2B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (19 structures)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
molecule tags Electron transport
molecule keywords PROTEIN (PLASTOCYANIN)
total genus 13
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2b3iA00
2IWEA 4A2DA 1ZV2A 1OE1A 2I7OA 5EHFA 1M9WA 1CYWA 3FSWA 4G7SB 4YVUA 4AI7A 1FFTB 1PF3A 3UADA 1RZQA 4F7KA 2B08A 4M4RB 3WNJA 2AZAA 3C75A 1V54B 3X1GA 2I7SA 2DYRB 4Q8BA 2VM3A 4YSDA 4HAKA 2TSBA 4TXVB 3AG2B 3ERXA 4QKTA 1RCYA 4HCFA 1E30A 4A2EA 2AZUA 1JZFA 3PCYA 2FQGA 4DP8X 4YSTA 1NDTA 3EH3B 2XV2A 3JT2A 1X9RA 3X1FA 1HAWA 4E9TA 4YSSA 1NIFA 3ABMB 3NJFA 3GDCA 2IWKA 4YSUA 2FT6A 2HRHA 2MRYA 3AW5A 4HHGA 1F56A 2VW6A 2YAHA 3T9WA 2HX8A 3X1BA 1KBWA 2BO0A 3NJLA 1KCBA 2NRDA 3FU7A 4DP4X 1ID2A 1GY1A 1CC3A 1GY2A 2PPDA 3T6WA 3TA4D 1KBVA 2XXFA 5AZUA 4YSQA 5I5JA 5FC9A 3JTBA 2BHFA 4YVNA 3WKPA 5A7EA 4BDVB 1JXGA 3QPKA 3RYMA 1ETJA 2ZXWB 1SFDA 3T71A 1RZPA 5LDUA 3IEAA 7PCYA 1PCSA 2BZCA 1AIZA 4DPAX 4E9QA 4E9WA 4PCYA 4BXSV 2MTAA 3IE9A 4NB7A 3NSFA 1GYCA 3NSDA 1M56B 1BAWA 3ABLB 2CJ3A 1SJMA 4KNUA 3NP4A 2B3IA 1NIBA 1XB3A 2UXVA 2BW5A 2VMJA 3BQVA 3ZX1A 2GI0A 3DIVA 1BXAA 4DP7X 1AZBA 1HFUA 3SQRA 1BYPA 3NJHA 2FWLB 2FTAA 4YSAA 9PCYA 4FAAB 3D12B 3PAVA 3QJSB 3EHBB 3S8FB 3HEIB 3SBQA 4A2GA 4HALA 2UX7A 1EZLA 3TU6A 1R1CA 2DWSA 7PAZA 3S8GB 2XWZA 4FA7B 1YLBB 3PLYA 3OMAB 1BYOA 4X4KA 1UATA 1PLBA 1IBYA 3EF4A 4F2FA 5I6MA 4A2HA 1ASPA 1XB8A 3IN2A 3PAUA 2GB2A 3S3DB 2XX0A 3NSCA 3IN0A 3QJTB 2EIMB 1PNDA 1JVLA 3WKQA 2P80A 1E5ZA 3PAZA 1V55B 1CUOA 3NJKA 5F7BA 3NYKA 1OF0A 4KNTA 2XX1A 1RKRA 1DYZA 2BW4A 2CUAA 1OV8A 2IWFA 2XYBA 4WTQA 1SHWA 1PMYA 2J57A 1NTDA 1J9SA 2IAAC 3CG8A 3FSZA 4GXFA 2XXGA 2OCCB 6PCYA 1WAEA 2FQDA 1N68A 2BP8A 1DZ0A 3FYEB 2YAOA 3OMIB 1KCWA 3NSYA 3T6VA 2YAMA 1AOZA 2FNWA 2XV0A 2WO3B 4G7RB 4KO5A 4N8UA 3TASA 4ENZA 2HRGA 4HCIA 1ZIBA 4DP9X 1BQ5A 1WA2X 2FT8A 1SF5A 4QLWA 2X88A 5PAZA 2W8CA 3ZDWA 3QQXA 1OOWA 3DTUB 3MX0B 2RACA 2BP0B 3IBOA 3FQ1A 1AS7A 2EILB 4UF7C 1WS8A 2XLLA 2GSMB 3G5WA 4K9JA 1T5KA 1A65A 4UANA 3FSAA 2J56A 4G70B 3S3BB 3TBCA 4EF3A 5I6LA 3TBBA 1WA1X 5D4JA 1URIA 5B1AB 3UGEA 2JKWA 1AACA 4DPBX 2BWIA 8PAZA 2TSAA 1XMEB 3L45A 4L0PB 5I6KA 2JXMA 1E67A 2QT6A 3V9EA 1MDAA 1J5DA 4YSRA 4A66A 3FPXA 4JHVA 4MFHA 2WSDA 2N0MA 1ILUA 1JZIA 1JZHA 3U25A 2AFNA 2GBAA 1AS8A 4GYBA 2DWTA 4E9RA 3AG1B 1IKOP 2ZONA 3PXLA 4W9ZA 2ZWNA 1SNRA 5B1BB 3X1NA 2YAEA 4KNSA 4JHUA 3QJRB 3ABKB 3AG4B 2EIKB 2HZHA 1NICA 5I26A 1IBZA 2FJSA 1ET7A 2FT7A 2UX6A 1ASOA 5B1JA 1L9OA 1AQ8A 1QNIA 2YARA 2DV6A 2HX7A 3FT0A 1PZAA 1W6LA 3DKHA 1TKWA 4HHWA 5AKRA 5IY5B 2YXVA 3QJUB 1NINA 3H56A 2I85A 1L9TA 3HB3B 4DP0X 1AZCA 2PP9A 4KO9A 4N4YB 4RH4A 2PPAA 2GIMA 3CDZA 1J9RA 2XVBA 1V10A 2PLTA 2P80D 3NT0A 4JKNA 1AS6A 3T6ZA 2BWDA 3SBRA 2YAQA 2VN3A 1FA4A 3FYIB 1ZDSA 4KOCA 3ZBMA 2ZOOA 4HZ1A 1SFHA 1PLAA 4BWUA 2JFCA 2QDVA 2GC7C 4W1TA 1NIEA 2QPEB 2VW7A 4DPCX 4G7QB 2A3TA 3UACA 5I28A 3NJIA 4DP1X 3WIAA 2YQBA 1AZRA 1MZYA 2VSKB 1EHKB 1WS7A 1ET8A 2Q5BA 5D4IA 3X2QB 2DY2A 4YSEA 2H5UA 1NIAA 3GXUB 1ADWA 1A8ZA 2PPCA 1PZBA 3FQ2A 1OCCB 2J5WA 1GW0A 2UXFA 1A3ZA 1PY0A 1MG2C 2YAFA 2IDQA 2PCYA 2AANA 3NP3A 2PPFA 2YAPA 1QLEB 5I5IA 2Y69B 4DP2X 5TK2A 3UAEA 2X87A 3OM3B 3WI9A 2HX9A 4NERA 4BXVA 4AKPA 5I5MA 1OE3A 1AZUA 1TU2A 1N70A 1GR7A 1L9QA 4BWTA 2UXGA 4BWWA 1AZNA 4HIPA 1BQRA 4AZUA 1KYAA 2FQFA 