2B2WA

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 55
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2wA01
2CVRA 1S4ZA 1CA6A 5CBEE 2KOLA 1F9SA 2RVLA 5D65A 2K28A 1B53A 2KVMA 3F2UA 4ZKBB 1XYIA 1BF4A 2B2YC 1GUWA 1G6ZA 1NAPA 4HCSA 4UAIA 3DEPA 1PFNA 2B2WA 1ZXTA 2R3ZA 2Q8TA 2B2VA 2XIWA 3FDTA 4HSVA 2HDMA 4ZK9B 3MTSA 2MPMA 4OIJA 2RSOA 1LV9A 2DY7A 2K05A 4X3UA 5E4XA 5EJWA 1Q3LA 1IL8A 1WTRA 2VXWA 5T1GA 5AFWA 5EPLA 2M2LA 4HEDA 1HFGA 4CJ0B 1HRJA 1JE4A 1SSOA 1QNKA 2L11A 4RWSC 1B4OA 1PDQA 3KBXA 1AZPA 1X3QA 2KEDA 3GV6A 5T1IA 5E4WC 1DONA 1B2TA 2X69A 2KECA 1F9PA 2MJ8A 4ZAIA 1BNZA 2JP1A 1MSGA 2KUMA 2H1EA 2K01A 3KUPA 2BDNA 4MN3A 2X6GA 2RA4A 1IKLA 2B2TA 3QO2A 1WTPA 2FINB 3I3CA 5EQ0A 1PFMA 1F9QA 1X32A 2KEEA 4IUUA 1CM9A 1E0BA 4ZKCB 4R8IA 1AZQA 1HFNA 2FFKB 4IURA 1RJTA 1U4MA 1WD1A 1M8AA 5CMDA 5JJZA 1BBXC 1RHPA 5DNFA 3IFDA 2B2UC 3I90A 2EOTA 3D6WA 2X6LA 1ML0D 3H91A 1VMCA 2B2VC 1HHVA 1ILPA 1DOMA 4CJ2C 1SAPA 1RTOA 2B2WC 2FHTA 2K04A 4O42A 1WTWA 1F9RA 1KNEA 1EIHA 3ONAB 2N88A 1HUNA 3GV3A 1WD0A 2FMMA 4IUPA 2FJ2A 2DY8A 2EE1A 1ICWA 1NCVA 1VMPA 3IL8A 4U68A 4IUTA 1XX8A 2HUGA 4QUCA 4QUFA 1EQTA 1B3AA 1EIGA 1MI2A 2IL8A 1WTQA 1DOLA 4NW2A 4ZLTF 1G91A 1MSHA 1G2TA 3N52A 1F2LA 4IUVA 2EPBA 1WVLA 2NWGA 5CBAE 2B2UA 2N55A 5D14A 1G2SA 2NYZD 4XT1B 1TVXA 2B2TC 2L1BA 2Q8RE 4LMQD 5EPJA 4XDXA 1J9OA 1WTXA 1PFBA 1WTVA 1U4RA 3G7LA 1B50A 2SDFA 5COYA 1BO0A 4MHEA 3MWYW 1RODA 1AP0A 1KNAA 2MGSA 1O7YA 1PLFA 4X3KA 1O7ZA 4XT3B 3I91A 1ESRA 2HDLA 4RA8A 1MGSA 1IKMA 3SVMA 1J8IA 1A15A 1DOKA 1X3PA 4X3TA 5CORA 4IUQA 2RSNA 3TZDA 1QE6A 1HUMA 4X3SA 2K03A 2JYOA 2L12A 1U4LA 3DM1A 1NR4A 1DZ1A 1O80A 1U4PA 2D9UA 3Q6SA 3TN2A 4HAEA 2L4NA 4CJ1B 2J7ZA 4OIKA 4RAUC 3LWEA 2K1BA 2L9HA 1ILQA 2NZ1D 4R9WA 2HCIA 2HCCA 3HP3A 3DEOA 1C8CA 1CA5A 3R93A 1EOTA 1WTOA 1NR2A 3P7JA 3UI2A 1QG7A 3FPUB 1JICA 3I8ZA 4DN4M 1RTNA 2MP1A 5EKIA 1EL0A 1HA6A 5EPKA 2B2YA 1SDFA
chains in the Genus database with same CATH superfamily
2DNEA 1A2UA 1S5DD 1NBWA 4JI4Q 2PPBC 1QWYA 3Q24A 4K2KA 2B2WA 1YJ9A 2R92B 5IY0A 2EY1A 4BXXG 2ZT9C 3F2BA 4C2MB 1TWCH 5KEEA 1STAA 5JJLA 4MTNA 1Z7TA 3E9HA 1CKNA 1JWSD 5AFWA 5BN3A 4R4TA 3HOZB 1P8LA 3LNNA 2F52A 4L6TB 2UUCL 4IOAA 5EKKA 4QMGA 5C3XA 3K80C 1ESFA 4A3BG 2KCNA 3ULPA 2E2HH 1II3A 1Q81C 2H5XA 1RCVD 2QDBA 2LFNA 3CKIB 4GNXC 1IKMA 2O4XA 1AZQA 1V1OA 4TRDA 4OL7A 3MXPA 2EZVA 2JA7B 1MKHA 4YWKA 4C3IB 1M8AA 4A3LH 3NBIA 1F2ZA 4KLKA 1OXXK 4IPCA 2A8VA 5DM63 2EYPA 4DNRB 1GD7A 1HNXL 4PNYA 3U9SA 3TP8A 4CJ2C 2WAQE 5GROA 2G5DA 1E22A 1S3OA 1D7QA 3PF4A 2PZWA 1T5EA 4RMFA 3Q8DA 5IYCG 1TY0A 4J15A 4U68A 2N8NA 3I73A 3OYYA 4QUCA 1BBUA 2NTSA 5HGQA 2D0PA 1SNCA 1R4QB 3NBHB 4NW2A 3A5UA 3RZDB 1KLUD 2F0NA 1F2LA 1Y1VH 4DR4Q 2B2UA 1VQIA 1DJRD 3W3AA 2PQAA 4P74A 2EJGC 3UE0A 3ITPA 4DK0A 3K58A 1EWCA 3J7ZC 2XSCA 3FRPB 4LFCQ 4X3KA 3KLSX 3PIOA 3QWNA 5C3WA 5G3LF 1PH3A 1KRSA 1EIFA 1HUMA 2Y0SE 5FO7B 4WRDA 3DM1A 2ZTCA 3T1YL 3A56A 2D9UA 1X3EA 3R8BA 4BS9A 4Y52H 4AQYQ 5JAVA 4DV5L 3CW2C 4LF6L 1EOTA 3KF8B 4LUOA 1Y1WG 3I8ZA 1STGA 2G9DA 3P7JA 3EN2A 4OHJA 1VQEA 4IZ8A 1D2BA 3ULJA 1GUWA 2D5DA 3BDCA 5I4DA 1HJPA 4BBSH 4LJZC 1WJJA 3NHHA 4KHPL 3KF6A 5C3EH 4JI8Q 1I3QH 3S1RB 4NB3A 4IUNA 2I5HA 1LYLA 2R61A 4A3GG 1VQFA 1WTRA 1Q12A 2VXWA 3HOYH 2Q2IA 2M2LA 1N33L 5J39A 4LFBQ 2VUMG 1YNXA 3W5OA 3GV6A 5GADC 1N9WA 1Z47A 2JN4A 2BA1A 3L0OA 4GN3B 1MSGA 1EYGA 4EQ5A 2RCFA 3T1HQ 3BDLA 5ELCA 1F9QA 4P72A 4IUUA 1I6HB 2BE5C 1X3GA 1T9HA 2HD3A 1E1TA 1V1PB 4A3EG 4FF3A 3NEMA 5C4XG 3N6RA 2KHSA 4XYOA 1DOMA 3AFQA 2LY7A 3BVZA 3S16H 1Q8KA 2NN6H 1Q7YC 1LT5D 4KJNA 3M4OB 1EY6A 3SDZA 1VCIA 2VW9A 4A3BH 3CQZB 4KK7A 1SYDA 3J81c 4DV0Q 1EQQA 1D6EC 3MFYA 1IYVA 3S2HB 4YWMA 4XDXA 3ULLA 1R9TB 4I7AA 4WFN3 1SMYC 3IAYA 3CMAA 2C35B 1QVGA 3K59A 3HGBA 4HJ9A 2QGQA 1A15A 3CPFA 3F2DA 1QE6A 5FOBB 5M3MG 4A3MB 3W1GA 1SMXA 4DAYA 3S1NB 4X3SA 1ET6A 1D5XC 3TBIB 1DZ1A 3QJYA 4HIDA 2LXJA 4OIKA 5M3FB 3I70A 4B3MQ 3HOVG 5K5PA 3OSOA 2SOBA 3OMGA 5EPKA 3IKJA 4B3ML 3OW7A 3CC4A 2B2YC 1NAPA 5C4HA 1JC7A 3CCUA 4DAVA 4JBMA 4LWCA 5A2QL 1EZ8A 1MIUA 2XIWA 2CCZA 1Y1WB 4FF4A 5ISRA 2QCPX 2SEBD 2NVQH 2VQEL 4A3KB 3S17B 4JI7L 1EFID 1ZYRD 1KABA 1BQQT 5JPMC 3GTGB 4IALA 5T1IA 2ICIA 5IWAL 3JC66 1KDBA 1JJCB 2UXCL 4ZAIA 3EQLC 1BXTA 4A3GB 4JI7Q 5TSSA 4LNQA 5DM73 1LTTD 1PZID 4M8AA 3TP6A 4LF9Q 1E2WA 3AEVA 1HQRD 4KKTA 3KF6B 3A0JA 1SNOA 4OWXB 3KF8A 3JAMc 2DNCA 3M4YA 3I90A 1GUOA 5IGFA 2Z6KC 1O7IA 3FPPA 3PUYA 3OIPA 2K52A 4DR5Q 3VR5A 1Y14B 2E74C 1WD0A 4O1NA 4PG3A 4A93B 3VDYA 1A6XA 2HUGA 5I9PA 1MI2A 3GTLB 4XIGS 4NXML 4A75A 1LTLA 1JJ2A 2ZM6L 2MFIA 4QIWB 1JWMD 3BG3A 4OGQC 4Y7NH 1CKNB 2O5JC 1MJEA 2UXCQ 1SYGA 1HXYD 4GN5A 2QW7A 2EVBA 1DD2A 3MWYW 3TS2A 2YTYA 1O7YA 4LAAA 3NENA 4JI6Q 1N33Q 2ZXPA 2QA4A 1CSQA 1N36L 3J80i 3ICEA 5JOBA 1E2ZA 1TS4A 1A62A 3PIP3 4LF9L 1GHJA 4A3CG 2AQ1B 4LW1A 1QG7A 2NZHA 1JICA 3STBD 4B3SQ 1U5KA 3H0GH 2CVRA 1S4ZA 2B8GA 4KHVA 4XTCS 4L5SA 3PQIA 4N8X1 1B53A 1EUJA 4BBRG 1U9RA 1TWAB 2F4IA 1EYAA 1Z6HA 4JK1C 4QIWE 3T51B 2EXDA 1PFNA 1XMOQ 4X6AH 3MVVA 3NQTA 1STYA 1LV9A 4O0AA 5GQOA 1IL8A 1LABA 5HY6A 4DR2Q 1LTGD 1FR3A 5T1GA 2VB2X 2VNUD 3UE1A 1WCMH 1K8OA 2O5IC 1ASYA 2F0SA 1PDQA 1AZPA 4JOIA 1SYFA 1BNZA 1Y8PB 4RFBA 4FXGC 1SRUA 2RA4A 4OO1H 3D8GA 1MHWC 2C5CA 3CAMA 2DGYA 3V05A 1HTPA 2Y0SB 3H6MA 4IURA 2ZTDA 3PUXA 3CCLA 3S16B 2IWHA 2R7DA 1VMCA 3CP0A 4JI2Q 2YV5A 4LF6Q 2K04A 2XRSD 1OXSC 3CXCA 3I4NB 2XTIA 2JXMB 2R7ZG 2E5LQ 5IYDH 1SNDA 3M7GA 1HZBA 1CZGA 1KC8C 1TS2A 2HQLA 3HOWG 3GTPB 4IQZA 1G2TA 4KHZA 3PO2B 1A8VA 4LF7L 1SE4A 1N34L 3MXNA 1W6JA 1YNJC 2L1BA 2OEOA 2JA5B 1KIXA 3RZDH 4QCLA 4O2DA 2XN9C 1JJGA 1A2TA 2HDLA 2F0TA 4XQJA 1Q90A 4ME5A 4QL5A 2N3SA 4DNIA 2NVYB 1JB7A 4APVA 2EYFA 3TP5A 4BY1B 3FMCA 5ELOA 2B63G 1IBLQ 2K1BA 5BR8Q 2NZ1D 1C8CA 2EYMA 2CKZB 2I46A 2PMZE 3QR8A 1K9MC 4GOPA 1C7YA 4IFDH 1VF5C 2F0IA 2GN5A 4IPDA 1TWHH 4A3FH 1X9NA 5ELBA 4JI2L 1E2VA 2SNMA 1OTCA 4MZ9A 2PI2A 4GKKQ 4EQPA 2Q8TA 2A74C 3GTPH 1JQYD 4HSVA 5KIXA 3B6YA 5IODA 3OPOA 5E4XA 1TT2A 5IYDG 2A68D 4JYAL 5BR8L 4X64Q 4QQBX 1TWFH 2F0HA 4GKKL 4HEDA 4ZUJA 5I6YA 3HKSA 4JPBW 3CPWA 3HOUG 2KECA 2L15A 5IP9G 2EIFA 1YHAA 5CV9A 4A76A 1OXUA 4B08A 4DR3L 3H3VH 5IGGA 1E7ZA 1IKLA 1PH5A 1PRTC 1W3SA 5IGDA 2A5HA 2RBMA 4DXGA 2F4VL 1PHJA 1IBML 2V1CC 4UHVA 1G51A 2IJ0A 2RQXA 1V1PA 4OO1I 2F3VA 2K4KA 2ZJQA 5LMUL 2B63B 4YCUA 1ML0D 3S1QH 3H3VC 1A3VA 3TREA 1SJHD 3KYHC 4PZ6A 2LKVA 3ONAB 5IIFA 4MTKA 1A0IA 4A3IG 3S9WA 3EJIA 2XVSA 1ICWA 2O2LD 1FJGL 1EY9A 1XX8A 5FLXE 1PRTD 1XNQQ 1EIGA 1K8MA 1C9OA 1DOLA 4ZLTF 1EWIA 4HIMA 3C46A 3HKZE 4DFAA 3MEHA 3M3YH 4B3RQ 2B2TC 4LMQD 3CCEA 4HTHA 4ZCKA 4WJ3M 2E2HB 4C1NI 3PO2G 4JI6L 2YYZA 4B3TQ 3A5ZB 2EJFC 2NZOA 4XT3B 3TEHB 2EYLA 1PZKD 4YCWA 4A3JB 5C4JB 1UE1A 2FMCA 4C3IH 1OXTA 2VY3A 3HOUH 2ZXOA 2HIXA 4PMCA 1K3RA 4S3SA 1HNZQ 2NTTA 2QEXA 2J7ZA 1C48A 3FP9A 3K5LA 3GTOH 4DR7Q 1YJNA 1EZ6A 2IX0A 3IFTA 3T1YQ 4DV7Q 2Z0SA 1GOZA 5M3FG 2F0UA 5CV4A 5GAEC 5LMUQ 1CQFA 2RVLA 2K5DA 2KVMA 5C4XH 3NTIA 2IY5B 1OO9B 3TP7A 4QGUA 2EYJA 5IYBG 3LGJA 2UUCQ 2F0FA 4UAIA 2WB1G 3A8IE 3DEPA 2PW5A 1OXVA 1ET9A 3RR5A 2B2VA 3D6CA 1BUVT 4A3IH 2F3IA 3MTSA 1NJIC 1PH8A 5EJWA 5C44H 5EKLA 4JBKA 4JI8L 1QILA 2JJQA 4H02A 3TQYA 4DAYB 3OW2A 5FJ8G 4XXEA 3G6JB 3UDFA 2L11A 1SN8A 2F0WA 4YCVA 1AW7A 2X69A 3TMEA 4L5TA 1FVIA 1P16A 1X6OA 2JP1A 3SR1A 4CDFC 2A6ED 1PXUA 4IPHA 4OX9L 1H9MA 5M5WH 1GUTA 5EBCA 4F87A 5IT9E 2VB3X 3S14B 3K7AB 4X65Q 4BBSG 2A69D 3KLRA 1I5FA 1RJTA 2IPKD 2BCOA 1WYDA 2K5HA 3K5NA 1CI3M 3HOXB 5IT9c 2B2UC 1J5EL 1Z9FA 2M9VA 2CQAA 5I9OA 4LFCL 1SFOB 1YVCA 3CCRA 1F9RA 3FKIH 1VQCA 1EIHA 4KN4C 4CHTB 5CV5A 4C3HH 4V190 3I4LA 4RGTA 3HOYB 2LMCB 1EQTA 3UDIA 1V8QA 1V9PA 1XXGA 4RGNA 4QJFA 4C2MH 5LMNL 4A3MG 2R92H 2MUYA 1TWGH 4A93H 2OQ0A 3DMUA 1PH2A 2SNSA 1J9OA 3K6OA 1PTOC 1H9JA 4P75A 1XPRA 1VDZA 1J8IA 1VQBA 1FGUA 3PGZA 3S15H 3S1MH 1MBYA 3A8JE 4IUQA 3M85A 5JJIA 1LUZA 1LACA 4LFAQ 2L4NA 3UDXA 4M1UB 4RAUC 1XWEA 4POFA 3ZJYC 3NWTA 1M90C 5FLXc 2E76C 1PRTF 4EQNA 1N8RC 4TVAB 4G7ZC 5CBEE 3F1ZA 2ZTEA 3F2UA 3S2DH 1BF4A 3CRLC 1W6KA 4JBWA 2CW0D 3I56A 1KAWA 2VQFQ 1CK1A 1R4PB 4LF5Q 1Q82C 2IX1A 1UWVA 1A3TA 2JA8H 4H13C 2IHFA 4LUZA 4KKSA 1DYQA 1H9SA 2F0MA 3NSWA 4A3MH 3HOVH 5C5LA 1TXYA 4CDEC 3S15B 1JMCA 3PUZA 2TMPA 3PV0A 2H1EA 3NTHA 5M3FH 2Q8IB 1CSPA 1I4QA 4GKJQ 1S5BD 2RCNA 3HKZB 3AB9A 1CM9A 3D3RA 2E2JB 3JAML 1HCZA 4LK1C 1RD9D 5M5YB 1WD1A 5CMDA 3K81C 1TR5A 4ULLA 5DNFA 3WOEA 3DWQA 1SXTA 4HJ5A 1D8LA 1STNA 4RG1A 4G7HC 3GTJB 2B2VC 2AHOB 4FF1A 1FD7D 2JA7G 2NUCA 5C4ZA 4JOIC 3RN5A 3J7A5 