2B2UC

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uC00
1RJTA 2B2UA 3MWYW 5DNFA 5EKIA 4ZAIA 3GV6A 4XDXA 1WTPA 1J8IA 4CJ1B 1DZ1A 3KBXA 1PFBA 5EPKA 1HHVA 3F2UA 4LMQD 1NCVA 1VMCA 4IURA 5T1IA 1CA6A 5EQ0A 1WD0A 2MP1A 2JYOA 1BO0A 3TZDA 2HUGA 5CMDA 3I90A 4IUTA 1HFGA 1U4RA 2D9UA 2NZ1D 2Q8TA 3TN2A 2RA4A 4QUFA 1XYIA 2K28A 2VXWA 1IL8A 2K04A 1EL0A 3P7JA 5E4XA 1DOLA 5AFWA 4MHEA 1MGSA 1F9SA 1RODA 2K03A 4X3SA 1HUNA 2KVMA 4IUVA 4CJ2C 2NYZD 3HP3A 2MGSA 4QUCA 1NR2A 4RAUC 4UAIA 1HRJA 3DM1A 1WTVA 1EIHA 5CBEE 2KOLA 2HDLA 5EPLA 2B2WA 2R3ZA 2H1EA 4R9WA 3SVMA 1WD1A 4IUQA 2RVLA 1NR4A 2DY8A 2EE1A 4DN4M 1U4PA 1WVLA 2K05A 2NWGA 3I3CA 1X3PA 4HSVA 4OIJA 2KEEA 3G7LA 1VMPA 1KNEA 1O7ZA 2L9HA 1BBXC 2FJ2A 1HA6A 2M2LA 4X3UA 1SSOA 1B3AA 3LWEA 2SDFA 1EQTA 2K1BA 1MSGA 1XX8A 1S4ZA 1G2SA 2X69A 1BNZA 1AZPA 1RTNA 1B2TA 2B2UC 3GV3A 5CBAE 1GUWA 2IL8A 2DY7A 4IUPA 1G2TA 1IKMA 2KECA 2RSNA 2L12A 4ZK9B 5JJZA 4R8IA 4RA8A 1ZXTA 2FINB 5T1GA 1QG7A 2CVRA 2FFKB 1A15A 2L11A 2KEDA 1IKLA 1SDFA 1EIGA 2L1BA 2HDMA 4ZKCB 1EOTA 2XIWA 2B2VA 3QO2A 1ILQA 1KNAA 1O80A 1QNKA 2HCIA 1PFMA 2FMMA 2X6GA 4HEDA 5E4WC 5EPJA 4ZLTF 1MI2A 1F9RA 1X3QA 1B50A 3R93A 1C8CA 1LV9A 4HCSA 4NW2A 4OIKA 3ONAB 3I91A 1WTQA 1NAPA 2KUMA 1G6ZA 2B2WC 5D14A 2FHTA 3FPUB 1J9OA 1O7YA 1JICA 1PLFA 1Q3LA 1U4MA 1PDQA 4O42A 2B2TA 1WTXA 1RHPA 4XT1B 2N55A 1DONA 3DEOA 1JE4A 4RWSC 5EJWA 4ZKBB 4XT3B 1WTOA 2EPBA 2RSOA 3DEPA 2B2YA 1ILPA 1PFNA 4U68A 1X32A 1SAPA 2J7ZA 4X3TA 1ESRA 1DOMA 1HUMA 1U4LA 3D6WA 3Q6SA 2K01A 5CORA 4IUUA 3UI2A 1ICWA 3KUPA 1HFNA 2B2TC 2JP1A 2X6LA 1BF4A 1AZQA 1QE6A 3MTSA 2MJ8A 2MPMA 4X3KA 1DOKA 1B53A 2B2YC 3I8ZA 1B4OA 2BDNA 1CA5A 1G91A 2Q8RE 1M8AA 3IL8A 2B2VC 5D65A 1WTWA 2HCCA 3FDTA 4HAEA 1AP0A 1ML0D 4CJ0B 1F9QA 2N88A 1MSHA 1F9PA 4MN3A 1RTOA 1TVXA 1F2LA 2L4NA 1WTRA 1E0BA 3N52A 3IFDA 2EOTA 5COYA 1CM9A 3H91A
chains in the Genus database with same CATH superfamily
5EKIA 1DZ1A 1ESFA 3OWFA 3K81C 1VMCA 5KGUA 1A2TA 1K8OA 4ZUIA 2JA8B 2QDLA 2PMZB 3EBEA 2A68C 4JYAL 3DMUA 1LT3D 2Z9HA 3RUZA 3M7NA 1EIHA 2IPKD 2MNAA 2E75C 2R7ZB 4YWLA 2F52A 1C7YA 3HG9A 4BY7H 4JW0A 2EE1A 3HKZE 2K05A 2QILA 3I3CA 2UXBQ 3UDXA 1LT5D 4OIJA 3MXUA 1W6KA 5J22A 4GOPA 3VR5A 4HIKA 2B63G 5C44B 2HHHL 2YTXA 2IL8A 4IUPA 3K5MA 2PW7A 3EQLC 3K5NA 1N33L 5TSSA 3M4PA 3T1HQ 1S5CD 2SNSA 1EYGA 1BVSA 4EQPA 5C4ZA 1G6PA 1E2ZA 3I4NB 3CPFA 3J80E 4G57A 1QVFA 1YHAA 1F2YA 4PNYA 4JI4Q 1TWAB 4OIKA 3TZUA 4A3EH 5D14A 4EQOA 4CGYB 1O7YA 3VR4A 1LTLA 4KHVA 3DEOA 3H09A 3NE5B 4ZQ3A 2O5IC 5IYDH 3W1BA 4KV6A 5KIXA 2AQ3B 1YNND 1E24A 4P72A 1WCMG 2AKWB 1SAPA 3J7AF 5D3IB 1V8QA 3KJPA 1K8AC 3FMCA 3KUPA 5KEEA 1KXLA 2V1CC 4DAMA 4O0AA 4GNXA 3TP6A 3SGIA 4LUVA 2QEXA 3NTHA 4RMFA 4UP8A 3I4NH 2NVQB 1GUGA 2EDGA 1CUKA 4UY8C 1JOKA 1Y1VG 1TWHH 4KD4A 4EVOA 3T1YL 4K0KQ 4ULLA 2JA6H 2XWBB 1CT1D 4HJ8A 2E2JH 3HOUG 5ELOA 1KC8C 4QJFA 3AYHB 4DUYL 2E2IH 3SR1A 1ENCA 5A2QL 5FLMG 1L2FA 2JA9A 2JA5B 4H13C 1BBWA 3LWUA 4DV3Q 5JAVA 2A6HD 1XNQQ 3ERQA 2A6EC 3Q22A 3GTOB 4IALA 2QGQA 1DCZA 2RCFA 3HP3A 2MGSA 2UUAL 1PH1A 4GN3B 4HJ9A 2L15A 4LF9L 1YJNA 2K7VA 2NVQH 5FO7B 5ELBA 1K83B 2RVLA 2WAQG 4XYOA 2VZAA 2Q8IB 5IT9E 1WVLA 1ENFA 4X65Q 5JEAH 4WRDA 3G7LA 3S24A 2L55A 2FJ2A 3H15A 4NXMQ 4HMIA 3J80i 1XJVA 2I5HA 4A3DG 1M90C 2OCEA 1Y1WG 3DWQA 2YTVA 4DXGA 2CHBD 2EJGC 2RKSA 4OEMB 2L12A 2BDOA 3CU7A 4RA8A 5C0XG 1HCZA 2K5DA 2F4VQ 4LF5Q 2EY5A 1SE3A 1EOTA 3BYTB 4BA1I 4E6IA 2UXCL 3BDOA 4YY3Q 1VQ7A 2LXKA 2N8NA 5E1FA 1DYQA 1J5EL 5FOBB 2LY7A 4C3JH 3H94A 3I73A 1Y8NB 3BDLA 2F0NA 4O2DA 4A3MH 4LFBL 4YIJA 1Q12A 5IYBH 1U4MA 3GD7A 1R4QB 2F3WA 3PIO3 4P2CB 2QCPX 4RWSC 4LUOA 1IBMQ 4N8FA 4OO1G 1K8MA 2UUBQ 3BVGA 4KMUC 4A3BH 4DV4L 3D6WA 1P16A 2C5CA 3PV0A 2JP1A 3K0XA 3CCMA 4DV6L 2CQAA 4NKLA 2E2HB 3CCJA 3K59A 4A3CG 5G3LF 1JQYD 2B2VC 5GROA 1QNUA 4A3EG 3FDTA 2K52A 1PH7A 2VB2X 1TXYA 3KF8B 3M7GA 4JI0L 1II3A 5M3MG 5ELEA 1CSPA 4R4IA 1VQFA 2B2UA 2F0FA 3KBGA 4HIDA 1U5KA 2BE5C 1STBA 4KY6A 4JI3Q 4P75A 3RR5A 4GLVB 1BO0A 4H7BA 1AFPA 3CD6A 1IZ6A 5C3EH 4ODGA 3TN2A 1VDZA 1N32L 3UDFA 1SYFA 1SRUA 1SBBB 1RIPA 4LF6L 1PH4A 3HKZB 1LYLA 4Q0FA 1MD2D 3S1MH 3MXNB 4G7OC 2RDHA 3CP0A 2XVSA 4OX9Q 4ALPA 2JA6G 1PTOC 2NUCA 4C3IG 3J7A5 4KY5A 4XYQA 4A3FB 2UUCQ 2TSSA 1GD7A 1HR0W 5KNBA 1BQQT 1B3AA 4IFDJ 2A69D 3S2DH 2K1BA 2KHSA 1FVIA 4FF3A 5LL6S 5M5WH 2DJFC 2QDBA 4WFN3 3A5UA 2J4XA 1ZXTA 1KTKA 3TS0A 2SOBA 1SMYD 4TRDA 1EIGA 3A7AB 4A4IA 3PO2B 3QO2A 1KNAA 3EA6A 2GVAA 3M4OH 1E7ZA 1MI2A 1V43A 3MVVA 2VUMB 2EYJA 2Q2TA 1LV9A 3PUZA 2F0JA 1ICFB 3P20A 1V1OA 2PQAB 2VY3A 4LFAQ 1HNXL 3GP7A 1QVGA 2I5MX 3CRLC 3IKJA 4A3JG 3B6YA 4HN7A 3E3XA 4QB4A 4JK1C 3GTGB 1PTOF 4RCNA 3OW2A 3NK9A 4YCVA 3QG1A 2DJGC 3HOYB 1STAA 1P8LA 2Y0SG 4CHTB 4A93G 3FKIH 4X3KA 5CV6A 1PH6A 1B4OA 1GOZA 3J81j 4A3MG 1G91A 2HQLA 1X9NA 5M9OA 3AFQA 2VUMH 1ZKOA 4N9TA 4CDDC 1KDBA 5C4JB 5KYLA 1X65A 5IYBG 3W5OA 4DR3L 4JI2L 1RTOA 4B3SL 3V05A 4NXNQ 2EOTA 3X3NA 3H91A 5JVG3 2HD3A 3OHXC 5LMNL 4H44C 4DV2Q 4JV5Q 5IGEA 3DWAA 1PTOB 4JPBW 4APVA 4FP5D 1PZJD 2F0OA 3NWSA 1HFGA 2VXWA 1EFID 5E4XA 1OXVA 4MHEA 3SHLA 2K03A 2XGTA 1I5FA 1UEAB 3S2HH 2ICEC 1CZWA 2E5LQ 4J1MA 3W2DA 1WD1A 2EYHA 2ZM6Q 3E0JA 1U4PA 2NZOA 3H3VH 1A3TA 2F0WA 5FJ8G 1LM0A 5C4XG 1VQ5A 1AE3A 4HJ7A 3OYYA 2SDFA 3FHWA 1D1KA 3GV3A 5C3EG 3P75A 4WORA 1XXGA 1BCPB 1I50B 4IUNA 3PIOA 4DV5Q 4QY7A 1EIYB 3HOZH 4DV1Q 1RD9D 4J8QA 4R4QA 2E76C 2JA7H 5CV4A 1JOOA 3UDIA 2HCIA 3TDQA 1E2VA 1LT4D 2FMMA 4ZLTF 3S1NB 1SE8A 5M3FG 4IOAA 1V9PA 2BA0A 3PUWA 5K36G 3D31A 1L0YB 1KLGD 1NAPA 1NMFA 1G6ZA 3A55A 3MHBA 1XPRA 3F2CA 3GDEA 2ENBA 4BBSH 5IYCH 3I2ZA 1D5ZC 2EPBA 2AWOA 2OT2A 2KCNA 1ASZA 1VQBA 3Q6SA 1JCKB 1M4VA 5JJIA 5IODA 1I50H 2B2TC 4AQYL 2ZXOA 1PYBA 1QE6A 1F2ZA 2EQSA 3NPPA 3VA5A 2Z1CA 4CKCA 4OONA 1GKHA 1H9JA 1F9QA 3OSOA 3C1EA 4CJ0B 1SJED 3BVZA 3PMFA 3TBIB 4UP9A 2RDFA 2UXDL 5T1IA 2CH4W 3CCRA 1I94Q 3ICEA 1VCIA 3K0YA 5CMDA 1EQRA 4JI5L 2D9UA 2Q8TA 3D4RA 2K14A 2PZTA 1EL0A 3FKIG 4L63B 1HUNA 4K8JA 4K6DA 2JJQA 3CQZB 3DXJC 1TWFB 3CCUA 3RLNA 3BU2A 4DR6Q 2A1AA 3R3OA 4IUQA 3VYUA 3ZYYX 1I4RA 2PZWA 1C4QA 1D6EC 2KEEA 2A6HC 2GN5A 3MXNA 2B63H 1SSOA 2XWJB 4TQUS 1WCMB 4PQXA 4ME3A 1A62A 4JVZA 1RTNA 2B2UC 3G71A 3VYRA 3AFPA 1XNRQ 1TY2A 1IBLQ 4FVMA 1FGBD 3E5SA 5CV5A 3NEMA 1SDFA 1OXXK 3BZKA 2NVTH 4R4TA 1Y1VB 1IYJB 3HGBA 2WB1G 1I6HH 4JI6Q 1N36Q 2Y0SE 2AWNA 4K5XA 4FNFA 4O1NA 3CQZH 3PIP3 4RHRA 3AB9A 3S9WA 5M5YH 2PPBC 3QR8A 3S1QB 1JJ2A 1H9MA 3HOUB 2EVBA 1DONA 4DV7L 1FNVA 1BCPD 2PQAA 2QW7A 3A7LA 3NWTA 2C9OA 3VR3A 4L5SA 1YI2A 4M8AA 1DOMA 1SJHD 1ICWA 5AJ3L 1YJWA 4Z9CB 2AQ1B 1BF4A 1SYDA 3HOWB 3BG3A 1D5XC 1C9OA 3H0GG 3I8ZA 2QF7A 2DNEA 2KBNA 1Y1VH 5JJKA 4X64Q 2NVXH 3G6JB 2WV6D 3E0EA 4LK1C 1SNDA 4KN4C 1HJPA 1IBKQ 2F0TA 4MN3A 4I7AA 1VQGA 5IYCG 2F0GA 4DV0L 3PF4A 4A3DB 3UDGA 3IFDA 4BWGB 3GV6A 5C4HA 4F7XA 1BDOA 3QOLA 5J39A 1J6QA 1I3QH 2I5LX 4LF8L 3GO5A 5IWAQ 2JYOA 3FP9A 4IUTA 2RBMA 2RA4A 4LFCQ 3CMAA 4OGQC 3PUVA 5DLQE 3D6CA 4BY7B 2L5TA 1VQAA 1PMRA 4OXPA 1RF2D 4KD3A 1VQ9A 1SYEA 1QZGA 4PMCA 1S3OA 4DR7L 1S72A 5IGGA 5EPLA 3MXGA 1HA5A 3KJOA 4V190 4QIWE 1SE2A 2VQEL 4HSVA 3VR6A 4P74A 4IPCA 1SNCA 4A3DH 1M1KC 3J7ZC 1LTID 5IY0A 1Y1WH 1MSGA 4X66Q 1RDPD 4CKEA 5KYIA 4DPGA 1STYA 1EYCA 4KHPQ 3NBIA 4BY1H 1GJXA 1MBYA 2K50A 1Z6HA 2DY7A 2H5XA 3V96A 1IKMA 1G2TA 4HSPA 5IT9L 5C0XH 4R8IA 4JI1L 1YNJD 1PZID 2CVRA 5GAHC 4LF4L 2L1BA 1BUVT 3E9IA 4WJ3M 4N8X1 1IXRA 4A3EB 1O80A 1ILQA 1Q82C 4HJAA 4IN3A 3AMUA 2A69C 3OTOL 1SXTA 2UU9L 1QUQB 1HR0L 1VQEA 3I4LA 2RHQB 2EXZA 4GKJL 2KCTA 4YY3L 2LS01 2IW3A 3JAMc 4OO1H 2R61A 3SK6A 2LSSA 3DWPA 2LFNA 2MQHA 4KJNA 1GHKA 4IFDI 1KDAA 1LTGD 3R2TA 1ESRA 2EYOA 1W2BA 4N9PA 5CORA 3MEHA 4JI7L 4DR5Q 2NN6H 3DHQA 1TWHB 1K73C 1AZQA 1NUCA 2XNAC 3Q23A 4NP5A 4A3CH 1IBML 2B2YC 2JA6B 4C3IB 2HCCA 1NMGA 1K3RA 3RZOH 2B29A 4EGVA 1UWVA 4KN7C 5CV8A 1H9KA 2N88A 1I6VC 2E2JB 1YBYA 3DM3A 5M3MH 2E2IB 3SK8A 2PZUA 1HNWL 1ZYRD 4C3HG 3PO3G 3UE0A 1UUPA 1LO5D 2KHIA 4XDXA 1UE6A 3A5ZB 4LNQA 4B3TL 1LUZA 5JJLA 1PXUA 2BCOA 1HHVA 2HIXA 2R92G 4DK6C 3S1RH 2HUGA 4M1UB 1PH2A 3KLWA 4IOCA 1O78A 1T9HA 3PCOB 1YNXA 1I4QA 3J7YW 1T5XD 1F9SA 1RODA 2KHJA 2KVMA 3NQTA 4AH6A 1PYWD 4UAIA 4JI3L 2IY5B 5CGKA 3DM1A 1S40A 3RLOA 2VQFQ 2H1EA 3SVMA 3L9AX 1N34Q 4C3IH 4X62Q 3M85A 3U50C 4IPGA 3AEVA 3HKSA 4J15A 4A3JB 1PZKD 5JEAJ 3NHHA 1NY4A 1QWYA 3PIPA 3OWEB 1FJGQ 3K7AH 4RGOS 4YCUA 4DUZL 4OX9L 2RSNA 5JJZA 1HNZQ 4GZYC 3SK5A 2Y0SB 4A93B 2VL6A 4C3JB 1IKLA 4JOIA 4A3MB 3BYYB 5KNDA 5E4WC 2CQOA 2ALYB 1X6OA 2I46A 1X3QA 2F3IA 2ATWA 5M5XB 1IW7C 2QEJC 