4E9YA 2IH9A 4NAJA 2FQEA 1CYXA 3KW7A 2IDFA 1JVOA 4ZK8A 2VM4A 2CAKA 5B1JC 2Y1AA 4A2FA 1NPJA 4F2EA 2IDUA 4CSPA 2LLNA 4GP5B 1BQKA 4KO7A 3KW8A 1A4BA 3GYRA 5B7FA 3EH4B 5I6NA 4G72B 1X9UA 3AZUA 3EH5B 4P5RA 1JXFA 3NJMA 2QDWA 4P5SA 3T6XA 3ASOB 2PPEA 3FS9A 1IC0A 3FPYA 4AKOA 1GS8A 4A68A 1ET5A 1IUZA 1KV7A 3FQYA 3FU8A 3V9CA 5TK4A 1GSKA 1AAJA 2BZ7A 5ANHA 3AY2A 1WA0X 2E86A 1NZRA 5D4HA 3QJQB 5B7MA 3H4HA 4M3HA 3QJVB 1JOIA 4GY4A 2YXWA 2EINB 2HXAA 4KO6A 1PNCA 3UABA 4DP5X 3PPSA 4GP4B 1I53A 3CVBA 3NJJA 5B3SB 3ABGA 1J9QA 4G71B 2IDSA 5PCYA 2GHZA 1OCZB 1A4CA 5AFAA 1ILSA 1SDDA 1TEGA 2OV0A 4YSOA 5I6PA 1KDIA 3ZIYA 1SDDB 1ASQA 2BP0A 2PP8A 2CBPA 1L9RA 1VLXA 3CZUB 3CVDA 3SBPA 2VW4A 3CVCA 1MG3C 3WNIA 1AANA 4WKXA 2OJ1A 2GC4C 5F7AA 4Q89A 1JERA 2IH8A 1MZZA 1KGYE 2WO2B 4CSZA 3NJGA 5I6OA 2J55A 4AX3A 1NWOA 1PAZA 2BP8B 1SF3A 4E9SA 3WG7B 3FU9A 1E65A 2W88A 2XUWA 1SHXA 2AVFA 4E9XA 1NPNA 1NIDA 3X1EA 2QPDB 1JZJA 3S3CB 2XU9A 3FU7B 1AG0A 1ZIAA 4YSCA 3H4FA 3CDZB 3MBWB 2CCWA 1W8EA 3N2JA 3OMNB 4UAHA 1W6WA 4GP8B 2H47C 2R7EA 1B3IA 4YSPA 3FSVA 4DP6X 2DYSB 2R7EB 1BEXA 1L9PA 4HCGA 1OCOB 2HLEB 1E5YA 1FWXA 5B1KA 1PZCA 6PAZA 1BXUA 4AKQA 4KOBA 2XV3A 3BVDB 2PCFA 1ZDQA 2Q9OA 1NWPA 4YL4A 1AG6A 1JZGA 3NJNA 2H3XC 3OD3A 2UXTA 4BDVA 1QHQA 1JXDA 1OCRB 1J9TA 2PP7A 3ASNB 1M57B 1L9SA 3OQRA 5E9NA 2VSMB 1HAUA 3N55A 1ZPUA 1TEFA 5B7EA 1J5CA 4PAZA 2EIJB 3UAAA 1KDJA 4E9VA 4BK5C 1GS6X 1A4AA 1XB6A 3AG3B 4A67A 1PLCA 2IDTA 1BXVA 1JZEA 1CURA 2CALA 1OE2A 1GS7A 1AR1B
chains in the Genus database with same CATH superfamily
3QDJE 2WXNA 1DQJB 3GKZA 5F7DA 4I1RA 4KAQL 4R2GC 1KGCD 4G6AC 3H85A 2CRIA 4NQDA 1OB0A 3HCVA 4LU5L 4PJHA 4FFVD 1KTBA 1F1GA 1SBSL 2DLGA 4F7KA 2CO7A 2VAAB 4LLQB 1WBZA 2KHAA 2VDPB 1Z3GH 3EBGA 3KJ4B 4XX1E 2EVIA 4W93A 3IGFA 3QS3A 3S0PA 5CFHA 2KMWA 4X5PA 5I66A 4JFTA 5JDJA 3VDAA 4ORGA 2Y5TB 3L3OC 1ETB1 2BVEA 5D5MA 1UXSB 5I5RA 5JNYB 4IBZA 3ERXA 3BAKA 1I7TB 3CAFA 3EXJA 1T83A 1D5ZB 4IBVA 2OM5A 5HPOA 3RBGA 3ECBA 4FI7A 1VDGA 4J23A 2FBJL 2K4WA 3EYOB 4XAKE 1M2VB 5IBLC 5CHNA 1Z9MA 5HHOA 3T4YB 5BS0D 1SXZA 2JKSA 4UDTA 3RWFA 1NIFA 2YD3A 4G9FD 1JVKA 1XFPA 3T04D 5CGYC 4GSUA 3T0EC 2QR0A 3LXBA 4Z7VB 5F6IB 1A7PH 1LMIA 2HX8A 2Q20A 2AEQH 4QRTB 5E99L 4ZXBD 5DVLA 3AREB 5I18L 4WWKB 3JWDH 4XN7A 3LPOA 1FN4B 1UEMA 1ZANL 4A2MA 4MQSB 1CFTB 4Z3TA 1S5IL 2APBA 1TQWA 3BWAB 3TIEA 1V27A 1P4BH 3JTBA 4Y2DA 3U1SL 1TO4A 4FLHA 3K71B 3QNFA 3LNHA 4QOKD 2HKFL 1JXGA 4P23A 4PI0A 1ETJA 1QR1A 4OUUB 2BZCA 1DDHA 4XXWA 2IG2L 3MREB 5DHDA 2HLFC 1B0GA 5DO2C 1TO5A 5C0ND 1OW0C 4ZFOL 1ZLSH 2DIJA 4S10A 4JDEB 4OLYL 4XVTH 1PX8A 3DTXA 4MCMA 1UQSB 4QHUA 4Y4FA 5I16B 1T5WB 1N10A 3CHRA 4OLWL 4RGMB 3FO2A 3QUXD 5ACLA 2BINA 1BECA 1ZHBA 2AQ1A 3ARXA 1JGLH 4M43H 2LTQB 4NNPL 4TN9A 4XNXH 1QRNA 4A1RA 3HMXA 4YZFF 4BA8A 2EH8L 2BOBA 2R9HC 3RVVC 5JPMA 4NKIH 4KQ4H 3S8FB 1KIRA 2DQGH 2O6DA 4FFZA 2YJLA 3I50H 3ZT5A 1CF8L 2G3ZA 4L8SC 5JA9A 1WITA 2UX7A 1OGPA 1UH3A 2GTZB 1QUNB 4HALA 2CUMA 4KXBA 2ZCKH 4XCYB 4H7VA 5AYQA 1A6TA 1T20A 4CVWA 1A6PA 4ENED 1E28B 5EDSA 4QD2E 3DJSA 4Y5VA 3LZPA 3RQ3A 2ADIA 3PJLA 2E76C 2LLLA 3IJ7A 2X44D 3HG4A 4N8VB 5D7JA 2ZG2A 1G84A 4GAGH 1UCTA 3GSVB 4WW2F 3ARYA 2ZJSH 4WHYH 1LNUA 5DUJA 3KWWB 3NZ8B 5K1NA 4QWWC 2I26N 3NZUA 3DOSA 4WSJA 2GJZA 5IUSA 1NM4A 1Q4NX 3LSOB 4P3DA 3LKPA 4FZEL 3BH8B 4HWBH 5GS1C 1RURL 2YGOA 4NO5B 1G9NH 4XPAH 5CZVH 