V8Q A;  1M4V A;  4DNT B;  1E2W A;  5G3L D;  1PV4 A;  4JC0 A;  1KDC A;  5IY0 A;  3GQB A;  1Y1W H;  1HA6 A;  2AWO A;  2F0S A;  1IYJ B;  2Q2T A;  3S1M B;  4IUR A;  4HJ9 A;  4OHJ A;  1NNX A;  3PO2 G;  1FD7 D;  1EQV A;  2H4O A;  4TQU S;  2CCZ A;  4XQN A;  1VQI A;  4R4C A;  4X3U A;  2UUA Q;  1PH9 A;  1G6P A;  3H3V H;  4HJA A;  4HJ7 A;  4FYD A;  1MKH A;  4JI7 Q;  4IUT A;  3GTJ H;  4BBS B;  3HZX A;  2NN6 G;  1GD7 A;  4ABN A;  4KKS A;  3OMG A;  5EPJ A;  1W3S A;  1AEX A;  1LO5 D;  1X65 A;  4JI5 Q;  5C0X H;  3ULL A;  4DV3 Q;  5NUC A;  3M3Y B;  3GD7 A;  1BKB A;  4DR6 Q;  2CWA A;  4DUY Q;  1IW7 D;  4IPD A;  4JBK A;  1DCZ A;  2I07 B;  2F4I A;  4YWM A;  1WCM B;  2ZXR A;  4OO1 H;  2YU9 H;  1YI2 A;  3I3C A;  3FPU B;  3IL8 A;  2R7D A;  5CBA E;  3J80 c;  1VQG A;  4IPH A;  2IJ0 A;  2RA4 A;  4RKL A;  3F2U A;  1LTT D;  2L5T A;  2R7F A;  2Y0S G;  1OXS C;  3E9H A;  2OT2 A;  4FXD A;  4BXX G;  2LSS A;  2KEC A;  3C1F A;  2MUY A;  2RDF A;  1TU2 B;  1ONL A;  1ZYR C;  4LFA L;  2ICE C;  2K01 A;  1SE3 A;  3VYT A;  2DUD A;  2OF1 A;  3CQZ H;  1PA6 A;  2RVL A;  2HDL A;  3SVM A;  1BUV T;  4MNO A;  5CV4 A;  3TRE A;  2KHS A;  4CGY B;  1D2B A;  1I4Q A;  2BOS A;  2VS1 A;  1IL8 A;  3TSS A;  3HOY H;  2EJM A;  2MHV A;  4K5V A;  2ASB A;  2NZH A;  1MJC A;  4X65 L;  4DV7 L;  4A3I G;  3DHQ A;  3H0G B;  3RR5 A;  1PFM A;  3UE0 A;  3IAY A;  2AWN A;  2CH4 W;  2HCI A;  1PYW D;  2NVQ H;  2EYL A;  2BH2 A;  1ENC A;  4A3F G;  1E24 A;  3KLS X;  2PI2 E;  1XNR L;  4C3H G;  1WTW A;  3VYS A;  2FMM A;  4H0L C;  1S40 A;  1FYC A;  3A8K E;  3NSW A;  2IHF A;  1QVF A;  1Q3L A;  2K03 A;  3VA7 A;  2JSO A;  2RHQ B;  1LTS D;  1RCV D;  3H0G G;  4M8A A;  1QZH A;  2MJ8 A;  2JA6 B;  2Q8T A;  4XXE A;  2O2L D;  3GTL B;  3HOU B;  1MHW C;  4BY1 G;  1GUN A;  1VQK A;  2L0C A;  1K8A C;  3DXJ C;  1Y69 U;  4LFC L;  4NXN L;  3GP7 A;  5M3F B;  1ASY A;  4PNY A;  3BU2 A;  3GTQ B;  4C3I G;  1HQM C;  4Z9C B;  2Z1C A;  4FVM A;  2KJX A;  5ELN A;  1FNU A;  4JG2 A;  1WTQ A;  4NXM Q;  1EIY B;  1PFS A;  2JEB I;  3JAM L;  3I4M G;  4DAP A;  1TWA H;  2F52 A;  1K83 H;  4PMB A;  4DR1 Q;  3T53 B;  4ME5 A;  3T16 A;  5EPK A;  1CHP D;  1D8L A;  2YTV A;  2ATW A;  2JA7 B;  2E2H H;  1LTL A;  5DLQ E;  2PZU A;  1HA5 A;  1BCP F;  2NBF A;  3KDF B;  3K59 A;  3J7Y W;  1SYG A;  2E2H B;  4FF4 A;  4P71 A;  1N32 Q;  5LMN W;  1HTP A;  3PUX A;  5CV5 A;  2LY7 A;  4KD3 A;  4G4K A;  4ID6 A;  1EEF D;  1KRS A;  1TWA B;  3LGJ A;  1JOK A;  1P16 A;  1CI3 M;  3QOL A;  4IUV A;  4YWK A;  5FO8 B;  5IOC A;  5A35 A;  5I6W A;  1NSN S;  4DV0 L;  4M1U B;  4JI3 Q;  1QZG A;  5EGT A;  1YJW A;  2B2W A;  2EJF C;  1EY4 A;  1YNJ C;  1NE3 A;  2A69 D;  5CR3 A;  5M3F H;  1F9P A;  1S5E D;  2EOT A;  4ZKC B;  2Q8R E;  4L5Q A;  1A6X A;  4DV4 Q;  4F8M A;  4DXG A;  2RHS B;  5KGU A;  1PTO B;  4A3K B;  1KHI A;  3C1E A;  3A55 A;  5C0X J;  1L1O A;  3UE1 A;  2HT1 A;  3J7A 5;  4EQP A;  1V43 A;  1CKM A;  3K5N A;  3CHB D;  3CCL A;  2EYF A;  1YNJ D;  2BCO A;  4PG3 A;  3ERO A;  5K5P A;  1IYU A;  5C4X G;  1EY5 A;  1HNX Q;  1F9Q A;  1JIC A;  5LMN L;  3I55 A;  2JA8 B;  3VYU A;  1JWS D;  1NAP A;  4GOP C;  1L1O C;  1V1P B;  3HOY B;  2K14 A;  3D31 A;  4IN3 A;  4RGO S;  1NR2 A;  2EE1 A;  2LXK A;  1YNN C;  2PQA B;  1EIH A;  4DR2 L;  1PH5 A;  4N9T A;  4X3T A;  3K8A A;  4J15 A;  4FO2 A;  1HQR D;  4OWW B;  2Q2I A;  1K3R A;  4L8J A;  4JV5 L;  4NDX A;  1HPC A;  3JAM E;  3BYY B;  4AH6 A;  1TWH B;  3NP8 A;  4NB3 A;  3QR8 A;  2R93 B;  5FJ8 G;  2AQ1 B;  4P75 A;  1JMC A;  1X56 A;  2B2T C;  2D62 A;  3CCJ A;  2JK8 A;  3AB9 A;  3GTO H;  1VQL A;  5JAV A;  5A2Q L;  4UP8 A;  1AE2 A;  5IT9 L;  5C4X B;  2AQ3 B;  5LL6 S;  1D5Z C;  3MHB A;  2VUM G;  2LKV A;  2J7Z A;  1I4H A;  3VR6 A;  2YU9 B;  3GV6 A;  3FPP A;  1Y8O B;  5D3I B;  5KYI A;  1WCM H;  2GVB A;  5GQO A;  1SLJ A;  2E8G A;  2ID0 A;  4QY7 A;  1A62 A;  4ZUI A;  1G2S A;  1WTV A;  1N32 L;  5IYC G;  1B1Z A;  3U50 C;  2A74 C;  3M3Y H;  1G8Z D;  1LUZ A;  1TT2 A;  4GNX A;  1EYG A;  4OX9 L;  5JOB A;  3R93 A;  1SNM A;  4OGQ C;  4XYO A;  1QUQ B;  1STN A;  2Q2U A;  4X66 L;  4KHP L;  1JOO A;  2L9H A;  1BCP B;  2N88 A;  3ERQ A;  4R4I A;  1KAW A;  1KAB A;  