1CKOA 1CHQD 1T5EA 2KCMA 1GHJA 5GAEC 1QJOA 1E1TA 2KUMA 2HQEA 4RG1A 1FNUA 1LT6D 1NNXA 1XMQL 4A3BB 5ELCA 1Q3LA 4IZ8A 2EYPA 2B2TA 4QQBX 4A3JH 4XT1B 1SE4A 2TMPA 3NTIA 2D2CC 4BY1G 5NUCA 1EWHA 4FYDA 3DEPA 1D5MC 4B3RL 2AUJD 2R93G 3CCLA 3NENA 1STNA 1JC7A 2VB3X 3HOVH 3L3OC 3D3RA 5FKAC 2DNCA 1D2BA 4A93H 4K5VA 3RNUA 5EBDA 3URYA 2Q8RE 2PW5A 5M5XH 5C4XB 1TS3A 3U4ZA 4UPAA 1L1OC 4ZYSA 3CHBD 2HHHQ 1Q7YC 5AFWA 5C3EB 1AE2A 3X3MA 1VQLA 1N33Q 4XQJA 3WWVA 5IGFA 4ABNA 5FO9B 5EQ0A 1L0WA 4KKUA 1HZAA 3KF6B 2CCZA 3ND8A 3E6ZX 2NN6G 1U4RA 2JEBI 3QJYA 4R1JA 2O4XA 4B08A 2NZHA 1K0SA 3S1MB 3P7JA 2ZXRA 1I4HA 5M3FB 2PNRC 4QIWB 2K6AA 4DK0A 4H0LC 4HCEA 2Q2IA 4RCOA 3FEWX 3DLLA 4LF7L 2AQ2B 2Z4HA 2JQOA 2JA8G 1PVOA 3C46A 3S2DB 5JVH3 3GTLH 4DN4M 5FJ8H 3IFTA 4DKAC 4POFA 5C4XH 4Y7NH 4DR2Q 2YU9H 5M5WB 1RL2A 2L9HA 5DM63 2YTYA 3CF5A 1LLRD 1K9MC 2R7ZG 2YV5A 1HZBA 3GTMB 1QOHA 3RZDB 1X3GA 3M4OB 1S5DD 1ENAA 1SFOB 3GTPH 4A3GG 1QG7A 1I4XA 5ELFA 2CWPA 1WOCA 2R7DA 4CBVA 2CW0D 5C44G 4DU9A 5M3FH 1PFMA 3NBHB 3T1YQ 4K6LA 4JBWA 1XPOA 5K36H 1EWCA 2K4KA 3PQIA 4CDEC 2A5HA 2A73B 4DV5L 1U9RA 3AQQA 2D5DA 1HQMC 1STEA 5HURA 1EQVA 4A75A 1G51A 4RH6A 4DUYQ 3TS2A 5HY6A 1QUQA 1YHQA 2Z6BA 5BR8L 4PMWA 4DK1A 1DGSA 3C3LA 1JE4A 3G6EA 5EBCA 4KY7A 3TP7A 1HTLD 1A2UA 1L1OB 1PFNA 3FKIB 3GTMH 3S16H 5I2YA 4NB3A 3RZDH 2UUAQ 2HIVA 3LGJA 3K57A 4LF9Q 1SFOH 3VYTA 1VQOA 1EYAA 1SMXA 1B9MA 4DR1L 4JI8Q 1TY0A 5HGTA 5FLXc 1I4PA 1JJCB 1BCPC 1YITA 1EUJA 1E1OA 4FXDA 1F9PA 2FMCA 1R9TH 1WTRA 1VQKA 1IYVA 3J81c 3CMEA 1DD2A 4DNIA 4G7ZC 2ZJQA 1KAAA 1OXSC 1XMOL 3KYHC 1FGUA 1B44D 3SK4A 4CDFC 4IURA 4JBMA 3C1FA 1HXYD 1YIJA 3HOVG 2UXCQ 3S2HB 1J5EQ 1IL8A 4UHVA 1LTRD 1TWCB 2F1MA 4LFBQ 3STBD 3ULLA 1MKHA 3PSIA 1NR2A 2JN4A 2WFWA 2G9DA 2JA5G 3KLRA 2WAQE 2ZJPA 1I94L 2VNUD 1NJIC 4K5WA 4R8NA 4FF1A 1DJRD 2K5NA 2F0QA 1VMPA 1Y8OB 1O7ZA 4DV4Q 3HOZB 1BCPF 2JA7B 1AZPA 4RGMA 4DV6Q 3RN5A 1SROA 4LWCA 5K5PA 4DNRB 3TMEA 5CV9A 4QGUA 2IT1A 2I07B 2K5HA 1XTCD 4K14A 4HJ5A 4C1NK 5GADC 1QNKA 2Z4IA 1E22A 1B3QA 1EEID 1TWCH 3PUXA 4JI0Q 3I7FA 1JWMD 4BBSB 2LXJA 4EQ5A 1C48A 4HCSA 2NVYH 1XNRL 1LTAD 2F0DA 2LMCB 1AN8A 1IBLL 4J6HA 1JE5A 3ONAB 3CRKC 2B39A 5DM73 4MNOA 1YNJC 1UE7A 1VQMA 2IJ0A 3S15H 1STHA 2A6ED 4ZKBB 1NTGA 1N36L 1MJEA 1N32Q 4YWKA 2B2YA 1X32A 1UEBA 5LMUL 1U4LA 3KLSX 4LF6Q 1EY5A 2CKZB 1CSQA 1I4GA 2KQ3A 1XPUA 3GTQH 3H0GH 1EY6A 4K2KA 4JOIC 1H9SB 2BDNA 3CXCA 1O7LA 5D65A 3KLSA 4MTNA 1OTCA 2A19A 1TS4A 2F0LA 1ML0D 4RHSA 2WACA 3TP5A 3MFYA 1EZ8A 1H95A 1E0BA 2OEOA 1PRTB 1RJTA 2QA4A 4DR4Q 4X64L 2VS1A 1CZGA 2KENA 5JPMC 2KCCA 3CCSA 3K80C 3OOCA 4JG2A 3I70A 3ERSX 5E3FA 2OTJA 2OXPA 5GQOA 3K7UC 1GUTA 4PV1C 4CKBA 1Q8IA 3KF6A 4CJ2C 1QZHA 4RAUC 2ES2A 1YNNC 2F0EA 2JE6I 4XTCS 5IWAL 2B63B 4EQNA 4A3IH 1A3VA 4AYBG 4DAYB 4LFCL 1WFQA 3KF8A 4GLXA 1KRTA 1EEFD 3A0JA 2MO0A 3HKZG 2AHOB 3I72A 1JOQA 1VQ8A 5IIFA 4X6AH 1TU2B 1A6XA 1D7QA 2AMCB 4EX5A 3JAME 1FYCA 2XRQD 2NVTB 2KECA 1I6HB 4ZUJA 3M3YH 2OTLA 2FFKB 1A15A 4GNXB 1BR9A 1W6JA 2ICIA 1EIFA 2XIWA 4RGTA 5M5YB 1EY0A 5EPJA 2X6GA 4DR3Q 4JI2Q 4JBJA 5CYUA 4B3SQ 5KRUA 2BE5D 3VDYA 4C2MH 4C3HB 2LKVA 3NBHA 4GKKQ 3I55A 5LHY1 4OWTB 3MA2B 4O42A 2P5ZX 1WTXA 5IP9G 1CKMA 1NBWA 3MZ5A 3CC7A 2UXBL 3QOJA 3M4QA 1MJCA 2J7ZA 3MXPA 1HUMA 3EJIA 3UI2A 1WI5A 3A8IE 2PCFB 4S3SA 4WJ4A 1PH5A 2NVXB 2AUKA 1L1OA 2WIIB 3MAQA 3PF5A 2EJFC 2Z0SA 3T1HL 1RCVD 3G48A 2HT1A 4HAEA 3GTKB 2DUDA 2N3SA 1AP0A 5LL6X 3HOYG 1WYDA 2XN9C 1I3QB 4C3HH 4GLAC 1RKNA 2N78A 1N9WA 3PO3H 2V4DA 1CM9A 1NSNS 2K75A 3MWYW 1WTPA 5DNFA 4JI4L 1JORA 2PO4A 2F0UA 1F77A 2R92H 1TWGH 1NCVA 1VS0A 4ZCKA 1CA6A 3U9OA 1K8GA 1ET6A 3I90A 1E2WA 4P73A 3D0FA 2EYLA 2WAQB 1KL9A 5EAYA 3KFUA 1MGSA 1V1QA 3T4AC 4DF7A 1CFMA 4IJHA 1STGA 1OXUA 2PI2E 2F4IA 3JAMi 4PZ7A 3O13A 1Y1WB 1G291 2DY8A 5IP7G 3GTKH 1PRTD 2XSCA 3EN2A 5BN4A 4BY1B 2SNMA 1EQQA 3F2DA 1WTHA 3FPPA 1AEXA 1IHZA 4X3UA 3D4WA 1EOVA 5C3XA 1UAPA 1S4ZA 2X69A 2NB0A 4K0KL 4DNTB 3G4SA 3U4VA 5C6AA 1N34L 1HH2P 2JK8A 1BBUA 2Z8LA 2XTIA 5C0XJ 2HDMA 3L0OA 3KOJA 3TQYA 3C2PA 5FLXL 4A76A 4DV3L 2ZJRA 1R4PB 4NDXA 4A3IG 4Q5VA 2D62A 3R93A 2G5DA 4KI0A 1XNQL 1EFWA 2F3VA 1Y14B 2H4OA 3I91A 1Q90A 1KABA 2UXDQ 2OQ0A 4R4CA 1EU3A 1JR0D 2RF4A 5I6WA 1HZCA 3TP8A 4FDBA 2CW0C 4XT3B 4X65L 5CC4A 5GAGC 2R93H 4U68A 2K5WA 4NXML 3TREA 5C3WA 2RCNA 4KLKA 4B3MQ 3ND9A 3Q24A 1JMCA 3RZOB 1GUNA 4JC0A 3RMHA 4BA2I 4I65A 5M3MB 3FVQA 4PMBA 4YHHQ 2RHSB 1FD7D 4TKOB 2F4VL 4LF5L 4ME5A 3EFXD 3BJUA 1CHPD 1Q1BA 4HR7B 3U9SA 4IO9A 2B3GA 1SMYC 1UNSA 1H9SA 1TQOA 3N6RA 4GN5A 1VQPA 3S17H 4YWMA 4AYBE 4LJZC 4FO2A 3N52A 3S1RB 4H02A 3HOXG 3Q8DA 1J8IA 3CCVA 4ZRZA 4CJ1B 5IE8A 1PFBA 2K32A 3I4MH 1SR3A 4L8JA 1AW7A 4A3GB 1WD0A 4BBRH 1WJJA 3OIPA 1CKNB 1D1IA 2F0HA 2Q2UA 2D0PA 3TSSA 2UUBL 1HZ9A 4QUCA 5FO8B 3WOEA 3BZDB 1JB3A 1XTDA 4A3LG 2JA8H 4CDCC 1TIID 2B2WA 3K6OA 1TKWB 3MFGA 1IYUA 3BVMA 4DV7Q 3K7AB 4L5RC 1Z7TA 4AIMA 1OXTA 1SYCA 1HA6A 4OELB 2R7ZH 4DAYA 5ELDA 5AJ3Q 1LTSD 3STBC 1B2TA 2EXDA 2JXMB 3VA7A 1UE1A 1NE3A 4DAVA 2BA1A 1CI3M 2SEBD 3A54A 4A3GH 1KAWA 4ZK9B 3V2TA 2FINB 4DR2L 4A3KG 1JJGA 5C44H 1VQ6A 1B70B 2WB1E 5KNCA 3RN2A 2ZTDA 1YVCA 4QL5A 4DV0Q 2C35B 1Q46A 2EJMA 5CR3A 2F0SA 4L5TA 2KJXA 5FLXE 4LF8Q 2RQXA 1JICA 1PLFA 1KIXA 3ZJYC 2MFIA 4ILWA 1TWAH 3H3VI 3HOVB 2UUCL 1LABA 3J81E 3CPWA 4IPDA 1K28A 4X3TA 2PNHA 4G4KA 2K33A 3SE0A 4IUUA 1U0LA 4DR7Q 1ET9A 1QB5D 2ZXPA 5CV7A 2X6LA 3A74A 4BXXG 1X55A 5I2XA 2MJ8A 5I9OA 1Y8PB 4UDUC 2VQEQ 1PH8A 1CA5A 4MIUA 3T51B 4DFAA 1B9NA 4RFBA 3D8GA 3MC0B 5E7NA 1MSHA 2BH2A 3HOWG 4JBKA 3F1ZA 4NPSA 3Q0AA 2NBFA 3TEHB 4JYAQ 4JI8L 5FK9C 4JI1Q 5EPKA 2RDGA 4LFAL 3F2UA 5I9PA 4LF4Q 3D4DA 2YYZA 2GA4B 2O5JC 1VQNA 3OTOQ 2UU9Q 3GTLB 1HR0Q 4RKLA 4Y52H 3HS0C 1EY9A 1JB7A 3BDCA 4Y7NB 2JA5H 4C1NI 2YU9B 2ASBA 4GKJQ 3W3AA 2HDLA 3U58A 1NR4A 3GTOH 2I0QA 4BY7G 3NELA 1X3PA 3RLFA 2MHVA 1PA6A 5D3DA 1BBXC 4JCVE 3I4MG 1F2MA 4XQQA 3HZXA 3GTPB 1K83H 1S5ED 1SYBA 4HTHA 1XX8A 1PYSB 4BBRG 4DK3C 4JI7Q 5IGBA 2OQKA 4NXNL 2O2LD 2ZTEA 4BS9A 1X3EA 1TT2A 2CH4A 4DV2L 4JV5L 3T16A 4HMJA 1VQCA 4V0BA 3AU7A 4P71A 4MZ9A 2CWAA 1MIUA 1C8CA 1HNWQ 4ID6A 3J81i 5J1ZA 3OMGA 3HFZB 2D0OA 1WTQA 4B3TQ 1TS2A 1J9OA 2E5LL 3EIVA 2IX3A 3S16B 1FNWA 3H3VC 4G7HC 2ZM6L 5EJWA 5IYDG 1L0XB 1XYIA 1GVPA 1FR3A 2K01A 3J80c 2EY6A 3CC4A 1VQJA 3MTSA 5DEHA 2WINB 1DOKA 2F0VA 1R9TB 3QIAA 2E2DC 4AYBB 4DV1L 5HGQA 1LTTD 3I4NG 4DXFA 3QB3A 5A2QE 5DAUA 2E2HH 4FXKC 2A68D 4QMGA 2N49A 5EGTA 4DUZQ 5COYA 1VF7A 1GUSA 3KDFB 2JSOA 4GN4B 1CQFA 2F0PA 4LMQD 3OW7A 1KDCA 4R4OA 2K5QA 4TSSA 2WKDA 4KTAA 4KHZA 3F2BA 3NUCA 3SXHA 2K04A 4RKBA 3CC2A 1DOLA 2NTTA 4L6TB 3K8AA 4DR4L 1CKNA 4IUVA 3SDZA 3CAMA 1K3BC 4PZ8A 1HRJA 5I4DA 3OMCA 2QKIC 5CBEE 1DM0B 1XMQQ 1EY4A 1EY8A 1SN8A 1YZ6A 4OHJA 1X56A 2WP8J 1SNOA 5F2DA 3RD4A 1VQ4A 3FRPB 2VW9A 1X54A 1EY7A 2M9VA 4I7ZC 4IFDH 5JEAG 3A8KE 4B3RQ 2R6GA 4POGA 4OWWB 1SEBD 4MTKA 5ELNA 2F0IA 3KK7A 3CCQA 4A3FH 2WB1B 4F8MA 2A74C 4GOPC 3NSWA 5J3BA 4KKSA 2GVBA 1Q8KA 2Z6KA 2NVYB 2L11A 1PH9A 1PRTC 1YEZA 1SYGA 4K2LA 3J7AV 4F87A 5JOBA 1A63A 1GXDC 5IT9c 3GTJB 2R7FA 1B50A 3R2IA 3JAML 1KHIA 4C3JG 3PO2H 3S15B 4NW2A 3NXWA 2JEAI 3S14B 2B2WC 1PH3A 3OPOA 4KK7A 3T13A 4DR6L 5IP9H 4QF4A 4FF2A 1OO9B 5H1SE 1WTOA 3ULJA 2RSOA 3GTQB 3H0GB 1ILPA 3EVQA 4GKKL 3WDNA 1KD1C 4A3BG 3W1GA 4UP7A 1H9RA 3PGZA 1ONLA 4LF7Q 1A8VA 2PQEA 3M4YA 5C0XI 2EYFA 3GTGH 4DA2A 4IJLA 2ZT9C 4FXGC 3IRBA 1M8AA 1O7IA 3GQBA 1WTWA 1Z47A 3LX0A 1E3PA 3GTJH 1V1PB 3HOYH 1BXTA 2EZVA 3IAYA 1PRTF 4GNXC 1TVXA 4JI6L 3CKIB 1F2LA 3S14H 1YHBA 1TS5A 2J0TD 4ZAIA 4B9WA 5C4JH 1MHWC 2BOSA 3KBXA 2EIFA 1S5FD 2EYMA 4OO1I 1CQVA 2NTSA 3A56A 3OIQA 3TRZA 1IW7D 1FL0A 4RGNA 4DAPA 4K8IA 4A3IB 3F8TA 1PTOH 4XXEA 2NYZD 4NMZA 2PI2A 5G3LD 2WKCA 2NN6I 4GOPB 3MEFA 2PMZE 3R8BA 5IP7H 3LNNA 3P1HA 5BR8Q 1CTMA 5IGCA 3SEBA 3M9BA 2L0CA 1KLUD 2EY1A 2F03A 1KNEA 2CFMA 4TVAB 1UE5A 3M3YB 2M2LA 4KJOA 1EQTA 1IBKL 1G2SA 4LW1A 1KQSA 5L37A 1TR5A 3L7ZC 3WOFA 4F88A 5CBAE 1EU4A 3K5OA 4DR1Q 4PG3A 4DGZA 1ZYRC 3E9HA 1HNXQ 4ZKCB 4C2MB 1B7YB 1Y69U 2DGYA 1N8RC 1GUOA 2G9HD 4IPHA 1X3FA 3EROA 3VYSA 4IFDG 2BH8A 3HOXB 1XMOQ 3S1NH 1Z9FA 2FHTA 3FPUB 5C5LA 3H6MA 3I4OA 2E74C 5A35A 1GM5A 1RHPA 1VQDA 4A3FG 1PHJA 1HPCA 3BZCA 1LTBD 1CK1A 3CCEA 4XIGS 2F0MA 5EKKA 1W3SA 4X66L 1K0RA 1HFNA 4KHPL 3ITPA 4LUZA 1JT8A 4PZ6A 2DN8A 3ER0A 3NP8A 4YCWA 2MPMA 1A3UA 2IHFA 1B53A 1QILA 3PO3B 3PO2G 5LMNQ 1QCBD 3IL8A 4HIMA 3HRZC 4B3ML 2M00A 2VUMG 2R92B 1TWGB 3ULPA 1Q1EA 1D8LA 5C5MA 3K5LA 3HOXH 2L4NA 3JC66 5ISRA 4YHHL 3I56A 3L2PA 2KA7A 2FXQA 4A3KB 1PTOD 2MP1A 4LAAA 3TZDA 2Q2HA 1S5BD 3KDFA 2NZ1D 5EKLA 2IX1A 4QUFA 2K28A 4C56C 5IOCA 2B8FA 4KKTA 4IQZA 1BKBA 2PYKA 4X3SA 2ZTCA 2OF1A 4A3LH 1YJ9A 1SNMA 1HTPA 4DR5L 1WTVA 3NTKA 1KRSA 2OWOA 1B8AA 2KOLA 1PFSA 2R3ZA 4R9WA 2E8GA 1EWIA 2B8GA 1HQRD 1SLJA 4GS3A 2NWGA 5BN3A 1TWFH 4FF4A 1IL2A 1QVCA 5LMUQ 3LWEA 2IWHA 1BNZA 1LACA 1GO3E 3J80L 4HIOA 1GUWA 2MUYA 3CW2C 1C0AA 4A3KH 5T1GA 1WCMH 3QWNA 3T53B 2KEDA 3HOZG 4OL7A 1DXMA 2JA7G 2B2VA 2XRSD 1EZ6A 4HEDA 3K58A 4QCLA 1F9RA 2EY2A 5IGDA 2A8VA 2IHEA 2K5VA 1VF5C 1SNQA 4AQYQ 2R93B 4WJWA 2VQFL 1B1ZA 1PDQA 5JPNC 4BBSG 4X62L 2N55A 3BS1A 1Q81C 3DUZA 5BN5A 2F0KA 2ID0A 1PV4A 3S1QH 1EYDA 1JWSD 1AH9A 3HOUH 1VQIA 5LMNW 1FJGL 2IX0A 3T56B 1Q86C 4L5QA 3VR2A 3A8JE 1G8ZD 5FLMH 1JWUD 4BXXH 1ZEQX 4B9XA 3HEJA 1SNPA 1A0IA 2Z6KC 1VQHA 1HNZL 4OWXB 3S17B 4XQNA 3J81L 1ASYA 5I6YA 2MO1A 3UE1A 3HOWH 3PUYA 3I4MB 4JI5Q 1XWEA 1BOSA 4BBRB 4U673 3NQIA 1V1PA