1V3MA 3IRZA 1KCSL 2QQQA 2XI9A 2X4RA 4KI5C 2JIXD 1S7UB 3GLEA 4IMLB 4M1GH 3QRFM 1BLNB 3WUWB 2MNWA 2WVUA 3D50A 3FSZA 1CWVA 1C16B 3D5OF 6PCYA 4HSCX 3NCJH 3QUYB 4I3RH 5AVRB 1Z5YD 3W0WE 5KBKA 3OMIB 1I1AA 3GZOA 3TYGH 3FQXA 3TASA 3MRRB 2DQUH 2OA9A 6CGTA 2Y1VA 3ZE0B 2H0EA 3QJHA 3OPUA 3MX0A 3WDHA 3NIGF 3QDME 4IGBC 2BX5A 1CICB 2YC1B 5FGSA 1NGXA 1XSOA 4LK4A 5E9DB 3HC4L 1KXHA 3O6LL 5EN3A 1T22A 2ZXQA 4PJ7E 4V11A 3U4BL 4IDJH 1LO3L 4AYEC 2QPSA 3LD8B 3V7AE 4TNWF 2X4SB 3D39B 3IGAA 3QYNA 3FRPB 1QFPA 1PKQB 3M88A 3CHXA 1NEZB 4GG6B 4XT1C 1XF4A 1XCXA 2DL9A 1J5OH 4LPTA 5CNHA 4M7KH 5CR8A 3QO0B 4X8XA 4Q4EA 3O9WD 3LOWA 5GGRA 1IFGA 4G8GD 4BZ1H 4YUEL 1BPVA 5CILH 4M5SA 3D30A 5JQ6L 3L6FA 4Q56A 1MHHA 3L9RA 4HIJB 3SPVB 1VZIA 3KR3L 1ZOXA 4NZRL 4D8PA 2QV4A 5ESAB 3CZLA 2CA4A 2LVCA 1J1OH 3O45B 4HKZB 3TJEL 3MUHL 5LCVH 4OFDA 3B8SA 3CU7A 3KLSA 1YEFL 1YEHH 4JPVL 2WMPB 5KZCD 1DUZB 4PRHA 3HNVH 5GS0L 1WFUA 3F6JA 4NQSA 1AQ8A 4OGYL 4KKAD 2HX7A 4PJCE 4DGUA 3GMLB 2OR7A 4NM4L 4K5LA 2YXVA 3FRUA 4BSVA 5HDQL 2XG5B 3MLPA 2YPLB 2N1KA 4KO9A 3WNPA 1VPOL 1IM9D 3JWOL 5DMJB 2UZPA 5J6GA 1AY1L 3PGCA 3D33A 3BUDA 2JKJA 2BNRA 4LEBA 2P1YA 5EUKB 2P8PA 4RISH 2YRBA 1I8IA 2Q8BH 5K5YA 4ZFZA 2OZ4A 1M3IA 1ZT4B 4S1RL 2ERJC 3VQLA 1FPTH 3TO4A 1FZJA 1D5XB 3O6ML 4F8LA 3MCKB 3HS9A 2VW7A 1W72B 4U1SB 4HK3J 1WAAF 2WP3O 1KWKA 5HVGB 4G7QB 3TF7C 4EVNA 4ZMAT 2P5EB 4HX1A 1JBJA 5B8CA 2JCWA 4H26B 2YQBA 1NCUA 4EKXA 2ZUWA 1A6UH 3FU3A 5DC4B 1QSEE 4E9LA 3RAJH 2DLHA 2DY2A 4HJ0C 5HYJE 2Q3XA 5E4EB 4JPWL 3HVNA 2AQ2A 2H8PA 2UWEF 1NBCA 5I1DB 1ZLVK 1A25A 3OZKA 5BV7C 4KXZI 1QR4A 2C1OA 4JFQB 1PY0A 2YAFA 3ARBD 4G8GA 4ZDHB 2APSA 1I1YA 4NFBA 3NP3A 3ZYIA 5I1AB 1ZCRA 4R2GD 1QLEB 2VDLL 4DP2X 1QLFA 2BVQB 1BEYL 1Q90A 3EGDA 4YE0A 1IJNA 2IADA 4KRMB 3W0WB 3A4EA 3LIZH 4XBGB 2AJ3A 4K55A 4Y5VC 1V8HA 4DO6A 1D5BA 2X4OB 4MS8D 4PREA 2FECI 3QB7C 3WS3A 3VCLA 5DO8A 2BRQA 2DKMA 1NKGA 4H8WL 4IRJB 5DMYA 4XH2B 4P2CG 3GSUB 2NMSA 3MBEB 3VUAA 3V5DA 2YMOA 3BWUF 2N7AA 5FYLE 3DSNB 1FYTE 1CZ8H 4HHAB 1V7NL 3ZTCC 2VN4A 3HB3C 4IU3A 2BSRB 2OS7A 4P5KA 1E4XH 3JVFC 1NEUA 3C9NB 4LIQH 3N50A 3TPKA 1N3NA 3G5YB 4WWOA 5C07A 3GMQB 2MCPL 5HYSB 1BZOA 5E2JA 1DSWA 3MACL 3MBXL 4TQPA 4HUKB 3AB0B 4XPFH 4PRDB 2WWNA 4DFHA 4M48L 3MLXL 4CADB 1J88A 3IFPA 1MW1A 2R0WL 3P4MB 1NZRA 4N2OA 4NUGH 4CSSA 4JG0H 1PD1A 4KXDA 4OZ4A 2ZXCA 4GY4A 5FA3B 1TETL 4P2QD 3W39B 2Z7UA 2OZNA 1FYTD 3PHSA 1BQLL 1KEGL 4XCEB 2APWA 2EC9U 3NJJA 4IGBD 3MV7D 5E6ID 3LRHA 4O58L 4GSDL 2WPGA 4L18A 3OAUL 4LLAA 4FQPA 5AFAA 1ILSA 3S7GA 1CLZH 2BVYA 4YGAB 4GRWE 4LCUA 3SKOA 2HKHH 4H1LG 5E1AB 5KS9F 2ARJB 4GS7B 3ZHFA 3V4VA 3S4SA 5L2KD 1QBML 3WXWL 3KPRA 5FM5M 3Q1SH 3CX5K 2AAAA 4RWYH 3WEOA 2DAVA 4GUQA 4QMEA 2HWZH 1DJSA 4O02B 2OCFD 3EDEA 3PWPD 4PBXA 3MV01 3D3VA 4Y9FA 3SPIA 2WYIA 1OPOA 4Z95H 4AITA 5KSAC 2J88L 4LASH 4GG8A 2ZX5A 4HD5A 4LLUB 2Z1KA 4XE5B 3PWNA 2J20A 3WKML 1VGKA 2GAZA 3HPJB 1I7TA 1WCQA 3KD4A 4LO9A 2N3JA 4N2CA 4N0YH 1UA7A 2OMYA 4X6FA 3AAZB 1EZUA 5D72H 2KKQA 5I1HH 3ZRSA 1RQ5A 1A7QH 2YLKA 2C9RA 2J1YA 2O6PA 4ZBJA 1QFUL 3MRMA 4AEHH 1U6AH 3A4FA 4UAHA 2YFOA 1DBBL 5HSFA 4X4YB 3CSFA 4XP6H 3DYMA 5DDHB 1XBDA 3QHZL 2UUDH 3RTQA 2OMWB 2UWEA 5FHAL 3LNIA 4P04A 1YY9C 4NO5A 1X3DA 5CD3B 1NMCC 4W68A 3LZFH 1IKNC 3HZMA 2H2PD 3DV4B 5HGDB 4KFMA 3ZR6A 3O3BA 1KIUA 2AK1H 4AVIA 1UD5A 2P44B 4HXAH 1RZJL 4N2MA 5BRQA 3TFKD 1P4LA 4EMZA 