3E0EA 5C0XG 4X65L 2DY8A 2EE1A 4J6HA 1M1KC 1NCVA 1PA6A 4RCNA 4KD4A 4JCVE 1EYDA 4BBRB 3V96A 2R93B 4HN7A 1HTLD 4IN3A 1K8GA 4A3CH 3BZDB 1WTQA 2EY2A 3H15A 5IWAQ 2JA9A 3H0GG 2A6HC 1E3PA 5JVG3 3J81E 2A73B 2UUBQ 1I4XA 4EQOA 4KY6A 1ZKOA 1PFBA 2WAQB 4N9PA 1WTVA 3VR4A 1E1OA 2KCCA 1EY7A 3I91A 4RGOS 2ASBA 1MGSA 1SNPA 3U50C 1JR0D 2JQOA 1D5MC 1F2YA 4NXNQ 2JYOA 2ZXRA 1STEA 2OT2A 4KTAA 4KMUC 4DR4L 3Q6SA 4DV3L 2E2JH 3VR6A 3GTOB 4KI0A 3J81i 2RHQB 2JK8A 1D1KA 1QUQB 3OIQA 3HS0C 3KJOA 3R93A 5F2DA 4CKEA 4ME3A 2E8GA 2P5ZX 1FNVA 4DN4M 1LT6D 4KY5A 4GOPB 4R4IA 2R92G 5IGEA 4X62Q 4BY1H 2A69C 5C5MA 4ZKBB 4QY7A 5ELNA 5EGTA 3WDNA 1HH2P 3D31A 2Z6BA 1YNND 2R3ZA 2MPMA 2DY7A 1ENCA 1LTAD 3CC2A 3MFGA 3QIAA 4A3BB 1TU2B 3T4AC 1JCKB 1HRJA 3J7AF 1TIID 1SSOA 3CRKC 5IYCH 1N32Q 1BCPF 4Q5VA 1IBLL 4PZ7A 1JOKA 2XWJB 4HCEA 1B2TA 5A2QE 1I6VC 4QB4A 4G57A 3GO5A 2K01A 3T13A 3K7AH 1JOQA 2HIVA 3E3XA 4DU9A 2F0EA 4KY7A 4BY7G 1STBA 4DK1A 3DLLA 2RF4A 2F0DA 1X55A 2LS01 4RHRA 1TQOA 1BDOA 3J80L 3QB3A 3D6WA 3RLFA 1IW7C 1AEXA 5IGCA 4GKJL 1RTOA 4KKUA 2AKWB 3HKZG 1HUNA 3RUZA 3GV3A 5AJ3L 1PVOA 2FMMA 5J1ZA 5BN4A 3HZXA 2BE5D 4JI0Q 4IUTA 1PH6A 2B63H 5D3DA 1B3AA 3U9OA 4DK3C 4F8MA 4A3FG 4CKCA 2E5LL 4DR7L 3QG1A 2B29A 1Y1WH 3KDFB 1PRTB 4RCOA 2Q2UA 4DF7A 1RF2D 2PO4A 4IFDG 1EY0A 5ELDA 3Q22A 2NVTH 4DKAC 4U673 3A7LA 1QJOA 1WTXA 4GS3A 4QF4A 2F1MA 5D3IB 1K83B 1T5XD 2CWAA 2K5QA 2WFWA 5CYUA 1SNMA 1AN8A 3ERSX 1AP0A 4DXFA 3GTQH 1M4VA 1EQVA 2PQAB 4GN4B 2UU9Q 2KCMA 3Q0AA 4DGZA 1PFSA 2HQEA 1CTMA 1EIYB 1KTKA 1XNQL 3I4NH 5C3EB 5JEAJ 5FO8B 2QKIC 4DV2Q 4Q0FA 4DR2L 3BVMA 4C56C 1KXLA 1B7YB 2IW3A 3EIVA 1LTID 1VQHA 1QOHA 4K0KL 2Z4HA 1RL2A 2WV6D 2QEJC 1DCZA 1SLJA 4FVMA 4JBJA 2WIIB 5AJ3Q 4A3EH 1QCBD 3R2TA 4JI4L 4NMZA 5ELEA 4OIJA 3I4MH 1HR0Q 2TSSA 3A7AB 4K8JA 5LL6X 1VQ4A 2F0QA 5GAHC 2PYKA 4YWLA 3L7ZC 4LUVA 1Q1BA 1YHBA 1B4OA 3SK4A 4XYQA 4FYDA 4K0KQ 4DR6L 5J22A 1HZCA 2D2CC 3BZKA 1VQ5A 2HHHQ 2UUBL 4IPGA 4OXPA 1HNZL 1C4QA 4MN3A 1CFMA 1IYJB 4ODGA 1NTGA 4OONA 5EQ0A 1PFMA 4MNOA 4AIMA 2Z9HA 3JAME 2FXQA 4ZKCB 1HFNA 3SE0A 2FFKB 4DV2L 3I72A 5J3BA 4TQUS 1L1OA 3KLWA 3RLNA 5JJZA 1K0RA 4YY3L 1TWHB 4A3FB 2AWNA 2MHVA 3H91A 2K14A 1Q8IA 3RD4A 1GXDC 4FXKC 3CF5A 1LM0A 2PMZB 5KNCA 2CQOA 4K2LA 3J80E 4WJ4A 4TKOB 1VMPA 3NXWA 2Z6KA 1UNSA 3P75A 4HJAA 1R9TH 1BCPC 5DAUA 3CD6A 1PYWD 1KQSA 4TSSA 2JA6H 3TZUA 3SXHA 4IJHA 3RZOB 4L63B 1MSHA 2WKDA 2CH4A 1SBBB 3M4PA 3D4WA 5CV6A 2IX3A 5CV8A 2EPBA 2NWGA 4C3JH 4CBVA 3URYA 1GHKA 5GAGC 1WTHA 1RIPA 3OWFA 4P73A 1XMQQ 4NKLA 2OQKA 1U4RA 5E7NA 3HOXG 2SDFA 5KYIA 1BO0A 1SE3A 2L55A 3H94A 1O7ZA 3VR3A 1HZ9A 4GNXA 5CORA 1DM0B 3HRZC 5EBDA 1WCMB 1JOOA 5M9OA 3VYSA 2E2DC 1IL2A 3MAQA 1U4LA 1N34Q 1NR4A 1Y69U 1CHQD 1X54A 4L8JA 3LWEA 2L5TA 3S1MB 3T53B 1F2MA 4H7BA 3UI2A 1UUPA 1SE2A 1RTNA 3M9BA 2UU9L 1SDFA 2CHBD 3VYUA 4R8NA 3CCQA 2C9OA 3OMCA 2K28A 1XTDA 3CHBD 3OHXC 4FXDA 4HCSA 4X62L 4ID6A 2I5MX 1B3QA 2MNAA 3HOWB 4GLAC 1YIJA 4BBSB 2L0CA 4RGMA 4X66Q 3V2TA 5E3FA 2F0JA 3U58A 4KHPQ 4A3DG 2JE6I 3S1RH 1U0LA 1N32L 1FNWA 3PO2H 3S2DB 1CT1D 3CU7A 1SYEA 5EPLA 3VYTA 3NQIA 1UEAB 1A3UA 1B1ZA 3JAMi 1LT4D 1QNKA 3A55A 3KBXA 4UP8A 2OCEA 2MJ8A 4I65A 2JA8B 1HR0L 1HPCA 3D4RA 2ID0A 1S72A 2B2TA 2XGTA 1UE5A 4B9XA 1H9RA 4DV4Q 2EY5A 3MC0B 4JV5Q 2B3GA 2BOSA 2NB0A 2X6LA 3C1FA 2EY6A 2ZJRA 3EFXD 1PTOH 1B9MA 4G4KA 2A1AA 4B9WA 1V43A 3BYYB 1VQ7A 3R2IA 4OWTB 3M4OH 2KENA 1JORA 3MHBA 3IRBA 3SK6A 1UEBA 5C3EG 1CUKA 3S2HH 1JB3A 1VQ9A 1G2SA 1GUGA 5IP7G 5JEAG 2R93H 1B50A 4MHEA 3J7AV 3TS0A 1Y1VB 4NXMQ 2VUMH 5KNBA 2K03A 1L0WA 3VA7A 4C3HG 2CH4W 4K8IA 3FKIG 1XNRL 1TS3A 4FO2A 1G291 4K5XA 4KV6A 4H0LC 3L2PA 3S24A 2F4VQ 2F0OA 3QOLA 1KAAA 2OTJA 2VL6A 1BOSA 1G6PA 5D65A 1EY5A 1XYIA 3K8AA 2NVXH 3T1HL 3G4SA 1G6ZA 2PZUA 3Q23A 4ILWA 4ZYSA 4NDXA 1LTSD 4KJOA 1A63A 3I4MB 1YJWA 3ND9A 1AE2A 4DV7L 1GKHA 4PQXA 3SHLA 1KDAA 1J5EQ 4AYBG 4LF5L 1ENFA 3X3MA 4RWSC 2F0PA 4AQYL 2KEDA 2KJXA 1NNXA 2N78A 4R4CA 4X66L 4ALPA 1X65A 1NMGA 4RKBA 3EVQA 2UXBL 4CKBA 4K14A 1IYUA 2BDNA 4HMIA 1EU4A 5JVH3 1BCPB 4I7ZC 5M3MH 3H09A 1FGBD 5K36H 2JA5G 5LL6S 2KCTA 4WJWA 1ILPA 4UP7A 1SYBA 3KOJA 4GLVB 1FL0A 1NSNS 3DWPA 4DA2A 2MQHA 3C2PA 4JV5L 4BY1G 1SROA 4JI5Q 5C4XB 2I5LX 1CQVA 2CFMA 4Y7NB 2F03A 1EEID 1WCMG 4IUVA 3M7NA 1I4RA 4V0BA 2AWOA 4HJ7A 3LX0A 2R7ZB 3KFUA 1B9NA 3HFZB 5C0XI 4OWWB 5COYA 1HR0W 2AQ3B 3KK7A 4ABNA 1X3FA 3AQQA 3EROA 4R4QA 4X3TA 2JA7H 2Q2HA 5FLMG 3NE5B 2L12A 3OTOQ 2HHHL 1K3BC 2RDHA 3MA2B 5C0XH 1K83H 4R4OA 5CV7A 1XJVA 1Q46A 1VQDA 4HR7B 4R9WA 1CA5A 3HP3A 4LF4Q 4DAPA 1FNUA 1NR2A 3BZCA 3OTOL 2XNAC 3HG9A 3S1NH 4DR6Q 4YHHL 1VS0A 2JEAI 3KBGA 5K36G 3FKIB 4DK6C 4DR1Q 3J81j 2ALYB 3A54A 2E2IH 1KHIA 3U4VA 3BYTB 1GUNA 1TS5A 1XPOA 2HDMA 2RSOA 5M5XH 2KBNA 5KGUA 4UDUC 2N49A 5JJKA 3E9IA 1TWGB 2EDGA 1IZ6A 1EFWA 4ZUIA 3A74A 4PZ8A 4H44C 4EX5A 2BA0A 1VQMA 3VA5A 4DAMA 4DV6Q 1L0XB 3J7YW 2KUMA 5C6AA 4JI1Q 3SK5A 4K6LA 1IBKQ 1HZAA 2PQEA 3S1QB 1X32A 5H1SE 2J0TD 1VQKA 4JYAQ 1O78A 2XRQD 1BBXC 3D4DA 4WORA 1YBYA 3J80c 4A3KG 3CCSA 1VQ6A 3NWSA 1SAPA 2B2WC 1HNWL 2FHTA 4DV1L 1JE5A 3GD7A 3RN2A 1K0SA 4EVOA 2YU9B 5C0XJ 4BY7B 3BS1A 3X3NA 3W1BA 4YIJA 1I94L 3F8TA 1QZGA 1PYSB 4UY8C 1QVFA 1QUQA 2EXZA 3EBEA 4OELB 4KN7C 1I4HA 2KA7A 1NY4A 5M5XB 1G91A 3SK8A 2EQSA 1DXMA 4JI3L 2PNRC 2K75A 1IBMQ 1CKOA 1F77A 2A19A 1PV4A 4EGVA 4N9TA 5I2YA 4L5RC 3C1EA 2WKCA 3HOZH 2JA5H 1NE3A 2B39A 3KLSA 3DM3A 4Z9CB 2NVYH 4IOCA 1PZJD 1I4PA 1XNRQ 1EY8A 2K33A 3DEOA 4F7XA 1K28A 2Z1CA 2YTVA 3GTJH 2H4OA 3TZDA 4BWGB 3CCJA 1EL0A 2B2YA 4R8IA 3GTKH 1CA6A 4N8FA 4AYBB 2QILA 4IJLA 4B3TL 3J81L 2AUKA 3FVQA 1ZXTA 5LMNW 3FDTA 4K5WA 3CQZH 3H0GB 1KD1C 5DLQE 1VQLA 3ND8A 5FKAC 1TWFB 1BKBA 1LTBD 2WB1B 4C3JG 1X3QA 4C3IG 2A68C 1VQAA 2KHJA 3K5MA 1PH1A 3HOXH 3BU2A 1VQJA 3GP7A 1BCPD 3TDQA 5M3MB 4E6IA 1E0BA 5CGKA 4RHSA 3ERQA 5KYLA 2F3WA 1U4MA 1SJED 2GVBA 2PW7A 1RHPA 1YITA 1PMRA 3CC7A 2DUDA 1LO5D 5EAYA 4LF7Q 2M00A 3RMHA 4IFDJ 4O42A 1TKWB 1EQRA 4YY3Q 2AMCB 1UE6A 1IW7D 1UAPA 1L0YB 4KD3A 1GJXA 3I4OA 2NVQB 1GUSA 3F2CA 1ENAA 1B44D 2GVAA 4DUYQ 3GTGH 5FK9C 1G8ZD 2N55A 1WFQA 4XT1B 4IO9A 1YNJD 4A3GH 1I94Q 4JVZA 3RNUA 3E6ZX 4B3RL 4A3LG 3NUCA 3K5OA 1ESRA 2AQ2B 3LWUA 1HNWQ 1X3PA 1CZWA 1VF7A 2D62A 5CC4A 4PMBA 1VQ8A 3L3OC 1U4PA 4DV5Q 4DV6L 4HAEA 3D0FA 3TRZA 3PO3B 2HCIA 2HCCA 5CR3A 1S5CD 2LSSA 1WTOA 2VUMB 4P2CB 2BH2A 3K0YA 2EYHA 3A8KE 3AFPA 2KOLA 3QOJA 4LFBL 3SEBA 1PYBA 2IHEA 2JA6G 1S5ED 4BA1I 4GNXB 3GTMB 1VQNA 1AH9A 1Y1VG 1L1OB 4B3SL 3HOZG 1QVCA 3M4QA 5HURA 5HGTA 3L9AX 3C3LA 3MEFA 2K05A 1KRTA 1SE8A 1TY2A 2NN6I 1EWHA 2PZTA 1EOVA 2NVXB 5IE8A 4HJ8A 2NVTB 1XMOL 4CDCC 4NP5A 1W2BA 1JE4A 3MZ5A 3PUWA 1N36Q 3VR2A 2Q2TA 2CWPA 1EY4A 2KQ3A 3PCOB 1IXRA 2QF7A 5IP7H 3GTQB 3FEWX 4J1MA 3MXNB 3E5SA 2X6GA 5LHY1 3PUVA 2ZJPA 3I3CA 1O7LA 2UUAL 4OX9Q 1YEZA 4DV1Q 1YHQA 2DJFC 2K7VA 1D5ZC 1IHZA 1AE3A 1ZEQX 2MO1A 3CCMA 3KJPA 1KLGD 2Z4IA 1WTWA 3K7UC 3HOYG 2K5VA 2DN8A 2N88A 1LT3D 3GTMH 1XMQL 4A3DH 2ATWA 1AFPA 5E1FA 4QUFA 2JA8G 2K32A 5LMNQ 2K5NA 5I6WA 1HQMC 5IYBH 2WAQG 4JG2A 4FDBA 3VYRA 5JPNC 4GOPC 5D14A 2QDLA 1HA5A 1BBWA 2NYZD 5EPJA 1TVXA 2OWOA 4JI3Q 4PMWA 1I50B 5C44G 2LXKA 5NUCA 4RH6A 1CKMA 1RODA 2I0QA 1KNAA 1XTCD 1HNXQ 4GLXA 3T56B 3SVMA 1DOKA 2RDGA 3I7FA 1L2FA 3KDFA 3PMFA 1O80A 1VQOA 3ER0A 1EU3A 4NPSA 1RDPD 2JSOA 1QB5D 2L9HA 1ILQA 4A3JH 2NN6G 1S5FD 5C4JH 1I3QB 4LF8L 4FF2A 1RKNA 3HOUB 1E24A 5EKIA 1HA6A 1VQGA 2G9HD 3WWVA 5FLXL 1F9SA 5IT9L 4A3DB 3G48A 5JEAH 2R93G 2DJGC 3P20A 4UP9A 2F0LA 4ZRZA 3G6EA 2WB1E 3EA6A 2JA6B 1H95A 1H9SB 1Y8NB 3O13A 3RZOH 3G71A 1Q3LA 3BVGA 1ONLA 2R6GA 4MIUA 3MXGA 5BN5A 4DPGA 1BR9A 1TWCB 5IGBA 5A35A 3GTLH 1HFGA 4K6DA 4CJ0B 2E2IB 1YNNC 2F0KA 3K0XA 4P71A 1Y8OB 3PSIA 4JI0L 1D1IA 4A3IB 2ZM6Q 1DONA 2K5WA 3PIO3 3NELA 2XWBB 2PCFB 4DNTB 1F9PA 3BJUA 1J6QA 1LLRD 1SMYD 3NK9A 3KUPA 2YTXA 2EJMA 4AYBE 2K50A 3E0JA 3STBC 3QO2A 1WTPA 2FINB 4L5QA 3K57A 1ICFB 1KDCA 5G3LD 4DR1L 4OEMB 4DR5L 1PH4A 3IFDA 1K8AC 2VZAA 2WACA 1HHVA 1CHPD 5I2XA 4CDDC 5FO9B 5FLMH 1KNEA 3RLOA 2UXBQ 1FYCA 3P1HA 1GO3E 4DUYL 1K73C 5FJ8H 1NMFA 2K6AA 2UUAQ 1ASZA 2WP8J 2D0OA 2FJ2A 2BDOA 2I07B 2UXDQ 3MXUA 3NTKA 2IL8A 3ZYYX 1B70B 3DUZA 1SFOH 4BBRH 1XPUA 1TWAH 2A6HD 3N52A 3WOFA 1WVLA 3AU7A 3BDOA 2RDFA 1FJGQ 1Q1EA 2UXDL 2RKSA 2Q8RE 3OWEB 3DWAA 3OOCA 4JC0A 2VQEQ 3G7LA 1WI5A 1GVPA 2E75C 2F0VA 2V4DA 1PLFA 4R1JA 4RA8A 4UPAA 4BXXH 3R3OA 3CMEA 2RSNA 4A4IA 4JI5L 1H9KA 4HIKA 3PO3H 1L1OC 3TN2A 4NXNL 2VQFL 1C0AA 4K5VA 3U4ZA 4DV3Q 3CCVA 1STHA 2EYOA 3GQBA 4A3EB 2PNHA 3FPUB 4JW0A 2MP1A 4XQNA 4DV4L 4X64L 2EOTA 2AUJD 4A93G 1PTOB 2OF1A 1BVSA 4LF4L 1LTRD 4A3KH 4HMJA 3S17H 1DGSA 4C1NK 4DUZQ 4F88A 3T16A 1SNQA 1ZYRC 3FHWA 4GZYC 4YHHQ 3W2DA 3M3YB 4BA2I 4ZK9B 1Q86C 2R7ZH 4X3UA 3GTKB 3AMUA 1GM5A 5IOCA 5DEHA 4DUZL 4AH6A 4J8QA 4LFAL 4PV1C 4XQQA 1SYCA 3PIPA 1VQPA 4A3JG 2CW0C 5E4WC 4G7OC 4POGA 2ICEC 3H3VI 2F0GA 1EEFD 3SGIA 3UDGA 1V1QA 3NPPA 2ES2A 1NUCA 5KRUA 3I4NG 2JEBI 2KEEA 3I2ZA 1JT8A 2IT1A 1SR3A 3HOVB 1IBKL 4JI1L 1I6HH 1PH7A 2GA4B 2MO0A 3PO3G 4ZQ3A 2HT1A 1PH9A 4HSPA 3AYHB 1JWUD 3HEJA 4C3JB 4IUPA 1SEBD 5M5YH 1X56A 5C44B 5KNDA 3I4MG 1MD2D 3IL8A 2RHSB 1PTOD 2PI2E 2OXPA 3I55A 2BH8A 4IFDI 4DR3Q 4FNFA 5L37A 2A6EC 1YZ6A 3NP8A 1EYCA 4OO1G 2R7FA 1KL9A 5CBAE 1I50H 1UE7A 2Y0SG 3TSSA 2OTLA 4CGYB 1QZHA 3GDEA 1S40A 1I4GA 5M5WB 3NBHA 4FP5D 2MGSA 1PTOF 4DV0L 2VS1A 2B8FA 4LF8Q 3S14H 3DHQA 4HIOA 4RKLA 1B8AA 1QNUA 3PF5A 4CJ1B 2J4XA 5ELFA 1WOCA 2KHIA 2YU9H 4BY7H 1MJCA 3HOWH 3DXJC 2ENBA 2Z8LA 5IP9H 1YI2A 2WINB 4C3HB 2NBFA