chains in the Genus database with same CATH topology
5EKIA 1DZ1A 1ESFA 3OWFA 1VMCA 5KGUA 1A2TA 1K8OA 4ZUIA 2JA8B 2PMZB 2A68C 3DMUA 1LT3D 3RUZA 3M7NA 1EIHA 2IPKD 2E75C 2R7ZB 3HG9A 2EE1A 2K05A 2QILA 3I3CA 5J22A 1LT5D 4OIJA 3MXUA 1W6KA 3VR5A 5C44B 2IL8A 4IUPA 3K5MA 2PW7A 3EQLC 3K5NA 5TSSA 1S5CD 2SNSA 4EQPA 5C4ZA 1E2ZA 3I4NB 3J80E 4G57A 1F2YA 4PNYA 1TWAB 4OIKA 3TZUA 5D14A 4EQOA 4CGYB 1O7YA 3VR4A 4KHVA 3DEOA 3H09A 3NE5B 4ZQ3A 2O5IC 5KIXA 4KV6A 2AQ3B 1YNND 1SAPA 3J7AF 5D3IB 1V8QA 3FMCA 3KUPA 5KEEA 3TP6A 3NTHA 2NVQB 1GUGA 2EDGA 1JOKA 4KD4A 4EVOA 4ULLA 2XWBB 1CT1D 3SR1A 1ENCA 5A2QL 2JA5B 4H13C 3LWUA 5JAVA 2A6HD 3ERQA 2A6EC 3Q22A 3GTOB 4IALA 1DCZA 3HP3A 2MGSA 2K7VA 5FO7B 5ELBA 1K83B 2RVLA 4XYOA 2Q8IB 5IT9E 1WVLA 1ENFA 5JEAH 4WRDA 3G7LA 2L55A 2FJ2A 4HMIA 3DWQA 4DXGA 2CHBD 2EJGC 2RKSA 2L12A 2BDOA 3CU7A 4RA8A 5C0XG 1HCZA 2K5DA 2EY5A 1SE3A 1EOTA 3BYTB 4BA1I 4E6IA 3BDOA 5E1FA 1DYQA 5FOBB 2LY7A 3H94A 3I73A 1Y8NB 3BDLA 2F0NA 4YIJA 1Q12A 1U4MA 3GD7A 1R4QB 2F3WA 3PIO3 4P2CB 2QCPX 4RWSC 4OO1G 1K8MA 3BVGA 4KMUC 3D6WA 2C5CA 3PV0A 2JP1A 2CQAA 4NKLA 2E2HB 3K59A 5G3LF 1JQYD 2B2VC 1QNUA 3FDTA 2VB2X 3M7GA 1II3A 5ELEA 2B2UA 2F0FA 3KBGA 2BE5C 1STBA 4KY6A 1BO0A 4H7BA 1AFPA 4ODGA 3TN2A 1VDZA 1SYFA 1SBBB 3HKZB 4Q0FA 1MD2D 4G7OC 2RDHA 2XVSA 1PTOC 2NUCA 4C3IG 4KY5A 4XYQA 4A3FB 2TSSA 5KNBA 1BQQT 1B3AA 4IFDJ 2A69D 2K1BA 2KHSA 4FF3A 5LL6S 2QDBA 4WFN3 2J4XA 1ZXTA 1KTKA 2SOBA 1SMYD 4TRDA 1EIGA 3A7AB 3PO2B 3QO2A 1KNAA 3EA6A 1V43A 1MI2A 3MVVA 2VUMB 2EYJA 1LV9A 3PUZA 2F0JA 3P20A 1V1OA 3GP7A 3CRLC 3IKJA 4HN7A 4QB4A 4JK1C 3GTGB 1PTOF 4RCNA 3NK9A 3QG1A 3HOYB 1STAA 4CHTB 4X3KA 5CV6A 1B4OA 1GOZA 1G91A 5M9OA 1ZKOA 4N9TA 1KDBA 5C4JB 5KYLA 1RTOA 3V05A 2EOTA 3X3NA 3H91A 5JVG3 3OHXC 4H44C 5IGEA 3DWAA 1PTOB 4FP5D 1PZJD 2F0OA 3NWSA 1HFGA 2VXWA 1EFID 5E4XA 1OXVA 4MHEA 3SHLA 2K03A 1UEAB 2ICEC 1CZWA 4J1MA 3W2DA 1WD1A 2EYHA 3E0JA 1U4PA 1A3TA 2F0WA 2SDFA 1D1KA 3GV3A 3P75A 4WORA 1XXGA 1BCPB 1I50B 4IUNA 1RD9D 4J8QA 2E76C 5CV4A 1JOOA 2HCIA 3TDQA 1E2VA 1LT4D 2FMMA 4ZLTF 3S1NB 2BA0A 3PUWA 5K36G 3D31A 1L0YB 1KLGD 1NAPA 1G6ZA 3A55A 3MHBA 2ENBA 1D5ZC 2EPBA 2AWOA 2OT2A 2KCNA 3Q6SA 1JCKB 1M4VA 5IODA 2B2TC 2ZXOA 1QE6A 1F2ZA 3NPPA 3VA5A 2Z1CA 4CKCA 4CJ0B 1H9JA 1F9QA 3OSOA 3C1EA 1SJED 3BVZA 3PMFA 3TBIB 2RDFA 5T1IA 1VCIA 3K0YA 5CMDA 2D9UA 2Q8TA 3D4RA 2PZTA 1EL0A 4L63B 1HUNA 4K8JA 4K6DA 3CQZB 3DXJC 1TWFB 3R3OA 4IUQA 3VYUA 3ZYYX 1I4RA 2PZWA 1C4QA 1D6EC 2KEEA 2A6HC 3MXNA 1SSOA 2XWJB 4TQUS 1WCMB 4PQXA 1RTNA 2B2UC 3VYRA 1TY2A 4FVMA 1FGBD 3E5SA 5CV5A 1SDFA 1OXXK 1Y1VB 3HGBA 2AWNA 4K5XA 4FNFA 4O1NA 3PIP3 4RHRA 3AB9A 3S9WA 2PPBC 3S1QB 1H9MA 3HOUB 2EVBA 1DONA 1FNVA 1BCPD 3A7LA 3NWTA 2C9OA 3VR3A 4M8AA 1DOMA 1SJHD 1ICWA 4Z9CB 2AQ1B 1BF4A 1SYDA 3HOWB 3BG3A 1D5XC 3I8ZA 2QF7A 2DNEA 3G6JB 2WV6D 4LK1C 1SNDA 4KN4C 2F0TA 4MN3A 2F0GA 4A3DB 3IFDA 4BWGB 3GV6A 5C4HA 4F7XA 1BDOA 3QOLA 5J39A 3GO5A 2JYOA 4IUTA 2RBMA 2RA4A 4OGQC 3PUVA 3D6CA 4BY7B 2L5TA 1PMRA 1RF2D 4KD3A 1SYEA 4PMCA 5IGGA 5EPLA 3MXGA 1HA5A 4V190 1SE2A 4HSVA 3VR6A 1SNCA 1LTID 1MSGA 1RDPD 4CKEA 5KYIA 1STYA 1EYCA 3NBIA 1GJXA 1MBYA 1Z6HA 2DY7A 3V96A 1G2TA 1IKMA 4HSPA 5IT9L 5C0XH 4R8IA 1YNJD 1PZID 2CVRA 2L1BA 1BUVT 4A3EB 1ILQA 1O80A 4IN3A 3AMUA 2A69C 1SXTA 3I4LA 2EXZA 2LS01 2IW3A 4OO1H 2R61A 3SK6A 3DWPA 2LFNA 4KJNA 1GHKA 4IFDI 1KDAA 1LTGD 3R2TA 1ESRA 2EYOA 4N9PA 5CORA 3MEHA 2NN6H 3DHQA 1TWHB 1AZQA 1NUCA 2XNAC 3Q23A 4NP5A 2B2YC 2JA6B 4C3IB 2HCCA 4EGVA 4KN7C 5CV8A 1H9KA 2N88A 1I6VC 2E2JB 2E2IB 3SK8A 2PZUA 1ZYRD 4C3HG 1UUPA 1LO5D 4XDXA 1HHVA 1PXUA 2BCOA 2HUGA 4M1UB 1O78A 1I4QA 3J7YW 1T5XD 1F9SA 1RODA 2KVMA 3NQTA 1PYWD 4UAIA 5CGKA 3DM1A 2H1EA 3SVMA 3L9AX 3M85A 4A3JB 1PZKD 5JEAJ 3NHHA 1QWYA 3OWEB 4RGOS 2RSNA 5JJZA 4GZYC 3SK5A 2Y0SB 4A93B 4C3JB 1IKLA 4A3MB 3BYYB 5KNDA 5E4WC 2I46A 1X3QA 5M5XB 1IW7C 2QEJC 1T5EA 1CHQD 1GHJA 1QJOA 2KUMA 2HQEA 1FNUA 1LT6D 4A3BB 5ELCA 1Q3LA 4IZ8A 2EYPA 2B2TA 4XT1B 1SE4A 2TMPA 3NTIA 2D2CC 5NUCA 1EWHA 4FYDA 3DEPA 1D5MC 2AUJD 1STNA 1JC7A 2VB3X 3L3OC 3D3RA 5FKAC 2DNCA 1D2BA 4K5VA 5EBDA 3URYA 2Q8RE 2PW5A 5C4XB 1TS3A 4ZYSA 3CHBD 5AFWA 5C3EB 3X3MA 4XQJA 5IGFA 4ABNA 5FO9B 5EQ0A 4KKUA 3ND8A 3E6ZX 2NN6G 1U4RA 2JEBI 3QJYA 2O4XA 4B08A 3S1MB 3P7JA 2ZXRA 1I4HA 5M3FB 2PNRC 4QIWB 2K6AA 4DK0A 4H0LC 4HCEA 4RCOA 3FEWX 2AQ2B 2Z4HA 3C46A 3S2DB 5JVH3 4DN4M 3IFTA 5M5WB 2L9HA 5DM63 1LLRD 3GTMB 1QOHA 3RZDB 3M4OB 1S5DD 1ENAA 1SFOB 1QG7A 1I4XA 5ELFA 4CBVA 2CW0D 4DU9A 1PFMA 4K6LA 4JBWA 5K36H 1EWCA 2A5HA 2A73B 1U9RA 2D5DA 1HQMC 1STEA 5HURA 1EQVA 4RH6A 4PMWA 4DK1A 3C3LA 1JE4A 5EBCA 4KY7A 3TP7A 1HTLD 1A2UA 1PFNA 3FKIB 5I2YA 3K57A 3VYTA 1EYAA 1B9MA 1TY0A 5HGTA 1I4PA 1BCPC 4FXDA 1F9PA 2FMCA 1WTRA 1IYVA 1DD2A 4G7ZC 1KAAA 1OXSC 1B44D 3SK4A 4IURA 3C1FA 1HXYD 3S2HB 1IL8A 1LTRD 1TWCB 2F1MA 1NR2A 2G9DA 3KLRA 2VNUD 4K5WA 4R8NA 4FF1A 1DJRD 2F0QA 1VMPA 1Y8OB 1O7ZA 3HOZB 1BCPF 2JA7B 1AZPA 4RGMA 5K5PA 4DNRB 3TMEA 5CV9A 2IT1A 2I07B 4K14A 1XTCD 4C1NK 1QNKA 2Z4IA 3PUXA 1EEID 1JWMD 4BBSB 1C48A 4HCSA 1LTAD 2F0DA 2LMCB 1AN8A 4J6HA 3ONAB 3CRKC 2B39A 5DM73 1YNJC 2IJ0A 1STHA 2A6ED 4ZKBB 2B2YA 1X32A 1U4LA 3KLSX 1EY5A 1I4GA 2KQ3A 1EY6A 4K2KA 1H9SB 2BDNA 1O7LA 5D65A 3KLSA 1TS4A 2F0LA 1ML0D 4RHSA 2WACA 3TP5A 3MFYA 1EZ8A 1E0BA 2OEOA 1PRTB 1RJTA 1CZGA 5JPMC 2KCCA 3OOCA 3I70A 5E3FA 2OXPA 1GUTA 4PV1C 4CKBA 1Q8IA 4CJ2C 4RAUC 1YNNC 2F0EA 2JE6I 4XTCS 2B63B 4EQNA 1A3VA 3KF8A 1EEFD 3I72A 1JOQA 5IIFA 1TU2B 1A6XA 3JAME 1FYCA 2XRQD 2NVTB 2KECA 1I6HB 4ZUJA 2FFKB 1A15A 1BR9A 1W6JA 2ICIA 2XIWA 4RGTA 5M5YB 1EY0A 5EPJA 2X6GA 5CYUA 5KRUA 2BE5D 4C3HB 2LKVA 3NBHA 5LHY1 3MA2B 4O42A 1WTXA 3MZ5A 3QOJA 2J7ZA 3MXPA 1HUMA 3EJIA 3UI2A 3A8IE 4S3SA 2PCFB 2NVXB 2AUKA 2WIIB 3MAQA 2EJFC 1RCVD 3GTKB 4HAEA 1AP0A 5LL6X 2XN9C 1I3QB 1RKNA 2V4DA 1CM9A 1NSNS 3MWYW 1WTPA 5DNFA 1JORA 2PO4A 2F0UA 1F77A 1NCVA 1CA6A 3U9OA 1ET6A 3I90A 1E2WA 2EYLA 2WAQB 1MGSA 3T4AC 4DF7A 1CFMA 1STGA 1OXUA 2F4IA 3O13A 1Y1WB 1G291 2DY8A 1PRTD 2XSCA 5BN4A 4BY1B 2SNMA 3FPPA 1AEXA 1IHZA 4X3UA 3D4WA 5C3XA 1UAPA 1S4ZA 2X69A 2NB0A 4DNTB 5C6AA 2Z8LA 5C0XJ 2HDMA 3C2PA 5FLXL 1R4PB 4NDXA 4Q5VA 2D62A 3R93A 4KI0A 2F3VA 2H4OA 3I91A 1Q90A 1KABA 1EU3A 1JR0D 5I6WA 3TP8A 2CW0C 4XT3B 5CC4A 4U68A 2K5WA 5C3WA 3ND9A 3Q24A 3RZOB 1GUNA 3RMHA 4BA2I 4I65A 5M3MB 3FVQA 4PMBA 1FD7D 4TKOB 4ME5A 3EFXD 1CHPD 1Q1BA 4HR7B 3U9SA 1SMYC 1UNSA 1H9SA 1TQOA 3N6RA 4LJZC 4FO2A 3N52A 3S1RB 1J8IA 4ZRZA 4CJ1B 1PFBA 2K32A 4L8JA 1AW7A 4A3GB 1WD0A 3OIPA 2F0HA 1D1IA 3TSSA 4QUCA 5FO8B 3WOEA 3BZDB 1JB3A 1TIID 2B2WA 3K6OA 1TKWB 3MFGA 1IYUA 3BVMA 3K7AB 1Z7TA 1OXTA 1SYCA 1HA6A 4DAYA 5ELDA 1LTSD 1B2TA 2JXMB 3VA7A 4DAVA 2BA1A 1CI3M 2SEBD 3A54A 4ZK9B 3V2TA 2FINB 5KNCA 2EJMA 5CR3A 2F0SA 2KJXA 5FLXE 2RQXA 1JICA 1PLFA 4ILWA 3HOVB 1LABA 3J81E 4X3TA 4G4KA 3SE0A 2K33A 4IUUA 1ET9A 1QB5D 2ZXPA 5CV7A 2X6LA 5I2XA 2MJ8A 5I9OA 1Y8PB 4UDUC 1CA5A 4MIUA 3T51B 4DFAA 1B9NA 4RFBA 3D8GA 3MC0B 1MSHA 3Q0AA 2NBFA 5FK9C 5EPKA 2RDGA 3F2UA 5I9PA 3D4DA 2YYZA 2GA4B 2O5JC 3GTLB 4RKLA 3HS0C 1EY9A 3BDCA 4Y7NB 4C1NI 2YU9B 3W3AA 2HDLA 1NR4A 1X3PA 3RLFA 2MHVA 5D3DA 1BBXC 1F2MA 4XQQA 3HZXA 3GTPB 1S5ED 1SYBA 4HTHA 1XX8A 5IGBA 2O2LD 4BS9A 1TT2A 3T16A 4HMJA 4V0BA 3AU7A 1C8CA 4ID6A 5J1ZA 3OMGA 1WTQA 1TS2A 1J9OA 2IX3A 3S16B 1FNWA 3H3VC 4G7HC 5EJWA 1L0XB 1XYIA 1FR3A 2K01A 2EY6A 3MTSA 5DEHA 2WINB 1DOKA 2F0VA 1R9TB 3QIAA 2E2DC 4AYBB 1LTTD 4DXFA 3QB3A 5A2QE 5DAUA 4FXKC 2A68D 4QMGA 5EGTA 5COYA 1VF7A 1GUSA 2JSOA 1CQFA 2F0PA 4LMQD 3OW7A 1KDCA 2K5QA 4TSSA 2WKDA 4KTAA 4KHZA 3NUCA 3SXHA 2K04A 4RKBA 1DOLA 2NTTA 4L6TB 