1CTMA 1AP2B 3WKYA 4OF6A 4Z77B 1FAIL 1JXDA 5F3FA 5FCSH 4HUXA 4J6IA 5E9NA 2OPCA 4JFFA 1ZPUA 3O4OC 2EEAA 4LSVH 4M02A 4U7MA 2ARWA 1TVBA 3O3AA 3KWUA 3L5JA 4I13B 4MJHA 2Y06H 4H8WC 1JF5A 4F5CA 4XCYA 1R3JB 1T3FA 1LE5B 4O4YH 1JZEA 3A6OA 3B7YA 4XVSL 1JRHH 4OFVA 2GABA 4KPHL 4NPYA 4A2DA 4Z7VA 1JPSH 2Y2WA 1IE4A 2B39A 3TESA 4OM1H 4OSUL 4QXTA 2XQYA 2Z35B 4EI5D 4AIXA 4DGIL 5ALCL 1SEQL 4CVZA 3U0WH 5BZWB 4U6HB 2HMID 3S6CA 5AKVA 2Y07L 3RDTA 3OKOB 3X1GA 2IALA 3ZGIA 5JQIB 4OGXH 2VE6A 2IANB 4FQCH 5HHXH 3LDBB 4TXVB 2V37A 4KXZH 3AG2B 3CVIH 3KWVA 1SVZA 4G2AA 3UYOD 2H1XA 3LIUA 5CCJA 1U8HA 3VMOA 1KJVB 3S34H 1C08A 2A6JB 2ZIDA 2Y7MA 5IFAL 2CLRB 4DWHA 1VFAA 4F20A 4Y4KC 1E4KA 1EBAA 2O93L 3DRQB 3UZVA 3VD1A 4ABQA 5J57B 4ZPTA 3VFVB 1KG0B 3LNGA 5B39G 3ZE2B 2DTML 3ABMB 4I0PC 1YN7A 2FT6A 1BF5A 5AW1B 3B2MA 5T1LA 2F1AA 4PWEA 5BJTA 4WAFA 1LQSR 5FYJD 3V5KB 1VENA 2I69A 1WIPA 3ELAT 2LABA 4MA8H 1FNLA 3BOVA 3BGFB 2NXYB 2AAVA 3RKPA 5EBMA 3UTOA 2ZOLB 3ULUD 1ESOA 2HUHA 4LL9A 2CUHA 1GZPB 3P69A 1E50A 1UYWL 1FO0L 4IMKA 2OXHA 1GVIA 2BHFA 2FIKA 2R2CA 3ARGD 6FABL 4HJJL 3QCVL 4AQ8C 2FO4A 4BDVB 2NY4C 3EOYG 3SQBB 1RFDL 4B5EA 4CGUB 3T3ME 2W0FA 2WWOA 1JCVA 1GZHA 5J4MA 4YAQA 1GJUA 1ZA3A 3B56A 2P5WD 3QNXB 2WKGA 1F6AB 4KK5C 3MJ7B 3X14B 1XMWA 3KVQA 3NP4A 5JOEA 1QO3A 3KPNB 2D9QB 1WWWX 4UMGA 5D8JL 3ARDA 2AK4B 4GXUN 3KLAA 4Z23A 4J27A 3ARPA 3ULUE 2VXQL 4DP7X 2XTJB 2R69L 3M1CA 4P2OA 5B22A 5J11B 3IXTA 1NLBL 3L3HB 4HIQA 4FAAB 2X4UB 3PQYD 3VB9A 1JZ2A 2IH3A 1T03L 4KKCD 4HBCL 4WNJA 4WFHE 3BFOA 2Z4QB 5FKAB 2ZCLL 1IT9H 2ICES 3RX5A 1E9OA 5DA4A 3UPCA 3O2VH 3DXAD 4D0CB 4HP5A 4LDEB 1PZDA 4NQSB 3KHQA 3DURB 3C5ZD 5C3LD 4XH2A 1FFPA 3NBNA 2DWEB 2BRRH 3FDWA 3G5XB 4JDVA 4AUUA 4YXLL 1FNHA 2OK0L 4PRNA 5E1HB 4BFNA 2A9MH 1S4IA 2PXYB 4GG6F 2V7NB 1G1CA 5F9JB 3P2TA 3FCTB 5FOBB 2UY7B 2Z65C 4TTGA 2ZNXA 5C07B 2VZUA 4OW6A 3KBHE 4IS6B 2DIAA 3QUXB 2CR0A 3QORC 3DSFH 1I1AD 4JO4H 1DVFD 4DEUA 4K7FB 1JFHA 2R0ZH 1ZVSA 4EQ2A 3NYKA 4MLSA 5DK0B 1Q1JH 1ZV9A 3OSKA 3DGGB 3NGBB 3QXUA 4M6AA 5CP7A 5L2JB 2ZOTA 5H2BB 4ZO8A 4LOVA 4GNKB 4PWGA 2J57A 2J72A 5MENB 3MRFB 3NCFB 1U8MA 2QVTA 3PHAA 4MAUH 2ZYIA 3TV3H 1HL8A 4MJ5A 1ROCA 5I8KH 2BS9A 2KH2B 3GQFA 3W39A 1EMTL 5GZOA 3C6LA 1SXAA 2UZYA 4PLKD 4B5ZA 2NT0A 3M1BA 1RK1B 2ESVB 3RVTC 3CC5B 2ZAGA 3BSGA 1NKOA 1UM5L 3VRLE 1RU9L 1HYRC 1OWWA 4J28A 1JHLL 5E2TL 5T3XL 2NPLX 4JRWA 5E1AA 3VXSA 3OLIA 4N20A 3FQ1A 1EPFA 3P0VL 1AS7A 4J3OG 2H8PB 4A6YH 1EH9A 3BWZA 3G5WA 4I18A 4DKEL 4MD0B 1SY6L 3FSAA 4MA7H 4YJZL 4YPJA 4YFDB 3RA7L 1YDPA 2X09A 5DHYB 2OTWB 5LGKA 2E9JA 4EF3A 3FRUB 3O0LA 4JO3H 4NXSA 4X80L 2E7LC 4ZW8A 1A1OA 5JHDB 3BP6A 1L5GB 1XGTA 2FJUB 3S36L 1N3NB 5I6KA 2YD2A 3HBPA 3C9NA 3QZWA 2YK1H 3ZE1E 3KS0J 2DMCA 4PJ8A 5CFAA 2NZIA 1JNHB 1SXBA 3DO3A 4P9HH 4PUBH 3P02A 2FLMA 5DZOA 4E9RA 1KB5H 2EDBA 2ED8A 5CINL 4JY5H 1IGML 4QXVA 4W9DC 4HUVB 1CGTA 3GMMA 3SE8L 3L3GA 3ZKXC 4UQCA 4M7ZB 1QI5A 3FTYA 4QRRA 1ASOA 2FT7A 3OLEA 3QISA 2PW2A 4XX5A 1WHPA 5C0BA 2ITDB 5TE6H 4HSAC 4JN2A 4XC3H 1U2HA 5C1MB 3LZOA 4YDLB 4ZTPH 1TZGL 4JN1H 2OMVB 3PRZA 3O6FA 1P1ZA 1IU1A 4JO2H 4Y19B 5EZLB 4N4YB 4CJ0A 3WD5H 3RGVD 4WY7H 4HW6A 4NQUA 3F00A 3AWFA 3NCXA 2JI1A 4PRHE 3QI9B 3T6ZA 2BHYA 1EEUA 2LE9A 4AV5A 5JPNC 1GL4B 4D9RD 4JL1A 4P2RE 1CFQB 3GRBA 2OMXB 5EA0H 1S8DA 4O02A 4AVJA 4JFFB 1INEL 2XTJD 5ICXA 1XH2A 2NTFB 3MRDA 3UP6A 2GC7C 2AHIA 