chains in the Genus database with same CATH topology
2DNEA 1A2UA 1S5DD 2PPBC 1QWYA 3Q24A 4K2KA 2B2WA 2R92B 2EY1A 2ZT9C 4C2MB 5KEEA 1STAA 1Z7TA 1JWSD 5AFWA 5BN3A 3HOZB 3LNNA 4L6TB 5EKKA 4QMGA 5C3XA 1ESFA 2KCNA 1II3A 1RCVD 2QDBA 2LFNA 3CKIB 1IKMA 2O4XA 1AZQA 1V1OA 4TRDA 4OL7A 3MXPA 2EZVA 2JA7B 4C3IB 1M8AA 3NBIA 1F2ZA 1OXXK 5DM63 2EYPA 4DNRB 4PNYA 3U9SA 3TP8A 4CJ2C 2PZWA 1T5EA 1TY0A 4U68A 3I73A 4QUCA 2NTSA 1SNCA 1R4QB 4NW2A 3RZDB 1KLUD 2F0NA 1F2LA 2B2UA 1DJRD 3W3AA 2EJGC 3ITPA 4DK0A 3K58A 1EWCA 2XSCA 3FRPB 4X3KA 3KLSX 3QWNA 5C3WA 5G3LF 5FO7B 1HUMA 4WRDA 3DM1A 3A56A 2D9UA 3R8BA 4BS9A 5JAVA 1EOTA 3I8ZA 1STGA 2G9DA 3P7JA 4OHJA 4IZ8A 1D2BA 1GUWA 2D5DA 3BDCA 5I4DA 4LJZC 3NHHA 3S1RB 4IUNA 2R61A 1WTRA 1Q12A 2VXWA 2M2LA 5J39A 3GV6A 1Z47A 2BA1A 1MSGA 3BDLA 5ELCA 1F9QA 4IUUA 1I6HB 2BE5C 1V1PB 4FF3A 3N6RA 2KHSA 4XYOA 1DOMA 2LY7A 3BVZA 2NN6H 1LT5D 4KJNA 3M4OB 1EY6A 3SDZA 1VCIA 3CQZB 4KK7A 1SYDA 1D6EC 3MFYA 1IYVA 3S2HB 4XDXA 1R9TB 4WFN3 1SMYC 3IAYA 3K59A 3HGBA 1A15A 1QE6A 5FOBB 4A3MB 4DAYA 3S1NB 4X3SA 1ET6A 1D5XC 3TBIB 1DZ1A 3QJYA 4OIKA 5M3FB 3I70A 5K5PA 3OSOA 2SOBA 3OMGA 5EPKA 3IKJA 3OW7A 2B2YC 1NAPA 5C4HA 1JC7A 4DAVA 5A2QL 1EZ8A 2XIWA 4FF4A 1Y1WB 5ISRA 2QCPX 2SEBD 4A3KB 3S17B 1EFID 1ZYRD 1KABA 1BQQT 5JPMC 3GTGB 4IALA 5T1IA 2ICIA 1KDBA 4ZAIA 3EQLC 1BXTA 4A3GB 5TSSA 5DM73 1LTTD 1PZID 4M8AA 3TP6A 1E2WA 1HQRD 4KKTA 1SNOA 3KF8A 2DNCA 3M4YA 3I90A 1GUOA 5IGFA 3PUYA 3FPPA 3OIPA 3VR5A 2E74C 1WD0A 4O1NA 4A93B 1A6XA 2HUGA 5I9PA 1MI2A 3GTLB 4XIGS 4QIWB 1JWMD 3BG3A 4OGQC 2O5JC 1SYGA 1HXYD 2EVBA 1DD2A 3MWYW 1O7YA 4LAAA 2ZXPA 5JOBA 1E2ZA 1TS4A 3PIP3 1GHJA 2AQ1B 1QG7A 1JICA 2CVRA 1S4ZA 2B8GA 4KHVA 4XTCS 1B53A 1U9RA 1TWAB 2F4IA 1EYAA 1Z6HA 4JK1C 3T51B 1PFNA 3MVVA 3NQTA 1STYA 1LV9A 1IL8A 1LABA 1LTGD 1FR3A 5T1GA 2VB2X 2VNUD 1K8OA 2O5IC 2F0SA 1PDQA 1AZPA 1SYFA 1BNZA 1Y8PB 4RFBA 4FXGC 2RA4A 4OO1H 3D8GA 2C5CA 3V05A 1HTPA 2Y0SB 3H6MA 4IURA 3PUXA 3S16B 2IWHA 1VMCA 2K04A 2XRSD 1OXSC 3I4NB 2JXMB 1SNDA 3M7GA 1CZGA 1TS2A 3GTPB 4IQZA 1G2TA 4KHZA 3PO2B 1SE4A 3MXNA 1W6JA 1YNJC 2L1BA 2OEOA 2JA5B 4QCLA 2XN9C 1A2TA 2HDLA 2F0TA 4XQJA 1Q90A 4ME5A 2NVYB 2EYFA 3TP5A 4BY1B 3FMCA 2K1BA 1C8CA 2NZ1D 2EYMA 2I46A 4IFDH 1VF5C 2F0IA 5ELBA 1E2VA 2SNMA 4EQPA 2Q8TA 2A74C 1JQYD 4HSVA 5KIXA 5IODA 3OPOA 5E4XA 1TT2A 2A68D 2F0HA 4HEDA 4ZUJA 5I6YA 2KECA 5CV9A 1OXUA 4B08A 5IGGA 1IKLA 1PRTC 5IGDA 2A5HA 2RBMA 4DXGA 2IJ0A 2RQXA 1V1PA 4OO1I 2F3VA 2B63B 1ML0D 3H3VC 1A3VA 1SJHD 2LKVA 3ONAB 5IIFA 3S9WA 3EJIA 2XVSA 1ICWA 2O2LD 1EY9A 1XX8A 5FLXE 1PRTD 1EIGA 1K8MA 1DOLA 4ZLTF 3C46A 4DFAA 3MEHA 2B2TC 4LMQD 4HTHA 2E2HB 4C1NI 2YYZA 2EJFC 4XT3B 2EYLA 1PZKD 4A3JB 5C4JB 2FMCA 1OXTA 2ZXOA 4PMCA 4S3SA 2NTTA 2J7ZA 1C48A 3K5LA 1EZ6A 2IX0A 3IFTA 1GOZA 2F0UA 5CV4A 1CQFA 2RVLA 2K5DA 2KVMA 3NTIA 1OO9B 3TP7A 2EYJA 2F0FA 4UAIA 3A8IE 3DEPA 2PW5A 1OXVA 1ET9A 2B2VA 3D6CA 1BUVT 3MTSA 5EJWA 5EKLA 1QILA 4XXEA 3G6JB 2L11A 2F0WA 1AW7A 2X69A 3TMEA 2JP1A 3SR1A 2A6ED 1PXUA 1H9MA 5IT9E 1GUTA 5EBCA 4F87A 2VB3X 3S14B 3K7AB 2A69D 3KLRA 1RJTA 2IPKD 2BCOA 3K5NA 1CI3M 3HOXB 2B2UC 2M9VA 2CQAA 5I9OA 1SFOB 1F9RA 1EIHA 4KN4C 4CHTB 5CV5A 4V190 3I4LA 4RGTA 3HOYB 2LMCB 1EQTA 1V8QA 1XXGA 4RGNA 2MUYA 3DMUA 2SNSA 1J9OA 3K6OA 1PTOC 1H9JA 1VDZA 1J8IA 1MBYA 3A8JE 4IUQA 3M85A 1LACA 2L4NA 4M1UB 4RAUC 1XWEA 3NWTA 2E76C 1PRTF 4EQNA 4G7ZC 5CBEE 3F2UA 1BF4A 3CRLC 1W6KA 4JBWA 2CW0D 1CK1A 1R4PB 2IX1A 1A3TA 4H13C 4KKSA 1DYQA 1H9SA 2F0MA 3NSWA 5C5LA 3S15B 3PUZA 2TMPA 3PV0A 2H1EA 3NTHA 2Q8IB 1I4QA 1S5BD 3HKZB 3AB9A 1CM9A 3D3RA 2E2JB 3JAML 1HCZA 4LK1C 1RD9D 5M5YB 1WD1A 5CMDA 1TR5A 4ULLA 5DNFA 3WOEA 3DWQA 1SXTA 1STNA 4G7HC 3GTJB 2B2VC 4FF1A 1FD7D 2NUCA 5C4ZA 5C0XG 2DY8A 2EE1A 4J6HA 1NCVA 4RCNA 4KD4A 1EYDA 4BBRB 3V96A 2R93B 4HN7A 1HTLD 4IN3A 3BZDB 1WTQA 2EY2A 2A6HC 5JVG3 3J81E 2A73B 1I4XA 4EQOA 4KY6A 1ZKOA 1PFBA 2WAQB 4N9PA 1WTVA 3VR4A 2KCCA 1EY7A 3I91A 4RGOS 1MGSA 1SNPA 1JR0D 1D5MC 1F2YA 2JYOA 2ZXRA 1STEA 2OT2A 4KTAA 4KMUC 3Q6SA 3VR6A 3GTOB 4KI0A 1D1KA 3OIQA 3HS0C 3R93A 5F2DA 4CKEA 1FNVA 4DN4M 1LT6D 4KY5A 5IGEA 2A69C 5C5MA 4ZKBB 5EGTA 3WDNA 3D31A 1YNND 2R3ZA 2MPMA 2DY7A 1ENCA 1LTAD 3MFGA 3QIAA 4A3BB 1TU2B 3T4AC 1JCKB 1HRJA 3J7AF 1TIID 1SSOA 3CRKC 1BCPF 4Q5VA 1JOKA 2XWJB 4HCEA 1B2TA 5A2QE 1I6VC 4QB4A 4G57A 3GO5A 2K01A 3T13A 1JOQA 4DU9A 2F0EA 4KY7A 1STBA 4DK1A 2F0DA 2LS01 4RHRA 1TQOA 1BDOA 3J80L 3QB3A 3D6WA 3RLFA 1IW7C 1AEXA 5IGCA 1RTOA 4KKUA 1HUNA 3RUZA 3GV3A 2FMMA 5J1ZA 5BN4A 3HZXA 2BE5D 4IUTA 5D3DA 1B3AA 3U9OA 4F8MA 4CKCA 3QG1A 1PRTB 4RCOA 4DF7A 1RF2D 2PO4A 4IFDG 1EY0A 5ELDA 3Q22A 4U673 3A7LA 1QJOA 1WTXA 4QF4A 2F1MA 5D3IB 1K83B 1T5XD 2K5QA 5CYUA 1SNMA 1AN8A 1AP0A 4DXFA 1M4VA 1EQVA 3Q0AA 4DGZA 2HQEA 1CTMA 1KTKA 5C3EB 5JEAJ 5FO8B 2QKIC 4Q0FA 3BVMA 4C56C 2IW3A 1LTID 1QOHA 2Z4HA 2WV6D 2QEJC 1DCZA 4FVMA 2WIIB 1QCBD 3R2TA 4NMZA 5ELEA 4OIJA 2TSSA 3A7AB 4K8JA 5LL6X 2F0QA 2PYKA 3L7ZC 1Q1BA 1B4OA 3SK4A 4XYQA 4FYDA 5J22A 2D2CC 1C4QA 4MN3A 1CFMA 4ODGA 5EQ0A 1PFMA 3JAME 1HFNA 4ZKCB 3SE0A 2FFKB 3I72A 4TQUS 5JJZA 1TWHB 4A3FB 2AWNA 2MHVA 3H91A 1Q8IA 3RD4A 1GXDC 4FXKC 2PMZB 5KNCA 4K2LA 3J80E 4TKOB 1VMPA 3NXWA 1UNSA 3P75A 1BCPC 5DAUA 1PYWD 4TSSA 3TZUA 3SXHA 3RZOB 4L63B 1MSHA 2WKDA 1SBBB 3D4WA 5CV6A 2IX3A 5CV8A 2EPBA 2NWGA 4CBVA 3URYA 1GHKA 3OWFA 4NKLA 1U4RA 2SDFA 5KYIA 1BO0A 1SE3A 2L55A 3H94A 1O7ZA 3VR3A 5CORA 1DM0B 3HRZC 5EBDA 1WCMB 1JOOA 5M9OA 3VYSA 2E2DC 3MAQA 1U4LA 1NR4A 1Y69U 1CHQD 4L8JA 3LWEA 2L5TA 3S1MB 3T53B 1F2MA 4H7BA 3UI2A 1UUPA 1SE2A 1RTNA 1SDFA 2CHBD 3VYUA 4R8NA 2C9OA 3OMCA 2K28A 3CHBD 3OHXC 4FXDA 4HCSA 4ID6A 3HOWB 4BBSB 2L0CA 4RGMA 3V2TA 5E3FA 2F0JA 2JE6I 1FNWA 3S2DB 1CT1D 3CU7A 1SYEA 5EPLA 3VYTA 3NQIA 1UEAB 1A3UA 1B1ZA 1LT4D 1QNKA 3A55A 3KBXA 2MJ8A 4I65A 2JA8B 1HPCA 3D4RA 2ID0A 2B2TA 4B9XA 1H9RA 2EY5A 3MC0B 2BOSA 2NB0A 2X6LA 3C1FA 2EY6A 3EFXD 1PTOH 1B9MA 4G4KA 4B9WA 1V43A 3BYYB 3R2IA 1JORA 3MHBA 3SK6A 1JB3A 1G2SA 1GUGA 5JEAG 1B50A 4MHEA 3J7AV 1Y1VB 5KNBA 2K03A 3VA7A 4C3HG 4K8IA 1TS3A 4FO2A 1G291 4K5XA 4KV6A 4H0LC 2F0OA 3QOLA 1KAAA 1BOSA 5D65A 1EY5A 1XYIA 1G6ZA 2PZUA 3Q23A 4ILWA 4ZYSA 4NDXA 1LTSD 4KJOA 3I4MB 3ND9A 4PQXA 3SHLA 1KDAA 1ENFA 3X3MA 4RWSC 2F0PA 2KEDA 2KJXA 4RKBA 3EVQA 4CKBA 4K14A 1IYUA 2BDNA 4HMIA 1EU4A 5JVH3 1BCPB 4I7ZC 3H09A 1FGBD 5K36H 5LL6S 4WJWA 1ILPA 1SYBA 1NSNS 3DWPA 4DA2A 3C2PA 5C4XB 1CQVA 4Y7NB 2F03A 1EEID 4IUVA 3M7NA 1I4RA 4V0BA 2AWOA 3LX0A 2R7ZB 1B9NA 5C0XI 5COYA 2AQ3B 3KK7A 4ABNA 3EROA 4X3TA 3NE5B 2L12A 2RDHA 3MA2B 5C0XH 5CV7A 4HR7B 4R9WA 1CA5A 3HP3A 4DAPA 1FNUA 1NR2A 2XNAC 3HG9A 2JEAI 3KBGA 5K36G 3FKIB 3A54A 3BYTB 1GUNA 1TS5A 2HDMA 2RSOA 5KGUA 4UDUC 1TWGB 2EDGA 4ZUIA 4H44C 2BA0A 3VA5A 1L0XB 3J7YW 2KUMA 5C6AA 3SK5A 4K6LA 2PQEA 3S1QB 1X32A 2J0TD 1O78A 2XRQD 1BBXC 3D4DA 4WORA 3NWSA 1SAPA 2B2WC 2FHTA 3GD7A 4EVOA 2YU9B 5C0XJ 4BY7B 3BS1A 3X3NA 4YIJA 2EXZA 4KN7C 1I4HA 2KA7A 5M5XB 1G91A 3SK8A 1DXMA 2PNRC 1F77A 4EGVA 4N9TA 5I2YA 3C1EA 2WKCA 3KLSA 2B39A 4Z9CB 1PZJD 1I4PA 1EY8A 2K33A 3DEOA 4F7XA 2Z1CA 2H4OA 4BWGB 3TZDA 1EL0A 2B2YA 4R8IA 1CA6A 4AYBB 2QILA 3J81L 2AUKA 3FVQA 1ZXTA 3FDTA 4K5WA 3H0GB 3ND8A 5FKAC 1TWFB 1LTBD 2WB1B 4C3JG 1X3QA 4C3IG 2A68C 3K5MA 3GP7A 1BCPD 3TDQA 5M3MB 4E6IA 1E0BA 5CGKA 4RHSA 3ERQA 5KYLA 2F3WA 1U4MA 1SJED 2PW7A 1RHPA 1PMRA 1LO5D 2M00A 3RMHA 4IFDJ 4O42A 1TKWB 1IW7D 1UAPA 1L0YB 4KD3A 1GJXA 2NVQB 1GUSA 1ENAA 1B44D 5FK9C 1G8ZD 2N55A 4XT1B 1YNJD 3E6ZX 3NUCA 3K5OA 1ESRA 2AQ2B 3LWUA 1X3PA 1CZWA 1VF7A 2D62A 5CC4A 4PMBA 3L3OC 1U4PA 4HAEA 3PO3B 2HCIA 2HCCA 