4IUVA 3SDZA 1HRJA 5I4DA 3OMCA 2QKIC 5CBEE 1DM0B 1EY4A 1EY8A 5F2DA 4OHJA 2WP8J 3RD4A 1SNOA 3FRPB 1EY7A 2M9VA 4I7ZC 4IFDH 5JEAG 3A8KE 2R6GA 1SEBD 2F0IA 3KK7A 2WB1B 4F8MA 2A74C 3NSWA 4KKSA 2NVYB 2L11A 1PRTC 1SYGA 4K2LA 3J7AV 4F87A 5JOBA 1GXDC 3GTJB 1B50A 3R2IA 3JAML 4C3JG 3S15B 4NW2A 3NXWA 2JEAI 3S14B 2B2WC 3OPOA 4KK7A 3T13A 4QF4A 4FF2A 1OO9B 1WTOA 2RSOA 3GTQB 3H0GB 1ILPA 3EVQA 3WDNA 1H9RA 1ONLA 2PQEA 3M4YA 5C0XI 2EYFA 4DA2A 2ZT9C 4FXGC 1M8AA 3GQBA 1WTWA 1Z47A 3LX0A 1V1PB 1BXTA 2EZVA 3IAYA 1PRTF 1TVXA 3CKIB 1F2LA 1TS5A 2J0TD 4ZAIA 4B9WA 2BOSA 3KBXA 1S5FD 2EYMA 4OO1I 1CQVA 2NTSA 3A56A 3OIQA 1IW7D 4RGNA 4DAPA 4K8IA 4A3IB 1PTOH 4XXEA 2NYZD 4NMZA 5G3LD 2WKCA 2NN6I 3R8BA 3LNNA 3P1HA 1CTMA 5IGCA 3SEBA 2L0CA 1KLUD 2EY1A 2F03A 1KNEA 3M3YB 2M2LA 4KJOA 1EQTA 1G2SA 1TR5A 3L7ZC 3WOFA 4F88A 5CBAE 1EU4A 3K5OA 4DGZA 1ZYRC 4ZKCB 4C2MB 1Y69U 1GUOA 2G9HD 3EROA 3VYSA 4IFDG 3HOXB 2FHTA 3FPUB 5C5LA 3H6MA 2E74C 5A35A 1RHPA 1HPCA 1LTBD 1CK1A 4XIGS 2F0MA 5EKKA 1HFNA 3ITPA 2DN8A 3NP8A 2MPMA 1A3UA 1B53A 1QILA 3PO3B 1QCBD 3IL8A 3HRZC 2M00A 2R92B 1TWGB 1Q1EA 5C5MA 3K5LA 2L4NA 5ISRA 2KA7A 4A3KB 1PTOD 2MP1A 4LAAA 3TZDA 1S5BD 2NZ1D 5EKLA 2IX1A 4QUFA 2K28A 4C56C 5IOCA 2B8FA 4KKTA 4IQZA 2PYKA 4X3SA 2OF1A 1SNMA 1HTPA 1WTVA 3NTKA 2KOLA 2R3ZA 4R9WA 2B8GA 1HQRD 2NWGA 5BN3A 4FF4A 3LWEA 2IWHA 1BNZA 1LACA 3J80L 1GUWA 2MUYA 5T1GA 3QWNA 3T53B 2KEDA 4OL7A 1DXMA 2B2VA 2XRSD 1EZ6A 4HEDA 3K58A 4QCLA 1F9RA 2EY2A 5IGDA 1VF5C 1SNQA 2R93B 4WJWA 1B1ZA 1PDQA 5JPNC 2N55A 3BS1A 3DUZA 5BN5A 2F0KA 2ID0A 1EYDA 1JWSD 2IX0A 3T56B 3VR2A 3A8JE 1G8ZD 1JWUD 1ZEQX 4B9XA 3HEJA 1SNPA 3S17B 4XQNA 3J81L 5I6YA 3PUYA 3I4MB 1XWEA 1BOSA 4BBRB 4U673 3NQIA 1V1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJT A;  2B2U A;  3MWY W;  5DNF A;  5EKI A;  4ZAI A;  3GV6 A;  4XDX A;  1WTP A;  1J8I A;  4CJ1 B;  1DZ1 A;  3KBX A;  1PFB A;  5EPK A;  1HHV A;  3F2U A;  4LMQ D;  1NCV A;  1VMC A;  4IUR A;  5T1I A;  1CA6 A;  5EQ0 A;  1WD0 A;  2MP1 A;  2JYO A;  1BO0 A;  3TZD A;  2HUG A;  5CMD A;  3I90 A;  4IUT A;  1HFG A;  1U4R A;  2D9U A;  2NZ1 D;  2Q8T A;  3TN2 A;  2RA4 A;  4QUF A;  1XYI A;  2K28 A;  2VXW A;  1IL8 A;  2K04 A;  1EL0 A;  3P7J A;  5E4X A;  1DOL A;  5AFW A;  4MHE A;  1MGS A;  1F9S A;  1ROD A;  2K03 A;  4X3S A;  1HUN A;  2KVM A;  4IUV A;  4CJ2 C;  2NYZ D;  3HP3 A;  2MGS A;  4QUC A;  1NR2 A;  4RAU C;  4UAI A;  1HRJ A;  3DM1 A;  1WTV A;  1EIH A;  5CBE E;  2KOL A;  2HDL A;  5EPL A;  2B2W A;  2R3Z A;  2H1E A;  4R9W A;  3SVM A;  1WD1 A;  4IUQ A;  2RVL A;  1NR4 A;  2DY8 A;  2EE1 A;  4DN4 M;  1U4P A;  1WVL A;  2K05 A;  2NWG A;  3I3C A;  1X3P A;  4HSV A;  4OIJ A;  2KEE A;  3G7L A;  1VMP A;  1KNE A;  1O7Z A;  2L9H A;  1BBX C;  2FJ2 A;  1HA6 A;  2M2L A;  4X3U A;  1SSO A;  1B3A A;  3LWE A;  2SDF A;  1EQT A;  2K1B A;  1MSG A;  1XX8 A;  1S4Z A;  1G2S A;  2X69 A;  1BNZ A;  1AZP A;  1RTN A;  1B2T A;  2B2U C;  3GV3 A;  5CBA E;  1GUW A;  2IL8 A;  2DY7 A;  4IUP A;  1G2T A;  1IKM A;  2KEC A;  2RSN A;  2L12 A;  4ZK9 B;  5JJZ A;  4R8I A;  4RA8 A;  1ZXT A;  2FIN B;  5T1G A;  1QG7 A;  2CVR A;  2FFK B;  1A15 A;  2L11 A;  2KED A;  1IKL A;  1SDF A;  1EIG A;  2L1B A;  2HDM A;  4ZKC B;  1EOT A;  2XIW A;  2B2V A;  3QO2 A;  1ILQ A;  1KNA A;  1O80 A;  1QNK A;  2HCI A;  1PFM A;  2FMM A;  2X6G A;  4HED A;  5E4W C;  5EPJ A;  4ZLT F;  1MI2 A;  1F9R A;  1X3Q A;  1B50 A;  3R93 A;  1C8C A;  1LV9 A;  4HCS A;  4NW2 A;  4OIK A;  3ONA B;  3I91 A;  1WTQ A;  1NAP A;  2KUM A;  1G6Z A;  2B2W C;  5D14 A;  2FHT A;  3FPU B;  1J9O A;  1O7Y A;  1JIC A;  1PLF A;  1Q3L A;  1U4M A;  1PDQ A;  4O42 A;  2B2T A;  1WTX A;  1RHP A;  4XT1 B;  2N55 A;  1DON A;  3DEO A;  1JE4 A;  4RWS C;  5EJW A;  4ZKB B;  4XT3 B;  1WTO A;  2EPB A;  2RSO A;  3DEP A;  2B2Y A;  1ILP A;  1PFN A;  4U68 A;  1X32 A;  1SAP A;  2J7Z A;  4X3T A;  1ESR A;  1DOM A;  1HUM A;  1U4L A;  3D6W A;  3Q6S A;  2K01 A;  5COR A;  4IUU A;  3UI2 A;  1ICW A;  3KUP A;  1HFN A;  2B2T C;  2JP1 A;  2X6L A;  1BF4 A;  1AZQ A;  1QE6 A;  3MTS A;  2MJ8 A;  2MPM A;  4X3K A;  1DOK A;  1B53 A;  2B2Y C;  3I8Z A;  1B4O A;  2BDN A;  1CA5 A;  1G91 A;  2Q8R E;  1M8A A;  3IL8 A;  2B2V C;  5D65 A;  1WTW A;  2HCC A;  3FDT A;  4HAE A;  1AP0 A;  1ML0 D;  4CJ0 B;  1F9Q A;  2N88 A;  1MSH A;  1F9P A;  4MN3 A;  1RTO A;  1TVX A;  1F2L A;  2L4N A;  1WTR A;  1E0B A;  3N52 A;  3IFD A;  2EOT A;  5COY A;  1CM9 A;  3H91 A; 
#chains in the Genus database with same CATH topology
 5EKI A;  1DZ1 A;  1ESF A;  3OWF A;  3K81 C;  1VMC A;  5KGU A;  1A2T A;  1K8O A;  4ZUI A;  2JA8 B;  2QDL A;  2PMZ B;  3EBE A;  2A68 C;  4JYA L;  3DMU A;  1LT3 D;  2Z9H A;  3RUZ A;  3M7N A;  1EIH A;  2IPK D;  2MNA A;  2E75 C;  2R7Z B;  4YWL A;  2F52 A;  1C7Y A;  3HG9 A;  4BY7 H;  4JW0 A;  2EE1 A;  3HKZ E;  2K05 A;  2QIL A;  3I3C A;  2UXB Q;  3UDX A;  1LT5 D;  4OIJ A;  3MXU A;  1W6K A;  5J22 A;  4GOP A;  3VR5 A;  4HIK A;  2B63 G;  5C44 B;  2HHH L;  2YTX A;  2IL8 A;  4IUP A;  3K5M A;  2PW7 A;  3EQL C;  3K5N A;  1N33 L;  5TSS A;  3M4P A;  3T1H Q;  1S5C D;  2SNS A;  1EYG A;  1BVS A;  4EQP A;  5C4Z A;  1G6P A;  1E2Z A;  3I4N B;  3CPF A;  3J80 E;  4G57 A;  1QVF A;  1YHA A;  1F2Y A;  4PNY A;  4JI4 Q;  1TWA B;  4OIK A;  3TZU A;  4A3E H;  5D14 A;  4EQO A;  4CGY B;  1O7Y A;  3VR4 A;  1LTL A;  4KHV A;  3DEO A;  3H09 A;  3NE5 B;  4ZQ3 A;  2O5I C;  5IYD H;  3W1B A;  4KV6 A;  5KIX A;  2AQ3 B;  1YNN D;  1E24 A;  4P72 A;  1WCM G;  2AKW B;  1SAP A;  3J7A F;  5D3I B;  1V8Q A;  3KJP A;  1K8A C;  3FMC A;  3KUP A;  5KEE A;  1KXL A;  2V1C C;  4DAM A;  4O0A A;  4GNX A;  3TP6 A;  3SGI A;  4LUV A;  2QEX A;  3NTH A;  4RMF A;  4UP8 A;  3I4N H;  2NVQ B;  1GUG A;  2EDG A;  1CUK A;  4UY8 C;  1JOK A;  1Y1V G;  1TWH H;  4KD4 A;  4EVO A;  3T1Y L;  4K0K Q;  4ULL A;  2JA6 H;  2XWB B;  1CT1 D;  4HJ8 A;  2E2J H;  3HOU G;  5ELO A;  1KC8 C;  4QJF A;  3AYH B;  4DUY L;  2E2I H;  3SR1 A;  1ENC A;  5A2Q L;  5FLM G;  1L2F A;  2JA9 A;  2JA5 B;  4H13 C;  1BBW A;  3LWU A;  4DV3 Q;  5JAV A;  2A6H D;  1XNQ Q;  3ERQ A;  2A6E C;  3Q22 A;  3GTO B;  4IAL A;  2QGQ A;  1DCZ A;  2RCF A;  3HP3 A;  2MGS A;  2UUA L;  1PH1 A;  4GN3 B;  4HJ9 A;  2L15 A;  4LF9 L;  1YJN A;  2K7V A;  2NVQ H;  5FO7 B;  5ELB A;  1K83 B;  2RVL A;  2WAQ G;  4XYO A;  2VZA A;  2Q8I B;  5IT9 E;  1WVL A;  1ENF A;  4X65 Q;  5JEA H;  4WRD A;  3G7L A;  3S24 A;  2L55 A;  2FJ2 A;  3H15 A;  4NXM Q;  4HMI A;  3J80 i;  1XJV A;  2I5H A;  4A3D G;  1M90 C;  2OCE A;  1Y1W G;  3DWQ A;  2YTV A;  4DXG A;  2CHB D;  2EJG C;  2RKS A;  4OEM B;  2L12 A;  2BDO A;  3CU7 A;  4RA8 A;  5C0X G;  1HCZ A;  2K5D A;  2F4V Q;  4LF5 Q;  2EY5 A;  1SE3 A;  1EOT A;  3BYT B;  4BA1 I;  4E6I A;  2UXC L;  3BDO A;  4YY3 Q;  1VQ7 A;  2LXK A;  2N8N A;  5E1F A;  1DYQ A;  1J5E L;  5FOB B;  2LY7 A;  4C3J H;  3H94 A;  3I73 A;  1Y8N B;  3BDL A;  2F0N A;  4O2D A;  4A3M H;  4LFB L;  4YIJ A;  1Q12 A;  5IYB H;  1U4M A;  3GD7 A;  1R4Q B;  2F3W A;  3PIO 3;  4P2C B;  2QCP X;  4RWS C;  4LUO A;  1IBM Q;  4N8F A;  4OO1 G;  1K8M A;  2UUB Q;  3BVG A;  4KMU C;  4A3B H;  4DV4 L;  3D6W A;  1P16 A;  2C5C A;  3PV0 A;  2JP1 A;  3K0X A;  3CCM A;  4DV6 L;  2CQA A;  4NKL A;  2E2H B;  3CCJ A;  3K59 A;  4A3C G;  5G3L F;  1JQY D;  2B2V C;  5GRO A;  1QNU A;  4A3E G;  3FDT A;  2K52 A;  1PH7 A;  2VB2 X;  1TXY A;  3KF8 B;  3M7G A;  4JI0 L;  1II3 A;  5M3M G;  5ELE A;  1CSP A;  4R4I A;  1VQF A;  2B2U A;  2F0F A;  3KBG A;  4HID A;  1U5K A;  2BE5 C;  1STB A;  4KY6 A;  4JI3 Q;  4P75 A;  3RR5 A;  4GLV B;  1BO0 A;  4H7B A;  1AFP A;  3CD6 A;  1IZ6 A;  5C3E H;  4ODG A;  3TN2 A;  1VDZ A;  1N32 L;  3UDF A;  1SYF A;  1SRU A;  1SBB B;  1RIP A;  4LF6 L;  1PH4 A;  3HKZ B;  1LYL A;  4Q0F A;  1MD2 D;  3S1M H;  3MXN B;  4G7O C;  2RDH A;  3CP0 A;  2XVS A;  4OX9 Q;  4ALP A;  2JA6 G;  1PTO C;  2NUC A;  4C3I G;  3J7A 5;  4KY5 A;  4XYQ A;  4A3F B;  2UUC Q;  2TSS A;  1GD7 A;  1HR0 W;  5KNB A;  1BQQ T;  1B3A A;  4IFD J;  2A69 D;  3S2D H;  2K1B A;  2KHS A;  1FVI A;  4FF3 A;  5LL6 S;  5M5W H;  2DJF C;  2QDB A;  4WFN 3;  3A5U A;  2J4X A;  1ZXT A;  1KTK A;  3TS0 A;  2SOB A;  1SMY D;  4TRD A;  1EIG A;  3A7A B;  4A4I A;  3PO2 B;  3QO2 A;  1KNA A;  3EA6 A;  2GVA A;  3M4O H;  1E7Z A;  1MI2 A;  1V43 A;  3MVV A;  2VUM B;  2EYJ A;  2Q2T A;  1LV9 A;  3PUZ A;  2F0J A;  1ICF B;  3P20 A;  1V1O A;  2PQA B;  2VY3 A;  4LFA Q;  1HNX L;  3GP7 A;  1QVG A;  2I5M X;  