1QEWB 2KLRA 2QPEB 4EUPG 5HGHA 3MU3A 2A9NH 2A3TA 3AXIA 4WDIA 5AYUL 1AZRA 3FOLA 5E4IA 4LIQE 1NCWL 3IU4L 3L13A 4TNWK 1TOXA 3QRGL 1VFBB 3NAAH 4CILA 4UU9B 5BW7A 2H5UA 2W9EH 5I17A 2VN7A 2QZ5A 4I2XB 3ZIMA 1Q9OB 1KOAA 2J1ZA 4WUUE 3WFCL 3DX7A 2WCGA 3SPJA 4PB0L 3ULVL 5I1EL 1BWMA 5KVGH 1HSBA 5E1IA 2KDYA 1QA9A 2JELL 3FFCB 1JDDA 3Q2VA 1CU4H 2XFXA 4M8UA 5CGYD 3T0ED 2O5YL 2W0KA 5D1QD 4AYFA 4HOWA 2NSXA 5HPMB 1OF2B 2DWDB 3KPPB 3H9HA 1AZUA 5IIEA 2HKAA 3NPZB 3K2KA 1NDGB 3LHPL 4P2OD 2OMWA 4XBEH 1XR8B 1AHWB 1MRDL 3GBMH 2YD8A 5CEZL 2AXJA 5TQ0L 1F45A 1NCHA 3Q8AA 2X4QB 3D4YA 4KO7A 4XMWA 3BPCA 5HGDA 4Z3FA 1X6LA 1MJ8H 3GYRA 4FTVD 4WEUD 3CDCA 4G72B 4PJ7B 3OKNB 5ISZA 3BD5A 3V4PL 1V7ML 3BLKA 1MF2H 4GPVA 3RWGB 3M1OA 3SO3B 5IM7A 4M7JH 1H0DA 5B39A 3L4ZA 4QHLA 4JFEB 5JYLA 4C56B 1DO6A 4MMYA 1E3XA 1GSMA 2JJVA 3VXOB 4HJ0D 4OJCA 3EKCA 1UB6A 2WXJA 3QNZB 3VI4B 2G60L 4RDBA 3HBGA 3SQOH 2IANE 2C5DC 3ZZSA 3S2AA 4YHOL 5F9OL 4YZWA 4PRPA 3RY6C 4EBQH 2XQBL 4GQZA 4N5ED 2IQ9L 4U3HA 1IAKA 3RNKB 3J8F7 1D2OA 1R5VA 4ONFL 5M95B 4BV1A 3WY1A 4XNMA 2GHZA 1NUDA 1F6AA 4P3CH 4NI3A 3EG9A 4I3SL 1R3JA 1T3FB 2HCZX 3OGCA 5I6PA 4YSOA 4B41A 4FJYA 1T5XB 5J1AA 2AKRA 2PP8A 4QAMB 4ZFFA 3OB0K 1G7LB 3WJLC 1T1WA 2AEQL 2RQEA 2VJ8A 1WYJA 1YN6B 4PJ9A 4OGAD 1DJZA 3LKOA 5ABZA 1TJXA 2OMUA 3HMWL 2Z34A 4I9WD 3AREA 4Q89A 1IO4C 2VMCA 4QRTA 2NY6C 5FGBA 1F4YH 3DRQA 4P0DA 3UZVB 4Z8FH 3ETTA 4CSZA 3W38A 4UMSA 1PU0A 4ZQKA 3C6SA 2HKFH 2BS71 3V4VH 1PAZA 2BP8B 2XWDA 3NZ8A 4AM0Q 2I9TA 4JY4B 4M5YL 2E7BA 1H8OA 3LVEA 3MLRL 2XUWA 2OULB 4ODTH 5DD3H 5DEGA 4BUQA 1E3ZA 4ZUUA 3D1MC 1S9XB 1L6XA 3PAYA 5GJTL 5T5NF 1ZLSL 3UYRL 5J3HC 5IFJB 4BELD 3JZ7A 4WI6A 5I2IA 4M29A 1W8EA 3SJVE 3VXUE 4Z78B 3OMNB 4D0BA 4UOW0 2RALA 3ZHNA 2NX5B 3QUHA 5SWZB 4M43L 1RI8A 4YN3A 1QVOA 1E5YA 2L8AA 2PTTB 4LESA 5FO9A 1RZKH 1V3LA 5CCGE 1CXFA 1MVUB 2EH8H 1HJBC 5J56B 4Y1AA 1R6VA 2DH3A 1U92B 5C3TA 4BM7A 4E42B 4PVLA 5HYQB 5L8LB 1KIPA 3OBAA 3QEQD 4OZFH 4LAQH 1NGXB 1NBZA 1QSFE 1TTAA 2YEVB 4FC3E 5I74C 5INCA 3S3JA 4OZIA 4W9FC 4DN3H 4LGPB 1H3XA 1M57B 4XCCH 3CXDL 4WI2A 2A9CA 2X4SA 3D39A 4B3VA 1TEFA 4F8PA 2B8OT 4L4TD 2APFA 5EO0B 5C0JB 1HHKB 1I3VA 2FATH 3NACL 4JRXB 1FVCB 3ROLA 3CHPA 1A4AA 2ZJSL 2YR3A 4XNZC 1YEKL 1HZHH 1X5ZA 2CDEA 4YQXH 2WP3T 4M7LH 3NZSA 1NGZB 1AR1B 4FZEH 4HWBL 4OZGB 1G9NL 1XBRA 15C8L 4AI7A 3TA3B 4OF5A 4UT6L 3BH8A 4KX7A 1ACCA 2PCFB 4QYOB 5CCKH 1SYSA 3UROR 2YZ8A 4YHKL 1TZAA 3NCJL 1XR9A 2NR6A 3EYUH 1J0KA 5D2LA 2OXHB 1UWGH 2EE6A 4LVNB 4NN6B 3TYGL 3X3GL 1JWUB 3BP7A 3KGRA 3OC8A 4WI8A 3JVGA 1F4HA 3UZQA 1HTYA 1Q9KA 4B9GA 1YMHB 4GRLA 2YPVA 5JMOC 1KYOK 3PCYA 5DTFA 4K7PL 3TT3L 1OVZA 3ESVF 3HC4H 1G5AA 3KNBA 3MRPA 2VR9A 2VC2B 2K45A 1LWJA 3DPBA 1Q0YL 4GFTB 1R5WA 3U4BH 3OHXB 3UAJC 4YSUA 4U1NB 3CN0A 2ZUVA 5TF1L 5INDB 5JMRA 1WK0A 2JK5B 1A2YA 1FYTA 4QNPE 4CC1A 3BDBA 2NNCA 1AKJB 1I8MB 3S5LA 3OXSA 3RX8A 1EAPA 1IVLA 1E9QB 5E7FA 2CIIA 1GY2A 3DX9B 3FO1A 5GRXG 5AW9B 3N9GH 5JR1L 5T33H 3QH3A 3V6OC 1NEZA 4GG6A 5F6HJ 4H26A 4L4TA 1IAMA 4N2EA 1QZ1A 3MVSA 5CILL 4RGOL 1ONQB 1XCQB 4AIZB 3SYAA 1OTSD 2EKJA 4YH6A 1KB9K 3KR3H 1CFVH 1W72H 2XWTA 4HKJB 5HI3D 3TJEH 2DZEA 2RFXA 3M6DA 2FLRT 4JDZB 4WHTA 1MWAA 1VRSA 4NC1E 1I1YB 3UTTE 3P9LB 1DCEA 1X7SA 4GO6B 4N90E 4X9FA 4ZOCA 1QLEL 2VDLB 3B8YA 4TNEA 5GS0H 2XWRA 2K7PA 3FJTA 1T7ZA 2DEXX 2GI0A 3ZX1A 2HLAA 1BD2D 1ZHLA 1EJ6A 3SQRA 