1NTG A;  2EY6 A;  3CAM A;  4JK1 C;  4OWX B;  1A8V A;  2K28 A;  2UUB L;  3I4N H;  4A3G G;  1XPR A;  2BA0 A;  1K83 B;  5IP9 H;  4KK7 A;  3S15 B;  1WFQ A;  1VQD A;  4QJF A;  2NYZ D;  2F0V A;  3NQI A;  1H9S B;  2G5D A;  3CCQ A;  1PRT F;  2IPK D;  5DNF A;  3KBG A;  3E0E A;  3MVV A;  3QWN A;  4Q0F A;  4HID A;  3CRK C;  2WAC A;  2IWH A;  2K5V A;  3KLS A;  1QB5 D;  4G7O C;  1Y1V G;  2JA6 H;  2IX0 A;  4DV6 L;  2NB0 A;  5IWA Q;  2HIX A;  4LUO A;  1EYD A;  2FHT A;  4JI1 Q;  2M2L A;  1HR0 Q;  1SYF A;  3D6C A;  3DM1 A;  3OPO A;  1KDB A;  1SND A;  3MFG A;  1EQT A;  1Z9F A;  1LAB A;  1VF7 A;  3T13 A;  1B53 A;  1L1O B;  2HQL A;  3CC7 A;  1JJC B;  3BZD B;  1GUO A;  3A7L A;  2K5W A;  3BDL A;  2JEA I;  1II3 A;  4A3M G;  4R4Q A;  3UDG A;  1NUC A;  2JYO A;  4EQ5 A;  2X69 A;  4JI4 L;  4JI8 L;  3BZK A;  3UDI A;  1SN8 A;  1K73 C;  1SE4 A;  1BCP D;  2O5J C;  1X3P A;  1Y1V B;  1V1O A;  3CU7 A;  3MA2 B;  2ENB A;  3RD4 A;  1N34 L;  3K58 A;  4A3E B;  5IYD H;  4IFD J;  1ILQ A;  1NCV A;  2R92 H;  4AYB B;  2WAQ B;  3BJU A;  4BWG B;  3P75 A;  3MTS A;  1HZB A;  4N8F A;  3PQI A;  3F8T A;  4O0A A;  1AW7 A;  2OTL A;  1NJI C;  3AEV A;  2B2T A;  1L0W A;  4PQX A;  3EBE A;  1SNQ A;  3M4Y A;  4KI0 A;  1GOZ A;  3NTI A;  2AMC B;  3KOJ A;  4A3B G;  4N8X 1;  1B9M A;  1XTC D;  3HEJ A;  1LTR D;  2FXQ A;  3M4Q A;  2N3S A;  3S17 H;  3GTG B;  3J81 i;  2WII B;  1VQP A;  1IL2 A;  2JA8 H;  1DOL A;  1VS0 A;  4A93 G;  2EY2 A;  3FKI B;  1IW7 C;  4K6L A;  2GN5 A;  4JI0 Q;  5FK9 C;  1BCP C;  4DV2 L;  1UE6 A;  2F0Q A;  2XGT A;  3RNU A;  3O13 A;  1YJN A;  1ILP A;  3FHW A;  3A5Z B;  1IXR A;  2CH4 A;  3LWU A;  1X9N A;  1IBM Q;  1HZ9 A;  1JT8 A;  4A3K H;  5IGB A;  1E7Z A;  2RCN A;  5FLM G;  1YIJ A;  1A3U A;  1HR0 W;  2A8V A;  3Q0A A;  4YCV A;  5I2X A;  1LLR D;  3VA5 A;  3KJP A;  1J5E L;  1BBW A;  1VQ5 A;  1PRT B;  2NVX H;  2D9U A;  2GVA A;  1SRU A;  4GNX B;  1SYC A;  4PMC A;  1SJH D;  4J6H A;  1WOC A;  4F88 A;  1CQV A;  1Q1B A;  3FEW X;  3IRB A;  2XIW A;  2UU9 L;  4YY3 Q;  2L12 A;  2R93 G;  2PQE A;  4OIJ A;  2ZJR A;  5C3W A;  2WV6 D;  2R7Z G;  3DWP A;  3NQT A;  1R4P B;  4HCS A;  1EZ6 A;  3A8I E;  1L2F A;  3CC4 A;  2MO1 A;  1S4Z A;  3JC6 6;  5EKK A;  1GUG A;  1PTO D;  1X54 A;  1JWM D;  3IFD A;  3HOX H;  5HGQ A;  1DON A;  1EY7 A;  3GV3 A;  4DUZ L;  3CCV A;  3J81 j;  2E2D C;  1LTI D;  4A3J G;  1W2B A;  3NPP A;  1SR3 A;  3CCE A;  4IUP A;  4LF5 L;  1W6J A;  4O2D A;  1TKW B;  2B29 A;  1IBL Q;  4IAL A;  1EFW A;  2PYK A;  2EPB A;  4K0K L;  3J80 L;  1S72 A;  2HHH L;  2ES2 A;  3FVQ A;  3F2C A;  1LT6 D;  4KY5 A;  1GUS A;  2N55 A;  4GOP A;  3CPW A;  1I6H H;  4A75 A;  3RZD B;  1F9S A;  3A54 A;  4XIG S;  5FKA C;  2ALY B;  1XXG A;  4RCO A;  1FJG Q;  3TQY A;  3TBI B;  4LF7 L;  5IE8 A;  1X3F A;  2QDB A;  2K33 A;  3CCM A;  4V0B A;  1PH4 A;  3W1B A;  4B3R Q;  5ELE A;  5ELD A;  3MXN B;  4DV5 Q;  4KLK A;  1KLG D;  2L4N A;  3MEH A;  4YY3 L;  1Y8P B;  2RBM A;  3IFT A;  2VW9 A;  1CSQ A;  1O7L A;  2CWP A;  5EQ0 A;  2A1A A;  3NTH A;  1F2Y A;  1D7Q A;  3I73 A;  1I4P A;  3DEO A;  1X3E A;  4OIK A;  1CTM A;  4DNR B;  3A56 A;  4A4I A;  1EY6 A;  4DV2 Q;  1VQ9 A;  4ILW A;  1EWI A;  3E9I A;  3ZJY C;  4R8I A;  4KHP Q;  1SJE D;  1PYB A;  3ER0 A;  3SGI A;  3A74 A;  2MO0 A;  4X62 L;  5G3L F;  4IOC A;  1HZA A;  1BDO A;  4JBM A;  4OX9 Q;  1GXD C;  3S16 H;  5JEA G;  1TXY A;  4J8Q A;  2PW7 A;  2MFI A;  4RHR A;  4KKU A;  2H5X A;  4A3C G;  4FXG C;  4DU9 A;  5C4H A;  1PTO F;  3TP8 A;  3S2D H;  4HTH A;  1CSP A;  3NE5 B;  3AFQ A;  3MAQ A;  3HOW H;  3S1N H;  1IHZ A;  1BXT A;  5LMU L;  1Q81 C;  4L5R C;  2XNA C;  3KUP A;  3D6W A;  4QIW E;  2F3I A;  2UXC Q;  1D5X C;  5JJK A;  4ZK9 B;  1CK1 A;  4KTA A;  3KFU A;  2Z6K A;  2R3Z A;  1NMG A;  2B2V A;  2E2I H;  2FJ2 A;  4UP7 A;  5BN4 A;  2B63 G;  4GKJ Q;  2K05 A;  5C44 G;  5C5M A;  4G7H C;  1GKH A;  1TY2 A;  3VR2 A;  2K6A A;  1C8C A;  1STA A;  4MTK A;  2XTI A;  2HIV A;  2NZO A;  4LF4 L;  1S5D D;  2B2Y C;  4AYB G;  3S1R B;  2WAQ G;  1X3Q A;  4DR5 Q;  3MC0 B;  1O7I A;  4L6T B;  3DWA A;  1HUN A;  1S5F D;  2JJQ A;  1I5F A;  2C9O A;  2IY5 B;  2A68 C;  4IO9 A;  5IT9 E;  4BY7 H;  5IOD A;  