3CRL C;  3IKJ A;  4A3J G;  3B6Y A;  4HN7 A;  3E3X A;  4QB4 A;  4JK1 C;  3GTG B;  1PTO F;  4RCN A;  3OW2 A;  3NK9 A;  4YCV A;  3QG1 A;  2DJG C;  3HOY B;  1STA A;  1P8L A;  2Y0S G;  4CHT B;  4A93 G;  3FKI H;  4X3K A;  5CV6 A;  1PH6 A;  1B4O A;  1GOZ A;  3J81 j;  4A3M G;  1G91 A;  2HQL A;  1X9N A;  5M9O A;  3AFQ A;  2VUM H;  1ZKO A;  4N9T A;  4CDD C;  1KDB A;  5C4J B;  5KYL A;  1X65 A;  5IYB G;  3W5O A;  4DR3 L;  4JI2 L;  1RTO A;  4B3S L;  3V05 A;  4NXN Q;  2EOT A;  3X3N A;  3H91 A;  5JVG 3;  2HD3 A;  3OHX C;  5LMN L;  4H44 C;  4DV2 Q;  4JV5 Q;  5IGE A;  3DWA A;  1PTO B;  4JPB W;  4APV A;  4FP5 D;  1PZJ D;  2F0O A;  3NWS A;  1HFG A;  2VXW A;  1EFI D;  5E4X A;  1OXV A;  4MHE A;  3SHL A;  2K03 A;  2XGT A;  1I5F A;  1UEA B;  3S2H H;  2ICE C;  1CZW A;  2E5L Q;  4J1M A;  3W2D A;  1WD1 A;  2EYH A;  2ZM6 Q;  3E0J A;  1U4P A;  2NZO A;  3H3V H;  1A3T A;  2F0W A;  5FJ8 G;  1LM0 A;  5C4X G;  1VQ5 A;  1AE3 A;  4HJ7 A;  3OYY A;  2SDF A;  3FHW A;  1D1K A;  3GV3 A;  5C3E G;  3P75 A;  4WOR A;  1XXG A;  1BCP B;  1I50 B;  4IUN A;  3PIO A;  4DV5 Q;  4QY7 A;  1EIY B;  3HOZ H;  4DV1 Q;  1RD9 D;  4J8Q A;  4R4Q A;  2E76 C;  2JA7 H;  5CV4 A;  1JOO A;  3UDI A;  2HCI A;  3TDQ A;  1E2V A;  1LT4 D;  2FMM A;  4ZLT F;  3S1N B;  1SE8 A;  5M3F G;  4IOA A;  1V9P A;  2BA0 A;  3PUW A;  5K36 G;  3D31 A;  1L0Y B;  1KLG D;  1NAP A;  1NMF A;  1G6Z A;  3A55 A;  3MHB A;  1XPR A;  3F2C A;  3GDE A;  2ENB A;  4BBS H;  5IYC H;  3I2Z A;  1D5Z C;  2EPB A;  2AWO A;  2OT2 A;  2KCN A;  1ASZ A;  1VQB A;  3Q6S A;  1JCK B;  1M4V A;  5JJI A;  5IOD A;  1I50 H;  2B2T C;  4AQY L;  2ZXO A;  1PYB A;  1QE6 A;  1F2Z A;  2EQS A;  3NPP A;  3VA5 A;  2Z1C A;  4CKC A;  4OON A;  1GKH A;  1H9J A;  1F9Q A;  3OSO A;  3C1E A;  4CJ0 B;  1SJE D;  3BVZ A;  3PMF A;  3TBI B;  4UP9 A;  2RDF A;  2UXD L;  5T1I A;  2CH4 W;  3CCR A;  1I94 Q;  3ICE A;  1VCI A;  3K0Y A;  5CMD A;  1EQR A;  4JI5 L;  2D9U A;  2Q8T A;  3D4R A;  2K14 A;  2PZT A;  1EL0 A;  3FKI G;  4L63 B;  1HUN A;  4K8J A;  4K6D A;  2JJQ A;  3CQZ B;  3DXJ C;  1TWF B;  3CCU A;  3RLN A;  3BU2 A;  4DR6 Q;  2A1A A;  3R3O A;  4IUQ A;  3VYU A;  3ZYY X;  1I4R A;  2PZW A;  1C4Q A;  1D6E C;  2KEE A;  2A6H C;  2GN5 A;  3MXN A;  2B63 H;  1SSO A;  2XWJ B;  4TQU S;  1WCM B;  4PQX A;  4ME3 A;  1A62 A;  4JVZ A;  1RTN A;  2B2U C;  3G71 A;  3VYR A;  3AFP A;  1XNR Q;  1TY2 A;  1IBL Q;  4FVM A;  1FGB D;  3E5S A;  5CV5 A;  3NEM A;  1SDF A;  1OXX K;  3BZK A;  2NVT H;  4R4T A;  1Y1V B;  1IYJ B;  3HGB A;  2WB1 G;  1I6H H;  4JI6 Q;  1N36 Q;  2Y0S E;  2AWN A;  4K5X A;  4FNF A;  4O1N A;  3CQZ H;  3PIP 3;  4RHR A;  3AB9 A;  3S9W A;  5M5Y H;  2PPB C;  3QR8 A;  3S1Q B;  1JJ2 A;  1H9M A;  3HOU B;  2EVB A;  1DON A;  4DV7 L;  1FNV A;  1BCP D;  2PQA A;  2QW7 A;  3A7L A;  3NWT A;  2C9O A;  3VR3 A;  4L5S A;  1YI2 A;  4M8A A;  1DOM A;  1SJH D;  1ICW A;  5AJ3 L;  1YJW A;  4Z9C B;  2AQ1 B;  1BF4 A;  1SYD A;  3HOW B;  3BG3 A;  1D5X C;  1C9O A;  3H0G G;  3I8Z A;  2QF7 A;  2DNE A;  2KBN A;  1Y1V H;  5JJK A;  4X64 Q;  2NVX H;  3G6J B;  2WV6 D;  3E0E A;  4LK1 C;  1SND A;  4KN4 C;  1HJP A;  1IBK Q;  2F0T A;  4MN3 A;  4I7A A;  1VQG A;  5IYC G;  2F0G A;  4DV0 L;  3PF4 A;  4A3D B;  3UDG A;  3IFD A;  4BWG B;  3GV6 A;  5C4H A;  4F7X A;  1BDO A;  3QOL A;  5J39 A;  1J6Q A;  1I3Q H;  2I5L X;  4LF8 L;  3GO5 A;  5IWA Q;  2JYO A;  3FP9 A;  4IUT A;  2RBM A;  2RA4 A;  4LFC Q;  3CMA A;  4OGQ C;  3PUV A;  5DLQ E;  3D6C A;  4BY7 B;  2L5T A;  1VQA A;  1PMR A;  4OXP A;  1RF2 D;  4KD3 A;  1VQ9 A;  1SYE A;  1QZG A;  4PMC A;  1S3O A;  4DR7 L;  1S72 A;  5IGG A;  5EPL A;  3MXG A;  1HA5 A;  3KJO A;  4V19 0;  4QIW E;  1SE2 A;  2VQE L;  4HSV A;  3VR6 A;  4P74 A;  4IPC A;  1SNC A;  4A3D H;  1M1K C;  3J7Z C;  1LTI D;  5IY0 A;  1Y1W H;  1MSG A;  4X66 Q;  1RDP D;  4CKE A;  5KYI A;  4DPG A;  1STY A;  1EYC A;  4KHP Q;  3NBI A;  4BY1 H;  1GJX A;  1MBY A;  2K50 A;  1Z6H A;  2DY7 A;  2H5X A;  3V96 A;  1IKM A;  1G2T A;  4HSP A;  5IT9 L;  5C0X H;  4R8I A;  4JI1 L;  1YNJ D;  1PZI D;  2CVR A;  5GAH C;  4LF4 L;  2L1B A;  1BUV T;  3E9I A;  4WJ3 M;  4N8X 1;  1IXR A;  4A3E B;  1O80 A;  1ILQ A;  1Q82 C;  4HJA A;  4IN3 A;  3AMU A;  2A69 C;  3OTO L;  1SXT A;  2UU9 L;  1QUQ B;  1HR0 L;  1VQE A;  3I4L A;  2RHQ B;  2EXZ A;  4GKJ L;  2KCT A;  4YY3 L;  2LS0 1;  2IW3 A;  3JAM c;  4OO1 H;  2R61 A;  3SK6 A;  2LSS A;  3DWP A;  2LFN A;  2MQH A;  4KJN A;  1GHK A;  4IFD I;  1KDA A;  1LTG D;  3R2T A;  1ESR A;  2EYO A;  1W2B A;  4N9P A;  5COR A;  3MEH A;  4JI7 L;  4DR5 Q;  2NN6 H;  3DHQ A;  1TWH B;  1K73 C;  1AZQ A;  1NUC A;  2XNA C;  3Q23 A;  4NP5 A;  4A3C H;  1IBM L;  2B2Y C;  2JA6 B;  4C3I B;  2HCC A;  1NMG A;  1K3R A;  3RZO H;  2B29 A;  4EGV A;  1UWV A;  4KN7 C;  5CV8 A;  1H9K A;  2N88 A;  1I6V C;  2E2J B;  1YBY A;  3DM3 A;  5M3M H;  2E2I B;  3SK8 A;  2PZU A;  1HNW L;  1ZYR D;  4C3H G;  3PO3 G;  3UE0 A;  1UUP A;  1LO5 D;  2KHI A;  4XDX A;  1UE6 A;  3A5Z B;  4LNQ A;  4B3T L;  1LUZ A;  5JJL A;  1PXU A;  2BCO A;  1HHV A;  2HIX A;  2R92 G;  4DK6 C;  3S1R H;  2HUG A;  4M1U B;  1PH2 A;  3KLW A;  4IOC A;  1O78 A;  1T9H A;  3PCO B;  1YNX A;  1I4Q A;  3J7Y W;  1T5X D;  1F9S A;  1ROD A;  2KHJ A;  2KVM A;  3NQT A;  4AH6 A;  1PYW D;  4UAI A;  4JI3 L;  2IY5 B;  5CGK A;  3DM1 A;  1S40 A;  3RLO A;  2VQF Q;  2H1E A;  3SVM A;  3L9A X;  1N34 Q;  4C3I H;  4X62 Q;  3M85 A;  3U50 C;  4IPG A;  3AEV A;  3HKS A;  4J15 A;  4A3J B;  1PZK D;  5JEA J;  3NHH A;  1NY4 A;  1QWY A;  3PIP A;  3OWE B;  1FJG Q;  3K7A H;  4RGO S;  4YCU A;  4DUZ L;  4OX9 L;  2RSN A;  5JJZ A;  1HNZ Q;  4GZY C;  3SK5 A;  2Y0S B;  4A93 B;  2VL6 A;  4C3J B;  1IKL A;  4JOI A;  4A3M B;  3BYY B;  5KND A;  5E4W C;  2CQO A;  2ALY B;  1X6O A;  2I46 A;  1X3Q A;  2F3I A;  2ATW A;  5M5X B;  1IW7 C;  2QEJ C;  1CKO A;  1CHQ D;  1T5E A;  2KCM A;  1GHJ A;  5GAE C;  1QJO A;  1E1T A;  2KUM A;  2HQE A;  4RG1 A;  1FNU A;  1LT6 D;  1NNX A;  1XMQ L;  4A3B B;  5ELC A;  1Q3L A;  4IZ8 A;  2EYP A;  2B2T A;  4QQB X;  4A3J H;  4XT1 B;  1SE4 A;  2TMP A;  3NTI A;  2D2C C;  4BY1 G;  5NUC A;  1EWH A;  4FYD A;  3DEP A;  1D5M C;  4B3R L;  2AUJ D;  2R93 G;  3CCL A;  3NEN A;  1STN A;  1JC7 A;  2VB3 X;  3HOV H;  3L3O C;  3D3R A;  5FKA C;  2DNC A;  1D2B A;  4A93 H;  4K5V A;  3RNU A;  5EBD A;  3URY A;  2Q8R E;  2PW5 A;  5M5X H;  5C4X B;  1TS3 A;  3U4Z A;  4UPA A;  1L1O C;  4ZYS A;  3CHB D;  2HHH Q;  1Q7Y C;  5AFW A;  5C3E B;  1AE2 A;  3X3M A;  1VQL A;  1N33 Q;  4XQJ A;  3WWV A;  5IGF A;  4ABN A;  5FO9 B;  5EQ0 A;  1L0W A;  4KKU A;  1HZA A;  3KF6 B;  2CCZ A;  3ND8 A;  3E6Z X;  2NN6 G;  1U4R A;  2JEB I;  3QJY A;  4R1J A;  2O4X A;  4B08 A;  2NZH A;  1K0S A;  3S1M B;  3P7J A;  2ZXR A;  1I4H A;  5M3F B;  2PNR C;  4QIW B;  2K6A A;  4DK0 A;  4H0L C;  4HCE A;  2Q2I A;  4RCO A;  3FEW X;  3DLL A;  4LF7 L;  2AQ2 B;  2Z4H A;  2JQO A;  2JA8 G;  1PVO A;  3C46 A;  3S2D B;  5JVH 3;  3GTL H;  4DN4 M;  5FJ8 H;  3IFT A;  4DKA C;  4POF A;  5C4X H;  4Y7N H;  4DR2 Q;  2YU9 H;  5M5W B;  1RL2 A;  2L9H A;  5DM6 3;  2YTY A;  3CF5 A;  1LLR D;  1K9M C;  2R7Z G;  2YV5 A;  1HZB A;  3GTM B;  1QOH A;  3RZD B;  1X3G A;  3M4O B;  1S5D D;  1ENA A;  1SFO B;  3GTP H;  4A3G G;  1QG7 A;  1I4X A;  5ELF A;  2CWP A;  1WOC A;  2R7D A;  4CBV A;  2CW0 D;  5C44 G;  4DU9 A;  5M3F H;  1PFM A;  3NBH B;  3T1Y Q;  4K6L A;  4JBW A;  1XPO A;  5K36 H;  1EWC A;  2K4K A;  3PQI A;  4CDE C;  2A5H A;  2A73 B;  4DV5 L;  1U9R A;  3AQQ A;  2D5D A;  1HQM C;  1STE A;  5HUR A;  1EQV A;  4A75 A;  1G51 A;  4RH6 A;  4DUY Q;  3TS2 A;  5HY6 A;  1QUQ A;  1YHQ A;  2Z6B A;  5BR8 L;  4PMW A;  4DK1 A;  1DGS A;  3C3L A;  1JE4 A;  3G6E A;  5EBC A;  4KY7 A;  3TP7 A;  1HTL D;  1A2U A;  1L1O B;  1PFN A;  3FKI B;  3GTM H;  3S16 H;  5I2Y A;  4NB3 A;  3RZD H;  2UUA Q;  2HIV A;  3LGJ A;  3K57 A;  4LF9 Q;  1SFO H;  3VYT A;  1VQO A;  1EYA A;  1SMX A;  1B9M A;  4DR1 L;  4JI8 Q;  1TY0 A;  5HGT A;  5FLX c;  1I4P A;  1JJC B;  1BCP C;  1YIT A;  1EUJ A;  1E1O A;  4FXD A;  1F9P A;  2FMC A;  1R9T H;  1WTR A;  1VQK A;  1IYV A;  3J81 c;  3CME A;  1DD2 A;  4DNI A;  4G7Z C;  2ZJQ A;  1KAA A;  1OXS C;  1XMO L;  3KYH C;  1FGU A;  1B44 D;  3SK4 A;  4CDF C;  4IUR A;  4JBM A;  3C1F A;  1HXY D;  1YIJ A;  3HOV G;  2UXC Q;  3S2H B;  1J5E Q;  1IL8 A;  4UHV A;  1LTR D;  1TWC B;  2F1M A;  4LFB Q;  3STB D;  3ULL A;  1MKH A;  3PSI A;  1NR2 A;  