5CR3A 1S5CD 2VUMB 1WTOA 4P2CB 3K0YA 2EYHA 3A8KE 3QOJA 2KOLA 3SEBA 1S5ED 4BA1I 3GTMB 5HURA 5HGTA 3L9AX 3C3LA 2K05A 1TY2A 2NN6I 1EWHA 2PZTA 2NVXB 2NVTB 4NP5A 1JE4A 3MZ5A 3PUWA 3VR2A 1EY4A 2KQ3A 2QF7A 3GTQB 3FEWX 4J1MA 3E5SA 2X6GA 5LHY1 3PUVA 3I3CA 1O7LA 2K7VA 1D5ZC 1IHZA 1ZEQX 1KLGD 2Z4IA 1WTWA 2DN8A 2N88A 1LT3D 1AFPA 5E1FA 4QUFA 2K32A 5I6WA 1HQMC 3VYRA 5JPNC 5D14A 1HA5A 2NYZD 5EPJA 1TVXA 4PMWA 1I50B 5NUCA 4RH6A 1RODA 1KNAA 1XTCD 3T56B 3SVMA 1DOKA 2RDGA 3PMFA 1O80A 1EU3A 1RDPD 2JSOA 1QB5D 2L9HA 1ILQA 2NN6G 1S5FD 1I3QB 4FF2A 1RKNA 3HOUB 5EKIA 1HA6A 2G9HD 5FLXL 1F9SA 5IT9L 4A3DB 5JEAH 3P20A 2F0LA 4ZRZA 3EA6A 2JA6B 1H9SB 1Y8NB 3O13A 1Q3LA 3BVGA 1ONLA 2R6GA 4MIUA 3MXGA 5BN5A 1BR9A 1TWCB 5IGBA 5A35A 1HFGA 4K6DA 4CJ0B 2E2IB 1YNNC 2F0KA 1Y8OB 1D1IA 4A3IB 1DONA 2K5WA 3PIO3 2XWBB 2PCFB 4DNTB 1F9PA 3NK9A 1LLRD 1SMYD 3KUPA 2EJMA 3E0JA 1WTPA 3QO2A 2FINB 3K57A 1KDCA 5G3LD 3IFDA 2WACA 1HHVA 1CHPD 5I2XA 5FO9B 1KNEA 1FYCA 3P1HA 2K6AA 2WP8J 2FJ2A 2BDOA 2I07B 3MXUA 3NTKA 2IL8A 3ZYYX 3DUZA 3N52A 2A6HD 3WOFA 1WVLA 3AU7A 3BDOA 2RDFA 1Q1EA 2RKSA 2Q8RE 3OWEB 3DWAA 3OOCA 3G7LA 2E75C 2F0VA 2V4DA 1PLFA 4RA8A 3R3OA 2RSNA 1H9KA 3TN2A 4K5VA 1STHA 2EYOA 3GQBA 4A3EB 3FPUB 2MP1A 4XQNA 2EOTA 2AUJD 1PTOB 2OF1A 1LTRD 4HMJA 4C1NK 4F88A 3T16A 1SNQA 1ZYRC 4GZYC 3M3YB 3W2DA 4BA2I 4ZK9B 4X3UA 3GTKB 3AMUA 5IOCA 5DEHA 4J8QA 4PV1C 4XQQA 1SYCA 2CW0C 5E4WC 4G7OC 2ICEC 2F0GA 1EEFD 3NPPA 1NUCA 5KRUA 2JEBI 2KEEA 2IT1A 3HOVB 2GA4B 4ZQ3A 4HSPA 1JWUD 3HEJA 4C3JB 4IUPA 1SEBD 5C44B 5KNDA 1MD2D 3IL8A 1PTOD 2OXPA 4IFDI 4FNFA 2A6EC 3NP8A 1EYCA 4OO1G 5CBAE 3TSSA 4CGYB 1I4GA 5M5WB 3NBHA 4FP5D 2MGSA 1PTOF 2B8FA 3DHQA 4RKLA 1QNUA 4CJ1B 2J4XA 5ELFA 3DXJC 2ENBA 2Z8LA 2WINB 4C3HB 2NBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVR A;  1S4Z A;  1CA6 A;  5CBE E;  2KOL A;  1F9S A;  2RVL A;  5D65 A;  2K28 A;  1B53 A;  2KVM A;  3F2U A;  4ZKB B;  1XYI A;  1BF4 A;  2B2Y C;  1GUW A;  1G6Z A;  1NAP A;  4HCS A;  4UAI A;  3DEP A;  1PFN A;  2B2W A;  1ZXT A;  2R3Z A;  2Q8T A;  2B2V A;  2XIW A;  3FDT A;  4HSV A;  2HDM A;  4ZK9 B;  3MTS A;  2MPM A;  4OIJ A;  2RSO A;  1LV9 A;  2DY7 A;  2K05 A;  4X3U A;  5E4X A;  5EJW A;  1Q3L A;  1IL8 A;  1WTR A;  2VXW A;  5T1G A;  5AFW A;  5EPL A;  2M2L A;  4HED A;  1HFG A;  4CJ0 B;  1HRJ A;  1JE4 A;  1SSO A;  1QNK A;  2L11 A;  4RWS C;  1B4O A;  1PDQ A;  3KBX A;  1AZP A;  1X3Q A;  2KED A;  3GV6 A;  5T1I A;  5E4W C;  1DON A;  1B2T A;  2X69 A;  2KEC A;  1F9P A;  2MJ8 A;  4ZAI A;  1BNZ A;  2JP1 A;  1MSG A;  2KUM A;  2H1E A;  2K01 A;  3KUP A;  2BDN A;  4MN3 A;  2X6G A;  2RA4 A;  1IKL A;  2B2T A;  3QO2 A;  1WTP A;  2FIN B;  3I3C A;  5EQ0 A;  1PFM A;  1F9Q A;  1X32 A;  2KEE A;  4IUU A;  1CM9 A;  1E0B A;  4ZKC B;  4R8I A;  1AZQ A;  1HFN A;  2FFK B;  4IUR A;  1RJT A;  1U4M A;  1WD1 A;  1M8A A;  5CMD A;  5JJZ A;  1BBX C;  1RHP A;  5DNF A;  3IFD A;  2B2U C;  3I90 A;  2EOT A;  3D6W A;  2X6L A;  1ML0 D;  3H91 A;  1VMC A;  2B2V C;  1HHV A;  1ILP A;  1DOM A;  4CJ2 C;  1SAP A;  1RTO A;  2B2W C;  2FHT A;  2K04 A;  4O42 A;  1WTW A;  1F9R A;  1KNE A;  1EIH A;  3ONA B;  2N88 A;  1HUN A;  3GV3 A;  1WD0 A;  2FMM A;  4IUP A;  2FJ2 A;  2DY8 A;  2EE1 A;  1ICW A;  1NCV A;  1VMP A;  3IL8 A;  4U68 A;  4IUT A;  1XX8 A;  2HUG A;  4QUC A;  4QUF A;  1EQT A;  1B3A A;  1EIG A;  1MI2 A;  2IL8 A;  1WTQ A;  1DOL A;  4NW2 A;  4ZLT F;  1G91 A;  1MSH A;  1G2T A;  3N52 A;  1F2L A;  4IUV A;  2EPB A;  1WVL A;  2NWG A;  5CBA E;  2B2U A;  2N55 A;  5D14 A;  1G2S A;  2NYZ D;  4XT1 B;  1TVX A;  2B2T C;  2L1B A;  2Q8R E;  4LMQ D;  5EPJ A;  4XDX A;  1J9O A;  1WTX A;  1PFB A;  1WTV A;  1U4R A;  3G7L A;  1B50 A;  2SDF A;  5COY A;  1BO0 A;  4MHE A;  3MWY W;  1ROD A;  1AP0 A;  1KNA A;  2MGS A;  1O7Y A;  1PLF A;  4X3K A;  1O7Z A;  4XT3 B;  3I91 A;  1ESR A;  2HDL A;  4RA8 A;  1MGS A;  1IKM A;  3SVM A;  1J8I A;  1A15 A;  1DOK A;  1X3P A;  4X3T A;  5COR A;  4IUQ A;  2RSN A;  3TZD A;  1QE6 A;  1HUM A;  4X3S A;  2K03 A;  2JYO A;  2L12 A;  1U4L A;  3DM1 A;  1NR4 A;  1DZ1 A;  1O80 A;  1U4P A;  2D9U A;  3Q6S A;  3TN2 A;  4HAE A;  2L4N A;  4CJ1 B;  2J7Z A;  4OIK A;  4RAU C;  3LWE A;  2K1B A;  2L9H A;  1ILQ A;  2NZ1 D;  4R9W A;  2HCI A;  2HCC A;  3HP3 A;  3DEO A;  1C8C A;  1CA5 A;  3R93 A;  1EOT A;  1WTO A;  1NR2 A;  3P7J A;  3UI2 A;  1QG7 A;  3FPU B;  1JIC A;  3I8Z A;  4DN4 M;  1RTN A;  2MP1 A;  5EKI A;  1EL0 A;  1HA6 A;  5EPK A;  2B2Y A;  1SDF A; 
#chains in the Genus database with same CATH topology
 2DNE A;  1A2U A;  1S5D D;  1NBW A;  4JI4 Q;  2PPB C;  1QWY A;  3Q24 A;  4K2K A;  2B2W A;  1YJ9 A;  2R92 B;  5IY0 A;  2EY1 A;  4BXX G;  2ZT9 C;  3F2B A;  4C2M B;  1TWC H;  5KEE A;  1STA A;  5JJL A;  4MTN A;  1Z7T A;  3E9H A;  1CKN A;  1JWS D;  5AFW A;  5BN3 A;  4R4T A;  3HOZ B;  1P8L A;  3LNN A;  2F52 A;  4L6T B;  2UUC L;  4IOA A;  5EKK A;  4QMG A;  5C3X A;  3K80 C;  1ESF A;  4A3B G;  2KCN A;  3ULP A;  2E2H H;  1II3 A;  1Q81 C;  2H5X A;  1RCV D;  2QDB A;  2LFN A;  3CKI B;  4GNX C;  1IKM A;  2O4X A;  1AZQ A;  1V1O A;  4TRD A;  4OL7 A;  3MXP A;  2EZV A;  2JA7 B;  1MKH A;  4YWK A;  4C3I B;  1M8A A;  4A3L H;  3NBI A;  1F2Z A;  4KLK A;  1OXX K;  4IPC A;  2A8V A;  5DM6 3;  2EYP A;  4DNR B;  1GD7 A;  1HNX L;  4PNY A;  3U9S A;  3TP8 A;  4CJ2 C;  2WAQ E;  5GRO A;  2G5D A;  1E22 A;  1S3O A;  1D7Q A;  3PF4 A;  2PZW A;  1T5E A;  4RMF A;  3Q8D A;  5IYC G;  1TY0 A;  4J15 A;  4U68 A;  2N8N A;  3I73 A;  3OYY A;  4QUC A;  1BBU A;  2NTS A;  5HGQ A;  2D0P A;  1SNC A;  1R4Q B;  3NBH B;  4NW2 A;  3A5U A;  3RZD B;  1KLU D;  2F0N A;  1F2L A;  1Y1V H;  4DR4 Q;  2B2U A;  1VQI A;  1DJR D;  3W3A A;  2PQA A;  4P74 A;  2EJG C;  3UE0 A;  3ITP A;  4DK0 A;  3K58 A;  1EWC A;  3J7Z C;  2XSC A;  3FRP B;  4LFC Q;  4X3K A;  3KLS X;  3PIO A;  3QWN A;  5C3W A;  5G3L F;  1PH3 A;  1KRS A;  1EIF A;  1HUM A;  2Y0S E;  5FO7 B;  4WRD A;  3DM1 A;  2ZTC A;  3T1Y L;  3A56 A;  2D9U A;  1X3E A;  3R8B A;  4BS9 A;  4Y52 H;  4AQY Q;  5JAV A;  4DV5 L;  3CW2 C;  4LF6 L;  1EOT A;  3KF8 B;  4LUO A;  1Y1W G;  3I8Z A;  1STG A;  2G9D A;  3P7J A;  3EN2 A;  4OHJ A;  1VQE A;  4IZ8 A;  1D2B A;  3ULJ A;  1GUW A;  2D5D A;  3BDC A;  5I4D A;  1HJP A;  4BBS H;  4LJZ C;  1WJJ A;  3NHH A;  4KHP L;  3KF6 A;  5C3E H;  4JI8 Q;  1I3Q H;  3S1R B;  4NB3 A;  4IUN A;  2I5H A;  1LYL A;  2R61 A;  4A3G G;  1VQF A;  1WTR A;  1Q12 A;  2VXW A;  3HOY H;  2Q2I A;  2M2L A;  1N33 L;  5J39 A;  4LFB Q;  2VUM G;  1YNX A;  3W5O A;  3GV6 A;  5GAD C;  1N9W A;  1Z47 A;  2JN4 A;  2BA1 A;  3L0O A;  4GN3 B;  1MSG A;  1EYG A;  4EQ5 A;  2RCF A;  3T1H Q;  3BDL A;  5ELC A;  1F9Q A;  4P72 A;  4IUU A;  1I6H B;  2BE5 C;  1X3G A;  1T9H A;  2HD3 A;  1E1T A;  1V1P B;  4A3E G;  4FF3 A;  3NEM A;  5C4X G;  3N6R A;  2KHS A;  4XYO A;  1DOM A;  3AFQ A;  2LY7 A;  3BVZ A;  3S16 H;  1Q8K A;  2NN6 H;  1Q7Y C;  1LT5 D;  4KJN A;  3M4O B;  1EY6 A;  3SDZ A;  1VCI A;  2VW9 A;  4A3B H;  3CQZ B;  4KK7 A;  1SYD A;  3J81 c;  4DV0 Q;  1EQQ A;  1D6E C;  3MFY A;  1IYV A;  3S2H B;  4YWM A;  4XDX A;  3ULL A;  1R9T B;  4I7A A;  4WFN 3;  1SMY C;  3IAY A;  3CMA A;  2C35 B;  1QVG A;  3K59 A;  3HGB A;  4HJ9 A;  2QGQ A;  1A15 A;  3CPF A;  3F2D A;  1QE6 A;  5FOB B;  5M3M G;  4A3M B;  3W1G A;  1SMX A;  4DAY A;  3S1N B;  4X3S A;  1ET6 A;  1D5X C;  3TBI B;  1DZ1 A;  3QJY A;  4HID A;  2LXJ A;  4OIK A;  5M3F B;  3I70 A;  4B3M Q;  3HOV G;  5K5P A;  3OSO A;  2SOB A;  3OMG A;  5EPK A;  3IKJ A;  4B3M L;  3OW7 A;  3CC4 A;  2B2Y C;  1NAP A;  5C4H A;  1JC7 A;  3CCU A;  4DAV A;  4JBM A;  4LWC A;  5A2Q L;  1EZ8 A;  1MIU A;  2XIW A;  2CCZ A;  1Y1W B;  4FF4 A;  5ISR A;  2QCP X;  2SEB D;  2NVQ H;  2VQE L;  4A3K B;  3S17 B;  4JI7 L;  1EFI D;  1ZYR D;  1KAB A;  1BQQ T;  5JPM C;  3GTG B;  4IAL A;  5T1I A;  2ICI A;  5IWA L;  3JC6 6;  1KDB A;  1JJC B;  2UXC L;  4ZAI A;  3EQL C;  1BXT A;  4A3G B;  4JI7 Q;  5TSS A;  4LNQ A;  5DM7 3;  1LTT D;  1PZI D;  4M8A A;  3TP6 A;  4LF9 Q;  1E2W A;  3AEV A;  1HQR D;  4KKT A;  3KF6 B;  3A0J A;  1SNO A;  4OWX B;  3KF8 A;  3JAM c;  2DNC A;  3M4Y A;  3I90 A;  1GUO A;  5IGF A;  2Z6K C;  1O7I A;  3FPP A;  3PUY A;  3OIP A;  2K52 A;  4DR5 Q;  3VR5 A;  1Y14 B;  2E74 C;  1WD0 A;  4O1N A;  4PG3 A;  4A93 B;  3VDY A;  1A6X A;  2HUG A;  5I9P A;  1MI2 A;  3GTL B;  4XIG S;  4NXM L;  4A75 A;  1LTL A;  1JJ2 A;  2ZM6 L;  2MFI A;  4QIW B;  1JWM D;  3BG3 A;  4OGQ C;  4Y7N H;  