1N8R C;  4FDB A;  4IQZ A;  1O80 A;  4JI4 Q;  4KN7 C;  3TS2 A;  4CKE A;  3CW2 C;  2DJF C;  1N33 Q;  3AFP A;  2VUM B;  3GTP H;  4LF5 Q;  4BBS H;  3K7A B;  1Q8K A;  3PUZ A;  3LWE A;  3CPF A;  4LFB L;  1H9R A;  1CM9 A;  4HMJ A;  2JP1 A;  1VQ6 A;  2VQF L;  1Z6H A;  4UY8 C;  4Y7N B;  2F3W A;  3R2I A;  1HNZ Q;  1SFO H;  4UAI A;  5KNB A;  4DN4 M;  1EY9 A;  2PI2 A;  4FF1 A;  3S1M H;  2YTX A;  2J0T D;  3GO5 A;  1G51 A;  2OWO A;  1BOS A;  2L11 A;  2WKD A;  3M4O H;  2EVB A;  5M3M B;  3FDT A;  3NBI A;  1Q8I A;  4B08 A;  3BVG A;  3PO3 B;  4RKB A;  1BQQ T;  1KD1 C;  4FF2 A;  1KLU D;  1PMR A;  5ELF A;  2K5H A;  1A3V A;  4LF9 Q;  1SE8 A;  4GLX A;  2ZXP A;  5I9O A;  1D6E C;  3HOZ H;  3NEN A;  2F0N A;  2UXD Q;  5M3M G;  3QG1 A;  4HAE A;  3E3X A;  2NVQ B;  4H44 C;  3D8G A;  3RZD H;  2KCN A;  1HHV A;  2BDN A;  1R9T H;  1QVC A;  5K36 G;  4DK0 A;  1PH1 A;  4BY7 G;  2JA5 B;  3TP6 A;  1IBM L;  1HJP A;  4QUF A;  4LJZ C;  4GLV B;  1XWE A;  3A7A B;  1LT4 D;  4BBR G;  4X3K A;  3R2T A;  3SXH A;  3T56 B;  1CQF A;  2Z4H A;  2SNM A;  3ICE A;  5C44 H;  4DA2 A;  1U4L A;  2BDO A;  5JVH 3;  4NXM L;  4OEL B;  2ZJP A;  3VR3 A;  4DR4 Q;  2B63 H;  4J1M A;  1EQR A;  5C3E H;  2NZ1 D;  1GHK A;  1C48 A;  2UUC Q;  1HCZ A;  4K5W A;  3PV0 A;  4QL5 A;  3KLW A;  1Z47 A;  4PZ8 A;  3NWT A;  4HED A;  4EGV A;  3HOV G;  3F2B A;  1B8A A;  2EYM A;  1MGS A;  3OSO A;  3MEF A;  3HOW G;  4KD4 A;  4L5T A;  1Q86 C;  2E2I B;  3DWQ A;  2VXW A;  4P2C B;  3T1H L;  4PV1 C;  2XRQ D;  4HJ5 A;  4IFD G;  5LHY 1;  4TVA B;  5D14 A;  1A0I A;  4ZUJ A;  4A3C H;  1B4O A;  2CVR A;  2NVX B;  3RUZ A;  3WDN A;  1F9R A;  1MD2 D;  4L5S A;  1BVS A;  1PH2 A;  2DJG C;  1EYC A;  5E4W C;  2V4D A;  4EX5 A;  4U67 3;  3L2P A;  3I56 A;  1I6V C;  2KBN A;  2R92 G;  3AMU A;  5IYD G;  3LNN A;  4JYA L;  4LFB Q;  1FNW A;  4HSP A;  2RKS A;  2K4K A;  1U9R A;  3CD6 A;  1UWV A;  1ASZ A;  3L9A X;  4DR7 L;  1VMC A;  1XPU A;  3FKI H;  1HZC A;  2RSN A;  1NR4 A;  3W1G A;  5I4D A;  2QEJ C;  2VQE Q;  1YBY A;  3Q6S A;  4JYA Q;  3TZU A;  1CA6 A;  4LFA Q;  5J3B A;  2RQX A;  1RIP A;  3PIO 3;  5LMN Q;  1FNV A;  4HN7 A;  4APV A;  5EAY A;  2NVT B;  4A3M H;  2VB2 X;  4HIK A;  4R4O A;  2K52 A;  3NEL A;  2PPB C;  4DXF A;  3N52 A;  4B9X A;  3EVQ A;  1EOT A;  4JBJ A;  2F0K A;  1KXL A;  4BA1 I;  2K5D A;  2K75 A;  2KCM A;  4DV0 Q;  4JOI C;  4GOP B;  4KN4 C;  4DV5 L;  2NTS A;  4NP5 A;  3G71 A;  1CFM A;  1QNK A;  1Q90 A;  2ZTC A;  1QUQ A;  2LS0 1;  1LT5 D;  4A3E H;  1U0L A;  1B7Y B;  3PGZ A;  1EFI D;  1EWH A;  3M9B A;  4C3J B;  1SRO A;  3TP5 A;  1DOM A;  2CHB D;  4I7A A;  4I7Z C;  1Y1V H;  5IYB G;  3L3O C;  3K5L A;  1STY A;  4DR4 L;  4A3J H;  3HOV H;  4FP5 D;  2ZTE A;  2R7Z B;  1XJV A;  4DV1 Q;  1PHJ A;  1Q46 A;  2UXB Q;  2HQE A;  2AKW B;  1M1K C;  1TS5 A;  4ME3 A;  1I4X A;  3S2H H;  5FLX c;  4Y52 H;  5M5Y H;  2IHE A;  5M5Y B;  1I50 B;  1PLF A;  1S5B D;  1JWU D;  3G6J B;  4CDC C;  1DYQ A;  4X66 Q;  1R9T B;  1MSH A;  4GZY C;  1JR0 D;  2R7Z H;  1I3Q B;  5COY A;  2K5Q A;  1K3B C;  1XPO A;  5AFW A;  2EDG A;  2UUA L;  3GTK H;  4LAA A;  1YVC A;  2BE5 D;  2NUC A;  4IUU A;  4BBR H;  3NHH A;  2Z8L A;  2EXZ A;  1MI2 A;  3HOZ B;  4RH6 A;  3L7Z C;  4RAU C;  1KC8 C;  3PUY A;  2NWG A;  4C3J H;  2CQA A;  4DFA A;  1VQC A;  4CDF C;  1CUK A;  1SNC A;  1WTX A;  4C3J G;  1BO0 A;  2XSC A;  5K36 H;  3STB D;  1PRT C;  3H15 A;  1PH3 A;  2G9H D;  4QB4 A;  3U4V A;  4JVZ A;  3CXC A;  1SMX A;  5M3M H;  5FLM H;  1IBK L;  3ZYY X;  4IUQ A;  1A2T A;  4A3K G;  2E5L Q;  3HOZ G;  3BDC A;  4TRD A;  5I2Y A;  1DZ1 A;  1Y8N B;  3OW7 A;  2A5H A;  5JEA J;  3MXP A;  4RA8 A;  2E76 C;  2F3V A;  4R4T A;  1T5X D;  1SNO A;  4LMQ D;  2FMC A;  5AJ3 Q;  4LUZ A;  1ET6 A;  1VQ4 A;  1PRT D;  2JA8 G;  1C0A A;  2A73 B;  2OQK A;  3HKS A;  1TR5 A;  4X65 Q;  4A76 A;  1YNX A;  3CME A;  4KV6 A;  2DY7 A;  4CDE C;  4X64 L;  3GTP B;  1SYD A;  3KF6 B;  5FJ8 H;  2F0I A;  3RLN A;  1IBL L;  4DR2 Q;  5IYB H;  5FO7 B;  5COR A;  2HCC A;  5ELO A;  3TME A;  1N33 L;  3J81 c;  1LTB D;  3CRL C;  3QB3 A;  3TEH B;  1GUT A;  4UDU C;  4O42 A;  4DV7 Q;  1UUP A;  4A3E G;  5BR8 L;  1H9S A;  1TS3 A;  2JA9 A;  4BBS G;  4PZ6 