4WFFD 2FWLB 2WKOA 4M7LT 5F1IA 5CBAB 1B3JA 2WCPA 1A3RH 2BOCA 2V5YA 1IILE 2EO7A 2XZQH 3UEQA 1J0IA 2GT9A 3GMMB 3GJFA 3MRLA 4B7IA 1FC2D 1T2JA 3DSNA 1CXKA 3MUJA 5GISL 2VQUA 5EV7A 4RISL 3UDWA 2GHWB 5MEQA 1OW0A 3PWPE 1JUFA 2YS4A 1I8IB 3ARGB 3EBAA 1F13A 3JTTB 5FWQA 1B4JH 1F90H 4TVUA 3DI2B 4RDQF 3BD3A 4PRDA 3GC3A 5TQ2L 1BVOA 1IVTA 2VQ1B 2YUVA 2Z92B 4KV5E 5BO0D 2CO2A 3RZCC 4GAJH 3LAFA 4URKA 2XX0A 4TLSA 2NNAA 3UTSA 2VLME 1AQDA 1ETA1 1MDTA 4XB3A 3RAJL 3UZEC 1D5IL 2QSVA 4OB5L 4Q0XH 4F7PA 2HJFB 2J44A 3HJEA 3KYMB 5KSUA 1MIEH 4L8BB 1UFGA 3BVWA 3JTSB 1ZLWK 5JIIA 2N7SA 5D7IA 1VGEL 4TKWA 2H6OA 2FJFB 3VX1A 2QVFB 3GNMH 3MR9B 4JRYD 4N2BA 4PU2A 5I1AA 4TRPL 3CN3A 3QRBA 4DGVL 4FEMA 4PJ7F 4X6DA 2BNQA 4OLZL 2XN9E 4XWGL 4YNYA 4TUJA 2ZE0A 1EBPA 3LIZL 4IBSA 4PJ6A 4UU9A 1CCZA 3T6VA 2YAMA 4L1SA 4WI7A 1U91B 3N85L 3KPMB 2DBJA 3FQWA 4DNLA 3GFUA 3SYPA 3VE0B 2CLZA 3NUKA 3HI5H 1K8DA 4XNMB 1DQDL 4YHIA 1CZ8L 1M7DA 2GTWA 2WBKA 3MQIA 4Z0BL 4PJXF 4ABWA 3II1A 1YO4A 1E4XL 1FCGA 4BQCA 5IR1A 3OZLA 1VFBA 3GSNB 3DRTB 5HJ3A 3UOAB 3HZVA 4RAHA 1HQ4A 3KYKH 1JI1A 3B3BA 1PPIA 3G5VB 4PSRA 3VM7A 5A1AA 3HG2A 3MACH 2PETA 4XPFL 3L5XL 3WTXA 4JFWA 4Z7VF 3SO3C 2VDQB 3OVUB 1JMXA 3BPCB 2BP3A 4W9KC 3TIEB 3GRWH 4BK5A 3SDCB 4U0RC 4K5PA 1MXDA 1N0XH 1XIWC 4MQXC 1AACA 3W5MA 1VB9A 3L45A 4L0PB 5E5LA 5FA3A 3RWGA 4PD4K 4M8QB 4OUUA 1MDAA 1AHWC 1IBGH 1A1NA 3FPXA 5CJ8A 1C1EH 5IB4B 1WIUA 3D25A 3H8NA 4O58H 4GSDH 2R56L 5GJSL 3RFZA 2D7OA 2X12A 4X7DC 4C56A 4ODBD 4L5FL 4XHJC 1WD8A 2B59A 3FONB 1C8QA 4ZSOA 2LR4A 1F3JA 2CMRL 3K6IA 3RVTD 2HKHL 4PJAA 1BJMA 4HC1A 3LTVA 3NIGB 1IIIA 3I75A 4HWEH 3S37H 3MNWA 4ZMYA 1L0QA 1BIIB 2EICA 5TE4L 1WFIA 3Q1SL 3W5NA 2H3KA 1CGVA 3ZDZB 3VXOA 4NGHL 5AKRA 1U36A 3TWCL 3X13A 3QFDB 4PIBA 3Q2NA 2XT1B 1CO1A 4G6FB 4N2AA 4Z95L 4RX4A 4U6VL 3T3MB 4B6ZA 4KX9A 4AW7A 3PXHA 5LLIC 3KYAA 3DX8B 5JOPE 5C0FA 2VN3A 4Y16A 4B53A 4LSUL 3UO1H 1SM3L 1ZWIB 1J1PL 5FYLL 1IBHA 5I75B 2I07A 3BYYA 4PJEF 1WEJH 2J2ZA 5F97E 1JYNA 2OMUB 5D72L 5D93B 5I1HL 5JPNB 1A7QL 2DM3A 4U1GC 4GKSB 3QI9C 5IHUL 3OR7B 3F6LA 5DRXB 5EZPA 5MEOA 5ALBH 3EOTH 3MJ8A 3W57A 5AB2A 3MJWA 1ZTXH 3P9MA 2NY3D 3HG1E 3SCMA 1MRCL 1ZXQA 4YPGB 3NEOA 2IOOA 4OLXL 4JRLA 2FH6A 2I24N 3NRFA 3ZTEA 3QHZH 4NO3A 5JHLL 2VJXA 4PJ9B 3QGVA 4CA4A 1I8LC 1XX9C 5BOJA 4APQC 1D9KA 3IT8D 1CIUA 4ZUTB 2W07A 3UTTA 5DJ2B 5FO7A 1YPZF 1XDTT 3REVA 1S7TB 3U30C 4DK3A 2H6PB 1KLGA 1IQDB 4NDMB 4ISVB 4F24A 3FQTB 4OFYD 4Z7OF 1TQCB 4AYSA 1UZ6E 2AK1L 2QHRL 1HILB 2R2EA 2WUBH 3PFUA 4FG4A 3ZKXB 4G43A 3AU0A 4OLVH 3A23A 2ZG3A 2ZT9C 1P0SE 3WFZA 2X2UA 4LE8A 2X0VA 1H8NA 3RWHB 2HSIA 4Z7QE 3D48R 5FDWB 2BFVH 1P9MC 3LQZB 4P57B 5J8OA 2OZ4L 5D7SH 1I3RA 5AW5B 4OCMC 4BJLA 3T6QC 2WLLA 1UWXH 1YMHA 2C9QA 1JVOA 2G3NA 4UDUA 4W9JC 2F8XC 2Y22A 1Q0XH 2AJZB 1OAQH 1FORL 4X5WB 4GW5B 4JFVA 3IFNL 3KXFB 1BOGA 2NY4D 2GBUA 4OGQC 2JSFA 4KPHH 2W95A 4ZAKA 5GGUB 1L6PA 1LEIA 3CFDB 1M7IB 4UAOB 1P7KA 1EHLH 1O6SB 3GXNA 5GRUL 4L0YA 3FS9A 4M00A 5AAPA 1SOSA 2F5AL 1OP3K 5CEXB 2Q2EB 4IBQA 1FQ9C 1IX2A 1EO8L 4IBYA 4L37B 1CDBA 2FRGP 1SEQH 3GKWL 5CSZB 1ET5A 4M61B 3C6EA 3RWCA 3V6ZB 5I1LB 4PGEB 4R97C 5BZWA 3ISWA 3WO4B 3BESR 3QZBA 3F7YB 1P7HL 3RIAF 4LL1A 4OGXL 3EOAA 5SX4I 2ZSVB 2NUTB 4OI8A 1CXHA 4NUPA 3P11H 5D7JD 3P0GB 4KVNL 4ABUA 1P5UB 2R0LH 1DBKH 3BKCH 4PGJA 3OX8A 4NCDA 2XKNA 5IFAH 2YOCA 2P28B 4XE0A 2B1HL 3BXNB 3MOAH 