2B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (19 structures)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PLASTOCYANIN)
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
molecule tags Electron transport
total genus 13
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2b3iA00
1RZPA 3WKQA 3IBOA 1IC0A 1IKOP 4NERA 2PLTA 1JVLA 4NB7A 4KO9A 1ET5A 1OCCB 5TK4A 4G71B 4CSZA 1ASPA 1FFTB 2DV6A 4GXFA 3JTBA 1AZBA 2Y1AA 1MDAA 1TEGA 1ASQA 5IY5B 1J9RA 3FU7A 5D4JA 1AG6A 4UF7C 1ZIAA 6PCYA 1RZQA 2VSKB 3DIVA 4YSQA 1WA2X 3T6XA 1OF0A 4A2DA 2XVBA 4JHUA 2W88A 2X88A 2E86A 4DP7X 3WNIA 3H4HA 3FQYA 4YSCA 1NPJA 2YARA 2YAOA 3ABGA 1ILSA 1V54B 7PAZA 2W8CA 1FWXA 1UATA 3S3DB 1JXFA 3CVCA 1KYAA 1ID2A 1TU2A 3IE9A 1WS7A 1PZCA 2PP8A 3RYMA 4ZK8A 5F7BA 2XX0A 1FA4A 1ADWA 4HCFA 2IDTA 1BXVA 4KNTA 2BZ7A 2BP0A 3ASNB 3FYEB 1PZBA 1SDDA 1AS8A 3QJSB 6PAZA 5E9NA 2HRHA 1NIEA 4DP6X 3QJUB 3WKPA 1IBYA 2QDVA 2XV3A 2CCWA 3OMIB 4CSPA 5B7FA 4KO6A 3CDZA 4DP2X 2CBPA 1VLXA 1A3ZA 2ZOOA 5I5IA 4JKNA 3AG1B 4E9VA 4K9JA 1CYXA 3IN0A 5B1BB 2ZXWB 3CG8A 2BHFA 4E9QA 5I6OA 1KGYE 2XX1A 2CJ3A 1PMYA 3NSYA 2VM4A 1GYCA 4QLWA 1SHWA 1SF5A 3ABKB 4M3HA 3L45A 4A68A 1M56B 1AZNA 3AG4B 4HZ1A 2GC7C 1PCSA 1E65A 2YAPA 1L9RA 5TK2A 1KV7A 4G70B 2UXVA 3SBPA 4G7RB 1XB3A 1ZDSA 2PPAA 2XV2A 4KNSA 2AZUA 3T6WA 7PCYA 1DYZA 3PPSA 1J9QA 5I5JA 2OV0A 3EF4A 1A4AA 3G5WA 1OCRB 1GY2A 1TEFA 2UX6A 2H47C 3SQRA 4W1TA 3FS9A 1GS6X 1A8ZA 3ZX1A 2MTAA 4DP1X 4AKQA 4DP4X 3S8GB 3NJKA 3MX0B 1ZDQA 4BXSV 1E67A 1M9WA 1OV8A 4Q8BA 2FNWA 1BXAA 3FU7B 4YSOA 1PLBA 4BK5C 4YL4A 1NWPA 2XWZA 1W8EA 1W6WA 2A3TA 1J5CA 3T9WA 3EH3B 3S8FB 2J55A 2PCFA 1MG3C 5I6KA 1CYWA 1KCWA 4F2EA 4HAKA 2PPDA 3NJHA 3FQ1A 4RH4A 4A2GA 3UACA 4FA7B 2IH9A 4HCIA 2PP7A 1NZRA 2GBAA 1NTDA 4WKXA 1N70A 3V9EA 1YLBB 1KBWA 3GXUB 2J56A 4E9TA 4F7KA 4BWTA 1SFDA 1AR1B 3FPXA 1M57B 3WI9A 3KW7A 4DP8X 1ET7A 1WA1X 3CVDA 1I53A 2BP0B 3HB3B 1SDDB 4DPAX 1E30A 2IDSA 2IWKA 3ZBMA 2OCCB 1BAWA 4YSRA 1IUZA 2IDFA 1GS7A 3CDZB 4A2FA 2DYSB 1AANA 2LLNA 9PCYA 1NPNA 3OQRA 4GP4B 1MZYA 3NJLA 2XV0A 3S3CB 5ANHA 2VM3A 3TBBA 2CALA 1MZZA 4HHGA 3NJFA 1NIDA 3AW5A 4E9SA 3KW8A 1SF3A 2YQBA 4UAHA 1HAUA 5A7EA 5I26A 1WA0X 1QLEB 3TA4D 1JZGA 1T5KA 2BWDA 2XLLA 2YAQA 2MRYA 2ZONA 1V10A 2DY2A 1BYPA 3AG3B 4YSDA 5B1JA 3WG7B 2JXMA 4YSTA 2IDQA 1AG0A 1X9RA 3UAEA 1BQKA 3QJTB 3OMAB 2P80D 2FWLB 5B3SB 2YAMA 1GR7A 1F56A 3IEAA 1NICA 4DPCX 2IWEA 4L0PB 1QHQA 3GDCA 2XXFA 1BQRA 4G7QB 2Q9OA 2WO3B 4X4KA 5AFAA 4AKPA 3X1FA 3AG2B 3UADA 4EF3A 4YSSA 5B7MA 1QNIA 4QKTA 1SFHA 3BQVA 4MFHA 1CC3A 1KDJA 4BWWA 2J5WA 2XYBA 2PCYA 4BXVA 3V9CA 5B7EA 2H5UA 4WTQA 3NP3A 4UANA 2YAHA 2ZWNA 1NDTA 1ZPUA 2R7EA 2RACA 3X1NA 2BP8A 4YVNA 3FYIB 3AZUA 1ZIBA 4W9ZA 4KO5A 4AI7A 1XB8A 4BWUA 4N8UA 2X87A 3NSCA 4GP8B 2WO2B 1ET8A 3NT0A 4HALA 3UABA 1CUOA 1B3IA 5B1KA 3NSDA 1L9PA 5PCYA 1JERA 2AFNA 2B3IA 1AZCA 1OE1A 4E9XA 1PF3A 3S3BB 2BW4A 4YVUA 1XB6A 1CURA 5FC9A 4P5SA 1DZ0A 1WAEA 3FPYA 2Q5BA 1EHKB 2UXFA 3HEIB 4AZUA 3NJNA 2QDWA 1GY1A 4A2EA 3FU9A 5I6PA 2J57A 1IBZA 1PNCA 1GS8A 1NIAA 1SJMA 1J5DA 1AS7A 2H3XC 2JKWA 2VSMB 2UX7A 3EH5B 3DKHA 4HIPA 4NAJA 3TU6A 3D12B 3T6ZA 3X1GA 3U25A 2CUAA 1AQ8A 1OE3A 1KCBA 4G7SB 3FSVA 1OE2A 3OD3A 2Y69B 2PPCA 2BO0A 2IWFA 2GI0A 1JZIA 3CZUB 4TXVB 2VN3A 3AY2A 3QQXA 1J9SA 2VW4A 4DP0X 1R1CA 1SNRA 3X1EA 1BXUA 3TASA 3WIAA 2AANA 2TSBA 2CAKA 3PAZA 3UGEA 1JZJA 2GHZA 2AZAA 3ZDWA 4E9RA 3FQ2A 2VW6A 1BQ5A 1JZFA 1ETJA 1KBVA 2HLEB 1E5ZA 2QPDB 1NINA 2QT6A 5I28A 1N68A 4GP5B 2R7EB 3N55A 2BP8B 2FT7A 2EIJB 4BDVA 2PPEA 1BYOA 1WS8A 4A66A 4DPBX 2NRDA 3NSFA 1JZEA 2FQFA 1W6LA 4ENZA 2YAFA 2FTAA 3H56A 3PCYA 1RCYA 1AACA 2AVFA 2QPEB 4DP9X 2BZCA 1RKRA 1L9SA 3ZIYA 1OCZB 3N2JA 4N4YB 1GSKA 1OOWA 1NWOA 2BWIA 3DTUB 4PAZA 4HHWA 2PP9A 4PCYA 1ILUA 2EILB 3OM3B 3IN2A 4HCGA 4KO7A 4A67A 1AS6A 1URIA 4YSEA 2FT6A 3PLYA 4M4RB 3PXLA 5D4IA 1NIBA 4G72B 3H4FA 1BEXA 2DWTA 5PAZA 4Q89A 1J9TA 5AZUA 1TKWA 4GYBA 3UAAA 1PLCA 2UXGA 3QPKA 5B1JC 3FT0A 3PAUA 3FU8A 3NJMA 3CVBA 3T6VA 3EHBB 2HXAA 1ASOA 1PLAA 8PAZA 2VMJA 1AIZA 2JFCA 1JVOA 2HRGA 1L9TA 1PNDA 4E9WA 2TSAA 3NP4A 1HFUA 1OCOB 3C75A 3X1BA 4DP5X 2B08A 3EH4B 2P80A 1AOZA 3MBWB 5D4HA 5I6NA 2OJ1A 3SBQA 2HX7A 3T71A 3GYRA 2HX9A 4A2HA 3ERXA 5LDUA 4KNUA 5EHFA 4E9YA 1PY0A 3QJRB 3QJVB 1A4BA 5I6LA 3QJQB 2YAEA 1A4CA 2GB2A 1AZRA 1A65A 2GSMB 3NJJA 1JOIA 3NJGA 5AKRA 4YSUA 4AKOA 5I6MA 4F2FA 2N0MA 2EIKB 2UXTA 2EINB 2GIMA 2XU9A 3JT2A 1AZUA 2YXVA 1NIFA 4KOBA 2HX8A 2IAAC 3WNJA 3PAVA 2IH8A 1HAWA 2XUWA 2IDUA 3ABMB 4KOCA 4BDVB 2I7SA 4GY4A 3OMNB 3TBCA 4YSAA 5F7AA 4YSPA 3ABLB 1KDIA 1PAZA 5I5MA 3FSAA 2GC4C 3NYKA 2I85A 2I7OA 1JXGA 1L9QA 2BW5A 2EIMB 2HZHA 2DYRB 3FSWA 1JZHA 1PZAA 2WSDA 1V55B 3FSZA 3BVDB 5B1AB 4FAAB 2DWSA 1E5YA 3NJIA 1EZLA 2FT8A 2FJSA 1JXDA 1AAJA 1X9UA 3SBRA 4P5RA 1GW0A 2PPFA 3X2QB 4AX3A 1L9OA 2YXWA 1SHXA 4JHVA 2FQEA 2FQDA 2FQGA 1ZV2A 3ASOB 2XXGA 2VW7A 1MG2C 1XMEB
chains in the Genus database with same CATH superfamily