A;  3FMC A;  1K28 A;  1UEA B;  3JAM i;  4GN4 B;  4UP9 A;  4DK6 C;  4B3T Q;  3PF4 A;  1RTO A;  2QW7 A;  1O7Z A;  2FFK B;  1KIX A;  4EQO A;  1ZXT A;  1B44 D;  4HIM A;  3P20 A;  3PIP 3;  3D3R A;  5C4X H;  4NMZ A;  1HH2 P;  4LUV A;  1A3T A;  3MWY W;  4QQB X;  2F0M A;  3UDX A;  2JQO A;  4H7B A;  3KDF A;  3ULJ A;  3URY A;  1SDF A;  3W2D A;  4AQY L;  1AFP A;  1G29 1;  2UXC L;  2KA7 A;  3FKI G;  3MXU A;  1J5E Q;  4DR6 L;  1TWH H;  3H09 A;  1NBW A;  2IX3 A;  1VQO A;  4P74 A;  3UDF A;  2KEE A;  1HUM A;  3EQL C;  1VQB A;  4WRD A;  4MN3 A;  1K0R A;  4DKA C;  3J7A V;  1HTL D;  3C46 A;  1WJJ A;  5GAE C;  1KL9 A;  1PDQ A;  1XYI A;  1AP0 A;  2F0T A;  2NN6 I;  3E0J A;  5I6Y A;  3CP0 A;  4RMF A;  4POG A;  3BS1 A;  2F4V Q;  1F2L A;  2ZTD A;  3KK7 A;  2D2C C;  5BN3 A;  2X6G A;  3VR4 A;  5CV8 A;  4IFD H;  2R61 A;  2WB1 E;  1LTA D;  4JI2 L;  1ZYR D;  1D1I A;  4X62 Q;  5DM6 3;  1YHQ A;  5CYU A;  1VQE A;  3RMH A;  1EQQ A;  1B3A A;  2EZV A;  1L0X B;  1HNW Q;  3PF5 A;  4BY1 B;  2QKI C;  5L37 A;  2ZM6 Q;  1Z7T A;  5JEA H;  5IGC A;  1QG7 A;  3ULP A;  4R8N A;  4EVO A;  4CJ1 B;  1YHB A;  3P7J A;  1OXU A;  2F0L A;  3F2D A;  2CW0 D;  1PTO H;  4LF6 Q;  4CHT B;  5JVG 3;  5C3E G;  4BA2 I;  3U9S A;  3TRZ A;  3KLR A;  2EXD A;  3F1Z A;  2VL6 A;  2K7V A;  2VNU D;  3SK5 A;  3SK4 A;  1M90 C;  3JAM c;  1EY0 A;  2UUC L;  5JJZ A;  2SDF A;  3S1Q H;  1PYS B;  2EYP A;  1RDP D;  1O78 A;  2HUG A;  1SFO B;  4RCN A;  3NBH B;  2L1B A;  3A0J A;  1I6H B;  4JI6 L;  2PNR C;  4P73 A;  3S15 H;  1E1T A;  5D65 A;  3CCU A;  1KAA A;  1G6Z A;  3K7A H;  2P5Z X;  2HHH Q;  1QOH A;  4C3I B;  4JI0 L;  5JPM C;  3U9O A;  2ZM6 L;  4K0K Q;  4L63 B;  3PMF A;  3KF6 A;  4LF8 L;  3RZO H;  5A2Q E;  2QF7 A;  4QF4 A;  4C3H B;  1JOR A;  1B9N A;  4KJN A;  4YHH Q;  2VY3 A;  3ND9 A;  5M9O A;  1UE7 A;  1SMY C;  1HXY D;  4C3H H;  3CF5 A;  3RZO B;  1WD1 A;  1KDA A;  5FO9 B;  2UXD L;  5HUR A;  5FOB B;  5GRO A;  3Q22 A;  3S1R H;  3KF8 B;  5EBD A;  1N9W A;  2XWB B;  3M7G A;  1LT3 D;  1E0B A;  4WJ3 M;  3NUC A;  5EKI A;  2WAQ E;  4HIO A;  3A5U A;  4DV6 Q;  3HOX G;  5DAU A;  4LW1 A;  4PMW A;  3BZC A;  1ICF B;  3S1Q B;  1GHJ A;  1MIU A;  2MNA A;  3HGB A;  4DGZ A;  3GTQ H;  3K7U C;  5C4J H;  3I70 A;  3R8B A;  4DAY B;  1DM0 B;  1SBB B;  4QGU A;  2R93 H;  4WFN 3;  3S9W A;  3HOW B;  4POF A;  3KBX A;  2IX1 A;  5J22 A;  1DGS A;  3HKZ B;  2PMZ B;  1B70 B;  5I9P A;  5FLX L;  1PFB A;  5T1G A;  2VZA A;  1GJX A;  3S14 B;  3Q23 A;  3NBH A;  5CV7 A;  3S16 B;  1PVO A;  3DEP A;  1EOV A;  1WTR A;  1ENA A;  4GN3 B;  1Q1E A;  2VQE L;  1WTO A;  4RG1 A;  1N36 Q;  5F2D A;  4X6A H;  4K14 A;  4G57 A;  3QJY A;  3BDO A;  4JI5 L;  1V1Q A;  1OO9 B;  4WJ4 A;  1K8G A;  2VB3 X;  3S14 H;  3OMC A;  4DAM A;  1RL2 A;  3EA6 A;  4LF4 Q;  4CJ0 B;  3EN2 A;  4X3S A;  1T9H A;  4E6I A;  1K8O A;  4O1N A;  4JOI A;  2DGY A;  3TDQ A;  3SK6 A;  5M3F G;  4A93 B;  2TMP A;  1GM5 A;  3ND8 A;  2O4X A;  3TZD A;  2MGS A;  3HP3 A;  4A3B H;  4GKJ L;  3NWS A;  2KCC A;  1F2M A;  1D5M C;  3PUV A;  2K32 A;  4H13 C;  4LWC A;  1SYB A;  4ZCK A;  4FNF A;  1SE2 A;  2DY8 A;  4FXK C;  1FVI A;  5C3X A;  5LL6 X;  1ML0 D;  4JBW A;  3I4M B;  1SEB D;  2C35 B;  4P72 A;  1I94 L;  1I4R A;  1I94 Q;  2FIN B;  4RHS A;  2D0P A;  1STB A;  2E2J B;  1Q82 C;  1BBU A;  2HDM A;  1X6O A;  3DMU A;  2N49 A;  2C5C A;  4JV5 Q;  2B2U C;  1NMF A;  3J7Z C;  5T1I A;  4I65 A;  4K2L A;  2L15 A;  2PMZ E;  2N8N A;  1BBX C;  2CKZ B;  1IKM A;  3V05 A;  3AYH B;  1PH7 A;  1VQ8 A;  2CFM A;  2SNS A;  1KQS A;  3STB C;  2D0O A;  3HOX B;  1HNX L;  4S3S A;  2EQS A;  5JJI A;  2AUJ D;  2BA1 A;  1TY0 A;  2DNC A;  1CKN B;  5GAG C;  4C3I H;  3Q24 A;  4GN5 A;  3GTJ B;  5EKL A;  1BR9 A;  4C1N I;  3OTO L;  4JI1 L;  1HR0 L;  1UAP A;  2F0W A;  1X55 A;  5CGK A;  4B3M Q;  1WTH A;  2KED A;  2EJG C;  5C5L A;  1TWG H;  2LXJ A;  3I2Z A;  3HG9 A;  3J80 E;  2NTT A;  3OWE B;  1J6Q A;  2E74 C;  3KF8 A;  4IPC A;  4R1J A;  1TWG B;  3HRZ C;  1E22 A;  1Y1W B;  5C0X I;  1EUJ A;  1FJG L;  3T1Y Q;  1Y14 B;  3GTL H;  4WOR A;  2JA6 G;  1DXM A;  4B3M L;  3OIP A;  2NVY B;  2KEN A;  1VMP A;  3M4P A;  2VQF Q;  1XMQ L;  2XWJ B;  4YIJ A;  1JCK