5JHDD 4QR7A 4BKLB 2YUWA 3LXUX 5D70L 4ZMQA 1TLKA 3D09A 2AV1B 4TL4A 2NCEA 1KGJA 1OB1A 2EDXA 4NUQA 1P4UA 4A6YA 1BJ1J 4APXA 2D3JA 1OD9A 3CFEA 4JG5A 3VVWA 3V8CA 4WNQA 3QORB 3V6FB 4AVKA 3C60B 5F96L 1JK8B 2G0LA 3DXAA 2ZQKA 1MCIA 3D07A 2RMNA 3C8DA 4JHBA 2BY0A 3CN1A 1HHHA 3WTSA 5F9WB 3B2DC 3DETC 4U3SA 4L1TA 2PXYC 1EUTA 1RAMA 4KJQC 5EUKA 6FABH 2FIKB 4TQEH 3PWVB 2HB0A 2EDYA 1R5WB 3FU9A 5ENWB 3HS0B 1OLLA 1BQHG 3HE7D 1L0YA 3PP3K 4TYUA 1RIUL 1P6AB 2CIIB 3Q9QA 3PXJA 1LD9B 3D2TA 5DJYA 2R0KL 1UVQA 5KVFE 2VABA 3QDGA 1WUNT 2CPUA 4ADGA 4HCGA 1OCOB 3KZ8A 3BH9B 2VDNL 3WTVA 3P77A 1KN2L 5J11C 4MB3A 4WKZB 2HFEB 1WZ1L 5D2NB 3C08H 1UD4A 2IH3B 1FSKC 4MYPA 1DN0A 1WGOA 1GRWA 2W60A 3W0WD 1REIA 2ZCLH 1DL7L 2VZVA 4ODUA 2WY3B 1BF8A 1OPGH 3I6GA 1ZT1A 3O2DL 5BV7L 1UB5A 5HXMA 1E5AA 1U33A 2VDOB 3QPXH 5D1XE 2Y3AA 4ZMWA 4EZJA 5IHZA 4HQQH 1S7SB 3UGXA 2CLZB 1YHPA 1MWAB 2C4FT 5JXAH 5T5FL 4N8CL 3FCBA 4PRHD 1XF5B 2ICCA 3JQOB 1KGCE 5J1SC 2A9ML 1KDJA 3K5RA 5IW1A 4MD4A 5BVPL 5T3ZD 2ADYA 1GS6X 2UYLB 4HUWA 2WWMD 3W11D 3AJ7A 3FTGB 3GRGA 3DRTA 4LKCB 1AE6H 3HE6A 4RA0C 5HJ3B 1J18A 1J0ZA 5BZXA 3WY3A 2NX5D 5SWZD 1YEEL 5K69A 3CCHA 1OWRM 5J13C 4BCYA 2ZXGA 1I3GL 4POUB 3MGTB 4H88L 3ZTDC 1G9NC 4AYBA 2G5RA 1TXKA 3LKNA 4MXWL 4Z7NB 2B08A 2BXYA 1YEWA 4I0PB 3VQ2C 2VR5A 2EXYC 3M07A 2ZUQC 3P4NA 2GUOA 4ABVA 4R26H 3DV6A 4PYGA 4Y4KB 2E7LA 3I3DA 4DQOL 4NEHB 2ZX9A 5I8KL 2A0LD 2VZOA 1EMTH 3MGOB 4MAYB 4N2DA 1NC2D 3TTYA 4PLJD 3QNYB 4POZC 2X1QA 2TSBA 1LE9A 4FE9A 3BHBA 4BEIA 4CDGC 3CFCL 1HWGB 2AVGA 3MR9A 3VGDA 3LDBC 1KZQA 1RU9H 1SMOA 2FJFA 3MDJA 3ZR5A 5DZ9A 4D2NA 5DJZA 5HHVH 4C56E 1HWWA 5T3XH 3W81A 2WZAA 2MOGA 4PJAB 4PJBF 1A9EB 4ZS7L 1LO4H 3QEQE 3DJRA 1MFVA 3H9YA 3FTSA 4MYWB 4EDXA 3L3IA 4UQEA 4MA7L 1UZ8A 3M17A 1GGIH 4LQ1A 4HZAA 2I9LA 1ZE3H 1ES0A 3RA7H 4XCFL 1E5BA 4NCC1 4X8JB 2BIIA 5F3HB 3WJJA 3QW9A 1LILA 3K46A 3WBDA 5I15L 2JF1A 5F1IB 2F53B 2V3FA 4QO1A 1RZFL 4X80H 5DHYA 4GKNB 1L7TL 3MC0A 4L5FE 4L8DB 3CVHL 3SDAA 1CK0L 4Y5XB 3B1UA 1G9ML 2Y6TE 3S36H 3L4WA 5I71B 2VUKA 5AW8B 3T4YA 3PWNB 5BRZE 3WN6A 5ADOL 1HWHB 2V3EA 3JWNG 1XH3A 2FBRA 4EI6A 4K94H 4L4VA 4O51A 2WXIA 4TQIA 2OYKA 1SFDA 3PWUB 5FKPA 2ZG1A 4P9HL 4PJ8C 3UG4A 3CHSA 1IAIH 4QJ5B 5JPNA 1KB5L 2XG4B 2Z3FA 2YKKA 4DTGL 3UJIH 2DJ4A 1GYCA 4JY5L 3TBWA 1I7ZB 1U3HB 4FXKC 5D7HA 3SE8H 2CCVA 1BZ9B 2R1YB 2VC2L 4FEIA 5F0JB 3ULVF 1ZXKA 3ARRA 3U79A 1RULH 5DF0A 1N9PA 3BQVA 1KYOJ 1GGTA 3PS6A 5TE6L 2HFTA 1NMCB 2ZSWA 3GSQA 1JGDB 3OJMB 4ZTPL 4P4KB 2ICEA 2X1PA 5MENE 4FTVA 2EZ0C 4GRWB 3QUZC 4L05A 1RPUA 1R4XA 3O3BB 3EJUA 2XJKA 5K9KA 3BSZA 4DF9A 5K9OA 3MUGB 2WZ6A 3H42L 2WBJD 3QEHB 4WY7L 4AYDC 5IBLD 3BO8B 4HKXB 4M3JA 3I3BA 5EZLA 2IPKA 1LK2A 3QEUB 2J21A 3IDXH 5EN2A 5AQ0A 2J8HA 5ISZB 1CFMA 2COVD 2LFGA 3RWIA 4YHLH 1DQLL 3RUGB 4L3AA 1S9WB 3TT1L 2GEQA 4XZUB 2VXVL 5JDSA 3HOGA 4BUHA 4M62H 2YBRB 3FAWA 2A9NL 4MA1C 3QIUD 2FGWL 5KSAB 4BINA 1NCWH 3QZWG 3QDJA 4FFVC 3PWPA 4RGNE 3HI6L 2UZIL 4I4WB 4DCQB 1B0WA 1IIKA 4OCXH 1FH2A 2MEJB 3VWJC 1GKEA 1ZY9A 3FFDB 3TXAA 2OQJB 3KPOA 5I1EH 2RCSH 1PFCA 3C5XA 5KVGL 5H8DA 2ZX8A 1GOGA 4LRIA 3FQNA 3T65A 1DYZA 1CU4L 5LJYH 4GI9A 4PRBA 2IWFA 2APTA 2ZXDA 5MI0C 3SCMB 4FQXC 1SHWA 3WUZA 4PJIE 4N24A 4LXFA 2IALB 4NOFA 2BLFA 2KYIA 2YPKB 4K3JH 5IESL 1N59A 4GJTB 3FN3A 2CJUL 4XBEL 4TSCL 4NLAA 4WFGD 1KN4L 1TTCA 4U1IA 1PKQE 1P6WA 2WLNA 3C12A 5I8OH 2H6PA 