2JN4 A;  2WFW A;  2G9D A;  2JA5 G;  3KLR A;  2WAQ E;  2ZJP A;  1I94 L;  2VNU D;  1NJI C;  4K5W A;  4R8N A;  4FF1 A;  1DJR D;  2K5N A;  2F0Q A;  1VMP A;  1Y8O B;  1O7Z A;  4DV4 Q;  3HOZ B;  1BCP F;  2JA7 B;  1AZP A;  4RGM A;  4DV6 Q;  3RN5 A;  1SRO A;  4LWC A;  5K5P A;  4DNR B;  3TME A;  5CV9 A;  4QGU A;  2IT1 A;  2I07 B;  2K5H A;  1XTC D;  4K14 A;  4HJ5 A;  4C1N K;  5GAD C;  1QNK A;  2Z4I A;  1E22 A;  1B3Q A;  1EEI D;  1TWC H;  3PUX A;  4JI0 Q;  3I7F A;  1JWM D;  4BBS B;  2LXJ A;  4EQ5 A;  1C48 A;  4HCS A;  2NVY H;  1XNR L;  1LTA D;  2F0D A;  2LMC B;  1AN8 A;  1IBL L;  4J6H A;  1JE5 A;  3ONA B;  3CRK C;  2B39 A;  5DM7 3;  4MNO A;  1YNJ C;  1UE7 A;  1VQM A;  2IJ0 A;  3S15 H;  1STH A;  2A6E D;  4ZKB B;  1NTG A;  1N36 L;  1MJE A;  1N32 Q;  4YWK A;  2B2Y A;  1X32 A;  1UEB A;  5LMU L;  1U4L A;  3KLS X;  4LF6 Q;  1EY5 A;  2CKZ B;  1CSQ A;  1I4G A;  2KQ3 A;  1XPU A;  3GTQ H;  3H0G H;  1EY6 A;  4K2K A;  4JOI C;  1H9S B;  2BDN A;  3CXC A;  1O7L A;  5D65 A;  3KLS A;  4MTN A;  1OTC A;  2A19 A;  1TS4 A;  2F0L A;  1ML0 D;  4RHS A;  2WAC A;  3TP5 A;  3MFY A;  1EZ8 A;  1H95 A;  1E0B A;  2OEO A;  1PRT B;  1RJT A;  2QA4 A;  4DR4 Q;  4X64 L;  2VS1 A;  1CZG A;  2KEN A;  5JPM C;  2KCC A;  3CCS A;  3K80 C;  3OOC A;  4JG2 A;  3I70 A;  3ERS X;  5E3F A;  2OTJ A;  2OXP A;  5GQO A;  3K7U C;  1GUT A;  4PV1 C;  4CKB A;  1Q8I A;  3KF6 A;  4CJ2 C;  1QZH A;  4RAU C;  2ES2 A;  1YNN C;  2F0E A;  2JE6 I;  4XTC S;  5IWA L;  2B63 B;  4EQN A;  4A3I H;  1A3V A;  4AYB G;  4DAY B;  4LFC L;  1WFQ A;  3KF8 A;  4GLX A;  1KRT A;  1EEF D;  3A0J A;  2MO0 A;  3HKZ G;  2AHO B;  3I72 A;  1JOQ A;  1VQ8 A;  5IIF A;  4X6A H;  1TU2 B;  1A6X A;  1D7Q A;  2AMC B;  4EX5 A;  3JAM E;  1FYC A;  2XRQ D;  2NVT B;  2KEC A;  1I6H B;  4ZUJ A;  3M3Y H;  2OTL A;  2FFK B;  1A15 A;  4GNX B;  1BR9 A;  1W6J A;  2ICI A;  1EIF A;  2XIW A;  4RGT A;  5M5Y B;  1EY0 A;  5EPJ A;  2X6G A;  4DR3 Q;  4JI2 Q;  4JBJ A;  5CYU A;  4B3S Q;  5KRU A;  2BE5 D;  3VDY A;  4C2M H;  4C3H B;  2LKV A;  3NBH A;  4GKK Q;  3I55 A;  5LHY 1;  4OWT B;  3MA2 B;  4O42 A;  2P5Z X;  1WTX A;  5IP9 G;  1CKM A;  1NBW A;  3MZ5 A;  3CC7 A;  2UXB L;  3QOJ A;  3M4Q A;  1MJC A;  2J7Z A;  3MXP A;  1HUM A;  3EJI A;  3UI2 A;  1WI5 A;  3A8I E;  2PCF B;  4S3S A;  4WJ4 A;  1PH5 A;  2NVX B;  2AUK A;  1L1O A;  2WII B;  3MAQ A;  3PF5 A;  2EJF C;  2Z0S A;  3T1H L;  1RCV D;  3G48 A;  2HT1 A;  4HAE A;  3GTK B;  2DUD A;  2N3S A;  1AP0 A;  5LL6 X;  3HOY G;  1WYD A;  2XN9 C;  1I3Q B;  4C3H H;  4GLA C;  1RKN A;  2N78 A;  1N9W A;  3PO3 H;  2V4D A;  1CM9 A;  1NSN S;  2K75 A;  3MWY W;  1WTP A;  5DNF A;  4JI4 L;  1JOR A;  2PO4 A;  2F0U A;  1F77 A;  2R92 H;  1TWG H;  1NCV A;  1VS0 A;  4ZCK A;  1CA6 A;  3U9O A;  1K8G A;  1ET6 A;  3I90 A;  1E2W A;  4P73 A;  3D0F A;  2EYL A;  2WAQ B;  1KL9 A;  5EAY A;  3KFU A;  1MGS A;  1V1Q A;  3T4A C;  4DF7 A;  1CFM A;  4IJH A;  1STG A;  1OXU A;  2PI2 E;  2F4I A;  3JAM i;  4PZ7 A;  3O13 A;  1Y1W B;  1G29 1;  2DY8 A;  5IP7 G;  3GTK H;  1PRT D;  2XSC A;  3EN2 A;  5BN4 A;  4BY1 B;  2SNM A;  1EQQ A;  3F2D A;  1WTH A;  3FPP A;  1AEX A;  1IHZ A;  4X3U A;  3D4W A;  1EOV A;  5C3X A;  1UAP A;  1S4Z A;  2X69 A;  2NB0 A;  4K0K L;  4DNT B;  3G4S A;  3U4V A;  5C6A A;  1N34 L;  1HH2 P;  2JK8 A;  1BBU A;  2Z8L A;  2XTI A;  5C0X J;  2HDM A;  3L0O A;  3KOJ A;  3TQY A;  3C2P A;  5FLX L;  4A76 A;  4DV3 L;  2ZJR A;  1R4P B;  4NDX A;  4A3I G;  4Q5V A;  2D62 A;  3R93 A;  2G5D A;  4KI0 A;  1XNQ L;  1EFW A;  2F3V A;  1Y14 B;  2H4O A;  3I91 A;  1Q90 A;  1KAB A;  2UXD Q;  2OQ0 A;  4R4C A;  1EU3 A;  1JR0 D;  2RF4 A;  5I6W A;  1HZC A;  3TP8 A;  4FDB A;  2CW0 C;  4XT3 B;  4X65 L;  5CC4 A;  5GAG C;  2R93 H;  4U68 A;  2K5W A;  4NXM L;  3TRE A;  5C3W A;  2RCN A;  4KLK A;  4B3M Q;  3ND9 A;  3Q24 A;  1JMC A;  3RZO B;  1GUN A;  4JC0 A;  3RMH A;  4BA2 I;  4I65 A;  5M3M B;  3FVQ A;  4PMB A;  4YHH Q;  2RHS B;  1FD7 D;  4TKO B;  2F4V L;  4LF5 L;  4ME5 A;  3EFX D;  3BJU A;  1CHP D;  1Q1B A;  4HR7 B;  3U9S A;  4IO9 A;  2B3G A;  1SMY C;  1UNS A;  1H9S A;  1TQO A;  3N6R A;  4GN5 A;  1VQP A;  3S17 H;  4YWM A;  4AYB E;  4LJZ C;  4FO2 A;  3N52 A;  3S1R B;  4H02 A;  3HOX G;  3Q8D A;  1J8I A;  3CCV A;  4ZRZ A;  4CJ1 B;  5IE8 A;  1PFB A;  2K32 A;  3I4M H;  1SR3 A;  4L8J A;  1AW7 A;  4A3G B;  1WD0 A;  4BBR H;  1WJJ A;  3OIP A;  1CKN B;  1D1I A;  2F0H A;  2Q2U A;  2D0P A;  3TSS A;  2UUB L;  1HZ9 A;  4QUC A;  5FO8 B;  3WOE A;  3BZD B;  1JB3 A;  1XTD A;  4A3L G;  2JA8 H;  4CDC C;  1TII D;  2B2W A;  3K6O A;  1TKW B;  3MFG A;  1IYU A;  3BVM A;  4DV7 Q;  3K7A B;  4L5R C;  1Z7T A;  4AIM A;  1OXT A;  1SYC A;  1HA6 A;  4OEL B;  2R7Z H;  4DAY A;  5ELD A;  5AJ3 Q;  1LTS D;  3STB C;  1B2T A;  2EXD A;  2JXM B;  3VA7 A;  1UE1 A;  1NE3 A;  4DAV A;  2BA1 A;  1CI3 M;  2SEB D;  3A54 A;  4A3G H;  1KAW A;  4ZK9 B;  3V2T A;  2FIN B;  4DR2 L;  4A3K G;  1JJG A;  5C44 H;  1VQ6 A;  1B70 B;  2WB1 E;  5KNC A;  3RN2 A;  2ZTD A;  1YVC A;  4QL5 A;  4DV0 Q;  2C35 B;  1Q46 A;  2EJM A;  5CR3 A;  2F0S A;  4L5T A;  2KJX A;  5FLX E;  4LF8 Q;  2RQX A;  1JIC A;  1PLF A;  1KIX A;  3ZJY C;  2MFI A;  4ILW A;  1TWA H;  3H3V I;  3HOV B;  2UUC L;  1LAB A;  3J81 E;  3CPW A;  4IPD A;  1K28 A;  4X3T A;  2PNH A;  4G4K A;  2K33 A;  3SE0 A;  4IUU A;  1U0L A;  4DR7 Q;  1ET9 A;  1QB5 D;  2ZXP A;  5CV7 A;  2X6L A;  3A74 A;  4BXX G;  1X55 A;  5I2X A;  2MJ8 A;  5I9O A;  1Y8P B;  4UDU C;  2VQE Q;  1PH8 A;  1CA5 A;  4MIU A;  3T51 B;  4DFA A;  1B9N A;  4RFB A;  3D8G A;  3MC0 B;  5E7N A;  1MSH A;  2BH2 A;  3HOW G;  4JBK A;  3F1Z A;  4NPS A;  3Q0A A;  2NBF A;  3TEH B;  4JYA Q;  4JI8 L;  5FK9 C;  4JI1 Q;  5EPK A;  2RDG A;  4LFA L;  3F2U A;  5I9P A;  4LF4 Q;  3D4D A;  2YYZ A;  2GA4 B;  2O5J C;  1VQN A;  3OTO Q;  2UU9 Q;  3GTL B;  1HR0 Q;  4RKL A;  4Y52 H;  3HS0 C;  1EY9 A;  1JB7 A;  3BDC A;  4Y7N B;  2JA5 H;  4C1N I;  2YU9 B;  2ASB A;  4GKJ Q;  3W3A A;  2HDL A;  3U58 A;  1NR4 A;  3GTO H;  2I0Q A;  4BY7 G;  3NEL A;  1X3P A;  3RLF A;  2MHV A;  1PA6 A;  5D3D A;  1BBX C;  4JCV E;  3I4M G;  1F2M A;  4XQQ A;  3HZX A;  3GTP B;  1K83 H;  1S5E D;  1SYB A;  4HTH A;  1XX8 A;  1PYS B;  4BBR G;  4DK3 C;  4JI7 Q;  5IGB A;  2OQK A;  4NXN L;  2O2L D;  2ZTE A;  4BS9 A;  1X3E A;  1TT2 A;  2CH4 A;  4DV2 L;  4JV5 L;  3T16 A;  4HMJ A;  1VQC A;  4V0B A;  3AU7 A;  4P71 A;  4MZ9 A;  2CWA A;  1MIU A;  1C8C A;  1HNW Q;  4ID6 A;  3J81 i;  5J1Z A;  3OMG A;  3HFZ B;  2D0O A;  1WTQ A;  4B3T Q;  1TS2 A;  1J9O A;  2E5L L;  3EIV A;  2IX3 A;  3S16 B;  1FNW A;  3H3V C;  4G7H C;  2ZM6 L;  5EJW A;  5IYD G;  1L0X B;  1XYI A;  1GVP A;  1FR3 A;  2K01 A;  3J80 c;  2EY6 A;  3CC4 A;  1VQJ A;  3MTS A;  5DEH A;  2WIN B;  1DOK A;  2F0V A;  1R9T B;  3QIA A;  2E2D C;  4AYB B;  4DV1 L;  5HGQ A;  1LTT D;  3I4N G;  4DXF A;  3QB3 A;  5A2Q E;  5DAU A;  2E2H H;  4FXK C;  2A68 D;  4QMG A;  2N49 A;  5EGT A;  4DUZ Q;  5COY A;  1VF7 A;  1GUS A;  3KDF B;  2JSO A;  4GN4 B;  1CQF A;  2F0P A;  4LMQ D;  3OW7 A;  1KDC A;  4R4O A;  2K5Q A;  4TSS A;  2WKD A;  4KTA A;  4KHZ A;  3F2B A;  3NUC A;  3SXH A;  2K04 A;  4RKB A;  3CC2 A;  1DOL A;  2NTT A;  4L6T B;  3K8A A;  4DR4 L;  1CKN A;  4IUV A;  3SDZ A;  3CAM A;  1K3B C;  4PZ8 A;  1HRJ A;  5I4D A;  3OMC A;  2QKI C;  5CBE E;  1DM0 B;  1XMQ Q;  1EY4 A;  1EY8 A;  1SN8 A;  1YZ6 A;  4OHJ A;  1X56 A;  2WP8 J;  1SNO A;  5F2D A;  3RD4 A;  1VQ4 A;  3FRP B;  2VW9 A;  1X54 A;  1EY7 A;  2M9V A;  4I7Z C;  4IFD H;  5JEA G;  3A8K E;  4B3R Q;  2R6G A;  4POG A;  4OWW B;  1SEB D;  4MTK A;  5ELN A;  2F0I A;  3KK7 A;  3CCQ A;  4A3F H;  2WB1 B;  4F8M A;  2A74 C;  4GOP C;  3NSW A;  5J3B A;  4KKS A;  2GVB A;  1Q8K A;  2Z6K A;  2NVY B;  2L11 A;  1PH9 A;  1PRT C;  1YEZ A;  1SYG A;  4K2L A;  3J7A V;  4F87 A;  5JOB A;  1A63 A;  1GXD C;  5IT9 c;  3GTJ B;  2R7F A;  1B50 A;  3R2I A;  3JAM L;  1KHI A;  4C3J G;  3PO2 H;  3S15 B;  4NW2 A;  3NXW A;  2JEA I;  3S14 B;  2B2W C;  1PH3 A;  3OPO A;  4KK7 A;  3T13 A;  4DR6 L;  5IP9 H;  4QF4 A;  4FF2 A;  1OO9 B;  5H1S E;  1WTO A;  3ULJ A;  2RSO A;  3GTQ B;  3H0G B;  1ILP A;  3EVQ A;  4GKK L;  3WDN A;  1KD1 C;  4A3B G;  3W1G A;  4UP7 A;  1H9R A;  3PGZ A;  1ONL A;  4LF7 Q;  1A8V A;  2PQE A;  3M4Y A;  5C0X I;  2EYF A;  3GTG H;  4DA2 A;  4IJL A;  2ZT9 C;  4FXG C;  3IRB A;  1M8A A;  1O7I A;  3GQB A;  1WTW A;  1Z47 A;  3LX0 A;  1E3P A;  3GTJ H;  1V1P