B;  3K81 C;  1NY4 A;  3RLF A;  4QUC A;  4TKO B;  3E6Z X;  1H95 A;  1GVP A;  4JI2 Q;  2KHJ A;  1J8I A;  2M9V A;  2PNH A;  4DK3 C;  4RGT A;  1XX8 A;  3PIO A;  3GTG H;  4WJW A;  4ZRZ A;  3I4N G;  4A3G H;  1VQM A;  1FGB D;  4OON A;  4KMU C;  5JPN C;  4G7Z C;  3I91 A;  1E1O A;  4DAY A;  1JQY D;  1X3G A;  2K5N A;  3S2H B;  1QCB D;  2HD3 A;  3VYR A;  4KJO A;  1FL0 A;  1X32 A;  2A6H D;  1LAC A;  3I90 A;  1KRT A;  4JI6 Q;  4A3J B;  4ZYS A;  4MIU A;  2E2J H;  1VQF A;  3BG3 A;  1TS4 A;  1YEZ A;  2UU9 Q;  2KQ3 A;  2OEO A;  4DV4 L;  2R92 B;  3PIP A;  1WCM G;  2EYH A;  4QIW B;  3KJO A;  5M5X B;  4OO1 G;  1H9J A;  5JJL A;  5M5X H;  1PXU A;  4ZQ3 A;  1HFG A;  3T1H Q;  4JW0 A;  2I5M X;  1SYE A;  1H9K A;  4DPG A;  3J7A F;  3P1H A;  4A3B B;  3BYT B;  3J80 i;  2YV5 A;  4A93 H;  2EYJ A;  3A8J E;  2XVS A;  4NPS A;  3N6R A;  2Z9H A;  4IZ8 A;  3OHX C;  1EY8 A;  3AQQ A;  4IPG A;  1XNR Q;  1IZ6 A;  4U68 A;  3SDZ A;  2N78 A;  2WKC A;  1UEB A;  1UE5 A;  3NXW A;  2F03 A;  3C2P A;  2WFW A;  4DAV A;  2NN6 H;  5BR8 Q;  5IGF A;  4UHV A;  3HKZ G;  4KKT A;  1MJE A;  2AUK A;  5IP7 G;  4NKL A;  1MBY A;  4MTN A;  5HGT A;  3HFZ B;  1UNS A;  2PQA A;  3LX0 A;  4X64 Q;  1TQO A;  1CHQ D;  3W5O A;  3M7N A;  2F0J A;  4N9P A;  2QGQ A;  2B8G A;  4QCL A;  3CKI B;  2YYZ A;  3DUZ A;  1CT1 D;  3HKZ E;  4C2M H;  1C7Y A;  4AQY Q;  1KNA A;  2PO4 A;  1STG A;  5KYL A;  2KHI A;  4XTC S;  4LFC Q;  4B3R L;  5J1Z A;  2IL8 A;  5E4X A;  2QA4 A;  1K9M C;  4LF7 Q;  2F0E A;  3I4L A;  3B6Y A;  1OXT A;  1QJO A;  1JE5 A;  2G9D A;  4ZAI A;  2I46 A;  3EIV A;  3V96 A;  2Z6B A;  1WYD A;  4JI8 Q;  2F0D A;  3I4N B;  2OQ0 A;  3T4A C;  2M00 A;  1TWC B;  2RCF A;  2ZT9 C;  1HNW L;  4DUY L;  5C3E B;  3EFX D;  1S3O A;  3W3A A;  1L0Y B;  3I7F A;  3NTK A;  3X3M A;  1I3Q H;  1XMO Q;  1C9O A;  2F0O A;  5J39 A;  1U5K A;  2KOL A;  3QO2 A;  2JA7 H;  4CJ2 C;  3D4W A;  3OIQ A;  2JE6 I;  2PW5 A;  1I50 H;  1W6K A;  3DLL A;  2YTY A;  1TS2 A;  1K8M A;  5ELC A;  4IFD I;  3H91 A;  3KYH C;  1I4G A;  1XNQ L;  2JA5 H;  1PTO C;  2IT1 A;  4GS3 A;  3G7L A;  1B2T A;  3HOV B;  3MFY A;  1V1P A;  4K2K A;  1BNZ A;  5GAH C;  1RHP A;  3ITP A;  1LV9 A;  3T1Y L;  1VQA A;  5D3D A;  2KCT A;  1A15 A;  1E2V A;  3I4O A;  2Z0S A;  1YIT A;  2GA4 B;  5IP9 G;  3GTO B;  1CZW A;  2B2W C;  1HRJ A;  4CBV A;  4H02 A;  2LFN A;  3J81 L;  2I5L X;  3I4M H;  5CMD A;  3HOU H;  3VDY A;  3WWV A;  3PO3 H;  5CV9 A;  5KIX A;  4DR3 L;  4R9W A;  2O5I C;  3PCO B;  4LF6 L;  2OTJ A;  3M4O B;  2RDH A;  4LK1 C;  2B39 A;  1VCI A;  4MZ9 A;  4IOA A;  1DJR D;  1IKL A;  3K5M A;  2EY1 A;  3GDE A;  4BY1 H;  1K0S A;  1IYV A;  3D4R A;  5IYC H;  3VR5 A;  1VQ7 A;  2E75 C;  3U4Z A;  3L0O A;  5LMU Q;  2RF4 A;  2ICI A;  3H0G H;  3MZ5 A;  2NVT H;  4Y7N H;  1WTP A;  2Z4I A;  1BF4 A;  1F2Z A;  2MP1 A;  3D4D A;  4ODG A;  4JPB W;  1RJT A;  4RGN A;  4OL7 A;  4CDD C;  2ZXO A;  4DR7 Q;  2F4V L;  2A68 D;  2VUM H;  2JXM B;  2XRS D;  3D0F A; 
#chains in the Genus database with same CATH homology
 1SAP A;  1EYA A;  2H1E A;  1DOK A;  4K8I A;  4XQQ A;  1RKN A;  1PZK D;  5EBC A;  2QCP X;  2K1B A;  4Q5V A;  3OOC A;  2F0U A;  1F77 A;  3SK8 A;  1EU3 A;  1PFN A;  2Y0S B;  3IKJ A;  4XQJ A;  5C4J B;  1ESF A;  1KNE A;  3H94 A;  5C4Z A;  1J9O A;  2KUM A;  4XDX A;  4CKC A;  5IIF A;  1KTK A;  2OXP A;  3WOE A;  3UI2 A;  4A3F B;  2KVM A;  5CBE E;  2L55 A;  2IW3 A;  2K04 A;  5EPL A;  5M5W B;  1TII D;  2XN9 C;  1ESR A;  4QMG A;  2MPM A;  4TSS A;  1U4P A;  1DD2 A;  3S1N B;  4C1N K;  1H9M A;  5C44 B;  3S2D B;  4IUN A;  4A3I B;  3BVZ A;  1FR3 A;  3K0Y A;  1AN8 A;  2A6E C;  4K6D A;  4ULL A;  3NK9 A;  4F87 A;  5E1F A;  3QIA A;  5KEE A;  1A2U A;  4CKB A;  2LMC B;  4KHV A;  4OO1 I;  1VDZ A;  3E5S A;  5KND A;  1STE A;  5EJW A;  2A6E D;  1QNU A;  1AZQ A;  2B8F A;  5DM7 3;  4RWS C;  2A69 C;  5KRU A;  3SR1 A;  2X6L A;  2QIL A;  3R3O A;  5E3F A;  3SE0 A;  1O7Y A;  4ZLT F;  2SOB A;  2CW0 C;  4V19 0;  4BBR B;  4FF3 A;  5ELB A;  1TVX A;  1GUW A;  2DNE A;  1QWY A;  2EY5 A;  2RSO A;  4XYQ A;  4KY6 A;  2AQ2 B;  3SHL A;  1SXT A;  1OXV A;  4K5X A;  1MSG A;  5ISR A;  1LTG D;  1ICW A;  3J81 E;  3GTM B;  3CQZ B;  1HFN