4ZSOB 4U49A 5I8OH 5GS1A 3WKQA 1KZQA 4OM1L 3VB9A 3UBXA 2AV1B 4ONHA 2BDNH 43CAA 3DO4A 2V8LA 4KO9A 4B5ZA 4JM2A 1A7RH 2J7LA 2K3TA 4QHNA 5LQBH 2HFGL 2YD6A 3UG5A 2ICES 3MAWA 5GSVA 1WIOA 2K45A 2VKXA 4XPGH 1XD1A 5B1CA 3KBPA 3MBEB 2H41A 4JDTL 4K71B 2L7UA 5FYLL 4YK4B 5SWSD 3T2QA 1ZIAA 1TYRA 3VU2A 1NCWH 4UIMB 2W9DL 3BIKA 4GMSH 3LKQB 4UTBA 2CU9A 2VR5A 4PBVC 4HKXA 1XGQB 3U4AA 4B41A 5JW3L 3IDMA 3PWVB 3CHRA 4PWGA 5DTFB 1RHHB 3PXJA 4NQVB 1XH0A 2Z35A 3H3PL 2AEQH 4P23D 3SGKC 1MCOH 3LNEA 5B39A 3TEWA 3O4LA 1KB5H 4P4RB 1ILSA 3L9EA 4AYFB 1WISA 1IC4L 4Q58C 5JR1H 5JO5A 2GSIA 1TU2A 3BUIA 1PZCA 2EDNA 2QKIA 4KXBA 3KS0H 4NGHL 3SDDD 4I13B 5D6DA 1ADWA 4X4MA 3MV7E 5TF1H 2DQGL 4ES9A 1P1ZB 2R51A 3PP4H 4RSYA 3IE4A 4L2LA 4BFBD 4C4BA 1G6RA 4OF3A 3C5SA 3C12A 2CCWA 4HUWA 2YMXL 1RUQH 3HI1B 5EUOB 4EBQH 4WY7H 4XP1L 4Z76A 3NIGE 2GTZA 1QAWA 4XMVA 4D7PA 1XFPA 2OJZL 3D25B 3WTVA 5ECGA 4RGNC 5AYQA 5GGSB 4UV4L 1DL7H 1R5WA 1T21B 3LMJH 4LLMA 4N2BA 4G82A 3G5XB 3OKKA 4R3SA 3T3PE 2CDEA 5JORA 3WTXA 4Y19D 3CH1A 4PJCE 1NSNH 2H3KA 3ZE2F 3BKCL 3TEUA 4P2QE 4JPWL 2ZUWA 2HJKA 3FB6A 3NEEA 1XB3A 2NZ9D 2PCPB 4ZW6A 1GZPB 4PB9L 4KNSA 5IMOA 1Y6KR 1L7TL 3MRJB 4LHUB 4R9HA 3SDAC 1P5UB 1EDHA 4AQ8A 4R5TA 3NCYS 2D7OA 2Y7NA 3KCWA 3CVHB 3V0WL 4ETQA 1YSOA 5TDNA 3JXAA 2EZ0C 3CFDA 1I8UA 5ITBH 5C0FA 4NO0D 3MTRA 5AOJA 3U7YL 2JV6A 2WN2A 4P4KB 3BPOC 3AT0A 3SE9L 3TX4A 3FU7B 4AEFA 4BK5C 3ARBB 3L9RA 5LBSH 3JUZA 3EYUH 4TSCL 3DOIA 3WAJA 5T1LB 3U0WH 5IFJB 3WXVL 1FNLA 1TZHB 3VWJA 3VX0A 3X3GL 3S4SA 1T6VN 2YA1A 4ZZFA 1NL0H 4LSTL 4GRLB 1CIUA 1M7IA 4I0PB 5CP7A 2XN9A 1MPAL 2J44A 1CF8H 1LEKB 2UZPA 3PUCA 5DUML 2W0FB 3KJ4C 3IT8D 5CKGA 3VH8A 2YGOA 1CD1B 3MO1A 3AQXA 5LO7A 3QYNA 4WGWB 2LU4A 1R3HA 3ARBD 4NDMA 4O4YH 2I69A 4P46B 3FPXA 5EBMA 2ENYA 4WHYG 5T1LD 4PJEA 4MMXC 2HVBA 3CVDA 3FCBA 3UYRL 5LDSA 1SDDB 4XCNB 4LLDA 4MCNA 1OM3H 1DCLA 1BMZA 4LZKA 2VXQH 3GZOA 3PWNB 1UD4A 3EW3B 3KCPB 4NNPL 1QQDB 1OM9A 4GAGH 3H42L 3QIWB 1MFBH 3HC4H 5IBLC 3RUGF 2LLNA 5FDWA 1T1XB 4XMKL 4X7EC 4X5XA 2PO6A 3LKRB 4OZ4B 1ZE3C 1MZYA 2V5MA 4Z7NE 1K8DB 1OTUC 4P46D 2Y07L 3V7AE 5E9DA 1T3FA 4HIHB 1LO2H 5D1QD 4LBAA 5IHLB 3KW8A 1ZT1B 4F7PA 3RIAK 3DDGA 4X4YB 4YDVA 1ANUA 1KIRB 1VFOA 4FJYA 4WFED 4NPJA 4TQEL 5EPMA 1G9NC 1IEHA 3FHQA 3FSOA 3VGBA 1ULVA 3KDMB 2IXQA 1S7RA 3GD1C 4PWEA 3DGDA 4QRSB 1HWWA 1RSYA 1TNMA 5B3SB 2BOCA 5HY9B 4EE2A 2X3BA 4BH8A 3L3JA 4RISH 2VDKH 3HUJF 4NM8H 4ALAC 3BEVA 1QHOA 3BVNA 4XPHL 2B5IB 2J6EL 4NKOA 1WSST 3G04B 3WGUB 3QQ4A 3OG6B 1YNLH 1SJHA 5G4MA 1AR2A 2LLGA 5DJ2B 2DYPD 2OLDA 5B38A 1MLBB 1BFVH 1WC7B 1CG9A 2DM3A 2TRYA 2YD0A 4Q0XH 4WJ5A 1QFWI 1RL1A 3A4FA 4JB9H 4DVBA 2AJVL 4QIRA 2UZIL 3W57A 2PCFB 1BPVA 3F7YA 4KVNH 3TYFB 3OPUA 5GGUA 2H6UA 3KLKA 1TQTA 6CGTA 4JR9L 2Z1PA 1IL1B 1GZQA 1GGBL 2DQFB 3TIDA 1F1GA 4ZUVA 4EIZC 1JHLH 1CFMA 4NQEA 3VI4A 3KVQA 4ZXBA 2WQSA 1RZJH 3OG4B 4IHBA 1LP9A 4FI7A 2VIRB 3VMPA 1U3YA 4H8VA 2ZX6A 3LNGA 4JG5A 3T3MF 1QABA 4BWUA 2R4RH 3LQAH 3LVEA 1R24A 4W9KC 1XCXA 2VXSL 4Y4KA 4HEPA 3CLWA 2CXKA 3FU5A 4PLJD 4F91B 4NZUL 1N4XH 1CFTA 3IVKA 3K4DA 2X2UA 2Y7QB 3RIFK 3V4PH 4APXA 1ZLEA 1FF5A 3O9WB 4RBPH 1PIFA 2C9RA 4A37A 4GMTL 4NQCA 4XCFL 1XZ0B 1ZY9A 3B6SA 5IFAH 5C92A 4IRJA 1DQJA 2V33A 3RY6C 3QQDB 4NWUL 1I3VA 2VISB 5AW6B 2VXUH 4GG6E 1JN6B 2IBGA 4OSUH 1DQIA 5ITFA 2MOGA 1AJ7L 4R96A 2Z31A 3TEZA 4HIXH 3D06A 2AJZA 4QJ4B 3RNKB 3OKLB 5JDSB 1MRFH 2QHLA 4HV8B 2W07B 5IV2B 2P48B 4Q9QL 3O9WD 3BSHA 3HNTH 4OQ1A 1QSFE 2FB4L 3VW3H 3LEXB 3IFLH 4Z95H 5FEBA 4KY2A 2J1WA 2NY2C 3J07A 1NCHA 2C7UB 3V5DB 1MSPA 3DX3A 3TH4T 5LCVA 5KWYC 4KK6C 1LNUA 1PKQB 1TFPA 2B7DT 3AUWB 3QPQC 3MBWA 5MEPA 1XGUA 3CXHJ 2WYTA 4MJIB 1IEBB 5IB1A 2BRQA 1WEJL 4G7SB 5E1IA 4AQ1B 1U8OA 4D0CA 4QRRD 1JZIA 3VG0L 1P4IL 4C83A 2X05A 3OZLA 1RPUA 4NC1E 5LLIC 4APQC 3ULUC 3UL4A 2TSBA 4G8IB 2Y3NA 3BZ5A 3MOBL 2CIIB 1S7WB 3BW9A 3WHXA 1B90A 5DMGD 4BK8A 3RBSA 4GKOA 1VFAA 2AZAA 2O5XH 2BJMH 3LEVL 3GKZA 1ZA3A 1CMOA 4MJID 5AKTA 1T1ZB 2XBZA 3R0MA 1HHHB 3OC5A 2NX5A 4XNMB 5FOBA 3ZE2B 4BDVA 3FB5B 2BINA 2V2XA 2A74A 4O9HL 2FUQA 3FFOA 1RZ7L 4JANA 4F9LC 3BAJA 1H5BC 3DXAB 3LKOA 3A22A 1FGVH 1IBGL 1NC2A 3KLLA 4P9ML 1A9VA 2BVQB 2F7PA 1AACA 5GJSH 3MA7B 5DCCA 2O1AA 5FECA 2BZCA 4HJTA 3BZFA 3EFOB 2WYZA 3A0OA 2AERT 5D55A 4QRPA 1G0DA 1CICB 5JHLH 3RE0A 5IOPA 5LNEA 4KO7A 1KBPA 3SO5A 1E2ZA 5BVJB 4XZ4A 3IJYB 1Z9NA 2UWEF 4PJ5D 5H94B 5IVNA 4PCSA 3Q9QA 4ZD3L 4NO3B 5LGKA 1K6QL 3KYOB 1MAKA 4XHJD 4IIQB 4FG6D 5J6HB 4G8AC 1AMXA 1H6UA 2J8UE 1N12A 3L8QA 2ROYA 3H9YA 3FB7B 4PY8I 2X2HA 3EJZC 3I6GA 3V4VA 1I3RA 4RMTA 1QPKA 3ELQA 3WS6A 2K8MA 1RMFH 3GPSA 3CHOA 3GI8L 1OAXH 2AJYH 3MUHL 4IJ3B 5DO2D 5K1NA 3RKPA 5MI0B 3ML8A 4M5SA 3B3IA 4F1ZA 3MOAL 4CVXA 3T0VA 5I1LA 4KI5E 4L3FA 4DP5X 3HCVA 4XN7A 5C7ZA 2BMKA 4KTGA 1AOZA 1ADQA 4AQAA 4CGTA 3SPVA 3ZMEA 2XA3A 4KX7A 1IFHH 2PR4H 4XP4L 1D6VL 1CDUA 2KQMA 4BK5A 2YQ3A 2H8PB 3VWKB 4XH2A 4P5MB 3RUGB 3VFOB 4L4TA 4Y8AA 1YUHB 2OX5B 3HFML 4GW1B 3QAZB 3MODL 2ZZUT 5FXCH 2JKLA 1CLVA 5FGCE 1UT1A 3QGVA 2C5DC 5EN3A 3RKDD 2Q87A 3SN6N 3CC1A 1AZUA 1UM4L 4KXZH 4XMLL 3KJ6H 3PYCA 4OKVB 3K2UH 5EH1A 4PUBH 2IDUA 1RJLB 4AMKL 3EDJA 4OQTA 1LEIA 1NFDE 1DSFH 4LEEA 4HX1B 2E7DA 3FSAA 1TQBC 4H8HA 2ZG2A 1GPOH 2CDGB 1BJ8A 2HZHA 2YXFA 5FO9B 1U4FA 3RZWA 