B;  3HOY H;  1BXT A;  2EZV A;  3IAY A;  1PRT F;  4GNX C;  1TVX A;  4JI6 L;  3CKI B;  1F2L A;  3S14 H;  1YHB A;  1TS5 A;  2J0T D;  4ZAI A;  4B9W A;  5C4J H;  1MHW C;  2BOS A;  3KBX A;  2EIF A;  1S5F D;  2EYM A;  4OO1 I;  1CQV A;  2NTS A;  3A56 A;  3OIQ A;  3TRZ A;  1IW7 D;  1FL0 A;  4RGN A;  4DAP A;  4K8I A;  4A3I B;  3F8T A;  1PTO H;  4XXE A;  2NYZ D;  4NMZ A;  2PI2 A;  5G3L D;  2WKC A;  2NN6 I;  4GOP B;  3MEF A;  2PMZ E;  3R8B A;  5IP7 H;  3LNN A;  3P1H A;  5BR8 Q;  1CTM A;  5IGC A;  3SEB A;  3M9B A;  2L0C A;  1KLU D;  2EY1 A;  2F03 A;  1KNE A;  2CFM A;  4TVA B;  1UE5 A;  3M3Y B;  2M2L A;  4KJO A;  1EQT A;  1IBK L;  1G2S A;  4LW1 A;  1KQS A;  5L37 A;  1TR5 A;  3L7Z C;  3WOF A;  4F88 A;  5CBA E;  1EU4 A;  3K5O A;  4DR1 Q;  4PG3 A;  4DGZ A;  1ZYR C;  3E9H A;  1HNX Q;  4ZKC B;  4C2M B;  1B7Y B;  1Y69 U;  2DGY A;  1N8R C;  1GUO A;  2G9H D;  4IPH A;  1X3F A;  3ERO A;  3VYS A;  4IFD G;  2BH8 A;  3HOX B;  1XMO Q;  3S1N H;  1Z9F A;  2FHT A;  3FPU B;  5C5L A;  3H6M A;  3I4O A;  2E74 C;  5A35 A;  1GM5 A;  1RHP A;  1VQD A;  4A3F G;  1PHJ A;  1HPC A;  3BZC A;  1LTB D;  1CK1 A;  3CCE A;  4XIG S;  2F0M A;  5EKK A;  1W3S A;  4X66 L;  1K0R A;  1HFN A;  4KHP L;  3ITP A;  4LUZ A;  1JT8 A;  4PZ6 A;  2DN8 A;  3ER0 A;  3NP8 A;  4YCW A;  2MPM A;  1A3U A;  2IHF A;  1B53 A;  1QIL A;  3PO3 B;  3PO2 G;  5LMN Q;  1QCB D;  3IL8 A;  4HIM A;  3HRZ C;  4B3M L;  2M00 A;  2VUM G;  2R92 B;  1TWG B;  3ULP A;  1Q1E A;  1D8L A;  5C5M A;  3K5L A;  3HOX H;  2L4N A;  3JC6 6;  5ISR A;  4YHH L;  3I56 A;  3L2P A;  2KA7 A;  2FXQ A;  4A3K B;  1PTO D;  2MP1 A;  4LAA A;  3TZD A;  2Q2H A;  1S5B D;  3KDF A;  2NZ1 D;  5EKL A;  2IX1 A;  4QUF A;  2K28 A;  4C56 C;  5IOC A;  2B8F A;  4KKT A;  4IQZ A;  1BKB A;  2PYK A;  4X3S A;  2ZTC A;  2OF1 A;  4A3L H;  1YJ9 A;  1SNM A;  1HTP A;  4DR5 L;  1WTV A;  3NTK A;  1KRS A;  2OWO A;  1B8A A;  2KOL A;  1PFS A;  2R3Z A;  4R9W A;  2E8G A;  1EWI A;  2B8G A;  1HQR D;  1SLJ A;  4GS3 A;  2NWG A;  5BN3 A;  1TWF H;  4FF4 A;  1IL2 A;  1QVC A;  5LMU Q;  3LWE A;  2IWH A;  1BNZ A;  1LAC A;  1GO3 E;  3J80 L;  4HIO A;  1GUW A;  2MUY A;  3CW2 C;  1C0A A;  4A3K H;  5T1G A;  1WCM H;  3QWN A;  3T53 B;  2KED A;  3HOZ G;  4OL7 A;  1DXM A;  2JA7 G;  2B2V A;  2XRS D;  1EZ6 A;  4HED A;  3K58 A;  4QCL A;  1F9R A;  2EY2 A;  5IGD A;  2A8V A;  2IHE A;  2K5V A;  1VF5 C;  1SNQ A;  4AQY Q;  2R93 B;  4WJW A;  2VQF L;  1B1Z A;  1PDQ A;  5JPN C;  4BBS G;  4X62 L;  2N55 A;  3BS1 A;  1Q81 C;  3DUZ A;  5BN5 A;  2F0K A;  2ID0 A;  1PV4 A;  3S1Q H;  1EYD A;  1JWS D;  1AH9 A;  3HOU H;  1VQI A;  5LMN W;  1FJG L;  2IX0 A;  3T56 B;  1Q86 C;  4L5Q A;  3VR2 A;  3A8J E;  1G8Z D;  5FLM H;  1JWU D;  4BXX H;  1ZEQ X;  4B9X A;  3HEJ A;  1SNP A;  1A0I A;  2Z6K C;  1VQH A;  1HNZ L;  4OWX B;  3S17 B;  4XQN A;  3J81 L;  1ASY A;  5I6Y A;  2MO1 A;  3UE1 A;  3HOW H;  3PUY A;  3I4M B;  4JI5 Q;  1XWE A;  1BOS A;  4BBR B;  4U67 3;  3NQI A;  1V1P A; 
#chains in the Genus database with same CATH homology
 5EKI A;  1DZ1 A;  1ESF A;  3OWF A;  1VMC A;  5KGU A;  1A2T A;  1K8O A;  4ZUI A;  2JA8 B;  2PMZ B;  2A68 C;  3DMU A;  1LT3 D;  3RUZ A;  3M7N A;  1EIH A;  2IPK D;  2E75 C;  2R7Z B;  3HG9 A;  2EE1 A;  2K05 A;  2QIL A;  3I3C A;  5J22 A;  1LT5 D;  4OIJ A;  3MXU A;  1W6K A;  3VR5 A;  5C44 B;  2IL8 A;  4IUP A;  3K5M A;  2PW7 A;  3EQL C;  3K5N A;  5TSS A;  1S5C D;  2SNS A;  4EQP A;  5C4Z A;  1E2Z A;  3I4N B;  3J80 E;  4G57 A;  1F2Y A;  4PNY A;  1TWA B;  4OIK A;  3TZU A;  5D14 A;  4EQO A;  4CGY B;  1O7Y A;  3VR4 A;  4KHV A;  3DEO A;  3H09 A;  3NE5 B;  4ZQ3 A;  2O5I C;  5KIX A;  4KV6 A;  2AQ3 B;  1YNN D;  1SAP A;  3J7A F;  5D3I B;  1V8Q A;  3FMC A;  3KUP A;  5KEE A;  3TP6 A;  3NTH A;  2NVQ B;  1GUG A;  2EDG A;  1JOK A;  4KD4 A;  4EVO A;  4ULL A;  2XWB B;  1CT1 D;  3SR1 A;  1ENC A;  5A2Q L;  2JA5 B;  4H13 C;  3LWU A;  5JAV A;  2A6H D;  3ERQ A;  2A6E C;  3Q22 A;  3GTO B;  4IAL A;  1DCZ A;  3HP3 A;  2MGS A;  2K7V A;  5FO7 B;  5ELB A;  1K83 B;  2RVL A;  4XYO A;  2Q8I B;  5IT9 E;  1WVL A;  1ENF A;  5JEA H;  4WRD A;  3G7L A;  2L55 A;  2FJ2 A;  4HMI A;  3DWQ A;  4DXG A;  2CHB D;  2EJG C;  2RKS A;  2L12 A;  2BDO A;  3CU7 A;  4RA8 A;  5C0X G;  1HCZ A;  2K5D A;  2EY5 A;  1SE3 A;  1EOT A;  3BYT B;  4BA1 I;  4E6I A;  3BDO A;  5E1F A;  1DYQ A;  5FOB B;  2LY7 A;  3H94 A;  3I73 A;  1Y8N B;  3BDL A;  2F0N A;  4YIJ A;  1Q12 A;  1U4M A;  3GD7 A;  1R4Q B;  2F3W A;  3PIO 3;  4P2C B;  2QCP X;  4RWS C;  4OO1 G;  1K8M A;  3BVG A;  4KMU C;  3D6W A;  2C5C A;  3PV0 A;  2JP1 A;  2CQA A;  4NKL A;  2E2H B;  3K59 A;  5G3L F;  1JQY D;  2B2V C;  1QNU A;  3FDT A;  2VB2 X;  3M7G A;  1II3 A;  5ELE A;  2B2U A;  2F0F A;  3KBG A;  2BE5 C;  1STB A;  4KY6 A;  1BO0 A;  4H7B A;  1AFP A;  4ODG A;  3TN2 A;  1VDZ A;  1SYF A;  1SBB B;  3HKZ B;  4Q0F A;  1MD2 D;  4G7O C;  2RDH A;  2XVS A;  1PTO C;  2NUC A;  4C3I G;  4KY5 A;  4XYQ A;  4A3F B;  2TSS A;  5KNB A;  1BQQ T;  1B3A A;  4IFD J;  2A69 D;  2K1B A;  2KHS A;  4FF3 A;  5LL6 S;  2QDB A;  4WFN 3;  2J4X A;  1ZXT A;  1KTK A;  2SOB A;  1SMY D;  4TRD A;  1EIG A;  3A7A B;  3PO2 B;  3QO2 A;  1KNA A;  3EA6 A;  1V43 A;  1MI2 A;  3MVV A;  2VUM B;  2EYJ A;  1LV9 A;  3PUZ A;  2F0J A;  3P20 A;  1V1O A;  3GP7 A;  3CRL C;  3IKJ A;  4HN7 A;  4QB4 A;  4JK1 C;  3GTG B;  1PTO F;  4RCN A;  3NK9 A;  3QG1 A;  3HOY B;  1STA A;  4CHT B;  4X3K A;  5CV6 A;  1B4O A;  1GOZ A;  1G91 A;  5M9O A;  1ZKO A;  4N9T A;  1KDB A;  5C4J B;  5KYL A;  1RTO A;  3V05 A;  2EOT A;  3X3N A;  3H91 A;  5JVG 3;  3OHX C;  4H44 C;  5IGE A;  3DWA A;  1PTO B;  4FP5 D;  1PZJ D;  2F0O A;  3NWS A;  1HFG A;  2VXW A;  1EFI D;  5E4X A;  1OXV A;  4MHE A;  3SHL A;  2K03 A;  1UEA B;  2ICE C;  1CZW A;  4J1M A;  3W2D A;  1WD1 A;  2EYH A;  3E0J A;  1U4P A;  1A3T A;  2F0W A;  2SDF A;  1D1K A;  3GV3 A;  3P75 A;  4WOR A;  1XXG A;  1BCP B;  1I50 B;  4IUN A;  1RD9 D;  4J8Q A;  2E76 C;  5CV4 A;  1JOO A;  2HCI A;  3TDQ A;  1E2V A;  1LT4 D;  2FMM A;  4ZLT F;  3S1N B;  2BA0 A;  3PUW A;  5K36 G;  3D31 A;  1L0Y B;  1KLG D;  1NAP A;  1G6Z A;  3A55 A;  3MHB A;  2ENB A;  1D5Z C;  2EPB A;  2AWO A;  2OT2 A;  2KCN A;  3Q6S A;  1JCK B;  1M4V A;  5IOD A;  2B2T C;  2ZXO A;  1QE6 A;  1F2Z A;  3NPP A;  3VA5 A;  2Z1C A;  4CKC A;  4CJ0 B;  1H9J A;  1F9Q A;  3OSO A;  3C1E A;  1SJE D;  3BVZ A;  3PMF A;  3TBI B;  2RDF A;  5T1I A;  1VCI A;  3K0Y A;  5CMD A;  2D9U A;  2Q8T A;  3D4R A;  2PZT A;  1EL0 A;  4L63 B;  1HUN A;  4K8J A;  4K6D A;  3CQZ B;  3DXJ C;  1TWF B;  3R3O A;  4IUQ A;  3VYU A;  3ZYY X;  1I4R A;  2PZW A;  1C4Q A;  1D6E C;  2KEE A;  2A6H C;  3MXN A;  1SSO A;  2XWJ B;  4TQU S;  1WCM B;  4PQX A;  1RTN A;  2B2U C;  3VYR A;  1TY2 A;  4FVM A;  1FGB D;  3E5S A;  5CV5 A;  1SDF A;  1OXX K;  1Y1V B;  3HGB A;  2AWN A;  4K5X A;  4FNF A;  4O1N A;  3PIP 3;  4RHR A;  3AB9 A;  3S9W A;  2PPB C;  3S1Q B;  1H9M A;  3HOU B;  2EVB A;  1DON A;  1FNV A;  1BCP D;  3A7L A;  3NWT A;  2C9O A;  3VR3 A;  4M8A A;  1DOM A;  1SJH D;  1ICW A;  4Z9C B;  2AQ1 B;  1BF4 A;  1SYD A;  3HOW B;  3BG3 A;  1D5X C;  3I8Z A;  2QF7 A;  2DNE A;  3G6J B;  2WV6 D;  4LK1 C;  1SND A;  4KN4 C;  2F0T A;  4MN3 A;  2F0G A;  4A3D B;  3IFD A;  4BWG B;  3GV6 A;  5C4H A;  4F7X A;  1BDO A;  3QOL A;  5J39 A;  3GO5 A;  2JYO A;  4IUT A;  2RBM A;  2RA4 A;  4OGQ C;  3PUV A;  3D6C A;  4BY7 B;  2L5T A;  1PMR A;  1RF2 D;  4KD3 A;  1SYE A;  4PMC A;  5IGG A;  5EPL A;  3MXG A;  1HA5 A;  4V19 0;  1SE2 A;  4HSV A;  3VR6 A;  1SNC A;  1LTI D;  1MSG A;  1RDP D;  4CKE A;  5KYI A;  1STY A;  1EYC A;  3NBI A;  1GJX A;  1MBY A;  1Z6H A;  2DY7 A;  3V96 A;  1G2T A;  1IKM A;  4HSP A;  5IT9 L;  5C0X H;  4R8I A;  1YNJ D;  1PZI D;  2CVR A;  2L1B A;  1BUV T;  4A3E B;  1ILQ A;  1O80 A;  4IN3 A;  3AMU A;  2A69 C;  1SXT A;  3I4L A;  2EXZ A;  2LS0 1;  2IW3 A;  4OO1 H;  2R61 A;  3SK6 A;  3DWP A;  2LFN A;  4KJN A;  1GHK A;  4IFD I;  1KDA A;  1LTG D;  3R2T A;  1ESR A;  2EYO A;  4N9P A;  5COR A;  3MEH A;  2NN6 H;  3DHQ A;  1TWH B;  1AZQ A;  1NUC A;  2XNA C;  3Q23 A;  4NP5 A;  2B2Y C;  2JA6 B;  4C3I B;  2HCC A;  4EGV A;  4KN7 C;  5CV8 A;  1H9K A;  2N88 A;  1I6V C;  2E2J B;  2E2I B;  3SK8 A;  2PZU A;  1ZYR D;  4C3H G;  1UUP A;  1LO5 D;  4XDX A;  1HHV A;  1PXU A;  2BCO A;  2HUG A;  4M1U B;  1O78 A;  1I4Q A;  3J7Y W;  1T5X D;  1F9S A;  1ROD A;  2KVM A;  3NQT A;  1PYW D;  4UAI