A;  2F0H A;  4BY7 B;  4B9W A;  5DEH A;  1TWF B;  1D1K A;  3MXG A;  4C56 C;  1B50 A;  2D5D A;  1ET9 A;  3MXN A;  1SMY D;  1ZKO A;  1M8A A;  3K5O A;  4KHZ A;  2PZW A;  5CC4 A;  1RF2 D;  1EIG A;  3K6O A;  3V2T A;  3X3N A;  4A3M B;  4C2M B;  1C4Q A;  1S5C D;  4MHE A;  4NW2 A;  1G91 A;  3WOF A;  1QE6 A;  2WP8 J;  1EWC A;  3H3V C;  2PCF B;  1EZ8 A;  1EEI D;  4HSV A;  3H6M A;  1JE4 A;  1U4M A;  1EL0 A;  3TN2 A;  2R6G A;  4A3D B;  1QIL A;  3K57 A;  3I72 A;  5KNC A;  2B2Y A;  1CA5 A;  1VF5 C;  1AZP A;  3TP7 A;  1JB3 A;  3S17 B;  5CV6 A;  2RDG A;  3QOJ A;  2Q8I B;  5FLX E;  1WVL A;  1OXX K;  1G2T A;  1Q12 A;  2F1M A;  2B2V C;  2EYO A;  3ONA B;  1SSO A;  1ROD A;  4F7X A;  3AU7 A;  2BE5 C;  1U4R A;  5C6A A;  4HCE A;  2F0F A;  4ZKB B;  2F0G A;  3C3L A;  1YNN D;  2WB1 B;  1T5E A;  3BVM A;  4DF7 A;  5C0X G;  4XT1 B;  1E2Z A;  1JOQ A;  5IGG A;  3SEB A;  2B63 B;  4XT3 B;  4BS9 A;  1JC7 A;  3GTK B;  3EJI A;  2F0P A;  2WIN B;  3I8Z A;  4HMI A;  1PZI D;  1WD0 A;  4HR7 B;  1R4Q B;  3PUW A;  3PO2 B;  3M85 A;  4DK1 A;  2J4X A;  2DN8 A;  5IGE A;  3HS0 C;  2PZT A;  1CZG A;  1ENF A;  2B2U A;  3FRP B;  4RGM A;  4A3G B;  5BN5 A;  1STH A;  4RFB A;  1PZJ D;  1RTN A;  3T51 B;  2SEB D;  1RD9 D;  1ZEQ X;  5TSS A;  2TSS A;  4KY7 A;  1EU4 A;  3OWF A;  2A6H C;  4EQN A;  4K8J A;  5IGD A;  1SNP A;  1V8Q A;  1M4V A;  4DNT B;  1E2W A;  5G3L D;  1KDC A;  3GQB A;  1HA6 A;  2AWO A;  2F0S A;  3S1M B;  4IUR A;  4OHJ A;  1FD7 D;  1EQV A;  2H4O A;  4TQU S;  4XQN A;  4X3U A;  4FYD A;  4IUT A;  4BBS B;  3HZX A;  2NN6 G;  4ABN A;  4KKS A;  3OMG A;  5EPJ A;  1AEX A;  1LO5 D;  5C0X H;  5NUC A;  3M3Y B;  3GD7 A;  1IW7 D;  1DCZ A;  2I07 B;  2F4I A;  1WCM B;  2ZXR A;  4OO1 H;  3I3C A;  3FPU B;  3IL8 A;  5CBA E;  2IJ0 A;  2RA4 A;  4RKL A;  3F2U A;  1LTT D;  2L5T A;  1OXS C;  2OT2 A;  4FXD A;  2KEC A;  3C1F A;  2MUY A;  2RDF A;  1TU2 B;  1ONL A;  1ZYR C;  2ICE C;  2K01 A;  1SE3 A;  3VYT A;  2OF1 A;  2RVL A;  2HDL A;  3SVM A;  1BUV T;  5CV4 A;  2KHS A;  4CGY B;  1D2B A;  1I4Q A;  2BOS A;  3TSS A;  1IL8 A;  2EJM A;  2MHV A;  4K5V A;  3DHQ A;  3H0G B;  3IAY A;  1PFM A;  2AWN A;  2HCI A;  1PYW D;  2EYL A;  1ENC A;  3KLS X;  4C3H G;  1WTW A;  3VYS A;  2FMM A;  4H0L C;  1FYC A;  3A8K E;  3NSW A;  1Q3L A;  2K03 A;  3VA7 A;  2JSO A;  4M8A A;  1LTS D;  1RCV D;  2MJ8 A;  2JA6 B;  2Q8T A;  4XXE A;  2O2L D;  3GTL B;  3HOU B;  1GUN A;  2L0C A;  3DXJ C;  1Y69 U;  5M3F B;  3GP7 A;  4PNY A;  3GTQ B;  4C3I G;  1HQM C;  4Z9C B;  2Z1C A;  4FVM A;  2KJX A;  1FNU A;  1WTQ A;  2JEB I;  3JAM L;  4DAP A;  4PMB A;  3T53 B;  4ME5 A;  3T16 A;  5EPK A;  1CHP D;  2JA7 B;  2PZU A;  1HA5 A;  1BCP F;  2NBF A;  3K59 A;  3J7Y W;  1SYG A;  2E2H B;  4FF4 A;  1HTP A;  3PUX A;  5CV5 A;  2LY7 A;  4KD3 A;  4G4K A;  4ID6 A;  1EEF D;  1TWA B;  1JOK A;  1CI3 M;  3QOL A;  4IUV A;  5FO8 B;  5IOC A;  5A35 A;  5I6W A;  1NSN S;  4M1U B;  5EGT A;  2B2W A;  2EJF C;  1EY4 A;  1YNJ C;  2A69 D;  5CR3 A;  1F9P A;  1S5E D;  2EOT A;  4ZKC B;  2Q8R E;  1A6X A;  4F8M A;  4DXG A;  5KGU A;  1PTO B;  4A3K B;  3C1E A;  3A55 A;  5C0X J;  4EQP A;  1V43 A;  3K5N A;  3CHB D;  2EYF A;  1YNJ D;  2BCO A;  3ERO A;  5K5P A;  1IYU A;  1EY5 A;  1F9Q A;  1JIC A;  2JA8 B;  3VYU A;  1JWS D;  1NAP A;  1V1P B;  3HOY B;  3D31 A;  4IN3 A;  4RGO S;  1NR2 A;  2EE1 A;  1YNN C;  1EIH A;  4N9T A;  4X3T A;  4FO2 A;  1HQR D;  4L8J A;  4NDX A;  1HPC A;  3JAM E;  3BYY B;  1TWH B;  3NP8 A;  2R93 B;  2AQ1 B;  2B2T C;  2D62 A;  3AB9 A;  5JAV A;  5A2Q L;  5IT9 L;  5C4X B;  2AQ3 B;  5LL6 S;  1D5Z C;  3MHB A;  2LKV A;  2J7Z A;  1I4H A;  3VR6 A;  2YU9 B;  3GV6 A;  3FPP A;  1Y8O B;  5D3I B;  5KYI A;  2ID0 A;  4ZUI A;  1G2S A;  1WTV A;  1B1Z A;  2A74 C;  1G8Z D;  1TT2 A;  5JOB A;  3R93 A;  1SNM A;  4OGQ C;  4XYO A;  1STN A;  1JOO A;  2L9H A;  1BCP B;  2N88 A;  3ERQ A;  1KAB A;  2EY6 A;  4JK1 C;  2K28 A;  2BA0 A;  1K83 B;  4KK7 A;  3S15 B;  2NYZ D;  2F0V A;  3NQI A;  1H9S B;  1PRT F;  2IPK D;  5DNF A;  3KBG A;  3MVV A;  3QWN A;  4Q0F A;  3CRK C;  2WAC A;  2IWH A;  3KLS A;  1QB5 D;  4G7O C;  2IX0 A;  2NB0 A;  1EYD A;  2FHT A;  2M2L A;  1SYF A;  3D6C A;  3DM1 A;  3OPO