5B21A 1Y0LA 2YA2A 3ETBF 3H55A 4JZNA 4LSUH 4QXTB 1Z5LB 5CILH 4KKLC 3HUJB 5KS9A 3SPGA 1SVBA 2Z64C 4MXVE 1YMMB 4X8XA 5I6XB 3DSFH 3S34L 2FJSA 5FYJE 1C5CL 1DO5A 1PG7H 4WTXA 3RPKA 4N2HA 2VDPL 3FONA 4I48B 5J9PB 4TTDC 4HIEB 5DZJA 3QI9B 3IB4A 1C8QA 2K4WA 5T3ZE 3HHSB 4PRHA 1HSAA 1CPUA 1PQZA 4ZW3A 1ET5A 3NFNA 1U92A 1XF5B 1WAPA 5MENB 2EE3A 3PHAA 3D0VA 4B5EA 4S1RH 4DHLA 2AXHA 2P8PB 3BVXA 3W2DH 4DCQB 3P4NB 4JGJA 5CKAA 1CO1A 5JIKA 2ODHA 1GTFA 1ZTXE 3B43A 1BD2B 1MDAA 3QUHA 2WUBL 1XIWC 4RQQB 3I9IA 1HQ4B 2VXTH 3O11B 3QI9D 3T3MB 2OMVB 2VZ3A 3EOTH 5DJ6A 3RFZC 4HPOH 1GH7A 1NFAA 5D4QA 4NNYB 1HHGA 2P8MA 1MNNA 3UC0L 1L9NA 1CFQA 2X88A 4KTDH 5E8DL 2XWTB 2XRAL 3IU3A 3RVWD 4H5SB 2K6YA 4L1HA 1KWGA 2WBKA 2DIAA 3EG9A 4D9QE 3KPMB 2L7QA 5E1QA 4EVNA 1DP0A 2ED8A 4XN2A 5I17B 5KBDA 1N18A 2FWUA 4YQXH 2ZXDA 3NN8A 2A77H 2PWHA 4XMWA 2VNCA 4F20A 3ZOAA 1WUNT 4WO4B 4ZNEA 1F3RB 3JWDL 2HTLC 4M6MH 1NBYA 3PDOA 2RD0A 1E6OH 2BY0A 4IBSA 3VD4A 4Y5VA 1EX0A 3HZVA 1TMCB 1MHPH 1GYWA 3PPEA 1ROWA 2GK2A 2KUTA 4LCYB 2HLFC 3QO1B 3RNQA 3WN5C 5F7DA 2CBPA 5I5IA 3MUUA 5A40E 4FQIH 2MCMA 3ZR5A 2C3HA 3QNYB 2WZPD 3ULVE 1G7JA 4CMHC 1CLYL 2GYSA 5AOLA 3S35H 3RVTD 2AXFB 2OJEA 2LTQB 1BVZA 1LK3H 2VH5H 3GRWA 2JB5H 3RY6A 1X5JA 5GGRY 1J0JA 1N0XL 3K8KA 5DHMC 5DHVB 3AAZA 4FXGA 4HFWA 3ZHKA 1HE8A 3WYRA 4KHXH 1D2PA 4OCNC 2CLVB 2VLME 3BH8B 3D3VA 3D39E 1B3JA 4YIQB 4D0BB 3DETC 2ESVE 4N22A 1DSYA 2G9HA 1F3DJ 2F9BT 4KMTL 5HDOA 5TE6L 5HYJA 2PPAA 2X4UA 3CZFA 3D85A 1TZIA 2R1YB 1DYZA 3SKJL 3D30A 3KPLB 3PABA 4HWBL 2YUVA 5EG6C 3IJSA 1DVFB 1S9WB 1A4AA 2KHAA 2Y5QA 5C6TL 1TEFA 3QFJB 3T2NH 5JW4N 4XOCA 1IAMA 2OZNA 5D7KD 5IBUG 4AXWA 1CI3M 2O6DA 2IQ9H 1QLEH 5ESQB 3GHEL 4YSOA 1AE6L 4XVJH 2NW3A 1O6SB 2JJSC 4LSDA 4KKAC 5EORH 3I02B 5BUGA 4YDNA 2P26A 1W8EA 5D7JB 1DQQB 1W6WA 3EGDA 4XC1H 3K6OA 1X3DA 3U0PA 3D51A 2WINA 1U8HA 1IRAY 1DVFD 3O4OC 3O3DB 4NUGL 2BS8A 4UOW0 4BA0A 4U6YA 2VWEC 3H9SB 1QKZH 2ITDA 1KFAH 4J3UA 4DKAA 4RA3A 2J1ZA 1IAII 3Q6FA 1NCJA 1NKGA 1ZHLB 3UTPD 1KT2A 1WTLA 3GNML 5I71C 3C8DA 4AL8H 2DB8A 1S7UB 3ZBMA 2AQRA 2Z8RA 4WLCA 1F41A 1IAOA 1J1PL 4FZEH 3SGJA 1SOKA 4YXHL 3RGVB 1N7ML 4I18C 3PJNA 4GAYA 4YC2B 2JB6A 3OQRA 3MRQA 1FAIL 1U3NA 3BP6B 4ISVA 4K7FA 5DJXA 1DEEB 4QYAA 2UY6A 4I2XA 4W4OC 2P5WD 4UM9A 3AJ7A 1UM6H 4Z7WF 5E6IB 4L8DA 4X5WB 4I3RH 3UFIA 3CHXA 5ACMA 4HXAH 2AK4E 4EN3B 4LEOB 3MLSL 1R5VB 3CCHA 1A6UH 4AG4H 4CVUA 2NXZB 5LXGL 2QQNL 4LKCB 1EFQA 3B83A 1JK9B 3RGVD 3QEQB 1VPOL 4PS4H 1NA8A 3PDDA 5JPMC 4I8DA 2R2HB 2W0LA 4YSTA 2F5AH 5D2LB 2XG4A 4HF5L 5DHDA 1E5AA 4XPFH 4FE9A 3CFTA 4GG8A 4JO2H 1EMTH 1DJSA 1UM5H 4Z77B 1EHNA 1B0GB 1U2HA 4IOSD 3RI5K 4AJYV 4EN3D 5HVHB 1S5IH 5JOPE 4LT7A 4X98A 4F2MA 3CBRA 1JF5A 3H3KA 4WUUE 3TFKC 2NXZD 3HE7C 1W16A 3MRRA 4XMXA 4I1RA 1UUNA 4OIIH 4OGXL 4CAGA 2WWMC 4EF3A 4ZFZB 4YSSA 5ICZB 1T83C 5I1CL 3HBZA 4WW1B 1SFHA 1W9XA 4PJXF 3MJ8A 2YJQA 1H3UA 1KDJA 4BWWA 4E9LA 5E03A 1IJ9A 2XFXA 3LKPA 2VE6A 3GSNA 4IDJH 3TA3D 4JG9A 4TYUA 3L3KA 1OOAA 3NP3A 4PI2A 3CZGA 1PW3A 4JUTA 5I74B 1ZPUA 1Z3GH 3O6LH 3OV6A 5IEHA 2VZSA 2XYCA 4GRMB 3Q8FA 2E47A 2PW2A 2MEJB 5BV7H 5KVEH 1OP4A 3KGRA 4RNRA 3FQUA 1IGFL 1R46A 4WKZA 3L3DB 1T5XA 2BHZA 3EFDL 4M8QA 4CC4C 3EJCA 2BHUA 1YECH 5ICYB 4XVOA 1J18A 4JJOA 2FYYA 1NDGB 1PDKA 4XNYH 1RJYB 3X11B 2RH0A 4OGYH 4ONGH 1X4ZA 5KSBA 2QTEA 3ES6B 3TO4C 2GBUA 5IWLC 3UABA 3GMNA 2O5NA 3UJTH 3W3BA 1OP9A 4LL4A 2ENQA 2YUZA 3QZWA 1AZCA 4O02A 4PJHE 1QLFB 3UJJH 5F3BB 1H8LA 4JHZA 3P4LA 4HLZH 1CT8A 4K9EC 2R8SH 3QJFB 3BT2L 5FC9A 3MLRH 4ODXA 4QF1B 5I1AB 4M03A 3D0LA 5CLTA 5BS0B 4GSRA 4ZFFA 4LL1A 3DHMA 1UB6A 1KGWA 1KBGH 1BQHB 2QDWA 3S2CA 3NTCH 3QR1A 3DRTA 4L4VA 3QEHA 3W82A 1OD9A 4F7EA 1AGFB 3UEZA 1O7VA 3NCXA 3K72A 4JN1L 4FABL 3V6FB 4D9RD 2P7TA 2HWZL 3I74A 1T80A 5DFVD 3UTTB 1GZHC 2YWYA 4JHAL 2DF3A 3QIUD 1XXFC 1K2DB 2OMZA 3AY2A 4JFFB 4JMXA 4EIBA 2G75A 5J3HD 1R5IA 1BXUA 2EDFA 2AW2A 2VMEA 3KPRA 1C1EL 3PAZA 1QSVA 4J8QA 1C5BL 3LDBC 4L5FL 5E8EB 3S36X 3V95A 2X1QA 2WVSA 4E9RA 1T04A 3DDFA 3UERA 2Y72A 3UTTD 3S2AA 2HJFB 4QOKB 5L2JB 1UH3A 3F01A 1QOKA 4JW3A 4TF4A 1F6AB 4GRWF 3ILPA 3TVMD 2OZ4A 2ZNWA 3RURA 2BP8B 1BIIA 3JVGA 3QUXD 5ESAA 1BIHA 1SXSA 4ZDHA 3GRBA 1YAIA 4L8BB 2MSPA 5EBLA 2DKSA 4LLUA 4E5XB 1UZ8A 3MUJA 5E99L 1GJWA 1EJOL 1G4RA 2X4TB 5TH2A 4DGYL 1OT2A 3QHZL 5BRZE 1OARL 2Y06L 3ZSSA 3TPUB 3C8KA 1JTTA 3ZIYA 2IEPA 4QOKD 2RB8A 4MWFB 4R7NB 4JY6A 4JPKL 4LDCA 5FGBA 4MD5B 3SE3A 1Y1UA 3CE1A 3VJ6B 4EKXA 1KTLA 3WU1A 5CEYA 1FYTE 1SOQA 2IGTA 4NWTH 1T89C 3QWNA 3DUHA 3V52L 1AS6A 5DHXB 1PKOA 4M4RB 3PXLA 5FKAB 1IIKA 1JL8A 4JN2A 4EUPB 1UCBL 3DOSB 1E8XA 3MQIA 1AGDA 2YBRB 2W9LA 4P2RB 5HHMD 4Y1TA 1QR1B 5IVZB 5DXWA 4TM9A 3BIAX 5KYYA 3U9PH 3UTSA 5F1KC 1PZ5B 8PAZA 1W0VA 1DBAL 3CV5A 4LASL 1BZ9B 1RQ5A 3KPPA 1N2RA 2Q76B 4PRPD 2NY5H 4EZLA 1N9PA 1MDTA 2JCCF 5IVXA 3O6FB 3G5ZA 3BN9D 3LNHA 4Q52A 3QNZB 3ALPA 4HH9A 1FE8L 3FO0H 4TNWK 2EH7L 3KPSE 1KPRB 2GIXA 4PJDF 3RG1C 2XN0A 3LD8B 5FYLD 3D18B 2G5BB 4PRDA 3MPCA 5B8CC 3QJRB 3MXWL 3TNNA 3VRIB 4WFGE 2OMYB 1WFUA 3O6KH 2A9ML 4ELME 1ZK5A 1JOIA 2QSQA 4JY5H 3VA6A 3RL2B 5I6MA 4F5CA 4IK7A 3O6FD 2EINB 