A;  5CGK A;  3DM1 A;  2H1E A;  3SVM A;  3L9A X;  3M85 A;  4A3J B;  1PZK D;  5JEA J;  3NHH A;  1QWY A;  3OWE B;  4RGO S;  2RSN A;  5JJZ A;  4GZY C;  3SK5 A;  2Y0S B;  4A93 B;  4C3J B;  1IKL A;  4A3M B;  3BYY B;  5KND A;  5E4W C;  2I46 A;  1X3Q A;  5M5X B;  1IW7 C;  2QEJ C;  1T5E A;  1CHQ D;  1GHJ A;  1QJO A;  2KUM A;  2HQE A;  1FNU A;  1LT6 D;  4A3B B;  5ELC A;  1Q3L A;  4IZ8 A;  2EYP A;  2B2T A;  4XT1 B;  1SE4 A;  2TMP A;  3NTI A;  2D2C C;  5NUC A;  1EWH A;  4FYD A;  3DEP A;  1D5M C;  2AUJ D;  1STN A;  1JC7 A;  2VB3 X;  3L3O C;  3D3R A;  5FKA C;  2DNC A;  1D2B A;  4K5V A;  5EBD A;  3URY A;  2Q8R E;  2PW5 A;  5C4X B;  1TS3 A;  4ZYS A;  3CHB D;  5AFW A;  5C3E B;  3X3M A;  4XQJ A;  5IGF A;  4ABN A;  5FO9 B;  5EQ0 A;  4KKU A;  3ND8 A;  3E6Z X;  2NN6 G;  1U4R A;  2JEB I;  3QJY A;  2O4X A;  4B08 A;  3S1M B;  3P7J A;  2ZXR A;  1I4H A;  5M3F B;  2PNR C;  4QIW B;  2K6A A;  4DK0 A;  4H0L C;  4HCE A;  4RCO A;  3FEW X;  2AQ2 B;  2Z4H A;  3C46 A;  3S2D B;  5JVH 3;  4DN4 M;  3IFT A;  5M5W B;  2L9H A;  5DM6 3;  1LLR D;  3GTM B;  1QOH A;  3RZD B;  3M4O B;  1S5D D;  1ENA A;  1SFO B;  1QG7 A;  1I4X A;  5ELF A;  4CBV A;  2CW0 D;  4DU9 A;  1PFM A;  4K6L A;  4JBW A;  5K36 H;  1EWC A;  2A5H A;  2A73 B;  1U9R A;  2D5D A;  1HQM C;  1STE A;  5HUR A;  1EQV A;  4RH6 A;  4PMW A;  4DK1 A;  3C3L A;  1JE4 A;  5EBC A;  4KY7 A;  3TP7 A;  1HTL D;  1A2U A;  1PFN A;  3FKI B;  5I2Y A;  3K57 A;  3VYT A;  1EYA A;  1B9M A;  1TY0 A;  5HGT A;  1I4P A;  1BCP C;  4FXD A;  1F9P A;  2FMC A;  1WTR A;  1IYV A;  1DD2 A;  4G7Z C;  1KAA A;  1OXS C;  1B44 D;  3SK4 A;  4IUR A;  3C1F A;  1HXY D;  3S2H B;  1IL8 A;  1LTR D;  1TWC B;  2F1M A;  1NR2 A;  2G9D A;  3KLR A;  2VNU D;  4K5W A;  4R8N A;  4FF1 A;  1DJR D;  2F0Q A;  1VMP A;  1Y8O B;  1O7Z A;  3HOZ B;  1BCP F;  2JA7 B;  1AZP A;  4RGM A;  5K5P A;  4DNR B;  3TME A;  5CV9 A;  2IT1 A;  2I07 B;  4K14 A;  1XTC D;  4C1N K;  1QNK A;  2Z4I A;  3PUX A;  1EEI D;  1JWM D;  4BBS B;  1C48 A;  4HCS A;  1LTA D;  2F0D A;  2LMC B;  1AN8 A;  4J6H A;  3ONA B;  3CRK C;  2B39 A;  5DM7 3;  1YNJ C;  2IJ0 A;  1STH A;  2A6E D;  4ZKB B;  2B2Y A;  1X32 A;  1U4L A;  3KLS X;  1EY5 A;  1I4G A;  2KQ3 A;  1EY6 A;  4K2K A;  1H9S B;  2BDN A;  1O7L A;  5D65 A;  3KLS A;  1TS4 A;  2F0L A;  1ML0 D;  4RHS A;  2WAC A;  3TP5 A;  3MFY A;  1EZ8 A;  1E0B A;  2OEO A;  1PRT B;  1RJT A;  1CZG A;  5JPM C;  2KCC A;  3OOC A;  3I70 A;  5E3F A;  2OXP A;  1GUT A;  4PV1 C;  4CKB A;  1Q8I A;  4CJ2 C;  4RAU C;  1YNN C;  2F0E A;  2JE6 I;  4XTC S;  2B63 B;  4EQN A;  1A3V A;  3KF8 A;  1EEF D;  3I72 A;  1JOQ A;  5IIF A;  1TU2 B;  1A6X A;  3JAM E;  1FYC A;  2XRQ D;  2NVT B;  2KEC A;  1I6H B;  4ZUJ A;  2FFK B;  1A15 A;  1BR9 A;  1W6J A;  2ICI A;  2XIW A;  4RGT A;  5M5Y B;  1EY0 A;  5EPJ A;  2X6G A;  5CYU A;  5KRU A;  2BE5 D;  4C3H B;  2LKV A;  3NBH A;  5LHY 1;  3MA2 B;  4O42 A;  1WTX A;  3MZ5 A;  3QOJ A;  2J7Z A;  3MXP A;  1HUM A;  3EJI A;  3UI2 A;  3A8I E;  4S3S A;  2PCF B;  2NVX B;  2AUK A;  2WII B;  3MAQ A;  2EJF C;  1RCV D;  3GTK B;  4HAE A;  1AP0 A;  5LL6 X;  2XN9 C;  1I3Q B;  1RKN A;  2V4D A;  1CM9 A;  1NSN S;  3MWY W;  1WTP A;  5DNF A;  1JOR A;  2PO4 A;  2F0U A;  1F77 A;  1NCV A;  1CA6 A;  3U9O A;  1ET6 A;  3I90 A;  1E2W A;  2EYL A;  2WAQ B;  1MGS A;  3T4A C;  4DF7 A;  1CFM A;  1STG A;  1OXU A;  2F4I A;  3O13 A;  1Y1W B;  1G29 1;  2DY8 A;  1PRT D;  2XSC A;  5BN4 A;  4BY1 B;  2SNM A;  3FPP A;  1AEX A;  1IHZ A;  4X3U A;  3D4W A;  5C3X A;  1UAP A;  1S4Z A;  2X69 A;  2NB0 A;  4DNT B;  5C6A A;  2Z8L A;  5C0X J;  2HDM A;  3C2P A;  5FLX L;  1R4P B;  4NDX A;  4Q5V A;  2D62 A;  3R93 A;  4KI0 A;  2F3V A;  2H4O A;  3I91 A;  1Q90 A;  1KAB A;  1EU3 A;  1JR0 D;  5I6W A;  3TP8 A;  2CW0 C;  4XT3 B;  5CC4 A;  4U68 A;  2K5W A;  5C3W A;  3ND9 A;  3Q24 A;  3RZO B;  1GUN A;  3RMH A;  4BA2 I;  4I65 A;  5M3M B;  3FVQ A;  4PMB A;  1FD7 D;  4TKO B;  4ME5 A;  3EFX D;  1CHP D;  1Q1B A;  4HR7 B;  3U9S A;  1SMY C;  1UNS A;  1H9S A;  1TQO A;  3N6R A;  4LJZ C;  4FO2 A;  3N52 A;  3S1R B;  1J8I A;  4ZRZ A;  4CJ1 B;  1PFB A;  2K32 A;  4L8J A;  1AW7 A;  4A3G B;  1WD0 A;  3OIP A;  2F0H A;  1D1I A;  3TSS A;  4QUC A;  5FO8 B;  3WOE A;  3BZD B;  1JB3 A;  1TII D;  2B2W A;  3K6O A;  1TKW B;  3MFG A;  1IYU A;  3BVM A;  3K7A B;  1Z7T A;  1OXT A;  1SYC A;  1HA6 A;  4DAY A;  5ELD A;  1LTS D;  1B2T A;  2JXM B;  3VA7 A;  4DAV A;  2BA1 A;  1CI3 M;  2SEB D;  3A54 A;  4ZK9 B;  3V2T A;  2FIN B;  5KNC A;  2EJM A;  5CR3 A;  2F0S A;  2KJX A;  5FLX E;  2RQX A;  1JIC A;  1PLF A;  4ILW A;  3HOV B;  1LAB A;  3J81 E;  4X3T A;  4G4K A;  3SE0 A;  2K33 A;  4IUU A;  1ET9 A;  1QB5 D;  2ZXP A;  5CV7 A;  2X6L A;  5I2X A;  2MJ8 A;  5I9O A;  1Y8P B;  4UDU C;  1CA5 A;  4MIU A;  3T51 B;  4DFA A;  1B9N A;  4RFB A;  3D8G A;  3MC0 B;  1MSH A;  3Q0A A;  2NBF A;  5FK9 C;  5EPK A;  2RDG A;  3F2U A;  5I9P A;  3D4D A;  2YYZ A;  2GA4 B;  2O5J C;  3GTL B;  4RKL A;  3HS0 C;  1EY9 A;  3BDC A;  4Y7N B;  4C1N I;  2YU9 B;  3W3A A;  2HDL A;  1NR4 A;  1X3P A;  3RLF A;  2MHV A;  5D3D A;  1BBX C;  1F2M A;  4XQQ A;  3HZX A;  3GTP B;  1S5E D;  1SYB A;  4HTH A;  1XX8 A;  5IGB A;  2O2L D;  4BS9 A;  1TT2 A;  3T16 A;  4HMJ A;  4V0B A;  3AU7 A;  1C8C A;  4ID6 A;  5J1Z A;  3OMG A;  1WTQ A;  1TS2 A;  1J9O A;  2IX3 A;  3S16 B;  1FNW A;  3H3V C;  4G7H C;  5EJW A;  1L0X B;  1XYI A;  1FR3 A;  2K01 A;  2EY6 A;  3MTS A;  5DEH A;  2WIN B;  1DOK A;  2F0V A;  1R9T B;  3QIA A;  2E2D C;  4AYB B;  1LTT D;  4DXF A;  3QB3 A;  5A2Q E;  5DAU A;  4FXK C;  2A68 D;  4QMG A;  5EGT A;  5COY A;  1VF7 A;  1GUS A;  2JSO A;  1CQF A;  2F0P A;  4LMQ D;  3OW7 A;  1KDC A;  2K5Q A;  4TSS A;  2WKD A;  4KTA A;  4KHZ A;  3NUC A;  3SXH A;  2K04 A;  4RKB A;  1DOL A;  2NTT A;  4L6T B;  4IUV A;  3SDZ A;  1HRJ A;  5I4D A;  3OMC A;  2QKI C;  5CBE E;  1DM0 B;  1EY4 A;  1EY8 A;  5F2D A;  4OHJ A;  2WP8 J;  3RD4 A;  1SNO A;  3FRP B;  1EY7 A;  2M9V A;  4I7Z C;  4IFD H;  5JEA G;  3A8K E;  2R6G A;  1SEB D;  2F0I A;  3KK7 A;  2WB1 B;  4F8M A;  2A74 C;  3NSW A;  4KKS A;  2NVY B;  2L11 A;  1PRT C;  1SYG A;  4K2L A;  3J7A V;  4F87 A;  5JOB A;  1GXD C;  3GTJ B;  1B50 A;  3R2I A;  3JAM L;  4C3J G;  3S15 B;  4NW2 A;  3NXW A;  2JEA I;  3S14 B;  2B2W C;  3OPO A;  4KK7 A;  3T13 A;  4QF4 A;  4FF2 A;  1OO9 B;  1WTO A;  2RSO A;  3GTQ B;  3H0G B;  1ILP A;  3EVQ A;  3WDN A;  1H9R A;  1ONL A;  2PQE A;  3M4Y A;  5C0X I;  2EYF A;  4DA2 A;  2ZT9 C;  4FXG C;  1M8A A;  3GQB A;  1WTW A;  1Z47 A;  3LX0 A;  1V1P B;  1BXT A;  2EZV A;  3IAY A;  1PRT F;  1TVX A;  3CKI B;  1F2L A;  1TS5 A;  2J0T D;  4ZAI A;  4B9W A;  2BOS A;  3KBX A;  1S5F D;  2EYM A;  4OO1 I;  1CQV A;  2NTS A;  3A56 A;  3OIQ A;  1IW7 D;  4RGN A;  4DAP A;  4K8I A;  4A3I B;  1PTO H;  4XXE A;  2NYZ D;  4NMZ A;  5G3L D;  2WKC A;  2NN6 I;  3R8B A;  3LNN A;  3P1H A;  1CTM A;  5IGC A;  3SEB A;  2L0C A;  1KLU D;  2EY1 A;  2F03 A;  1KNE A;  3M3Y B;  2M2L A;  4KJO A;  1EQT A;  1G2S A;  1TR5 A;  3L7Z C;  3WOF A;  4F88 A;  5CBA E;  1EU4 A;  3K5O A;  4DGZ A;  1ZYR C;  4ZKC B;  4C2M B;  1Y69 U;  1GUO A;  2G9H D;  3ERO A;  3VYS A;  4IFD G;  3HOX B;  2FHT A;  3FPU B;  5C5L A;  3H6M A;  2E74 C;  5A35 A;  1RHP A;  1HPC A;  1LTB D;  1CK1 A;  4XIG S;  2F0M A;  5EKK A;  1HFN A;  3ITP A;  2DN8 A;  3NP8 A;  2MPM A;  1A3U A;  1B53 A;  1QIL A;  3PO3 B;  1QCB D;  3IL8 A;  3HRZ C;  2M00 A;  2R92 B;  1TWG B;  1Q1E A;  5C5M A;  3K5L A;  2L4N A;  5ISR A;  2KA7 A;  4A3K B;  1PTO D;  2MP1 A;  4LAA A;  3TZD A;  1S5B D;  2NZ1 D;  5EKL A;  2IX1 A;  4QUF A;  2K28 A;  4C56 C;  5IOC A;  2B8F A;  4KKT A;  4IQZ A;  2PYK A;  4X3S A;  2OF1 A;  1SNM A;  1HTP A;  1WTV A;  3NTK A;  2KOL A;  2R3Z A;  4R9W A;  2B8G A;  1HQR D;  2NWG A;  5BN3 A;  4FF4 A;  3LWE A;  2IWH A;  1BNZ A;  1LAC A;  3J80 L;  1GUW A;  2MUY A;  5T1G A;  3QWN A;  3T53 B;  2KED A;  4OL7 A;  1DXM A;  2B2V A;  2XRS D;  1EZ6 A;  4HED A;  3K58 A;  4QCL A;  1F9R A;  2EY2 A;  5IGD A;  1VF5 C;  1SNQ A;  2R93 B;  4WJW A;  1B1Z A;  1PDQ A;  5JPN C;  2N55 A;  3BS1 A;  3DUZ A;  5BN5 A;  2F0K A;  2ID0 A;  1EYD A;  1JWS D;  2IX0 A;  3T56 B;  3VR2 A;  3A8J E;  1G8Z D;  1JWU D;  1ZEQ X;  4B9X A;  3HEJ A;  1SNP A;  3S17 B;  4XQN A;  3J81 L;  5I6Y A;  3PUY A;  3I4M B;  1XWE A;  1BOS A;  4BBR B;  4U67 3;  3NQI A;  1V1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...