1CKN B;  2O5J C;  1MJE A;  2UXC Q;  1SYG A;  1HXY D;  4GN5 A;  2QW7 A;  2EVB A;  1DD2 A;  3MWY W;  3TS2 A;  2YTY A;  1O7Y A;  4LAA A;  3NEN A;  4JI6 Q;  1N33 Q;  2ZXP A;  2QA4 A;  1CSQ A;  1N36 L;  3J80 i;  3ICE A;  5JOB A;  1E2Z A;  1TS4 A;  1A62 A;  3PIP 3;  4LF9 L;  1GHJ A;  4A3C G;  2AQ1 B;  4LW1 A;  1QG7 A;  2NZH A;  1JIC A;  3STB D;  4B3S Q;  1U5K A;  3H0G H;  2CVR A;  1S4Z A;  2B8G A;  4KHV A;  4XTC S;  4L5S A;  3PQI A;  4N8X 1;  1B53 A;  1EUJ A;  4BBR G;  1U9R A;  1TWA B;  2F4I A;  1EYA A;  1Z6H A;  4JK1 C;  4QIW E;  3T51 B;  2EXD A;  1PFN A;  1XMO Q;  4X6A H;  3MVV A;  3NQT A;  1STY A;  1LV9 A;  4O0A A;  5GQO A;  1IL8 A;  1LAB A;  5HY6 A;  4DR2 Q;  1LTG D;  1FR3 A;  5T1G A;  2VB2 X;  2VNU D;  3UE1 A;  1WCM H;  1K8O A;  2O5I C;  1ASY A;  2F0S A;  1PDQ A;  1AZP A;  4JOI A;  1SYF A;  1BNZ A;  1Y8P B;  4RFB A;  4FXG C;  1SRU A;  2RA4 A;  4OO1 H;  3D8G A;  1MHW C;  2C5C A;  3CAM A;  2DGY A;  3V05 A;  1HTP A;  2Y0S B;  3H6M A;  4IUR A;  2ZTD A;  3PUX A;  3CCL A;  3S16 B;  2IWH A;  2R7D A;  1VMC A;  3CP0 A;  4JI2 Q;  2YV5 A;  4LF6 Q;  2K04 A;  2XRS D;  1OXS C;  3CXC A;  3I4N B;  2XTI A;  2JXM B;  2R7Z G;  2E5L Q;  5IYD H;  1SND A;  3M7G A;  1HZB A;  1CZG A;  1KC8 C;  1TS2 A;  2HQL A;  3HOW G;  3GTP B;  4IQZ A;  1G2T A;  4KHZ A;  3PO2 B;  1A8V A;  4LF7 L;  1SE4 A;  1N34 L;  3MXN A;  1W6J A;  1YNJ C;  2L1B A;  2OEO A;  2JA5 B;  1KIX A;  3RZD H;  4QCL A;  4O2D A;  2XN9 C;  1JJG A;  1A2T A;  2HDL A;  2F0T A;  4XQJ A;  1Q90 A;  4ME5 A;  4QL5 A;  2N3S A;  4DNI A;  2NVY B;  1JB7 A;  4APV A;  2EYF A;  3TP5 A;  4BY1 B;  3FMC A;  5ELO A;  2B63 G;  1IBL Q;  2K1B A;  5BR8 Q;  2NZ1 D;  1C8C A;  2EYM A;  2CKZ B;  2I46 A;  2PMZ E;  3QR8 A;  1K9M C;  4GOP A;  1C7Y A;  4IFD H;  1VF5 C;  2F0I A;  2GN5 A;  4IPD A;  1TWH H;  4A3F H;  1X9N A;  5ELB A;  4JI2 L;  1E2V A;  2SNM A;  1OTC A;  4MZ9 A;  2PI2 A;  4GKK Q;  4EQP A;  2Q8T A;  2A74 C;  3GTP H;  1JQY D;  4HSV A;  5KIX A;  3B6Y A;  5IOD A;  3OPO A;  5E4X A;  1TT2 A;  5IYD G;  2A68 D;  4JYA L;  5BR8 L;  4X64 Q;  4QQB X;  1TWF H;  2F0H A;  4GKK L;  4HED A;  4ZUJ A;  5I6Y A;  3HKS A;  4JPB W;  3CPW A;  3HOU G;  2KEC A;  2L15 A;  5IP9 G;  2EIF A;  1YHA A;  5CV9 A;  4A76 A;  1OXU A;  4B08 A;  4DR3 L;  3H3V H;  5IGG A;  1E7Z A;  1IKL A;  1PH5 A;  1PRT C;  1W3S A;  5IGD A;  2A5H A;  2RBM A;  4DXG A;  2F4V L;  1PHJ A;  1IBM L;  2V1C C;  4UHV A;  1G51 A;  2IJ0 A;  2RQX A;  1V1P A;  4OO1 I;  2F3V A;  2K4K A;  2ZJQ A;  5LMU L;  2B63 B;  4YCU A;  1ML0 D;  3S1Q H;  3H3V C;  1A3V A;  3TRE A;  1SJH D;  3KYH C;  4PZ6 A;  2LKV A;  3ONA B;  5IIF A;  4MTK A;  1A0I A;  4A3I G;  3S9W A;  3EJI A;  2XVS A;  1ICW A;  2O2L D;  1FJG L;  1EY9 A;  1XX8 A;  5FLX E;  1PRT D;  1XNQ Q;  1EIG A;  1K8M A;  1C9O A;  1DOL A;  4ZLT F;  1EWI A;  4HIM A;  3C46 A;  3HKZ E;  4DFA A;  3MEH A;  3M3Y H;  4B3R Q;  2B2T C;  4LMQ D;  3CCE A;  4HTH A;  4ZCK A;  4WJ3 M;  2E2H B;  4C1N I;  3PO2 G;  4JI6 L;  2YYZ A;  4B3T Q;  3A5Z B;  2EJF C;  2NZO A;  4XT3 B;  3TEH B;  2EYL A;  1PZK D;  4YCW A;  4A3J B;  5C4J B;  1UE1 A;  2FMC A;  4C3I H;  1OXT A;  2VY3 A;  3HOU H;  2ZXO A;  2HIX A;  4PMC A;  1K3R A;  4S3S A;  1HNZ Q;  2NTT A;  2QEX A;  2J7Z A;  1C48 A;  3FP9 A;  3K5L A;  3GTO H;  4DR7 Q;  1YJN A;  1EZ6 A;  2IX0 A;  3IFT A;  3T1Y Q;  4DV7 Q;  2Z0S A;  1GOZ A;  5M3F G;  2F0U A;  5CV4 A;  5GAE C;  5LMU Q;  1CQF A;  2RVL A;  2K5D A;  2KVM A;  5C4X H;  3NTI A;  2IY5 B;  1OO9 B;  3TP7 A;  4QGU A;  2EYJ A;  5IYB G;  3LGJ A;  2UUC Q;  2F0F A;  4UAI A;  2WB1 G;  3A8I E;  3DEP A;  2PW5 A;  1OXV A;  1ET9 A;  3RR5 A;  2B2V A;  3D6C A;  1BUV T;  4A3I H;  2F3I A;  3MTS A;  1NJI C;  1PH8 A;  5EJW A;  5C44 H;  5EKL A;  4JBK A;  4JI8 L;  1QIL A;  2JJQ A;  4H02 A;  3TQY A;  4DAY B;  3OW2 A;  5FJ8 G;  4XXE A;  3G6J B;  3UDF A;  2L11 A;  1SN8 A;  2F0W A;  4YCV A;  1AW7 A;  2X69 A;  3TME A;  4L5T A;  1FVI A;  1P16 A;  1X6O A;  2JP1 A;  3SR1 A;  4CDF C;  2A6E D;  1PXU A;  4IPH A;  4OX9 L;  1H9M A;  5M5W H;  1GUT A;  5EBC A;  4F87 A;  5IT9 E;  2VB3 X;  3S14 B;  3K7A B;  4X65 Q;  4BBS G;  2A69 D;  3KLR A;  1I5F A;  1RJT A;  2IPK D;  2BCO A;  1WYD A;  2K5H A;  3K5N A;  1CI3 M;  3HOX B;  5IT9 c;  2B2U C;  1J5E L;  1Z9F A;  2M9V A;  2CQA A;  5I9O A;  4LFC L;  1SFO B;  1YVC A;  3CCR A;  1F9R A;  3FKI H;  1VQC A;  1EIH A;  4KN4 C;  4CHT B;  5CV5 A;  4C3H H;  4V19 0;  3I4L A;  4RGT A;  3HOY B;  2LMC B;  1EQT A;  3UDI A;  1V8Q A;  1V9P A;  1XXG A;  4RGN A;  4QJF A;  4C2M H;  5LMN L;  4A3M G;  2R92 H;  2MUY A;  1TWG H;  4A93 H;  2OQ0 A;  3DMU A;  1PH2 A;  2SNS A;  1J9O A;  3K6O A;  1PTO C;  1H9J A;  4P75 A;  1XPR A;  1VDZ A;  1J8I A;  1VQB A;  1FGU A;  3PGZ A;  3S15 H;  3S1M H;  1MBY A;  3A8J E;  4IUQ A;  3M85 A;  5JJI A;  1LUZ A;  1LAC A;  4LFA Q;  2L4N A;  3UDX A;  4M1U B;  4RAU C;  1XWE A;  4POF A;  3ZJY C;  3NWT A;  1M90 C;  5FLX c;  2E76 C;  1PRT F;  4EQN A;  1N8R C;  4TVA B;  4G7Z C;  5CBE E;  3F1Z A;  2ZTE A;  3F2U A;  3S2D H;  1BF4 A;  3CRL C;  1W6K A;  4JBW A;  2CW0 D;  3I56 A;  1KAW A;  2VQF Q;  1CK1 A;  1R4P B;  4LF5 Q;  1Q82 C;  2IX1 A;  1UWV A;  1A3T A;  2JA8 H;  4H13 C;  2IHF A;  4LUZ A;  4KKS A;  1DYQ A;  1H9S A;  2F0M A;  3NSW A;  4A3M H;  3HOV H;  5C5L A;  1TXY A;  4CDE C;  3S15 B;  1JMC A;  3PUZ A;  2TMP A;  3PV0 A;  2H1E A;  3NTH A;  5M3F H;  2Q8I B;  1CSP A;  1I4Q A;  4GKJ Q;  1S5B D;  2RCN A;  3HKZ B;  3AB9 A;  1CM9 A;  3D3R A;  2E2J B;  3JAM L;  1HCZ A;  4LK1 C;  1RD9 D;  5M5Y B;  1WD1 A;  5CMD A;  3K81 C;  1TR5 A;  4ULL A;  5DNF A;  3WOE A;  3DWQ A;  1SXT A;  4HJ5 A;  1D8L A;  1STN A;  4RG1 A;  4G7H C;  3GTJ B;  2B2V C;  2AHO B;  4FF1 A;  1FD7 D;  2JA7 G;  2NUC A;  5C4Z A;  4JOI C;  3RN5 A;  3J7A 5;  3E0E A;  5C0X G;  4X65 L;  2DY8 A;  2EE1 A;  4J6H A;  1M1K C;  1NCV A;  1PA6 A;  4RCN A;  4KD4 A;  4JCV E;  1EYD A;  4BBR B;  3V96 A;  2R93 B;  4HN7 A;  1HTL D;  4IN3 A;  1K8G A;  4A3C H;  3BZD B;  1WTQ A;  2EY2 A;  3H15 A;  5IWA Q;  2JA9 A;  3H0G G;  2A6H C;  1E3P A;  5JVG 3;  3J81 E;  2A73 B;  2UUB Q;  1I4X A;  4EQO A;  4KY6 A;  1ZKO A;  1PFB A;  2WAQ B;  4N9P A;  1WTV A;  3VR4 A;  1E1O A;  2KCC A;  1EY7 A;  3I91 A;  4RGO S;  2ASB A;  1MGS A;  1SNP A;  3U50 C;  1JR0 D;  2JQO A;  1D5M C;  1F2Y A;  4NXN Q;  2JYO A;  2ZXR A;  1STE A;  2OT2 A;  4KTA A;  4KMU C;  4DR4 L;  3Q6S A;  4DV3 L;  2E2J H;  3VR6 A;  3GTO B;  4KI0 A;  3J81 i;  2RHQ B;  2JK8 A;  1D1K A;  1QUQ B;  3OIQ A;  3HS0 C;  3KJO A;  3R93 A;  5F2D A;  4CKE A;  4ME3 A;  2E8G A;  2P5Z X;  1FNV A;  4DN4 M;  1LT6 D;  4KY5 A;  4GOP B;  4R4I A;  2R92 G;  5IGE A;  4X62 Q;  4BY1 H;  2A69 C;  5C5M A;  4ZKB B;  4QY7 A;  5ELN A;  5EGT A;  3WDN A;  1HH2 P;  3D31 A;  2Z6B A;  1YNN D;  2R3Z A;  2MPM A;  2DY7 A;  1ENC A;  1LTA D;  3CC2 A;  3MFG A;  3QIA A;  4A3B B;  1TU2 B;  3T4A C;  1JCK B;  1HRJ A;  3J7A F;  1TII D;  1SSO A;  3CRK C;  5IYC H;  1N32 Q;  1BCP F;  4Q5V A;  1IBL L;  4PZ7 A;  1JOK A;  2XWJ B;  4HCE A;  1B2T A;  5A2Q E;  1I6V C;  4QB4 A;  4G57 A;  3GO5 A;  2K01 A;  3T13 A;  3K7A H;  1JOQ A;  2HIV A;  3E3X A;  4DU9 A;  2F0E A;  4KY7 A;  4BY7 G;  1STB A;  4DK1 A;  3DLL A;  2RF4 A;  2F0D A;  1X55 A;  2LS0 1;  4RHR A;  1TQO A;  1BDO A;  3J80 L;  3QB3 A;  3D6W A;  3RLF A;  1IW7 C;  1AEX A;  5IGC A;  4GKJ L;  1RTO A;  4KKU A;  2AKW B;  3HKZ G;  1HUN A;  3RUZ A;  3GV3 A;  5AJ3 L;  1PVO A;  2FMM A;  5J1Z A;  5BN4 A;  3HZX A;  2BE5 D;  4JI0 Q;  4IUT A;  1PH6 A;  2B63 H;  5D3D A;  1B3A A;  3U9O A;  4DK3 C;  4F8M A;  4A3F G;  4CKC A;  2E5L L;  4DR7 L;  3QG1 A;  2B29 A;  1Y1W H;  3KDF B;  1PRT B;  4RCO A;  2Q2U A;  4DF7 A;  1RF2 D;  2PO4 A;  4IFD G;  1EY0 A;  5ELD A;  3Q22 A;  2NVT H;  4DKA C;  4U67 3;  3A7L A;  1QJO A;  1WTX A;  4GS3 A;  4QF4 A;  2F1M A;  5D3I B;  1K83 B;  1T5X D;  2CWA A;  2K5Q A;  2WFW A;  5CYU A;  1SNM A;  1AN8 A;  3ERS X;  1AP0 A;  4DXF A;  3GTQ H;  1M4V A;  1EQV A;  2PQA B;  4GN4 B;  2UU9 Q;  2KCM A;  3Q0A A;  4DGZ A;  1PFS A;  2HQE A;  1CTM A;  1EIY B;  1KTK A;  1XNQ L;  3I4N H;  5C3E B;  5JEA J;  5FO8 B;  2QKI C;  4DV2 Q;  4Q0F A;  4DR2 L;  3BVM A;  4C56 C;  1KXL A;  1B7Y B;  2IW3 A;  3EIV A;  1LTI D;  1VQH A;  1QOH A;  4K0K L;  2Z4H A;  1RL2 A;  2WV6 D;  2QEJ C;  1DCZ A;  1SLJ A;  4FVM A;  4JBJ A;  2WII B;  5AJ3 Q;  4A3E H;  1QCB D;  3R2T A;  4JI4 L;  4NMZ A;  5ELE A;  4OIJ A;  3I4M H;  