1JVKA 1CE6A 2I07A 3E8VA 4PHZA 1UOVA 1WJ3A 4X50A 4DERA 1TCRB 2ZCZA 4GXVL 1JGVL 1ZHBB 4QCIA 2D8KA 4R7XA 1A3LH 1C08B 2FX8L 3LXAA 1EXUB 1L7IH 3JV6B 2I26N 2IAMC 4OFYD 1YY8B 4Y9FA 1XEDA 4J8RA 2ZPKH 4L37A 4HS3B 3RVVC 2NY0C 1PY4A 4PJIE 3SDXB 3KH4A 2G60L 1J8RA 4OCXL 3CN2A 2IBZY 1JZ3A 2NUPA 2APXA 2XWCA 4OFDA 1PZAA 3POCA 5SV3A 2CO2A 3BVDB 3MDJA 4NO5A 5EO0B 3KBEA 4WJG3 4U05A 1E5YA 2GG1A 2O6EA 4XXWC 4RMQA 3HAEB 1NMCB 4Z5RB 1E8WA 1R17A 3EH1A 3WTYA 1L9OA 1F1DA 3APCA 3IDUA 4Y9EA 3ALXA 4BZ2H 1UKQA 2AXJA 3GK8H 3OJMB 4HWZB 4Y7OC 1JIBA 4NAQA 5LXVA 3IBOA 3LQMA 4PREA 5GSRB 5IKCB 2ZCHH 3S5ZA 2YD3A 4YHPB 4IBWA 3MLTA 4L8SB 4NB7A 1II4E 5JPMA 2C4FU 4U1LA 1FFTB 1NEZG 4B9YA 1Z0MA 1AHWB 2VDNB 3ME0A 4KXDA 2Y1AA 2EP6A 1HHKA 1OSPL 5C0BB 3PJSA 2ICEA 4M7LL 3WKMH 3HI6L 4DO6A 5FKPB 5IMLA 2PTTB 3BFOA 2JK5A 1IBHA 5CP3H 4FTVA 2ICCA 1KEML 4MD4B 5FCUL 4H1LG 4WTZG 4YBHA 3WGVB 3H2PA 1MCSA 1T2QL 3L7FA 2DQEL 3B5HA 4IW4C 2XVBA 3MN8A 3DYMA 3KGUA 4JLRA 1FVEB 4L9LB 1BQSA 1A7PL 2OM5A 3ESVF 5CAYB 3APMA 1IGCH 4HLEA 1OALA 4PY7B 4H8WL 2P5PA 4MRCA 4A6YB 1KYAA 4Y2DB 1YG9A 5E8PB 5DZAA 4ZUUA 2CGRL 4KPHL 3WSQL 3WMSA 2WKLA 3TCLB 2XZCL 3ASNB 4NUMA 5BQDA 2H32B 5IW1A 2DJSA 2VOTA 2HRHA 3IPBA 3MV8D 3OAYK 2V37A 4Y88A 3VUAA 4CC4A 3BRFA 1E27A 4YDLC 2NZ1A 1TTCA 1XGYL 3GXNA 1DANU 1LJMA 4G6MH 5GRJH 1VLXA 1PD0A 3V6OE 1G0YR 3EYQC 2WUCL 4FQLH 1ZV9A 3TO4A 3RB7A 2DIBA 1JPTH 3AFLA 4AV0A 3GTTA 1JK8B 1ORSA 1RZJC 1ZHNA 3KL3A 3L4YA 4XWGL 3TN0A 5KBKA 3AU1A 3WEBA 3N85L 3MLWL 1PG7X 5E4EB 5KG9A 3LQAC 3NSYA 5FO7B 4OF0A 2QBWA 4KTYA 1ZLSH 2MCPL 9CGTA 1Z66A 2E9GA 1NUFA 2XICA 4LNRA 3UPRA 1XF2A 1ES0A 1UZ6F 2R4SL 2V3EA 5GZNA 3QRLA 1C12A 4JS7A 1X5LA 3DOHA 4OF6A 3KPTA 1M2VB 3AM8C 3DVGA 2UZXA 2WP3O 1YNKL 3FZUD 4P23C 1P6AB 3DUSA 4ZOEA 3RWFB 2R0ZL 3ZGHA 5DYOA 3ARDA 1I1AB 5IB2A 2X7LB 1LE5A 4UIKH 3F7LA 3MV9B 5D1XE 3ASWA 1E3XA 3V0JA 2CBQA 5C3LD 2OL3H 2UY7A 1BVLA 2VDLL 1J0IA 2OMTB 3GHPA 3SDDC 3KLHD 3EFFB 7FABL 2CJTA 1PJWA 3BVWA 3PHOA 4FQXB 3VFNA 1EHLH 1DBJL 3HN5A 3ZX1A 3F58H 2G2RB 2MTAA 5KAQF 3MX0B 1U8MB 1Y1DA 2BSTA 1GZHA 1XCTB 3ZDZF 1E67A 4L48A 4MA7L 4XPAH 2KLSA 2VLKE 3U2SA 2EVIA 4JFHD 4RMUA 1C8PA 3DX7B 2E7BA 4R97B 4OZHE 2EVJA 2PF6A 1LD9A 2L0DA 4G8EA 5T5NG 1NMBH 1A6VH 5DD5H 4AYDC 2JLPA 4G8FA 1NEUA 4F2EA 1K72A 2G5UA 2JKIS 4JFWA 4MAYD 4D7BA 3BD5A 5C0CA 3REVB 1TQCB 1INEL 4WI4A 4FQXD 4TQPA 1NZRA 2R69A 4OM1H 4U1NA 4Y9GA 4FRWA 4OZIA 5LG6A 4LU5L 4WW2A 4XN1A 3CSGA 5SX4I 1KBWA 1M7UA 1NQBA 1VSCA 5ICXA 4TNVK 3PWPE 3QJHA 4PJBF 1HH6A 2HFGH 4HG4J 3TT3L 1BFTA 2BNRE 2H1PL 2GJ6D 3FAXA 2NZ9C 2VAAA 2Z9TA 3Q5YA 4YSRA 3HVDA 5DJYA 4JDTH 1AD0A 1D5BA 2VKWA 3GC3A 5FYLH 3T1FB 2YQ2A 4NKQB 5I9QB 1AANA 1A22B 1SY6L 1G0XA 1MFAH 3TBWB 2VQ1B 2W9DH 4QT5B 4ZTOL 1AGBA 5JW3H 2OS7A 3NJLA 4AC4A 5DEJA 1MI5B 4QRAA 4PJDB 5C1MB 2R15A 4ACTA 1WO2A 4MJ5A 4WI3A 2B59A 1E5BA 4L3EA 1ACYH 2FGWL 1IC4H 1S8DB 2EYRA 2Y7OA 5A7EA 3TA4D 3LHPL 3WIIL 1QFHA 3VXUD 2XLLA 3KYMB 2MRYA 5L4IA 1GKOA 2YPLA 3LY6A 4OD2B 2K9UA 1JYNA 4BFIB 2DQGH 5E8NB 2FEEL 3OMAB 2R0KL 2J73A 2DEYX 2YMXH 1QLRA 4KBPA 1YPZA 1UWYA 1TT6A 4GKSB 1WBZB 2Q9OA 3ARBC 4U1IA 3X1FA 4KJQD 1IEAA 3MCYA 3CIAA 2OJZH 3G9VA 1H3XA 5I66B 2H0FA 5EU5A 3EUUA 2J71A 4CU6A 1SLVA 1TVHB 5AG8A 4DGUA 1QRND 2VYRE 2JJUA 1WBYA 4G9FA 4NQSA 4P9HL 1PS3A 1YZZA 5IIEB 4HH8A 3BKCH 3E2HB 4HS6A 3VE0A 3ZE0F 1SEBB 1WD8A 1KGCD 3JTTA 4FN0A 5HJ3B 4X42A 1I9RL 4P46C 4QHUB 3EBAA 4IKKA 3W11C 5D1QC 1HU8A 4PB9H 1SDYA 2FSEB 1HYRC 1Y6NR 4XCCH 4X7DC 3OVUB 1NGWB 4Z7QE 2D03L 1KTJA 2FHBA 3V0WH 3VQ2C 3QP3A 4HALA 4JFZL 3U7YH 1GCYA 5E8OB 1CN4A 3NSDA 2VDMB 3SE9H 1CFSA 2FIRT 4BSWA 5TDPA 4TSCH 5FM5M 2XN2A 3WXVH 3S3BB 2HFTA 1TZGL 1BREA 1OP5H 3CDGA 3X3GH 3CMGA 3U30B 3FMGL 4LHUG 1RZ8B 4Y16B 5EBWB 4LSTH 3H54A 4MGXA 2CK0L 1IAKB 4AZ8A 1UWGL 4YR6B 5I75C 1HL5A 4LBEA 1TSRA 2E9BA 3WCYA 1F11A 3O4LE 3ARVA 3OKDA 3E80A 3HI5L 4E41A 3EJYD 3WO4C 1A0QL 4LDEB 4UU9A 5T1KD 3TTSA 1T1YA 1WG3A 3WTUA 3QRGL 4JFDD 2EACA 4ADJA 4D8OA 1LK2A 2EC8A 2VSMB 3FN3A 1XH3A 3DKHA 2PYEB 4X4ME 5DI8B 2IGLA 1FH5L 5KYWB 5C3TA 3MNWA 5ANME 4X99B 1NOFA 4CBZA 5KSVB 3VRJA 5DJCA 5EN2B 4M93B 2DM4A 2BSSA 4BFNA 4DEPB 4XMKH 4NPYB 5ILTL 4AE0A 5BZZA 5H4ZA 1HOCB 3L54A 3TWYA 4PLJC 1EVTC 4N5ED 4C4KT 2WXRA 3I84A 2A38A 1FL6B 3N50A 4K23H 35C8L 1WHPA 3E7JA 4D8PB 4MA3B 2BH0A 1CGYA 5TE4L 2JIXA 2ADGA 1LO3L 3JV4B 4N1EA 3KWTA 3WL9B 5HHQA 1OWRM 1JPFB 1JG9A 3HS9A 1IM9A 4PRAA 4XPTL 2FIKB 1TOXA 2R27A 3JV0A 3AUVA 4P07A 4GS7B 2VDRL 4TQEH 2QGBA 5TGBA 3FQ4A 2X4SB 2Q6WB 1B2WL 4B53A 5E1AB 2D3JA 4CKQA 5I28A 1HI6B 3D69B 4V1DE 1JE6A 4I1NB 2O6FA 1BYOA 1KTKE 2J2ZA 5IJVA 1I8IA 4X80L 5IK3A 1DJWA 2BP3A 1W6LA 3BZEA 1G7QA 4JFEB 1IFGA 2FTAA 1TO4A 2WTRB 5IQ7L 4ODSL 1TZOA 2Q86A 3O9WC 2J43A 4MLSA 4XPHH 5C08B 2F19L 2J6EH 3MFGB 1TITA 3OB0K 4JO3H 2WBWB 4U0RB 1GSKA 3MROA 1NWOA 4I89A 3HR5B 4GRWH 1ONQA 3O3BB 3QO0B 1UWFA 1MHCA 4OJEH 3ZDZB 1U8QB 2FEJA 3QAQA 5GGVY 1A9BA 4RAUB 2AJVH 2UZIH 5D1ZA 1S78D 4ZSOA 4JFED 2EKJA 3VFUB 3RA7L 1O7DC 4JR9H 2AV1A 3CZEA 1GGBH 4GYBA 2XV6B 2NSMA 2TAAA 3QPKA 3ZE1F 3US0A 2MPAL 2L7EA 4X6DF 4NPKA 2DRUA 2FH8A 2YO3A 3AM8A 3MKKA 