A;  1KDB A;  1SND A;  3MFG A;  1EQT A;  1LAB A;  1VF7 A;  3T13 A;  1B53 A;  3BZD B;  1GUO A;  3A7L A;  2K5W A;  3BDL A;  2JEA I;  1II3 A;  1NUC A;  2JYO A;  2X69 A;  1SE4 A;  1BCP D;  2O5J C;  1X3P A;  1Y1V B;  1V1O A;  3CU7 A;  3MA2 B;  2ENB A;  3RD4 A;  3K58 A;  4A3E B;  4IFD J;  1ILQ A;  1NCV A;  4AYB B;  2WAQ B;  4BWG B;  3P75 A;  3MTS A;  1AW7 A;  2B2T A;  4PQX A;  1SNQ A;  3M4Y A;  4KI0 A;  1GOZ A;  3NTI A;  1B9M A;  1XTC D;  3HEJ A;  1LTR D;  3GTG B;  2WII B;  1DOL A;  2EY2 A;  3FKI B;  1IW7 C;  4K6L A;  5FK9 C;  1BCP C;  2F0Q A;  3O13 A;  1ILP A;  3LWU A;  5IGB A;  1A3U A;  3Q0A A;  5I2X A;  1LLR D;  3VA5 A;  1PRT B;  2D9U A;  1SYC A;  4PMC A;  1SJH D;  4J6H A;  4F88 A;  1CQV A;  1Q1B A;  3FEW X;  2XIW A;  2L12 A;  2PQE A;  4OIJ A;  5C3W A;  2WV6 D;  3DWP A;  3NQT A;  1R4P B;  4HCS A;  1EZ6 A;  3A8I E;  1S4Z A;  5EKK A;  1GUG A;  1PTO D;  1JWM D;  3IFD A;  1DON A;  1EY7 A;  3GV3 A;  2E2D C;  1LTI D;  3NPP A;  4IUP A;  1W6J A;  1TKW B;  4IAL A;  2PYK A;  2EPB A;  3J80 L;  3FVQ A;  1LT6 D;  4KY5 A;  1GUS A;  2N55 A;  3RZD B;  1F9S A;  3A54 A;  4XIG S;  5FKA C;  1XXG A;  4RCO A;  3TBI B;  2QDB A;  2K33 A;  4V0B A;  5ELE A;  5ELD A;  1KLG D;  2L4N A;  3MEH A;  1Y8P B;  2RBM A;  3IFT A;  5EQ0 A;  1O7L A;  3NTH A;  1F2Y A;  3I73 A;  1I4P A;  3DEO A;  4OIK A;  1CTM A;  4DNR B;  3A56 A;  1EY6 A;  4ILW A;  4R8I A;  1SJE D;  5G3L F;  1BDO A;  1GXD C;  5JEA G;  4J8Q A;  2PW7 A;  4RHR A;  4KKU A;  4FXG C;  4DU9 A;  5C4H A;  1PTO F;  3TP8 A;  4HTH A;  3NE5 B;  3MAQ A;  1IHZ A;  1BXT A;  2XNA C;  3KUP A;  3D6W A;  1D5X C;  4ZK9 B;  1CK1 A;  4KTA A;  2R3Z A;  2B2V A;  2FJ2 A;  5BN4 A;  2K05 A;  5C5M A;  4G7H C;  1TY2 A;  3VR2 A;  2K6A A;  1C8C A;  1STA A;  1S5D D;  2B2Y C;  3S1R B;  1X3Q A;  3MC0 B;  4L6T B;  3DWA A;  1HUN A;  1S5F D;  2C9O A;  2A68 C;  5IT9 E;  5IOD A;  4IQZ A;  1O80 A;  4KN7 C;  4CKE A;  2VUM B;  3K7A B;  3PUZ A;  3LWE A;  1H9R A;  1CM9 A;  4HMJ A;  2JP1 A;  1Z6H A;  4Y7N B;  2F3W A;  3R2I A;  4UAI A;  5KNB A;  4DN4 M;  1EY9 A;  4FF1 A;  2J0T D;  3GO5 A;  1BOS A;  2L11 A;  2WKD A;  2EVB A;  5M3M B;  3FDT A;  3NBI A;  1Q8I A;  4B08 A;  3BVG A;  3PO3 B;  4RKB A;  1BQQ T;  4FF2 A;  1KLU D;  1PMR A;  5ELF A;  1A3V A;  2ZXP A;  5I9O A;  1D6E C;  2F0N A;  3QG1 A;  4HAE A;  2NVQ B;  4H44 C;  3D8G A;  2KCN A;  1HHV A;  2BDN A;  5K36 G;  4DK0 A;  2JA5 B;  3TP6 A;  4QUF A;  4LJZ C;  1XWE A;  3A7A B;  1LT4 D;  4X3K A;  3R2T A;  3SXH A;  3T56 B;  1CQF A;  2Z4H A;  2SNM A;  4DA2 A;  1U4L A;  2BDO A;  5JVH 3;  3VR3 A;  4J1M A;  2NZ1 D;  1GHK A;  1C48 A;  1HCZ A;  4K5W A;  3PV0 A;  1Z47 A;  3NWT A;  4HED A;  4EGV A;  2EYM A;  1MGS A;  3OSO A;  4KD4 A;  2E2I B;  3DWQ A;  2VXW A;  4P2C B;  4PV1 C;  2XRQ D;  4IFD G;  5LHY 1;  5D14 A;  4ZUJ A;  1B4O A;  2CVR A;  2NVX B;  3RUZ A;  3WDN A;  1F9R A;  1MD2 D;  1EYC A;  5E4W C;  2V4D A;  4U67 3;  1I6V C;  3AMU A;  3LNN A;  1FNW A;  2RKS A;  4HSP A;  1U9R A;  3L9A X;  1VMC A;  2RSN A;  1NR4 A;  5I4D A;  2QEJ C;  3Q6S A;  3TZU A;  1CA6 A;  2RQX A;  3PIO 3;  1FNV A;  4HN7 A;  2NVT B;  2VB2 X;  2PPB C;  4DXF A;  3N52 A;  4B9X A;  3EVQ A;  1EOT A;  2F0K A;  4BA1 I;  2K5D A;  4KN4 C;  2NTS A;  4NP5 A;  1CFM A;  1QNK A;  1Q90 A;  2LS0 1;  1LT5 D;  1EFI D;  1EWH A;  4C3J B;  3TP5 A;  1DOM A;  2CHB D;  4I7Z C;  3L3O C;  3K5L A;  1STY A;  4FP5 D;  2R7Z B;  2HQE A;  1TS5 A;  1I4X A;  5M5Y B;  1I50 B;  1PLF A;  1S5B D;  1JWU D;  3G6J B;  1DYQ A;  1R9T B;  1MSH A;  4GZY C;  1JR0 D;  1I3Q B;  5COY A;  2K5Q A;  5AFW A;  2EDG A;  4LAA A;  2BE5 D;  2NUC A;  4IUU A;  3NHH A;  3HOZ B;  2EXZ A;  1MI2 A;  2Z8L A;  4RH6 A;  3L7Z C;  4RAU C;  3PUY A;  2NWG A;  2CQA A;  4DFA A;  1SNC A;  1WTX A;  4C3J G;  1BO0 A;  2XSC A;  5K36 H;  1PRT C;  2G9H D;  4QB4 A;  3ZYY X;  4IUQ A;  1A2T A;  3BDC A;  4TRD A;  5I2Y A;  1DZ1 A;  1Y8N B;  3OW7 A;  2A5H A;  5JEA J;  3MXP A;  4RA8 A;  2E76 C;  2F3V A;  1T5X D;  1SNO A;  4LMQ D;  2FMC A;  1ET6 A;  1PRT D;  2A73 B;  1TR5 A;  4KV6 A;  2DY7 A;  3GTP B;  1SYD A;  2F0I A;  5FO7 B;  5COR A;  2HCC A;  3TME A;  1LTB D;  3CRL C;  3QB3 A;  1GUT A;  4UDU C;  4O42 A;  1UUP