1HR0 Q;  2TSS A;  3A7A B;  4K8J A;  5LL6 X;  1VQ4 A;  2F0Q A;  5GAH C;  2PYK A;  4YWL A;  3L7Z C;  4LUV A;  1Q1B A;  1YHB A;  1B4O A;  3SK4 A;  4XYQ A;  4FYD A;  4K0K Q;  4DR6 L;  5J22 A;  1HZC A;  2D2C C;  3BZK A;  1VQ5 A;  2HHH Q;  2UUB L;  4IPG A;  4OXP A;  1HNZ L;  1C4Q A;  4MN3 A;  1CFM A;  1IYJ B;  4ODG A;  1NTG A;  4OON A;  5EQ0 A;  1PFM A;  4MNO A;  4AIM A;  2Z9H A;  3JAM E;  2FXQ A;  4ZKC B;  1HFN A;  3SE0 A;  2FFK B;  4DV2 L;  3I72 A;  5J3B A;  4TQU S;  1L1O A;  3KLW A;  3RLN A;  5JJZ A;  1K0R A;  4YY3 L;  1TWH B;  4A3F B;  2AWN A;  2MHV A;  3H91 A;  2K14 A;  1Q8I A;  3RD4 A;  1GXD C;  4FXK C;  3CF5 A;  1LM0 A;  2PMZ B;  5KNC A;  2CQO A;  4K2L A;  3J80 E;  4WJ4 A;  4TKO B;  1VMP A;  3NXW A;  2Z6K A;  1UNS A;  3P75 A;  4HJA A;  1R9T H;  1BCP C;  5DAU A;  3CD6 A;  1PYW D;  1KQS A;  4TSS A;  2JA6 H;  3TZU A;  3SXH A;  4IJH A;  3RZO B;  4L63 B;  1MSH A;  2WKD A;  2CH4 A;  1SBB B;  3M4P A;  3D4W A;  5CV6 A;  2IX3 A;  5CV8 A;  2EPB A;  2NWG A;  4C3J H;  4CBV A;  3URY A;  1GHK A;  5GAG C;  1WTH A;  1RIP A;  3OWF A;  4P73 A;  1XMQ Q;  4NKL A;  2OQK A;  1U4R A;  5E7N A;  3HOX G;  2SDF A;  5KYI A;  1BO0 A;  1SE3 A;  2L55 A;  3H94 A;  1O7Z A;  3VR3 A;  1HZ9 A;  4GNX A;  5COR A;  1DM0 B;  3HRZ C;  5EBD A;  1WCM B;  1JOO A;  5M9O A;  3VYS A;  2E2D C;  1IL2 A;  3MAQ A;  1U4L A;  1N34 Q;  1NR4 A;  1Y69 U;  1CHQ D;  1X54 A;  4L8J A;  3LWE A;  2L5T A;  3S1M B;  3T53 B;  1F2M A;  4H7B A;  3UI2 A;  1UUP A;  1SE2 A;  1RTN A;  3M9B A;  2UU9 L;  1SDF A;  2CHB D;  3VYU A;  4R8N A;  3CCQ A;  2C9O A;  3OMC A;  2K28 A;  1XTD A;  3CHB D;  3OHX C;  4FXD A;  4HCS A;  4X62 L;  4ID6 A;  2I5M X;  1B3Q A;  2MNA A;  3HOW B;  4GLA C;  1YIJ A;  4BBS B;  2L0C A;  4RGM A;  4X66 Q;  3V2T A;  5E3F A;  2F0J A;  3U58 A;  4KHP Q;  4A3D G;  2JE6 I;  3S1R H;  1U0L A;  1N32 L;  1FNW A;  3PO2 H;  3S2D B;  1CT1 D;  3CU7 A;  1SYE A;  5EPL A;  3VYT A;  3NQI A;  1UEA B;  1A3U A;  1B1Z A;  3JAM i;  1LT4 D;  1QNK A;  3A55 A;  3KBX A;  4UP8 A;  2OCE A;  2MJ8 A;  4I65 A;  2JA8 B;  1HR0 L;  1HPC A;  3D4R A;  2ID0 A;  1S72 A;  2B2T A;  2XGT A;  1UE5 A;  4B9X A;  1H9R A;  4DV4 Q;  2EY5 A;  3MC0 B;  4JV5 Q;  2B3G A;  2BOS A;  2NB0 A;  2X6L A;  3C1F A;  2EY6 A;  2ZJR A;  3EFX D;  1PTO H;  1B9M A;  4G4K A;  2A1A A;  4B9W A;  1V43 A;  3BYY B;  1VQ7 A;  3R2I A;  4OWT B;  3M4O H;  2KEN A;  1JOR A;  3MHB A;  3IRB A;  3SK6 A;  1UEB A;  5C3E G;  1CUK A;  3S2H H;  1JB3 A;  1VQ9 A;  1G2S A;  1GUG A;  5IP7 G;  5JEA G;  2R93 H;  1B50 A;  4MHE A;  3J7A V;  3TS0 A;  1Y1V B;  4NXM Q;  2VUM H;  5KNB A;  2K03 A;  1L0W A;  3VA7 A;  4C3H G;  2CH4 W;  4K8I A;  3FKI G;  1XNR L;  1TS3 A;  4FO2 A;  1G29 1;  4K5X A;  4KV6 A;  4H0L C;  3L2P A;  3S24 A;  2F4V Q;  2F0O A;  3QOL A;  1KAA A;  2OTJ A;  2VL6 A;  1BOS A;  1G6P A;  5D65 A;  1EY5 A;  1XYI A;  3K8A A;  2NVX H;  3T1H L;  3G4S A;  1G6Z A;  2PZU A;  3Q23 A;  4ILW A;  4ZYS A;  4NDX A;  1LTS D;  4KJO A;  1A63 A;  3I4M B;  1YJW A;  3ND9 A;  1AE2 A;  4DV7 L;  1GKH A;  4PQX A;  3SHL A;  1KDA A;  1J5E Q;  4AYB G;  4LF5 L;  1ENF A;  3X3M A;  4RWS C;  2F0P A;  4AQY L;  2KED A;  2KJX A;  1NNX A;  2N78 A;  4R4C A;  4X66 L;  4ALP A;  1X65 A;  1NMG A;  4RKB A;  3EVQ A;  2UXB L;  4CKB A;  4K14 A;  1IYU A;  2BDN A;  4HMI A;  1EU4 A;  5JVH 3;  1BCP B;  4I7Z C;  5M3M H;  3H09 A;  1FGB D;  5K36 H;  2JA5 G;  5LL6 S;  2KCT A;  4WJW A;  1ILP A;  4UP7 A;  1SYB A;  3KOJ A;  4GLV B;  1FL0 A;  1NSN S;  3DWP A;  4DA2 A;  2MQH A;  3C2P A;  4JV5 L;  4BY1 G;  1SRO A;  4JI5 Q;  5C4X B;  2I5L X;  1CQV A;  2CFM A;  4Y7N B;  2F03 A;  1EEI D;  1WCM G;  4IUV A;  3M7N A;  1I4R A;  4V0B A;  2AWO A;  4HJ7 A;  3LX0 A;  2R7Z B;  3KFU A;  1B9N A;  3HFZ B;  5C0X I;  4OWW B;  5COY A;  1HR0 W;  2AQ3 B;  3KK7 A;  4ABN A;  1X3F A;  3AQQ A;  3ERO A;  4R4Q A;  4X3T A;  2JA7 H;  2Q2H A;  5FLM G;  3NE5 B;  2L12 A;  3OTO Q;  2HHH L;  1K3B C;  2RDH A;  3MA2 B;  5C0X H;  1K83 H;  4R4O A;  5CV7 A;  1XJV A;  1Q46 A;  1VQD A;  4HR7 B;  4R9W A;  1CA5 A;  3HP3 A;  4LF4 Q;  4DAP A;  1FNU A;  1NR2 A;  3BZC A;  3OTO L;  2XNA C;  3HG9 A;  3S1N H;  4DR6 Q;  4YHH L;  1VS0 A;  2JEA I;  3KBG A;  5K36 G;  3FKI B;  4DK6 C;  4DR1 Q;  3J81 j;  2ALY B;  3A54 A;  2E2I H;  1KHI A;  3U4V A;  3BYT B;  1GUN A;  1TS5 A;  1XPO A;  2HDM A;  2RSO A;  5M5X H;  2KBN A;  5KGU A;  4UDU C;  2N49 A;  5JJK A;  3E9I A;  1TWG B;  2EDG A;  1IZ6 A;  1EFW A;  4ZUI A;  3A74 A;  4PZ8 A;  4H44 C;  4EX5 A;  2BA0 A;  1VQM A;  3VA5 A;  4DAM A;  4DV6 Q;  1L0X B;  3J7Y W;  2KUM A;  5C6A A;  4JI1 Q;  3SK5 A;  4K6L A;  1IBK Q;  1HZA A;  2PQE A;  3S1Q B;  1X32 A;  5H1S E;  2J0T D;  1VQK A;  4JYA Q;  1O78 A;  2XRQ D;  1BBX C;  3D4D A;  4WOR A;  1YBY A;  3J80 c;  4A3K G;  3CCS A;  1VQ6 A;  3NWS A;  1SAP A;  2B2W C;  1HNW L;  2FHT A;  4DV1 L;  1JE5 A;  3GD7 A;  3RN2 A;  1K0S A;  4EVO A;  2YU9 B;  5C0X J;  4BY7 B;  3BS1 A;  3X3N A;  3W1B A;  4YIJ A;  1I94 L;  3F8T A;  1QZG A;  1PYS B;  4UY8 C;  1QVF A;  1QUQ A;  2EXZ A;  3EBE A;  4OEL B;  4KN7 C;  1I4H A;  2KA7 A;  1NY4 A;  5M5X B;  1G91 A;  3SK8 A;  2EQS A;  1DXM A;  4JI3 L;  2PNR C;  2K75 A;  1IBM Q;  1CKO A;  1F77 A;  2A19 A;  1PV4 A;  4EGV A;  4N9T A;  5I2Y A;  4L5R C;  3C1E A;  2WKC A;  3HOZ H;  2JA5 H;  1NE3 A;  2B39 A;  3KLS A;  3DM3 A;  4Z9C B;  2NVY H;  4IOC A;  1PZJ D;  1I4P A;  1XNR Q;  1EY8 A;  2K33 A;  3DEO A;  4F7X A;  1K28 A;  2Z1C A;  2YTV A;  3GTJ H;  2H4O A;  3TZD A;  4BWG B;  3CCJ A;  1EL0 A;  2B2Y A;  4R8I A;  3GTK H;  1CA6 A;  4N8F A;  4AYB B;  2QIL A;  4IJL A;  4B3T L;  3J81 L;  2AUK A;  3FVQ A;  1ZXT A;  5LMN W;  3FDT A;  4K5W A;  3CQZ H;  3H0G B;  1KD1 C;  5DLQ E;  1VQL A;  3ND8 A;  5FKA C;  1TWF B;  1BKB A;  1LTB D;  2WB1 B;  4C3J G;  1X3Q A;  4C3I G;  2A68 C;  1VQA A;  2KHJ A;  3K5M A;  1PH1 A;  3HOX H;  3BU2 A;  1VQJ A;  3GP7 A;  1BCP D;  3TDQ A;  5M3M B;  4E6I A;  1E0B A;  5CGK A;  4RHS A;  3ERQ A;  5KYL A;  2F3W A;  1U4M A;  1SJE D;  2GVB A;  2PW7 A;  1RHP A;  1YIT A;  1PMR A;  3CC7 A;  2DUD A;  1LO5 D;  5EAY A;  4LF7 Q;  2M00 A;  3RMH A;  4IFD J;  4O42 A;  1TKW B;  1EQR A;  4YY3 Q;  2AMC B;  1UE6 A;  1IW7 D;  1UAP A;  1L0Y B;  4KD3 A;  1GJX A;  3I4O A;  2NVQ B;  1GUS A;  3F2C A;  1ENA A;  1B44 D;  2GVA A;  4DUY Q;  3GTG H;  5FK9 C;  1G8Z D;  2N55 A;  1WFQ A;  4XT1 B;  4IO9 A;  1YNJ D;  4A3G H;  1I94 Q;  4JVZ A;  3RNU A;  3E6Z X;  4B3R L;  4A3L G;  3NUC A;  3K5O A;  1ESR A;  2AQ2 B;  3LWU A;  1HNW Q;  1X3P A;  1CZW A;  1VF7 A;  2D62 A;  5CC4 A;  4PMB A;  1VQ8 A;  3L3O C;  1U4P A;  4DV5 Q;  4DV6 L;  4HAE A;  3D0F A;  3TRZ A;  3PO3 B;  2HCI A;  2HCC A;  5CR3 A;  1S5C D;  2LSS A;  1WTO A;  2VUM B;  4P2C B;  2BH2 A;  3K0Y A;  2EYH A;  3A8K E;  3AFP A;  2KOL A;  3QOJ A;  4LFB L;  3SEB A;  1PYB A;  2IHE A;  2JA6 G;  1S5E D;  4BA1 I;  4GNX B;  3GTM B;  1VQN A;  1AH9 A;  1Y1V G;  1L1O B;  4B3S L;  3HOZ G;  1QVC A;  3M4Q A;  5HUR A;  5HGT A;  3L9A X;  3C3L A;  3MEF A;  2K05 A;  1KRT A;  1SE8 A;  1TY2 A;  2NN6 I;  1EWH A;  2PZT A;  1EOV A;  2NVX B;  5IE8 A;  4HJ8 A;  2NVT B;  1XMO L;  4CDC C;  4NP5 A;  1W2B A;  1JE4 A;  3MZ5 A;  3PUW A;  1N36 Q;  3VR2 A;  2Q2T A;  2CWP A;  1EY4 A;  2KQ3 A;  3PCO B;  1IXR A;  2QF7 A;  5IP7 H;  3GTQ B;  3FEW X;  4J1M A;  3MXN B;  3E5S A;  2X6G A;  5LHY 1;  3PUV A;  2ZJP A;  3I3C A;  1O7L A;  2UUA L;  4OX9 Q;  1YEZ A;  4DV1 Q;  1YHQ A;  2DJF C;  2K7V A;  1D5Z C;  1IHZ A;  1AE3 A;  1ZEQ X;  2MO1 A;  3CCM A;  3KJP A;  1KLG D;  2Z4I A;  1WTW A;  3K7U C;  3HOY G;  2K5V A;  2DN8 A;  2N88 A;  1LT3 D;  3GTM H;  1XMQ L;  4A3D H;  2ATW A;  1AFP A;  5E1F A;  4QUF A;  2JA8 G;  2K32 A;  5LMN Q;  2K5N A;  5I6W A;  1HQM C;  5IYB H;  2WAQ G;  4JG2 A;  4FDB A;  3VYR A;  5JPN C;  4GOP C;  5D14 A;  2QDL A;  1HA5 A;  1BBW A;  2NYZ D;  5EPJ A;  1TVX A;  2OWO A;  4JI3 Q;  4PMW A;  1I50 B;  5C44 G;  2LXK A;  5NUC A;  4RH6 A;  1CKM A;  1ROD A;  2I0Q A;  1KNA A;  1XTC D;  1HNX Q;  4GLX A;  3T56 B;  3SVM A;  1DOK A;  2RDG A;  3I7F A;  1L2F A;  3KDF A;  3PMF A;  1O80 A;  1VQO A;  3ER0 A;  1EU3 A;  4NPS A;  1RDP D;  2JSO A;  1QB5 D;  2L9H A;  1ILQ A;  4A3J H;  2NN6 G;  1S5F D;  5C4J H;  1I3Q B;  4LF8 L;  4FF2 A;  1RKN A;  3HOU B;  1E24 A;  5EKI A;  1HA6 A;  1VQG A;  2G9H D;  3WWV A;  5FLX L;  1F9S A;  5IT9 L;  4A3D B;  3G48 A;  5JEA H;  2R93 G;  2DJG C;  3P20 A;  4UP9 A;  2F0L