4GBXB 2XTLA 3WNLA 5DMGC 1ZKAA 1SUHA 3EOBB 4NM4H 2VO8A 2XCMC 1JVOA 3WELA 1TENA 4NFCA 5DJ0B 3R1GL 4YBLC 4OLZL 3U1PA 3MBEA 1LGVA 1OCOB 4NZUH 2VQ4A 1RLWA 1TYJA 2WIIB 2YBGA 1VAHA 3JUYA 3KR3H 4UIMA 3SQBB 3LKQA 4W9IC 4TUKL 4LCCC 1XGQA 4PJ8B 3PWVA 5DTFA 4GMTH 1RHHA 1YEFH 3FK3A 4NQVA 4XCFH 1FFOB 4KHTL 4ZO7A 4H1LH 5C0AB 5CEZE 4AVIA 2BNQB 3ZZSA 2RFXB 4ATWA 1YY9D 4NWUH 4E36A 1A65A 1ML0A 3MGTB 4AYFA 3NJGA 2J6WA 3IMVA 2KLTA 4RMRA 2EIKB 2EO9A 3SOBL 1A7NL 1AJ7H 1P6WA 2MH4A 5FUCE 2C4FT 1NAKL 4S0SD 2PN5A 1PD1A 3RB5A 4Q9QH 3HS0B 1P1ZA 2FB4H 4WFHE 1ICTA 4XN4A 2KDYA 4XHJC 1KCLA 4FG6C 5T5FA 4O00A 2I7SA 2YD7A 3HI1A 2LFEA 5EUOA 5DK0B 1WBXB 3GXTA 5IHZB 1VDGA 1GGCH 3NYKA 3OR7A 5ISZD 5A2CA 5EZPA 1JXGA 3D25A 4MJHA 1WEJH 4LOUD 5GRVK 5BZWB 1BWMA 5GGSA 2HT2D 1B4LA 3ZKSD 2X70A 1W8OA 5DO2C 3G5XA 3NK4A 3VG0H 5EDSA 1P4IH 3CFUA 4PJ9D 4YPJA 4FERA 4AL8C 1X9UA 3MOBH 4P5RA 5CF3A 1JDCA 1P84J 3K0YA 3FBKA 2F54D 3MRBB 2XXGA 3SBWA 1RY7B 3IPEA 3V0HA 2PCPA 5D1QE 1GZPA 3ZLQC 1L5GA 1VGKB 2WLLB 5KUKA 1IKOP 4LHUA 3MRJA 4OCYL 4X6CF 3T5WA 1P5UA 4BZ1A 3P3SA 3QUYB 3ZE0B 2MNJB 2OQJB 4WFEE 3VXMD 2VL5B 5F71A 5E2WL 3TBTB 3IFNL 4NQEE 3CVHA 4AM0B 4P57B 5CFAA 1FO0L 1DANT 1AZBA 1KLFB 3BOVA 4KY1L 4NC0B 1IBGH 3RKDC 4WF7A 3G5YB 1R4XA 1LP9E 2JKNA 3C5ZD 4R84A 4XNZC 4AIOA 4P4KA 5DD1L 2DLFL 3LIZA 3FU7A 2B16A 3ARBA 5HHOD 3M1CA 2OTPA 5IFJA 1KULA 5T1LA 5CN3A 2DBJA 1TZHA 4AV5A 3WO3B 1D5IL 1EJFA 4GRLA 3NACL 4I0PA 4L2YA 1UT2A 1LEKA 3LPGA 4PG2C 3ABGA 4F8NA 2W0FA 4C56B 1CD1A 4Y4FD 1FWXA 1JXFA 3KEDA 1D5XA 3U1SL 3D5OF 5DK3A 2W91A 4Q6KA 4M1CD 5F0PB 4P46A 5C86A 5JHDD 4OCSH 1FA4A 1XH1A 3DWTA 1SDDA 4XCNA 3GI8H 4R4FL 1D6EB 5E9NA 3ZK0A 1W8NA 3L4VA 3VXSD 1Q90A 3PWNA 3KCPA 3WKPA 1TQVA 3MOAH 4KO6A 1KGIA 1SM3L 3QIWA 2UVFA 5IHBA 4MJ6B 1T1XA 5DYFA 5BV7C 1CJYA 1CYXA 1PEWA 3LKRA 4OZ4A 3VXQB 2D7MA 4K3HA 1K8DA 4P04A 1AH1A 3PUUA 1D6VH 1YYLL 4J6IA 4XP4H 3IFOB 4HIHA 5EIIG 2XTJB 1WAAA 4MD0B 2PXYB 2DL2A 3QUZB 2NOYA 1ZT1A 3HFMH 3IJHB 3QI9C 3ABKB 4X4YA 1M56B 1KIRA 2ZOUA 3KXFB 3MODH 4Q2ZB 4IGBB 5IJKA 1SVCP 2DEWX 4N0CD 1WCQA 3L5XL 3QDMD 4I85A 1J05B 1V7ML 5TK2A 5DQJB 5HPMB 1UM4H 2OMXB 5CR8A 3RVWC 3KDMA 1EEYA 3D2UD 5E51A 4XMLH 4QRSA 4GQZA 4AYMC 4ZNCD 2W65B 3GMLB 2AZUA 1W72L 3DIFB 5HY9A 7PCYA 4AMKH 5FYJL 5I76B 3NPSC 4CC0A 3T4YB 3LHAA 4LOEA 3ZRSA 4AIXA 2J1KA 1BZEA 2UX6A 4YLQT 3FS9A 4P2CG 4U6TA 1OPOA 4X7FC 3G04A 1S9XB 2X4RB 5T3ZL 1YVLA 4P3DB 4F8OA 4JRXD 5F44A 5DJ2A 1NWPA 1MLBA 1WC7A 3O2WL 4JEGB 4Z0XB 5LVEA 2BPBA 4H13C 2APTA 4QRPE 2PCFA 3P0GB 3TYFA 2VDPH 1NCUA 2WBJB 1ZTXL 4ZX3A 4KX8A 1IL1A 1RZFL 2DQFA 1JD9A 3RVTC 3X17A 5I0YA 2CXGA 4RGMB 4WJKB 4K2UL 3AWFA 3C9NB 1U3HB 3TNMB 2VIRA 1HNFA 4G6FD 3BAIA 3ZE1B 5HPOA 2P9RA 2N59A 2RTTA 1SYSB 1WA1X 4I3SL 4X6DB 5EEXA 2BVPB 3HHRB 1TCMA 1HZKA 2WUBH 3C60B 3VXTB 3QNFA 5A2BA 2NDGA 2WD0A 2DLIA 2Y7QA 2KDGA 5BXFB 2VLLB 3RL1B 3UDWC 2LTQC 1JXJA 3O9WA 1P2CB 4ZFOL 3K91A 1XZ0A 4MKMA 1MW1A 1FDLH 3KWWB 4UOQA 4AEIL 3QQDA 1XF4B 2VISA 3UC0H 5E8DH 3E9TA 1HIML 1JN6A 4DWHA 1WF5A 3D2TA 4N0FB 1O5PA 4OV5B 3U48A 1OGAB 4Y2LA 2DL9A 5TDOB 4M62L 4U7MA 1AXIB 4YWGL 5JDSA 3OKLA 3RNKA 5DS1A 3VD1A 3T2OA 2ZSVB 4HV8A 2KH2B 2LR4A 2W07A 5IV2A 5GS0L 1NLDL 4A1RA 2F7RA 3LEXA 3QHTC 3ULVL 2BXYA 3QYCA 1DVFC 2C7UA 3DPDA 3V5DA 4AVJA 1BSIA 1T1WB 4HDIB 4FTDA 3RVUD 1THCA 3H2WA 1MNUL 3MXVL 1PKQA 2FWLB 1N0LB 3WUWB 4MJIA 1IEBA 3FKUS 5F97E 3LAFA 4U6HB 3J8F7 2WO3B 3HLKA 4AQ1A 5I0XA 1V7NL 3L4UA 5IB3B 4P05A 2W38A 1U9KA 3UADA 3M8OL 4IBYA 3VD3A 1NANH 3F62A 3FO2B 4AW4A 2D0FA 5A7BA 3QA3B 4QHKI 1CZ8L 4G8IA 2D7TL 3FFCE 2ZJSL 4MFHA 4BEIA 2CIIA 4FHBD 1S7WA 3NZSA 2NY5C 4WWID 3L9YA 8FABB 3VYPA 2M83A 5KS9E 2XJKA 4XBEL 1N0XH 1YEKL 2H5UA 4BCYA 1T1ZA 2HH0L 1FBIH 1HHHA 3WHE0 2NY1B 1CFNB 4XNMA 2HVJB 4G8GB 3QDGD 4BFRA 3FB5A 4HIQA 5TE6H 5DVLA 3K6FA 3BJLA 1WFIA 3DXAA 3SKJH 3T4AB 4PRHE 2DMBA 2BVQA 4ELKB 1IGYB 3N9GH 2WLIA 4MNHB 4NN6C 4YHOL 3SYCA 1LEGB 3MA7A 1HQRB 5C6TH 3RGVC 1IQWH 1F45A 1HESA 4YZFE 5DSCB 4YC2C 1PD6A 4H2CA 3EFOA 5HVGB 3KM1A 4NOFA 1CICA 3GHEH 3BAWA 5PCYA 1AE6H 4PRBB 4MB3A 1JTOA 5CWSB 4EN3C 2K6ZA 5F9OL 2C34A 5BVJA 4UILH 1RD6A 3IJYA 3QZMA 4GI8A 2NXZC 3BPLB 5H94A 4NO3A 1FSKB 4XBMA 1OL0A 3KYOA 1O5DT 4IIQA 5J6HA 5EBGA 1BQLL 4NUGH 5C0DB 2AEWA 2EDEA 3FB7A 4IKJA 4W81A 2VR9A 2X4QB 4MX7B 1QSZA 3D9AL 3L2MA 3TA3C 1K4DB 3SCMD 4YHML 1SQMA 4ZNEE 3DMMB 4NRYB 1CDYA 2IG2L 4XWOD 4FFYA 3Q3GB 3NIGF 2EIDA 1X7QB 4ZUTB 4TUJB 3PRZA 4OI8A 1CR9L 1FC1A 3OR6B 4YXHH 1N7MH 5DMKB 4OFVA 3FSVA 2H8PA 2NY4D 1ZJBA 2QJDA 3L3IB 3VWKA 3ZGIA 4A7QA 3U9WA 2L3BA 2F53B 1FAIH 2ZUVA 4P5MA 3RUGA 4WZ9A 4MNQD 1A8JH 1AO7D 1YUHA 2OX5A 3OAUL 1MCKA 3VFOA 4GW1A 5KOMC 1CS6A 3WIAA 3L1OL 4Y2NA 3AMLA 3BQUB 4IRZA 3MLSH 4G43B 1BX2B 1AR1D 1XXDC 5LXGH 4WV1C 2QQNH 1AGCB 3H9HB 4XVUD 4NBYB 3FTZA 1A6PA 3EJSA 4ADGA 4U33A 4AGNA 5INDA 5AL8A 4OKVA 3BWUF 3KPOB 2PTVA 3IDGB 2HSIA 2F53D 4HF5H 1RJLA 3D4ZA 1EANA 1E43A 1XSOA 1N6QL 4HJGB 4LNVA 4HX1A 4LOFA 5HYJE 3BQUD 4ZAKD 2YAFA 1M1XB 3SOTA 5EOTA 2AVFA 2YK1H 2CDGA 3OGCB 4LPUA 2WN3A 5FO9A 5EEWA 1XL6A 4JRFA 1Z5LA 3HUJA 3BUYB 3WNNA 5I1CH 1YEGH 4JRYD 4O5LL 4PCYA 