A;  1H9S A;  1TS3 A;  3FMC A;  1UEA B;  1RTO A;  1O7Z A;  2FFK B;  4EQO A;  1ZXT A;  1B44 D;  3P20 A;  3PIP 3;  3D3R A;  4NMZ A;  1A3T A;  3MWY W;  2F0M A;  4H7B A;  3URY A;  1SDF A;  3W2D A;  1AFP A;  1G29 1;  2KA7 A;  3MXU A;  3H09 A;  2IX3 A;  2KEE A;  1HUM A;  3EQL C;  4WRD A;  4MN3 A;  3J7A V;  1HTL D;  3C46 A;  1PDQ A;  1XYI A;  1AP0 A;  2F0T A;  2NN6 I;  3E0J A;  5I6Y A;  3BS1 A;  1F2L A;  3KK7 A;  2D2C C;  5BN3 A;  2X6G A;  3VR4 A;  5CV8 A;  4IFD H;  2R61 A;  1LTA D;  1ZYR D;  1D1I A;  5DM6 3;  5CYU A;  3RMH A;  1B3A A;  2EZV A;  1L0X B;  4BY1 B;  2QKI C;  1Z7T A;  5JEA H;  5IGC A;  1QG7 A;  4R8N A;  4EVO A;  4CJ1 B;  3P7J A;  1OXU A;  2F0L A;  2CW0 D;  1PTO H;  4CHT B;  5JVG 3;  4BA2 I;  3U9S A;  3KLR A;  2K7V A;  2VNU D;  3SK5 A;  3SK4 A;  1EY0 A;  5JJZ A;  2SDF A;  2EYP A;  1RDP D;  1O78 A;  2HUG A;  1SFO B;  4RCN A;  2L1B A;  1I6H B;  2PNR C;  5D65 A;  1KAA A;  1G6Z A;  1QOH A;  4C3I B;  5JPM C;  3U9O A;  4L63 B;  3PMF A;  5A2Q E;  2QF7 A;  4QF4 A;  4C3H B;  1JOR A;  1B9N A;  4KJN A;  3ND9 A;  5M9O A;  1SMY C;  1HXY D;  3RZO B;  1WD1 A;  1KDA A;  5FO9 B;  5HUR A;  5FOB B;  3Q22 A;  5EBD A;  2XWB B;  3M7G A;  1LT3 D;  1E0B A;  3NUC A;  5EKI A;  5DAU A;  4PMW A;  3S1Q B;  1GHJ A;  3HGB A;  4DGZ A;  3I70 A;  3R8B A;  1DM0 B;  1SBB B;  4WFN 3;  3S9W A;  3HOW B;  3KBX A;  2IX1 A;  5J22 A;  3HKZ B;  2PMZ B;  5I9P A;  5FLX L;  1PFB A;  5T1G A;  1GJX A;  3S14 B;  3Q23 A;  3NBH A;  5CV7 A;  3S16 B;  3DEP A;  1WTR A;  1ENA A;  1Q1E A;  1WTO A;  5F2D A;  4K14 A;  4G57 A;  3QJY A;  3BDO A;  1OO9 B;  2VB3 X;  3OMC A;  3EA6 A;  4CJ0 B;  4X3S A;  4E6I A;  1K8O A;  4O1N A;  3TDQ A;  3SK6 A;  4A93 B;  2TMP A;  3ND8 A;  2O4X A;  3TZD A;  2MGS A;  3HP3 A;  3NWS A;  2KCC A;  1F2M A;  1D5M C;  3PUV A;  2K32 A;  4H13 C;  1SYB A;  4FNF A;  1SE2 A;  2DY8 A;  4FXK C;  5C3X A;  5LL6 X;  1ML0 D;  3I4M B;  4JBW A;  1SEB D;  1I4R A;  2FIN B;  4RHS A;  1STB A;  2E2J B;  2HDM A;  3DMU A;  2C5C A;  2B2U C;  5T1I A;  4I65 A;  4K2L A;  1BBX C;  1IKM A;  3V05 A;  2SNS A;  3HOX B;  4S3S A;  2AUJ D;  2BA1 A;  1TY0 A;  2DNC A;  3Q24 A;  3GTJ B;  5EKL A;  1BR9 A;  4C1N I;  1UAP A;  2F0W A;  5CGK A;  2KED A;  2EJG C;  5C5L A;  3HG9 A;  3J80 E;  2NTT A;  3OWE B;  3KF8 A;  2E74 C;  1TWG B;  3HRZ C;  1Y1W B;  5C0X I;  4WOR A;  1DXM A;  3OIP A;  2NVY B;  1VMP A;  2XWJ B;  4YIJ A;  1JCK B;  3RLF A;  4QUC A;  4TKO B;  3E6Z X;  1J8I A;  2M9V A;  4RGT A;  1XX8 A;  4WJW A;  4ZRZ A;  1FGB D;  4KMU C;  5JPN C;  4G7Z C;  3I91 A;  4DAY A;  1JQY D;  3S2H B;  1QCB D;  3VYR A;  4KJO A;  1X32 A;  2A6H D;  1LAC A;  3I90 A;  4A3J B;  4ZYS A;  4MIU A;  3BG3 A;  1TS4 A;  2KQ3 A;  2OEO A;  2R92 B;  2EYH A;  5M5X B;  4QIW B;  4OO1 G;  1H9J A;  1PXU A;  4ZQ3 A;  1HFG A;  1SYE A;  1H9K A;  3J7A F;  3P1H A;  4A3B B;  3BYT B;  2EYJ A;  3A8J E;  2XVS A;  3N6R A;  4IZ8 A;  3OHX C;  1EY8 A;  4U68 A;  3SDZ A;  2WKC A;  3NXW A;  2F03 A;  3C2P A;  4DAV A;  2NN6 H;  5IGF A;  4KKT A;  2AUK A;  4NKL A;  1MBY A;  5HGT A;  1UNS A;  3LX0 A;  1TQO A;  1CHQ D;  3M7N A;  2F0J A;  4N9P A;  2B8G A;  4QCL A;  3CKI B;  2YYZ A;  3DUZ A;  1CT1 D;  1KNA A;  2PO4 A;  1STG A;  5KYL A;  4XTC S;  5J1Z A;  2IL8 A;  5E4X A;  2F0E A;  3I4L A;  1OXT A;  1QJO A;  2G9D A;  4ZAI A;  2I46 A;  3V96 A;  2F0D A;  3I4N B;  3T4A C;  2M00 A;  1TWC B;  2ZT9 C;  5C3E B;  3EFX D;  3W3A A;  1L0Y B;  3NTK A;  3X3M A;  2F0O A;  5J39 A;  2KOL A;  3QO2 A;  4CJ2 C;  3D4W A;  3OIQ A;  2JE6 I;  2PW5 A;  1W6K A;  1TS2 A;  1K8M A;  5ELC A;  4IFD I;  3H91 A;  1I4G A;  1PTO C;  2IT1 A;  3G7L A;  1B2T A;  3HOV B;  3MFY A;  1V1P A;  4K2K A;  1BNZ A;  1RHP A;  3ITP A;  1LV9 A;  5D3D A;  1A15 A;  1E2V A;  2GA4 B;  1HRJ A;  3GTO B;  1CZW A;  2B2W C;  4CBV A;  2LFN A;  3J81 L;  5CMD A;  5CV9 A;  5KIX A;  4R9W A;  2O5I C;  3M4O B;  2RDH A;  4LK1 C;  2B39 A;  1VCI A;  1DJR D;  1IKL A;  3K5M A;  2EY1 A;  1IYV A;  3D4R A;  3VR5 A;  2E75 C;  2ICI A;  3MZ5 A;  1WTP A;  2Z4I A;  1BF4 A;  1F2Z A;  2MP1 A;  3D4D A;  4ODG A;  1RJT A;  4RGN A;  4OL7 A;  2ZXO A;  2A68 D;  2JXM B;  2XRS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...