A;  4ZRZ A;  3G6E A;  2WB1 E;  3EA6 A;  2JA6 B;  1H95 A;  1H9S B;  1Y8N B;  3O13 A;  3RZO H;  3G71 A;  1Q3L A;  3BVG A;  1ONL A;  2R6G A;  4MIU A;  3MXG A;  5BN5 A;  4DPG A;  1BR9 A;  1TWC B;  5IGB A;  5A35 A;  3GTL H;  1HFG A;  4K6D A;  4CJ0 B;  2E2I B;  1YNN C;  2F0K A;  3K0X A;  4P71 A;  1Y8O B;  3PSI A;  4JI0 L;  1D1I A;  4A3I B;  2ZM6 Q;  1DON A;  2K5W A;  3PIO 3;  3NEL A;  2XWB B;  2PCF B;  4DNT B;  1F9P A;  3BJU A;  1J6Q A;  1LLR D;  1SMY D;  3NK9 A;  3KUP A;  2YTX A;  2EJM A;  4AYB E;  2K50 A;  3E0J A;  3STB C;  3QO2 A;  1WTP A;  2FIN B;  4L5Q A;  3K57 A;  1ICF B;  1KDC A;  5G3L D;  4DR1 L;  4OEM B;  4DR5 L;  1PH4 A;  3IFD A;  1K8A C;  2VZA A;  2WAC A;  1HHV A;  1CHP D;  5I2X A;  4CDD C;  5FO9 B;  5FLM H;  1KNE A;  3RLO A;  2UXB Q;  1FYC A;  3P1H A;  1GO3 E;  4DUY L;  1K73 C;  5FJ8 H;  1NMF A;  2K6A A;  2UUA Q;  1ASZ A;  2WP8 J;  2D0O A;  2FJ2 A;  2BDO A;  2I07 B;  2UXD Q;  3MXU A;  3NTK A;  2IL8 A;  3ZYY X;  1B70 B;  3DUZ A;  1SFO H;  4BBR H;  1XPU A;  1TWA H;  2A6H D;  3N52 A;  3WOF A;  1WVL A;  3AU7 A;  3BDO A;  2RDF A;  1FJG Q;  1Q1E A;  2UXD L;  2RKS A;  2Q8R E;  3OWE B;  3DWA A;  3OOC A;  4JC0 A;  2VQE Q;  3G7L A;  1WI5 A;  1GVP A;  2E75 C;  2F0V A;  2V4D A;  1PLF A;  4R1J A;  4RA8 A;  4UPA A;  4BXX H;  3R3O A;  3CME A;  2RSN A;  4A4I A;  4JI5 L;  1H9K A;  4HIK A;  3PO3 H;  1L1O C;  3TN2 A;  4NXN L;  2VQF L;  1C0A A;  4K5V A;  3U4Z A;  4DV3 Q;  3CCV A;  1STH A;  2EYO A;  3GQB A;  4A3E B;  2PNH A;  3FPU B;  4JW0 A;  2MP1 A;  4XQN A;  4DV4 L;  4X64 L;  2EOT A;  2AUJ D;  4A93 G;  1PTO B;  2OF1 A;  1BVS A;  4LF4 L;  1LTR D;  4A3K H;  4HMJ A;  3S17 H;  1DGS A;  4C1N K;  4DUZ Q;  4F88 A;  3T16 A;  1SNQ A;  1ZYR C;  3FHW A;  4GZY C;  4YHH Q;  3W2D A;  3M3Y B;  4BA2 I;  4ZK9 B;  1Q86 C;  2R7Z H;  4X3U A;  3GTK B;  3AMU A;  1GM5 A;  5IOC A;  5DEH A;  4DUZ L;  4AH6 A;  4J8Q A;  4LFA L;  4PV1 C;  4XQQ A;  1SYC A;  3PIP A;  1VQP A;  4A3J G;  2CW0 C;  5E4W C;  4G7O C;  4POG A;  2ICE C;  3H3V I;  2F0G A;  1EEF D;  3SGI A;  3UDG A;  1V1Q A;  3NPP A;  2ES2 A;  1NUC A;  5KRU A;  3I4N G;  2JEB I;  2KEE A;  3I2Z A;  1JT8 A;  2IT1 A;  1SR3 A;  3HOV B;  1IBK L;  4JI1 L;  1I6H H;  1PH7 A;  2GA4 B;  2MO0 A;  3PO3 G;  4ZQ3 A;  2HT1 A;  1PH9 A;  4HSP A;  3AYH B;  1JWU D;  3HEJ A;  4C3J B;  4IUP A;  1SEB D;  5M5Y H;  1X56 A;  5C44 B;  5KND A;  3I4M G;  1MD2 D;  3IL8 A;  2RHS B;  1PTO D;  2PI2 E;  2OXP A;  3I55 A;  2BH8 A;  4IFD I;  4DR3 Q;  4FNF A;  5L37 A;  2A6E C;  1YZ6 A;  3NP8 A;  1EYC A;  4OO1 G;  2R7F A;  1KL9 A;  5CBA E;  1I50 H;  1UE7 A;  2Y0S G;  3TSS A;  2OTL A;  4CGY B;  1QZH A;  3GDE A;  1S40 A;  1I4G A;  5M5W B;  3NBH A;  4FP5 D;  2MGS A;  1PTO F;  4DV0 L;  2VS1 A;  2B8F A;  4LF8 Q;  3S14 H;  3DHQ A;  4HIO A;  4RKL A;  1B8A A;  1QNU A;  3PF5 A;  4CJ1 B;  2J4X A;  5ELF A;  1WOC A;  2KHI A;  2YU9 H;  4BY7 H;  1MJC A;  3HOW H;  3DXJ C;  2ENB A;  2Z8L A;  5IP9 H;  1YI2 A;  2WIN B;  4C3H B;  2NBF A; 
#chains in the Genus database with same CATH homology
 2DNE A;  1A2U A;  1S5D D;  2PPB C;  1QWY A;  3Q24 A;  4K2K A;  2B2W A;  2R92 B;  2EY1 A;  2ZT9 C;  4C2M B;  5KEE A;  1STA A;  1Z7T A;  1JWS D;  5AFW A;  5BN3 A;  3HOZ B;  3LNN A;  4L6T B;  5EKK A;  4QMG A;  5C3X A;  1ESF A;  2KCN A;  1II3 A;  1RCV D;  2QDB A;  2LFN A;  3CKI B;  1IKM A;  2O4X A;  1AZQ A;  1V1O A;  4TRD A;  4OL7 A;  3MXP A;  2EZV A;  2JA7 B;  4C3I B;  1M8A A;  3NBI A;  1F2Z A;  1OXX K;  5DM6 3;  2EYP A;  4DNR B;  4PNY A;  3U9S A;  3TP8 A;  4CJ2 C;  2PZW A;  1T5E A;  1TY0 A;  4U68 A;  3I73 A;  4QUC A;  2NTS A;  1SNC A;  1R4Q B;  4NW2 A;  3RZD B;  1KLU D;  2F0N A;  1F2L A;  2B2U A;  1DJR D;  3W3A A;  2EJG C;  3ITP A;  4DK0 A;  3K58 A;  1EWC A;  2XSC A;  3FRP B;  4X3K A;  3KLS X;  3QWN A;  5C3W A;  5G3L F;  5FO7 B;  1HUM A;  4WRD A;  3DM1 A;  3A56 A;  2D9U A;  3R8B A;  4BS9 A;  5JAV A;  1EOT A;  3I8Z A;  1STG A;  2G9D A;  3P7J A;  4OHJ A;  4IZ8 A;  1D2B A;  1GUW A;  2D5D A;  3BDC A;  5I4D A;  4LJZ C;  3NHH A;  3S1R B;  4IUN A;  2R61 A;  1WTR A;  1Q12 A;  2VXW A;  2M2L A;  5J39 A;  3GV6 A;  1Z47 A;  2BA1 A;  1MSG A;  3BDL A;  5ELC A;  1F9Q A;  4IUU A;  1I6H B;  2BE5 C;  1V1P B;  4FF3 A;  3N6R A;  2KHS A;  4XYO A;  1DOM A;  2LY7 A;  3BVZ A;  2NN6 H;  1LT5 D;  4KJN A;  3M4O B;  1EY6 A;  3SDZ A;  1VCI A;  3CQZ B;  4KK7 A;  1SYD A;  1D6E C;  3MFY A;  1IYV A;  3S2H B;  4XDX A;  1R9T B;  4WFN 3;  1SMY C;  3IAY A;  3K59 A;  3HGB A;  1A15 A;  1QE6 A;  5FOB B;  4A3M B;  4DAY A;  3S1N B;  4X3S A;  1ET6 A;  1D5X C;  3TBI B;  1DZ1 A;  3QJY A;  4OIK A;  5M3F B;  3I70 A;  5K5P A;  3OSO A;  2SOB A;  3OMG A;  5EPK A;  3IKJ A;  3OW7 A;  2B2Y C;  1NAP A;  5C4H A;  1JC7 A;  4DAV A;  5A2Q L;  1EZ8 A;  2XIW A;  4FF4 A;  1Y1W B;  5ISR A;  2QCP X;  2SEB D;  4A3K B;  3S17 B;  1EFI D;  1ZYR D;  1KAB A;  1BQQ T;  5JPM C;  3GTG B;  4IAL A;  5T1I A;  2ICI A;  1KDB A;  4ZAI A;  3EQL C;  1BXT A;  4A3G B;  5TSS A;  5DM7 3;  1LTT D;  1PZI D;  4M8A A;  3TP6 A;  1E2W A;  1HQR D;  4KKT A;  1SNO A;  3KF8 A;  2DNC A;  3M4Y A;  3I90 A;  1GUO A;  5IGF A;  3PUY A;  3FPP A;  3OIP A;  3VR5 A;  2E74 C;  1WD0 A;  4O1N A;  4A93 B;  1A6X A;  2HUG A;  5I9P A;  1MI2 A;  3GTL B;  4XIG S;  4QIW B;  1JWM D;  3BG3 A;  4OGQ C;  2O5J C;  1SYG A;  1HXY D;  2EVB A;  1DD2 A;  3MWY W;  1O7Y A;  4LAA A;  2ZXP A;  5JOB A;  1E2Z A;  1TS4 A;  3PIP 3;  1GHJ A;  2AQ1 B;  1QG7 A;  1JIC A;  2CVR A;  1S4Z A;  2B8G A;  4KHV A;  4XTC S;  1B53 A;  1U9R A;  1TWA B;  2F4I A;  1EYA A;  1Z6H A;  4JK1 C;  3T51 B;  1PFN A;  3MVV A;  3NQT A;  1STY A;  1LV9 A;  1IL8 A;  1LAB A;  1LTG D;  1FR3 A;  5T1G A;  2VB2 X;  2VNU D;  1K8O A;  2O5I C;  2F0S A;  1PDQ A;  1AZP A;  1SYF A;  1BNZ A;  1Y8P B;  4RFB A;  4FXG C;  2RA4 A;  4OO1 H;  3D8G A;  2C5C A;  3V05 A;  1HTP A;  2Y0S B;  3H6M A;  4IUR A;  3PUX A;  3S16 B;  2IWH A;  1VMC A;  2K04 A;  2XRS D;  1OXS C;  3I4N B;  2JXM B;  1SND A;  3M7G A;  1CZG A;  1TS2 A;  3GTP B;  4IQZ A;  1G2T A;  4KHZ A;  3PO2 B;  1SE4 A;  3MXN A;  1W6J A;  1YNJ C;  2L1B A;  2OEO A;  2JA5 B;  4QCL A;  2XN9 C;  1A2T A;  2HDL A;  2F0T A;  4XQJ A;  1Q90 A;  4ME5 A;  2NVY B;  2EYF A;  3TP5 A;  4BY1 B;  3FMC A;  2K1B A;  1C8C A;  2NZ1 D;  2EYM A;  2I46 A;  4IFD H;  1VF5 C;  2F0I A;  5ELB A;  1E2V A;  2SNM A;  4EQP A;  2Q8T A;  2A74 C;  1JQY D;  4HSV A;  5KIX A;  5IOD A;  3OPO A;  5E4X A;  1TT2 A;  2A68 D;  2F0H A;  4HED A;  4ZUJ A;  5I6Y A;  2KEC A;  5CV9 A;  1OXU A;  4B08 A;  5IGG A;  1IKL A;  1PRT C;  5IGD A;  2A5H A;  2RBM A;  4DXG A;  2IJ0 A;  2RQX A;  1V1P A;  4OO1 I;  2F3V A;  2B63 B;  1ML0 D;  3H3V C;  1A3V A;  1SJH D;  2LKV A;  3ONA B;  5IIF A;  3S9W A;  3EJI A;  2XVS A;  1ICW A;  2O2L D;  1EY9 A;  1XX8 A;  5FLX E;  1PRT D;  1EIG A;  1K8M A;  1DOL A;  4ZLT F;  3C46 A;  4DFA A;  3MEH A;  2B2T C;  4LMQ D;  4HTH A;  2E2H B;  4C1N I;  2YYZ A;  2EJF C;  4XT3 B;  2EYL A;  1PZK D;  4A3J B;  5C4J B;  2FMC A;  1OXT A;  2ZXO A;  4PMC A;  4S3S A;  2NTT A;  2J7Z A;  1C48 A;  3K5L A;  1EZ6 A;  2IX0 A;  3IFT A;  1GOZ A;  2F0U A;  5CV4 A;  1CQF A;  2RVL A;  2K5D A;  2KVM A;  3NTI A;  1OO9 B;  3TP7 A;  2EYJ A;  2F0F A;  4UAI A;  3A8I E;  3DEP A;  2PW5 A;  1OXV A;  1ET9 A;  2B2V A;  3D6C A;  1BUV T;  3MTS A;  5EJW A;  5EKL A;  1QIL A;  4XXE A;  3G6J B;  2L11 A;  2F0W A;  1AW7 A;  2X69 A;  3TME A;  2JP1 A;  3SR1 A;  2A6E D;  1PXU A;  1H9M A;  5IT9 E;  1GUT A;  5EBC A;  4F87 A;  2VB3 X;  3S14 B;  3K7A B;  2A69 D;  3KLR A;  1RJT A;  2IPK D;  2BCO A;  3K5N A;  1CI3 M;  3HOX B;  2B2U C;  2M9V A;  2CQA A;  5I9O A;  1SFO B;  1F9R A;  1EIH A;  4KN4 C;  4CHT B;  5CV5 A;  4V19 0;  3I4L A;  4RGT A;  3HOY B;  2LMC B;  1EQT A;  1V8Q A;  1XXG A;  4RGN A;  2MUY A;  3DMU A;  2SNS A;  1J9O A;  3K6O A;  1PTO C;  1H9J A;  1VDZ A;  1J8I A;  1MBY A;  3A8J E;  4IUQ A;  3M85 A;  1LAC A;  2L4N A;  4M1U B;  4RAU C;  1XWE A;  3NWT A;  2E76 C;  1PRT F;  4EQN A;  4G7Z C;  5CBE E;  3F2U A;  1BF4 A;  3CRL C;  1W6K A;  4JBW A;  2CW0 D;  1CK1 A;  1R4P B;  2IX1 A;  1A3T A;  4H13 C;  4KKS A;  1DYQ A;  1H9S A;  2F0M A;  3NSW A;  5C5L A;  3S15 B;  3PUZ A;  2TMP A;  3PV0 A;  2H1E A;  3NTH A;  2Q8I B;  1I4Q A;  1S5B D;  3HKZ B;  3AB9 A;  1CM9 A;  3D3R A;  2E2J B;  3JAM L;  1HCZ A;  4LK1 C;  1RD9 D;  5M5Y B;  1WD1 A;  5CMD A;  1TR5 A;  4ULL A;  5DNF A;  3WOE A;  3DWQ A;  1SXT A;  1STN