1ILUA 4PPTA 3WIHA 3OM3B 3QORD 2GBTA 1BFOA 4JFVA 5EU7E 1MCIA 3RZCB 3CX5K 4P5TB 5DFVC 4HCGA 5H37H 2ADJB 3V0DA 4I48A 5J9PA 2R1WB 2DPKA 3QIUC 4HIEA 5GXBB 1CLCA 2VRKA 3QI9A 5JIPA 3H4FA 1HCVA 4M6OH 2KT6A 3HHSA 5J3HC 4OBSA 1FYHB 1P7QB 4BSJA 1FORH 1XF5A 5E4IA 3T6VA 5MENA 3V10A 5I23A 1IGFH 2P8PA 3P9MB 1PLAA 4PS7A 4DCQA 3P4NA 3BIBX 3CSFA 4D2NA 1BD2A 5EA0L 3RZCD 1FLRL 2F1BA 2NXYD 3QRBA 1HKLL 5BNXD 1GYAA 5AKSA 4RQQA 1HQ4A 3O11A 1PZ2A 3UROR 3TVMC 3KYKH 2BERA 3T0AA 4EDXB 2OMVA 4GFXA 3QUXC 3S9DB 3DBXB 3MUZ1 2VM9A 2WTOA 4Z7NF 4NNYA 2WWNA 1WFOA 3VU1A 3GI9L 4PVLA 5LN4A 2EXTA 4HQQL 2RCSL 1GJUA 2XWTA 3P3RA 5HDBF 4GB9A 4H5SA 1XCQB 1UOWA 3QG6B 1FNAA 3KPMA 5JQ6L 4N8VB 4HW6A 5I17A 3VD0A 4XOEA 2GSMB 5CBEA 5I8CB 2RA1A 1T6BX 2ZKMX 4I2XE 2UUDH 5J11C 5A1AA 4WO4A 3NJVA 1W0YT 4XNUH 4BFEA 2P5EB 1SRDA 2BVOB 1VIWA 2YXVA 1NIFA 5CJBA 3DURB 2WXPA 4DVRL 2DM7A 1BM7A 4ZPTB 4JZJB 1GTNA 4ZODA 5CN2A 3G6JE 4LCYA 3MSPA 4LRNL 3QO1A 1GOFA 4B95C 2IANB 3FCTB 4GY4A 4KK5D 1TXKA 1YEHL 4OCWH 5F7AA 3V55A 4EQ3A 4FABH 3SJVB 2G30A 4J2XA 3K6SB 5HHVL 2D0GA 3TC9A 3QNYA 4CC1A 3IMWA 3JZ7A 4GXUM 3TBSB 4JHAH 4G6KL 3GXIA 3U7AA 3BUDA 2AXFA 2R2EB 3FSZA 1BZDA 1V55B 4YLBA 1MH5B 1ZWIB 3ZMNA 1H3WM 3BN9C 3ZO0A 4L5FH 5DHVA 1C1EH 5AB1A 7CGTA 4X5LA 2CLVA 3D05A 3BH8A 4UOJA 2CCVA 4YIQA 4D0BA 1QATA 2VW7A 3IMTA 5CHNB 1ZANL 1UADC 4PB0L 5HD8D 2PLTA 3BPNC 2R1YA 1SXNA 1GYVA 3KPLA 1AMYA 1DVFA 1S9WA 3B9AA 1FQ9C 4G9DB 5E5LA 3T0EB 3O6FC 2X6VA 5L2KD 2X9YA 3QFJA 1PFCA 2NNXA 4M48L 5DC2A 4P2YA 2WAQA 5E99H 2CKBB 1EJOH 2FH6A 4OGQC 1FVDB 5CJOL 2LFGA 1NKRA 4CJ1A 3ZDXE 4DGYH 4Z76B 2QR0B 3QHZH 1OARH 2Y06H 4JE0A 3LYRA 4DNLA 1F58H 5ESQA 1MCPH 4GSXA 2W1NA 1O6SA 4UF7C 4YBQD 2Y24A 3I02A 5F9AC 5D7JA 3FTGB 1DQQA 2CBOA 4YAQB 5KSBE 4HT1L 4KQ0A 4LHJB 5DVKA 5C0IB 1OAUH 4A2DA 1TZAA 1E8YA 1J7VR 1ZGLB 1BBDL 5J0BA 3V52H 4GG6F 3KS0J 3O3DA 4ECNA 1X5ZA 2LQRA 3FN9A 4HGWB 5E24E 4KRPD 1BVOA 4CBPA 5D7SH 3EDFA 3H9SA 3QFGA 1UCBH 4E5XG 2XN1A 4JQIL 4B9KC 1ZHLA 1KJ2B 4ZMLA 3O0RL 2IIJA 1IKNC 3LIUA 3MJGX 3ILEA 3V7AG 1OQXA 1JZ7A 1DBAH 1CVSC 2Z6FA 4LASH 5MERB 1S7UA 4L4VE 1FCCA 2WQXA 3ZUCA 5IB5B 3RGVA 5KANI 2DLHA 5GZOA 3FO1B 4E9VA 2EH7H 4EUPG 3NIGB 3BP6A 4JE4B 2EVGA 1DEEA 3CMOH 4GKZB 3MXWH 5E6IA 1UXLA 2Y6SD 4X5WA 4EN3A 3FUNA 1JGDB 4LEOA 2WYHA 2V17L 2ZKWA 1R5VA 4XGZB 1OTTD 1T7XA 4Y8DC 5D5MB 2R56L 3LS4L 3MV7D 3VXNB 3QHFL 2B9BA 4K07A 1AZNA 4LKCA 3OWRA 1JK9A 4JDVB 1U3JA 2AHIA 3QEQA 4BKTC 3KPRE 1YN7B 3DJZA 3K71A 1NKOA 4GXVH 1Q9WB 2R2HA 3MLXL 4YHLL 5D2LA 1AHWC 5L7XL 2FX8H 3WMPA 3JTSB 5AW7B 4Z77A 1GHFH 2DTMH 3F7RA 1B0GA 4M5YL 3HNVL 1Q4NX 4LLDB 2OV0A 3RDTB 4DW2L 3LXBA 2CIKB 4OCXH 4WI0B 4ZFZA 5DJ8B 5A2FA 3PJLA 4AKQA 4DP4X 4WW1A 5ICZA 4OLYL 4JKMA 2PO6B 3ARFB 3QZNA 1EDQA 2ZCLL 4P2QD 1EWHA 4FA6A 2ITEA 1UJ3B 3HG5A 1JNHB 4ZMAT 1A14L 4NN5C 1XF1A 5F7EL 5TQ0L 5E1GA 2ZXAA 4JZOB 1TJHH 3QUGA 3RDTD 2CJUL 2J8UF 4K3JL 4XR8C 3KDPB 4GRMA 4M7JL 3AREB 1IVLA 4DOHE 5CJ8A 1G7MB 3L3DA 4KKBD 3TTYA 3O45B 2CM5A 5JTWA 4LVNC 3O0LA 3NIDE 2J4WL 2MNWA 5ICYA 4K9EL 1AFVH 4JG0H 1NDGA 4OF8A 5JHMA 1RJYA 4Y5YC 3X11A 4DP8X 2BP0B 5DMYA 4FULA 3ES6A 4XP6L 4ZOCA 3S98A 3FZUC 4I88A 2E74C 3BVNB 1AZZC 1GS7A 4XMTA 4TL5A 2HAZA 4K7PL 5DT1L 1OK8A 5FCUH 4WSJA 4A2FA 3QEUB 2X09A 3L4WA 4QRQB 5IVXE 3V5HB 1QLFA 5F3BA 4OIAA 1KCSH 3LEYL 3DUUA 4EZKA 1T2QH 1KENL 2DQEH 2ED7A 3FQXB 3QJFA 1SDAB 3W38A 1H8OA 5LB1A 2EE9A 3KLHC 5CXPA 2OKMA 3W5NA 4QF1A 5I1AA 4Z7NB 4KKPA 1NIDA 5BS0A 4E9SA 5KVDE 3MZGB 4OD3L 5HDBB 4J3WA 3MRIA 3VQMA 1BQHA 4I9WE 2E6PA 5I26A 2IBBA 4Y5XC 3KLDA 1JZGA 3NH7L 4F5CE 3ROLA 2EEAA 1AGFA 2CGRH 3KNBB 3MREB 3WSQH 3AG3B 4KJYB 2BCMA 1NCCL 2AEPL 1QVOB 2XWJB 1D9KB 2YSTA 1M42A 2XZCH 4MAYC 5IR1B 5KN5B 4YFDB 4PGEB 1OCWH 3V6FA 4ORGB 5HHME 3F04A 2B3RA 4FQXC 4GSDH 4FL4C 1GR7A 2CO7B 2QV2A 3B9KB 1XGYH 3DJSA 3UTTA 5KEZA 2P44B 2J25A 2Z0UA 3DA0A 4W9HC 1NCWL 4NQDB 1K2DA 4GMSL 3RWJB 5JW4R 2JJVA 5T1JA 4JFFA 2A4EA 1BZ7B 5HYSG 3FQRB 2VDRB 2YEZB 4XWGH 4FOMA 1EA9C 1JD7A 5EU6B 3MLWH 1PLGH 5E8EA 1KB5L 2VXVL 4CW1B 1REIA 4PRIB 2MCPH 5AKVA 1PL3A 1MIML 1WZKA 2ODIA 2R4SH 3P1VA 1CDGA 2HJFA 3N1MC 4QOKA 3UZEA 1P1VA 5L2JA 2C9PA 2DQDL 4IK6A 1F6AA 2BP8A 1YNKH 1CXFA 4LEBA 5D7LD 3ZRFC 4KRMB 4RMWA 5B3NA 2EO7A 4L8BA 5HXMA 2R0ZH 4W9GC 4E5XA 3O3AB 2GSGB 2QTVA 3NA9L 1LO5B 3COOA 1RUQL 2EEBA 2FCBA 4MBRA 1PIGA 2X4TA 4EBQL 3PFUA 3IAGC 2CRYA 3F7VB 3TPUA 2VDLH 1ID5I 3EO9L 4LSQL 4MWFA 4R7NA 5DQDH 3NT0A 3JVFC 4MD5A 3VJ6A 4N0UE 3IJEB 1LHZA 2ZTBA 4FTVE 3SYOA 3T04D 3KPNB 4M4RA 2B20A 5FKAA 4RFOL 4YVUA 2Z92B 4QKXB 3DOSA 4KJQC 1OW0A 4X8JB 4E42B 1NOLA 4W4NA 1T5WB 1ZA3B 2YBRA 1INEH 4P2RA 2HJLB 4KQ4L 1QR1A 4GG6B 5GGTA 5IVZA 2QVTA 5DWPA 5AZ2H 2NX5B 1GIGH 1MRCL 3VFWB 4LU5H 3FU9A 4MQXD 1SLUA 1F90H 2VUOA 1PZ5A 1TLKA 2I60H 4FNUA 4N3UA 1BZ9A 3PREA 5EMYA 3ZYOA 4DH2A 2Q76A 4UOZA 4FQ1L 3ZTDC 4MSWB 4PWHA 2JKWA 2GW5A 2GUYA 3TCXA 3O6FA 4U1SB 4LCVA 3T6ZA 3LXUX 3TT3H 2EDQA 3QNZA 2H1PH 2I9LB 1BAFL 5ES4B 3ULVF 3M1BB 4LLQB 5JZ7D 1KPRA 1PTZA 1A1NB 2G5BA 3D18A 3HMWL 3QWRD 3EYUL 1XH2A 1QSEE 4N9GB 2BO0A 3U0WL 3VRIA 5KVMC 4RGNB 1XQ4A 4DQAA 2ADIB 2VB5A 3KLQA 3QQXA 