A;  4G7H C;  3GTJ B;  2B2V C;  4FF1 A;  1FD7 D;  2NUC A;  5C4Z A;  5C0X G;  2DY8 A;  2EE1 A;  4J6H A;  1NCV A;  4RCN A;  4KD4 A;  1EYD A;  4BBR B;  3V96 A;  2R93 B;  4HN7 A;  1HTL D;  4IN3 A;  3BZD B;  1WTQ A;  2EY2 A;  2A6H C;  5JVG 3;  3J81 E;  2A73 B;  1I4X A;  4EQO A;  4KY6 A;  1ZKO A;  1PFB A;  2WAQ B;  4N9P A;  1WTV A;  3VR4 A;  2KCC A;  1EY7 A;  3I91 A;  4RGO S;  1MGS A;  1SNP A;  1JR0 D;  1D5M C;  1F2Y A;  2JYO A;  2ZXR A;  1STE A;  2OT2 A;  4KTA A;  4KMU C;  3Q6S A;  3VR6 A;  3GTO B;  4KI0 A;  1D1K A;  3OIQ A;  3HS0 C;  3R93 A;  5F2D A;  4CKE A;  1FNV A;  4DN4 M;  1LT6 D;  4KY5 A;  5IGE A;  2A69 C;  5C5M A;  4ZKB B;  5EGT A;  3WDN A;  3D31 A;  1YNN D;  2R3Z A;  2MPM A;  2DY7 A;  1ENC A;  1LTA D;  3MFG A;  3QIA A;  4A3B B;  1TU2 B;  3T4A C;  1JCK B;  1HRJ A;  3J7A F;  1TII D;  1SSO A;  3CRK C;  1BCP F;  4Q5V A;  1JOK A;  2XWJ B;  4HCE A;  1B2T A;  5A2Q E;  1I6V C;  4QB4 A;  4G57 A;  3GO5 A;  2K01 A;  3T13 A;  1JOQ A;  4DU9 A;  2F0E A;  4KY7 A;  1STB A;  4DK1 A;  2F0D A;  2LS0 1;  4RHR A;  1TQO A;  1BDO A;  3J80 L;  3QB3 A;  3D6W A;  3RLF A;  1IW7 C;  1AEX A;  5IGC A;  1RTO A;  4KKU A;  1HUN A;  3RUZ A;  3GV3 A;  2FMM A;  5J1Z A;  5BN4 A;  3HZX A;  2BE5 D;  4IUT A;  5D3D A;  1B3A A;  3U9O A;  4F8M A;  4CKC A;  3QG1 A;  1PRT B;  4RCO A;  4DF7 A;  1RF2 D;  2PO4 A;  4IFD G;  1EY0 A;  5ELD A;  3Q22 A;  4U67 3;  3A7L A;  1QJO A;  1WTX A;  4QF4 A;  2F1M A;  5D3I B;  1K83 B;  1T5X D;  2K5Q A;  5CYU A;  1SNM A;  1AN8 A;  1AP0 A;  4DXF A;  1M4V A;  1EQV A;  3Q0A A;  4DGZ A;  2HQE A;  1CTM A;  1KTK A;  5C3E B;  5JEA J;  5FO8 B;  2QKI C;  4Q0F A;  3BVM A;  4C56 C;  2IW3 A;  1LTI D;  1QOH A;  2Z4H A;  2WV6 D;  2QEJ C;  1DCZ A;  4FVM A;  2WII B;  1QCB D;  3R2T A;  4NMZ A;  5ELE A;  4OIJ A;  2TSS A;  3A7A B;  4K8J A;  5LL6 X;  2F0Q A;  2PYK A;  3L7Z C;  1Q1B A;  1B4O A;  3SK4 A;  4XYQ A;  4FYD A;  5J22 A;  2D2C C;  1C4Q A;  4MN3 A;  1CFM A;  4ODG A;  5EQ0 A;  1PFM A;  3JAM E;  1HFN A;  4ZKC B;  3SE0 A;  2FFK B;  3I72 A;  4TQU S;  5JJZ A;  1TWH B;  4A3F B;  2AWN A;  2MHV A;  3H91 A;  1Q8I A;  3RD4 A;  1GXD C;  4FXK C;  2PMZ B;  5KNC A;  4K2L A;  3J80 E;  4TKO B;  1VMP A;  3NXW A;  1UNS A;  3P75 A;  1BCP C;  5DAU A;  1PYW D;  4TSS A;  3TZU A;  3SXH A;  3RZO B;  4L63 B;  1MSH A;  2WKD A;  1SBB B;  3D4W A;  5CV6 A;  2IX3 A;  5CV8 A;  2EPB A;  2NWG A;  4CBV A;  3URY A;  1GHK A;  3OWF A;  4NKL A;  1U4R A;  2SDF A;  5KYI A;  1BO0 A;  1SE3 A;  2L55 A;  3H94 A;  1O7Z A;  3VR3 A;  5COR A;  1DM0 B;  3HRZ C;  5EBD A;  1WCM B;  1JOO A;  5M9O A;  3VYS A;  2E2D C;  3MAQ A;  1U4L A;  1NR4 A;  1Y69 U;  1CHQ D;  4L8J A;  3LWE A;  2L5T A;  3S1M B;  3T53 B;  1F2M A;  4H7B A;  3UI2 A;  1UUP A;  1SE2 A;  1RTN A;  1SDF A;  2CHB D;  3VYU A;  4R8N A;  2C9O A;  3OMC A;  2K28 A;  3CHB D;  3OHX C;  4FXD A;  4HCS A;  4ID6 A;  3HOW B;  4BBS B;  2L0C A;  4RGM A;  3V2T A;  5E3F A;  2F0J A;  2JE6 I;  1FNW A;  3S2D B;  1CT1 D;  3CU7 A;  1SYE A;  5EPL A;  3VYT A;  3NQI A;  1UEA B;  1A3U A;  1B1Z A;  1LT4 D;  1QNK A;  3A55 A;  3KBX A;  2MJ8 A;  4I65 A;  2JA8 B;  1HPC A;  3D4R A;  2ID0 A;  2B2T A;  4B9X A;  1H9R A;  2EY5 A;  3MC0 B;  2BOS A;  2NB0 A;  2X6L A;  3C1F A;  2EY6 A;  3EFX D;  1PTO H;  1B9M A;  4G4K A;  4B9W A;  1V43 A;  3BYY B;  3R2I A;  1JOR A;  3MHB A;  3SK6 A;  1JB3 A;  1G2S A;  1GUG A;  5JEA G;  1B50 A;  4MHE A;  3J7A V;  1Y1V B;  5KNB A;  2K03 A;  3VA7 A;  4C3H G;  4K8I A;  1TS3 A;  4FO2 A;  1G29 1;  4K5X A;  4KV6 A;  4H0L C;  2F0O A;  3QOL A;  1KAA A;  1BOS A;  5D65 A;  1EY5 A;  1XYI A;  1G6Z A;  2PZU A;  3Q23 A;  4ILW A;  4ZYS A;  4NDX A;  1LTS D;  4KJO A;  3I4M B;  3ND9 A;  4PQX A;  3SHL A;  1KDA A;  1ENF A;  3X3M A;  4RWS C;  2F0P A;  2KED A;  2KJX A;  4RKB A;  3EVQ A;  4CKB A;  4K14 A;  1IYU A;  2BDN A;  4HMI A;  1EU4 A;  5JVH 3;  1BCP B;  4I7Z C;  3H09 A;  1FGB D;  5K36 H;  5LL6 S;  4WJW A;  1ILP A;  1SYB A;  1NSN S;  3DWP A;  4DA2 A;  3C2P A;  5C4X B;  1CQV A;  4Y7N B;  2F03 A;  1EEI D;  4IUV A;  3M7N A;  1I4R A;  4V0B A;  2AWO A;  3LX0 A;  2R7Z B;  1B9N A;  5C0X I;  5COY A;  2AQ3 B;  3KK7 A;  4ABN A;  3ERO A;  4X3T A;  3NE5 B;  2L12 A;  2RDH A;  3MA2 B;  5C0X H;  5CV7 A;  4HR7 B;  4R9W A;  1CA5 A;  3HP3 A;  4DAP A;  1FNU A;  1NR2 A;  2XNA C;  3HG9 A;  2JEA I;  3KBG A;  5K36 G;  3FKI B;  3A54 A;  3BYT B;  1GUN A;  1TS5 A;  2HDM A;  2RSO A;  5KGU A;  4UDU C;  1TWG B;  2EDG A;  4ZUI A;  4H44 C;  2BA0 A;  3VA5 A;  1L0X B;  3J7Y W;  2KUM A;  5C6A A;  3SK5 A;  4K6L A;  2PQE A;  3S1Q B;  1X32 A;  2J0T D;  1O78 A;  2XRQ D;  1BBX C;  3D4D A;  4WOR A;  3NWS A;  1SAP A;  2B2W C;  2FHT A;  3GD7 A;  4EVO A;  2YU9 B;  5C0X J;  4BY7 B;  3BS1 A;  3X3N A;  4YIJ A;  2EXZ A;  4KN7 C;  1I4H A;  2KA7 A;  5M5X B;  1G91 A;  3SK8 A;  1DXM A;  2PNR C;  1F77 A;  4EGV A;  4N9T A;  5I2Y A;  3C1E A;  2WKC A;  3KLS A;  2B39 A;  4Z9C B;  1PZJ D;  1I4P A;  1EY8 A;  2K33 A;  3DEO A;  4F7X A;  2Z1C A;  2H4O A;  4BWG B;  3TZD A;  1EL0 A;  2B2Y A;  4R8I A;  1CA6 A;  4AYB B;  2QIL A;  3J81 L;  2AUK A;  3FVQ A;  1ZXT A;  3FDT A;  4K5W A;  3H0G B;  3ND8 A;  5FKA C;  1TWF B;  1LTB D;  2WB1 B;  4C3J G;  1X3Q A;  4C3I G;  2A68 C;  3K5M A;  3GP7 A;  1BCP D;  3TDQ A;  5M3M B;  4E6I A;  1E0B A;  5CGK A;  4RHS A;  3ERQ A;  5KYL A;  2F3W A;  1U4M A;  1SJE D;  2PW7 A;  1RHP A;  1PMR A;  1LO5 D;  2M00 A;  3RMH A;  4IFD J;  4O42 A;  1TKW B;  1IW7 D;  1UAP A;  1L0Y B;  4KD3 A;  1GJX A;  2NVQ B;  1GUS A;  1ENA A;  1B44 D;  5FK9 C;  1G8Z D;  2N55 A;  4XT1 B;  1YNJ D;  3E6Z X;  3NUC A;  3K5O A;  1ESR A;  2AQ2 B;  3LWU A;  1X3P A;  1CZW A;  1VF7 A;  2D62 A;  5CC4 A;  4PMB A;  3L3O C;  1U4P A;  4HAE A;  3PO3 B;  2HCI A;  2HCC A;  5CR3 A;  1S5C D;  2VUM B;  1WTO A;  4P2C B;  3K0Y A;  2EYH A;  3A8K E;  3QOJ A;  2KOL A;  3SEB A;  1S5E D;  4BA1 I;  3GTM B;  5HUR A;  5HGT A;  3L9A X;  3C3L A;  2K05 A;  1TY2 A;  2NN6 I;  1EWH A;  2PZT A;  2NVX B;  2NVT B;  4NP5 A;  1JE4 A;  3MZ5 A;  3PUW A;  3VR2 A;  1EY4 A;  2KQ3 A;  2QF7 A;  3GTQ B;  3FEW X;  4J1M A;  3E5S A;  2X6G A;  5LHY 1;  3PUV A;  3I3C A;  1O7L A;  2K7V A;  1D5Z C;  1IHZ A;  1ZEQ X;  1KLG D;  2Z4I A;  1WTW A;  2DN8 A;  2N88 A;  1LT3 D;  1AFP A;  5E1F A;  4QUF A;  2K32 A;  5I6W A;  1HQM C;  3VYR A;  5JPN C;  5D14 A;  1HA5 A;  2NYZ D;  5EPJ A;  1TVX A;  4PMW A;  1I50 B;  5NUC A;  4RH6 A;  1ROD A;  1KNA A;  1XTC D;  3T56 B;  3SVM A;  1DOK A;  2RDG A;  3PMF A;  1O80 A;  1EU3 A;  1RDP D;  2JSO A;  1QB5 D;  2L9H A;  1ILQ A;  2NN6 G;  1S5F D;  1I3Q B;  4FF2 A;  1RKN A;  3HOU B;  5EKI A;  1HA6 A;  2G9H D;  5FLX L;  1F9S A;  5IT9 L;  4A3D B;  5JEA H;  3P20 A;  2F0L A;  4ZRZ A;  3EA6 A;  2JA6 B;  1H9S B;  1Y8N B;  3O13 A;  1Q3L A;  3BVG A;  1ONL A;  2R6G A;  4MIU A;  3MXG A;  5BN5 A;  1BR9 A;  1TWC B;  5IGB A;  5A35 A;  1HFG A;  4K6D A;  4CJ0 B;  2E2I B;  1YNN C;  2F0K A;  1Y8O B;  1D1I A;  4A3I B;  1DON A;  2K5W A;  3PIO 3;  2XWB B;  2PCF B;  4DNT B;  1F9P A;  3NK9 A;  1LLR D;  1SMY D;  3KUP A;  2EJM A;  3E0J A;  1WTP A;  3QO2 A;  2FIN B;  3K57 A;  1KDC A;  5G3L D;  3IFD A;  2WAC A;  1HHV A;  1CHP D;  5I2X A;  5FO9 B;  1KNE A;  1FYC A;  3P1H A;  2K6A A;  2WP8 J;  2FJ2 A;  2BDO A;  2I07 B;  3MXU A;  3NTK A;  2IL8 A;  3ZYY X;  3DUZ A;  3N52 A;  2A6H D;  3WOF A;  1WVL A;  3AU7 A;  3BDO A;  2RDF A;  1Q1E A;  2RKS A;  2Q8R E;  3OWE B;  3DWA A;  3OOC A;  3G7L A;  2E75 C;  2F0V A;  2V4D A;  1PLF A;  4RA8 A;  3R3O A;  2RSN A;  1H9K A;  3TN2 A;  4K5V A;  1STH A;  2EYO A;  3GQB A;  4A3E B;  3FPU B;  2MP1 A;  4XQN A;  2EOT A;  2AUJ D;  1PTO B;  2OF1 A;  1LTR D;  4HMJ A;  4C1N K;  4F88 A;  3T16 A;  1SNQ A;  1ZYR C;  4GZY C;  3M3Y B;  3W2D A;  4BA2 I;  4ZK9 B;  4X3U A;  3GTK B;  3AMU A;  5IOC A;  5DEH A;  4J8Q A;  4PV1 C;  4XQQ A;  1SYC A;  2CW0 C;  5E4W C;  4G7O C;  2ICE C;  2F0G A;  1EEF D;  3NPP A;  1NUC A;  5KRU A;  2JEB I;  2KEE A;  2IT1 A;  3HOV B;  2GA4 B;  4ZQ3 A;  4HSP A;  1JWU D;  3HEJ A;  4C3J B;  4IUP A;  1SEB D;  5C44 B;  5KND A;  1MD2 D;  3IL8 A;  1PTO D;  2OXP A;  4IFD I;  4FNF A;  2A6E C;  3NP8 A;  1EYC A;  4OO1 G;  5CBA E;  3TSS A;  4CGY B;  1I4G A;  5M5W B;  3NBH A;  4FP5 D;  2MGS A;  1PTO F;  2B8F A;  3DHQ A;  4RKL A;  1QNU A;  4CJ1 B;  2J4X A;  5ELF A;  3DXJ C;  2ENB A;  2Z8L A;  2WIN B;  4C3H B;  2NBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...