4ZTOH 3RWIB 3GJFB 3IF1B 2VLRE 3RL2A 2AANA 3S5LG 1QSFD 4IS6B 4X6FB 2FZ3B 3DSNB 5HHPB 3EBIA 2GHZA 1NBCA 5EF2A 4HBCL 1TCRA 3TL5A 3VMNA 3G5VB 3IDJB 1ZHBA 3LHPH 3WIIH 3HB3D 1C08A 3ATEA 2AABL 3L1FA 3E3QE 1EXUA 1E3ZA 1EQWA 3JV6A 3TT1L 2R7EB 3DHJA 1E2WA 1YY8A 2G4EA 1U93B 1DEDA 4R6UA 4L0YA 1IKNA 3F3HA 1OM3L 3SDAB 3ORJA 4HS3A 3BO8B 4A66A 2R0KH 3QXWA 4DPBX 4QRBA 5CMAB 3GXMA 3F7QA 4HEMA 3EJYC 4EXKA 2JF1A 3B8YA 3N06B 5TD4A 5EO0A 1R19A 3MRKB 3MV8E 5C9KA 1M7DB 2QSVA 4OF5A 4AYBA 3HAEA 4KUZH 1RU9L 4Z5RA 2Y0SA 2OPCA 4ZW8A 1MXGA 2A9NH 4L4TB 2VERN 5BUPA 2R29A 3TYGL 4YSEA 4P9HH 4HWZA 2AMUA 2XY1A 2JJTC 3GHBH 5IKCA 5GSRA 4Q89A 5T1MB 3T6QC 3K5RA 1I9RH 4YHPA 2UXGA 4LVOC 3CFEB 4L8SA 3KJ4B 4N5EC 4ABWA 3ZVVA 4EIUA 3FU8A 2NYZA 2ZG3A 3MCLH 4XXDB 2IQAB 1K4CB 2J8UB 1AHWA 1TQUA 4AIEA 5AL0A 3OGOE 5J13C 1N64L 3B2DC 5DWUL 4OZIE 2NZIA 4RISL 5C0BA 2ENSA 1BMGA 4DQOH 1HEZB 2HRGA 4MMXB 2D03H 3VTMA 5FKPA 4P59H 2PTTA 3B8SA 3DHUA 3EJPA 3RPBA 4H4NA 3L4XA 4M61B 2K70A 4PG9B 4MD4A 3VSUA 5KVFH 1MFUA 4JFZH 5A6LA 1FZMB 1JFHA 4OLEA 4N24A 2K0RA 5EHFA 3PP3K 1BFVL 1FVEA 1JRHL 3AS3A 2NY6D 4H44C 4L9LA 2WVVB 2X1OA 4JB9L 5HGDB 3QJVB 2AVGA 1TZGH 1KJ3L 4PGDB 3VGAC 1CBJA 1AZRA 3P3YA 3FMGH 4PJAE 4PY7A 4FLSA 1YEEL 5AKRA 3EGXB 5DUPL 5GS3A 1XCWA 4JFHE 5C7XL 2YIHA 2CK0H 4J1UB 2BM3A 4A6YA 2QV4A 4Y2DA 5E8PA 3L4TA 5IG7A 1DBML 4KI5D 3TCLA 3HI5H 1RZJL 5K93A 1A0QH 4KOBA 4J5VA 2H32A 1WT5A 1S78C 2R4RL 3LQAL 1HN1A 4G7VH 1KIPB 1UQSB 4TLUA 1S5HB 2EUVA 2K7QA 2YD4A 2YPLE 1IBFA 1KXVA 1KV3A 5A2AA 3EH2A 1N4XL 1ZV5A 1FH5H 1KDIA 4HIJB 2NLJB 1X5FA 2MFNA 3AXHA 3MJ6A 3V4PL 4XXCA 5CEXB 2AQ3A 1JK8A 4FNPA 1ZMYA 2XETA 1YPZE 3U46B 3WE6B 1ZLUK 4KZEL 5ILTH 1ERNA 2GY5A 5FO7A 2N1KA 2FT8A 1KC5L 3K80A 1AAJA 3IPFA 5JOFB 2ED6A 1GW0A 3X2QB 1W72B 4OSUL 5TE4H 1EV2E 4HIXL 4XPTH 3K81A 2OXHB 3UOAB 2YFOA 1HHIB 3UMTA 1M2VA 3OMZA 4G9FE 2Y6TE 1MF2H 3AS0A 3QUMB 4AK2A 2Q8AL 1B2WH 3RWFA 3IFLL 1P69B 2VCOA 3QSKB 4AV4A 4BBWA 3BVVA 5K5YA 1YY9C 4KMQA 1I1AA 4JKWA 2X7LA 2D31B 3KPQB 4F7MB 5TK4A 2RGSA 3MV9A 1CE1H 1BGXL 3N6YA 4X80H 3AXLB 2OMTA 3LS5L 4NUJB 4KITB 3EFFA 4R0LC 4FQXA 5IQ7H 1DQVA 5FYJD 2G2RA 4A7VA 4GKNB 3MX0A 1U8MA 1PX4A 4JL1A 1RAMA 1XCTA 3IKKA 5F70A 3SDCD 5IESL 2I5YH 2F19H 5D4JA 4OJYA 3FT2B 5IROD 3I6LE 4PJHF 2WXGA 3DX7A 3PU7A 4UB0L 4XE5B 4B3EA 4I9XA 5T3ZD 5SV4A 3NFPB 2A6IB 3DTDA 4HHAB 3JBG7 1RJZB 4TV3A 2O5XL 2AEIT 1KYOJ 4EI5D 3ESMA 4LFHG 4LOUC 3REVA 3U4BL 1TQSA 3LZPA 2HT2C 2RQ8A 3H8NA 2WXOA 3RA7H 4AMXA 1I1RA 3L5WB 3HS0C 3T8XB 3H85A 2X9WA 1ID2A 3ZTJG 4PJ9C 3H9ZA 4QHKJ 3RYMA 1A6AB 1KPUB 3L7EA 3VCLB 4ZFOB 4BELD 1QBBA 2VDQL 5CEZL 1FGVL 2BZ7A 1CD8A 4E41E 1AS8A 3G3LA 5F1NB 2CG9X 2JKRM 3R1GH 4CSPA 4V11A 3Q13A 4OLZH 5BQ7B 1R9FA 2OMNA 4HKJB 2BIHA 3T1FA 3Q8AA 1A3ZA 3NG5A 2GABA 4P2OD 4BFJA 3MJ7B 1EGJH 4LAJH 4D9QD 3T8VA 5FYKU 2VQ1A 2VRAA 4QT5A 3TBWA 1EAPB 5AAPA 4DGVL 4TUKH 1YDPB 2EQDA 2R23B 5C9JB 4G7YL 3SPCA 1MI5A 1I9EA 4KHTH 5F8RC 2E5EA 3BCFA 4PJDA 2FO8A 5K39B 4APQB 3C5ZC 3HA0A 1PMYA 3L2LA 2VM4A 3EHBD 4XNBA 3MYZA 2Z8WC 5EZLB 1SF5A 5D2NC 5FWRA 1S8DA 3L45A 3IDYC 3PGCB 4A68A 2NY7L 3M45A 1HNGA 2WKOF 4PJGE 3KYMA 2ATPB 3SOBH 3G6DL 1A7NH 4OD1L 2ZSWB 3SEPA 3DX8B 4UQ3B 5ADPH 4OD2A 5EZOH 5A2KH 1F3JA 1KV7A 4NZRL 4BFIA 1NAKH 3Q6FB 1RP8A 5L88H 4G6AD 3FQNB 2PCXA 5E8NA 4TOYL 3ZYZA 5GS0D 1U2YA 2ESVB 3ULVD 1J48A 3T6WA 2PUQT 4TQ8A 3PV6B 3PPSA 2WZ5A 1J9QA 1H5BB 4N2EA 4Y4FC 5I5JA 4GKSA 1WBZA 4QHPA 4DN4H 4L9DA 1Q9KB 4M1CC 2EDKA 4W1TA 2F2HA 3CBJB 2ATAA 5I66A 5IGXH 4WGKA 4DP1X 3QR0A 1IZKA 4CVZB 1M9WA 1NGZB 1TVHA 2VLMD 1CVRA 3D39D 4KAQH 3CDYA 4IOIB 4WUKL 2WOYA 1QP1A 5IIEA 1JGIA 5ICUA 1T6WA 3Q8CA 1SEBA 4OJFL 3OKEB 4FQQB 2HA1A 3UZQB 5HJ3A 4A2GA 1HJCA 2V8MA 3UACA 5I30L 4QHUA 4UT6H 1NAMB 3V0AC 2EDTA 2FSEA 2ZKXA 2J21A 3MRNA 2WY3B 4MCMA 3K2UL 4OCYH 5BMFL 3UAJD 3AWGA 4X9HA 4N87A 3TXAA 1CL7I 4JG1L 5E2WH 1NGWA 4PQXA 4JGUA 4X4XB 3RWGB 1FO0H 3WI9A 3MRMB 4FHKA 4KY1H 4NYLB 4N0CC 1NBZB 5FHBL 4AUUA 4HUUB 4X98B 3X13B 2APVA 3GSUB 3PWLB 3R19A 1UA6L 4UAOC 4WHCA 5E8OA 5DD1H 2DLFH 2XWEA 4QHLB 2IDFA 1CGTA 5KSAD 4KRLB 3GQFA 1KCVL 2ZP0T 4LSUL 4C58B 1UB5B 1YHPA 3H53A 4RSVA 3DSFL 4FLQA 4GNKB 4Z1PA 1B0WA 1U8IB 1FZKB 4NHUB 4WTWA 2M8XA 4ELMF 1D5IH 1X9LA 4Y16A 3RBGA 1RZ8A 5EBWA 1O9WA 2MPVA 1TTUA 2NYKA 1BLNB 2APSA 3NACH 1O0VA 3NJFA 3QDJB 1IAKA 5JNYB 3AW5A 3WDHA 1CXHA 1KJVB 1JYXA 5FO8B 2JQZA 3CLEL 4AITA 4LFHD 5LCVL 2X5PA 2ZONA 3C8HA 3I9PA 4BV1A 1PGRB 4S1RL 2YS4A 3W2DL 1AG0A 2PYEA 3SGEI 1MCQA 5DI8A 1UGKA 1BQKA 1Q0XL 4MKTA 5KYWA 1NICA 5CCKL 4OZFB 3EGSB 4KK9D 4XRCB 1HXYB 4X99A 5KSVA 1SM3H 5EN2A 1TQBB 2CK2A 3HE6D 1QFPA 2XFGB 4HPOL 4X4KA 3UXFA 2AK4D 5EUOE 2A73B 5IMKB 2J1YA 5CCHE 1OGPA 2XWBB 3AG2B 4NPYA 3L81A 3VD9A 1HOCA 4UOW1 4BKSC 4YDIL 1FL6A 3N1GC 1GGYA 4D8PA 4MA3A 1K8IB 3WL9A 3JV4A 2Q7AA 1ITCA 1JPFA 4KGLA 3QH3B 1JHKL 2FIKA 3BI9X 1UKTA 3S96B 3V9CA 1IMHC 3D0LB 1P6FA 4WTQA 5F96L 3V6BR 2EIEA 3W1ZA 1M9SA 2Q6WA 2X4SA 3DVNB 3K3QA 5FK9B 5E1AA 1H3GA 3L5XH 2G5RA 1HI6A 5JOPD 1V7MH 2RACA 3D69A 2OYPA 2IWGA 4WUUD 2ZG1A 1E6OL 2B4CL 2XWRA 4Z7UE 5AALA 4LB8A 1NM4A 3VMOA 1C7TA 1ZIBA 2PWDA 4JFEA 5CIPH 5FYJH 2WTRA 3W0WB 1Z5YD 5C0ND 4FQIL 2P7TB 1I7RB 5KJ7E 1G7IB 3TURA 1IGTB 2AF2A 5FA4B 2B1AL 2VC2L 5CSGA 5C08A 1UACL 1XIWB 4CA4A 3RX8A 3RVUC 5C07B 3S35L 1I8LC 1A7BA 4FFZH 5T3ZH 3HR5A 3BEWB 2CNZA 3RFZB 3IGAB 3O3BA 2CMRL 3QO0A 3T2LA 5DEGB 3O2WH 1U8QA 1E4XL 2CWRA 1GGUA 4JDEB 4RAUA 1SN2A 2RMNA 1GRWA 3ZXAC 1TLMA 4FHJA 4PJHB 3VFUA 4CU8A 3NK3A 1J8KA 5E6ZA 3N44F 3V4VL 1ZTXH 4F9PC 2BVYA 1VA9A 1RZFH 1NCAH 4G1MB 3D0AA 5DR5H 2O5YL 3VGGA 4I0KA 2MQ3A 4GBXA 4K2UH 2YEVB 3GPEA 4ZFQA 2Q7YA 3EOBA 2J57A 1E9PB 5FIEA 3CWGA 1NIAA 2KKQA 5DJ0A 1EPFA 4KWUA 1CGWA 4IJTA 2MKLC 4I3SH 4YHKL 1UZGA 3ARGD 1EEQA 3VXRB 2X38A 1BAGA 3WN5B 4FJ6A 1CTMA 3SQBA 2Y9RT 1T0NB 3FUEA 2ITCB 5FA3B 5EORL 4RRPG 1WZMA 4PJ8A 5J4MA 2FECL 1FFOA 5C0AA 3LRKA 2BNQA 4R8WH 4CMHB 4LVHC 2RFXA 2F8XC 4AEIH 1PZUB 2ZYIA 3MGTA 1R1CA 2AJXL 2E7LC 1MW3A 2X2IA 3H7LA 2R1XB 4U1GC 1WAAE 3T2PA 3HG1B 1KFAL 4ZQKB 4YWGH 2XZAL 4OQTL 4UNVA 3FF7A 4KU1A 5GS0H 1NLDH 1YEIL 3HS0A 3ULVH 1PCXA 1N68A 2C7FA 1BYNA 3OF6A 4UTAA 3AGVA 3HZMB 4EOWL 4R4BB 3MXVH 1RJCA 1WBXA 1U8KB 1NBQA 5IHZA 2DMCA 1U8CB 1MIEL 2CD0A 3E6HB 4M4PA 4N1CA 1MAJA 4NKIL 5D6CB 4F24A 3D87B 2WLMA 4S0HA 1A5FL 5BZWA 4TVSa 3VGDA 3SCMC 3D09A 4MMZC 1MCWW 1BF2A 3M8OH 3DLQR 2WLHA 2ATKB 1CZ8H 2EDOA 4K4KA 4XWOC 2ZJSH 1KEGH 3N43B 1OPGH 4ANXA 3TLRA 4HWBA 3BUTA 2CNYA 1FYTB 3ZKXC 1DQLL 2QEJA 2YD1A 1NANI 3FUMA 3HLAB 3MRBA 3O4OB 4XBEH 1IT9L 2HH0H 2NY4C 2WVUA 1FUNA 2DWTA 1OVZA 1VGKA 2WLLA 4OY9A 2XTSA 4YXKL 3UAAA 4KQ3H 5F3FA 4YHNB 3FT0A 4QGTA 4UQIM 5BRZD 2OQJA 1DLHB 4WNQB 4ANWA 2VL5A 3TBTA 4MHHI 4ZW7A 1UM5L 4AM0A 2EEFA 4P57A 1KLFA 2WXJA 4ZFGL 3CXDL 1AR1C 4TQHA 4PVBA 5I71B 4XVUC 3T08A 3G5YA 4YHOH 4BHUA 2VABB 1FYTD 1MWAH 4Y4FA 3RVXD 4DN3H 3KYNB 5C71A 3WTTA 3DX1A 2UV3A 1XL4A 4AH2B 2B08A 3QNXB 2NUPB 2PR9A 1HXKA 1CGSL 1O9VA 4ACPA 2HKHH 2ZYRA 4I18B 1P5VB 4NO5B 1J8HB 4M3KB 3BQUC 1I31A 3BJ91 5F9OH 4ZAKC 3ATDA 3KH3A 1AP2B 3KPSB 1VENA 4FLRA 5ACLA 2DI7A 3RGHA 3QJQB 2LGNA 4XI5D 4JRXE 4C56A 5L4MA 2E6QA 1BQLH 4BYHA 1OLZA 3PXHA 1Z3GL 2PW1B 3SSGA 1JZ6A 4ELMB 1M4KA 4ANUA 1XR9B 1Q1JL 4C4UA 1EO5A 3QORC 4MB4A 4Y4HD 1V3JA 4LO9A 1I8KB 1WWBX 4BHUI 3GUTB 1N5YH 3BHBB 3D9AH 3ZTJH 3BKML 1B9KA 5EEZA 1YECL 1JJUA 2C3GA 1D6EA 3DO3A 4YHMH 4ZX4A 5DRZB 3KPSD 3ME0B 4X7CC 2XUWA 1R47A 4OGYL 1IARB 4JGMA 4IBTA 4RX4A 4YSAA 2IG2H 3RHWK 4WFGD 4UZUA 4MA1C 4MJ6A 1MHHB 3QDMA 3CN3A 3VXQA 1PKQE 4PD4K 5HDWA 3ZSTA 1CR9H 3QULB 2C26A 3HE7B 1L9QA 5D96C 5C09B 4EKJA 1U6AL 4PMEA 3IFOA 2JE8A 3RZCC 1JZHA 4MNGB 2NXYC 4MD0A 3RTLA 2PXYA 2NT1A 3QUZA 3NEOA 3OAUH 3IJHA 4FNSA 1AKPA 4Z3GA 3V4UH 3HG3A 4Y89A 3KXFA 1EHAA 3MRHB 3ETSA 3FU6A 4IGBA 3EOYG 1AKJD 3NGBC 2EKSB 4ODVL 3BFQG 3D34A 1EUUA 1J05A 3LPWA 5DQJA 3GSWB 4DESA 1MCLA 1NC4B 3NTCL 2OMXA 2WTPA 5HPMA 3ZT6A 1IAIL 1G94A 2W65A 3GMLA 3DIFA 5E6SB 3DJRA 2ZWSA 1JFQL 3KWUA 3ZE2E 5I76A 5KW9H 2WO4A 3T4YA 4Z7QF 1N6QH 4GI9A 1JZDC 1ZAGA 5H37A 5BOPA 3B9DA 2YRPA 3ZDYE 5KOVC 4C4KO 1TEGA 4LOVA 1S9XA 2X4RA 4HOXA 4AK1A 5HP5A 5K9JL 2EJ1A 2X0UA 4P3DA 5ELIA 5AAMA 2D7QA 4WSKA 3IXAB 2YC1B 4EN2A 5DMJB 2VUKA 4Z0XA 1ODAA 2VSKB 4O5LH 4X6BB 4KK5C 1WA2X 3FT9A 4NC2B 4TS6A 2DIJA 4R5VA 5E08H 1F0LA 2WBJA 3U7WL 1DSWA 5ABZA 3QS2A 5CGMA 1Q0YL 2YHGA 5HI5D 3UPRB 2AQPA 4Q9BA 1OY3B 1D7BA 1NMAH 3M7FB 1AQDB 3ZUNC 4AVHA 1FI8C 2QFRA 3C9NA 1U3HA 1FL3B 2Z34A 5AYTA 3TNMA 1BECA 3F00A 2PP8A 5E2UL 3N44B 3I3DA 1BJMA 2IOIA 1FRGL 4WI6A 1NGYB 4KUCF 2O72A 1BXVA 1SYSA 4X6DA 3P54A 5EOCL 2BVPA 5EA0H 1MCRA 1XF3B 4MRBA 1FLRH 3NABL 5KVGE 3A6OA 3C60A 3PQYB 3VXTA 5I1GH 3CSYB 3OMIB 5HD8C 5BXFA 1ZLUH 2VLLA 2EDRA 1VJSA 3RL1A 1Z3RA 1P2CA 2ZOOA 2HB0A 3NCJL 3OTTA 3AG1B 2H6PB 3FUKA 3KWWA 1C16B 3VYOA 5EULV 1FZJB 1CGVA 5FB8B 3K2MC 1I8LA 1XF4A 3GI9H 1TIUA 3MTXA 4HQQH 3R7QA 3T0XA 2RCSH 3CZNA 4PFEA 1UA7A 4N0FA 4OV5A 1FH2A 3Q1SH 4G8EB 4L23A 1KUMA 1OGAA 5JQ6H 1DJGA 2CJ3A 5TDOA 1YQVL 3RUGE 4YBQC 3BP7B 3LDBB 2BSRB 2ZSVA 4AJ0A 3VQLA 2AAAA 1PCSA 3WFEL 3MYJB 4QMEA 5EIVA 1NCOA 4LCWE 4F3FB 2UXVA 1AY1H 1T1WA 4HDIA 2Z4QA 4DVRH 5BW7C 1IM3D 5J5EA 2PYFB 4KRPC 3SE8L 4MB5A 1B4TA 1N0LA 3RY5A 3WUWA 3BPCB 5JYMA 4LRNH 2WCSA 4U6HA 1YEWA 4N86A 1YEHH 4B9PA 1KB5B 3VFSB 3CFIC 5J6SA 3PL6D 5HHVH 5DUBB 1EERB 2LU5A 5IB3A 1J87A 1SHMA 3FO2A 5A3ID 5K9QG 1KXHA 3GSNL 2JI2A 1OTSD 1S7TB 3QA3A 3ZKND 1OV8A 2KS0A 3R18A 4U1MB 3ZT5A 4K5NA 3F7PC 2XWZA 3UBXG 4F37F 8FABA 3TS8A 3V2AR 3FULA 5L6YL 3EH3B 3S8FB 1OAKH 1YMME 1HJBC 2NPLX 4Z6AT 1GOGA 5CM1A 1CFNA 2NSQA 5J12B 2HVJA 1WFJA 3GFUA 3PNRB 4Y9BA 4XB3A 5D1XD 3VXPA 1ZANH 2IMMA 4HCIA 4NN7C 4GFTB 1YAZA 1KTCA 4YE0A 4PB0H 3IS0X 2K6WA 3F83A 4WKXA 1OTTC 1X4YA 3T4AA 1EHXA 4FQCL 1F2XK 1IGYA 4ELKA 4F58L 4F7KA 4MNHA 1RV6X 4JFQB 1LEGA 1HQRA 4X6CA 2VLKD 5MENE 1UH4A 3P9LB 5DSCA 1I53A 5CJOH 4AC2A 2JH2A 4O02L 1DVYA 4PWFA 3PWPB 1S9VB 2LV4A 3IDIB 4IOFD 5B39G 4BFKA 4UWQB 3BYYA 1WITA 5T8IA 4PRBA 5CWSA 2PETA 3T3ME 1DUYB 4HT1H 1JZ5A 4J3OG 4E2OA 4GP4B 4PW9A 4LF3B 5B8CB 1X5GA 4M3JA 1BBDH 2YZ8A 2XC8A 3S3CB 1KFGA 3OLGA 4HMEA 3QG7L 4Q97A 4O2EB 5C0DA 3PWUB 3PWPD 1WFNA 4LRIC 3N1PC 2X4QA 4MX7A 2KYIA 4JQIH 4HVBA 2BNRD 1K4DA 2BWDA 3F7KA 2FO4B 3O0RH