1UASA 5IQ7L 1HKLL 3MJ8B 3STZA 4GI8A 5L8JB 3MNZA 3RVVD 3G6JA 4LT7A 1I8KB 5FUOH 2QKIA 3V6OA 1BLNA 4GQPH 3WUWA 2BM3A 1T5WA 2IIJA 1WCBA 4JUSA 3PV6B 3BUPA 4ZMNA 4NO3B 1NM9A 4GMTL 4MA3B 3WFEH 5GGVH 2NW2B 1O7DE 5AVQB 4L4TE 1WS8A 4Z7OE 1KCKA 1T5KA 1I1AB 4P3DB 2WM0A 4LDCA 2NY7L 3UCQA 1FV1A 2NY2B 4ZYKA 2EIDA 2G60H 4J3WA 4CNIA 1T0OA 1JHKH 4WEMB 3ARDD 3K0YA 5KVGE 4YHOH 1ICTA 2IAMB 4GT0A 4BQ6A 4YGVB 2Y6SC 3I6KA 4J1UB 2HVBA 2XXCB 2AERT 2XV6B 5E5UB 4ZFGH 5JPMC 1G7IA 4IRJC 1O6SA 1IJ9A 1I1CA 4YSRA 3AT8A 3UBXB 3UIYA 5SX4H 2R4SL 1OZUA 2N0MA 4Y5VB 3VRJB 3W9DA 5H94B 3RWCB 4QHMA 1H3UA 4GW5A 2B77A 3O9WB 2WC7A 2YAEA 5KYXB 5C7ZA 3ABKB 4FFZL 4JGJA 1LEIB 1NICA 2AF2A 5E5RB 4EN3B 1DE4A 3HB3D 2VXQA 4FJZA 4KTEL 4HOZA 1AGEA 1DJIA 2R69A 3WY2A 1CFSB 1G6RH 5BV7B 1DVUA 1BFSA 1NFDB 1CBJA 2CA3A 2C4XA 4NT6B 3VQ1C 4JANB 5E4EC 4HMDA 5T1DH 3SPVA 1LEGA 1SYVA 2P5PA 1F4YL 1A6WH 5C8JA 1FIGH 5FF6A 5KBDA 1K9TA 1U21A 2A38A 4GFXA 4IBTA 3V4VL 4LLMB 4G6KH 3T3PE 1I85A 3QO0A 1AS6A 1MCRA 4H5SA 5E7BA 3ZHLA 1BD2B 5FB8B 3ES6B 2XJLA 4N6QA 4F27A 4DKFL 4E5XG 4OZGA 3C60A 1IM9B 2X40A 2ZCZA 2BVPA 3UYRH 4P4KD 4NS0A 4YDZA 1GXEA 5A2BA 4G8FA 3SE4A 4UIKH 1WISA 3QIBD 2FWOB 2E9IA 4HUUA 3LEYH 5IVOA 4XB8A 1TQVA 4M5ZH 2DI7A 4BHUI 1D7BA 5E9DA 1KBPA 4ZT1A 1RUKH 2X9WA 1KXTA 3WYRA 4F58H 2PUQT 2PWHA 4CRPA 2PR4H 4JFDE 4XMZA 2G75A 5DWUH 4DOHB 3K2MC 5F2FA 3EJJX 3IMWA 2X1WL 5FUZL 1P69B 3IDYC 1HHGA 1ORSA 3MRHB 5DS8B 1OTTC 2DQJL 2OL3A 2BSED 5I5IA 1KIPB 1QABA 2BDNH 1AZVA 2X87A 3OM3B 5GRVL 2YUXA 4E42A 3WXVL 5LXVA 3MKKA 1JWSB 1EA9C 3EOAB 4G6ML 3C6LB 2H6UA 3WFBH 1TZ8A 4RFNC 2V8LA 4HIPA 1AGDB 4ELKA 3KL3A 2FQFA 4QI3A 4XCCL 3E9UA 3CXDH 3FL7A 3ECQA 2JKLA 3TO4B 4ERSL 1CFNA 5C08A 1FL6B 5DO2D 1EAPB 3QZPA 4PS8A 1I85C 1IAII 3MRKB 3VXNA 2YHGA 3VYNA 4PY8I 1HZHL 5HYFA 5IZ7A 2NUPB 1OGTA 2DS4A 4M7LL 4P5MA 4OFKA 5E00B 5C0DA 3AZUA 5DK2B 5DURD 3WE6A 2UUDK 2YMXL 4KI5D 5IKCA 2HVJA 3RB5A 3EZJB 3GMPB 4W9IC 4PV8A 2VR3A 5LGYA 3SY6A 3VW3L 1LDPL 3QQNA 4G8GB 1UJ3A 2R8SL 1KLUA 5GZNC 5CCKL 4IOIA 2ZF8A 3CLFH 2C9XA 4WW2B 5ANHA 4F15C 2E86A 4PRAB 2JNZA 1CICC 5IJDC 3EYUL 4PG2C 3RVUD 5B7MA 3PUUA 1P84J 3X3GH 1GZQB 1XIWD 1HQRB 4DP5X 4KV5F 2CIKB 3RTQD 2FSEA 1Q72H 1WC7B 4NRXB 1TZHB 2AMGA 3H7BB 3JUYA 4I0PA 1M9SA 2QGCA 5T3XD 3LKNB 4MD4B 2WVVA 5IB1A 5SWSB 1SDDB 4UNTA 1AGCA 5MERB 2GY5A 1GAFL 2X4NB 3MV7B 5E6IB 4Z3GA 4ONHB 2FK9A 2D9CA 4TUOA 3VFPA 5J7CC 4YLCA 3VGBA 3VWJD 3O6FB 1D5XA 5EU4A 1U95B 4MS8C 5FK9B 3WL9B 3AS2A 4IYKA 2YRLA 2BIQA 4AQ1A 3GTVA 4HIIB 3C2SA 4OAWB 5IBTH 1DBMH 1QRNE 25C8H 4MQTB 3BEWB 3HE7C 1N12A 3VI3F 2WO2B 3CWGA 3MJ9H 1GCYA 4OZ4B 3R1GH 3R18A 2YGPA 1J8RA 3SE3A 3QUKB 1SF3A 1SXNA 3WUWG 4YBQD 3ZKND 5IQ9A 3L3IB 1CD1B 3THML 3LV3A 3DX2A 1OSEA 3C8KB 4RIRA 1LO0L 2FZ3A 3HNTL 1T21B 1NSNL 3A3YB 4ODSH 3CDZB 1QLEH 2ADFH 2PW1B 2VLJA 2OYPA 3A6BL 1MKFA 5ABDE 4IU3B 1A64A 4L4VE 3DMMC 4N2IA 4FERA 4TUJB 3VNYA 4MD5A 1K2DB 4Z6AT 3GZKA 3QR0A 2R7EB 4GRLC 3EJRA 1GPOL 3DDGA 2OX5A 4AGNA 2Z9TA 1XGZA 2G5UA 4A04A 3DO7B 4X6CF 2LTQC 3C5JA 4WWNA 4ELMF 1W16A 3RJDA 3ARFD 5DHMC 4DSYA 3RIKA 2P9RA 3CZEA 3GI9H 2GT9B 3IKKA 4AYFB 1C7TA 5GISH 4WFED 4PJAF 1MRFH 2ZUTA 4C57C 4KMTH 1J11A 1S9VB 3Q48A 4H25B 5EIIG 5EPMB 3RFZC 1NCTA 2UXTA 1VGKB 5KVEE 5I19L 4LF3A 1HXYB 1UOVA 3OQRA 2E59A 1HAUA 3DHPA 2VZTA 4FTVB 4HPOL 1UEYA 1U3HA 5TQ2H 3U1QA 2GK0B 5I1KL 5DFVC 3V79C 1J5CA 3BAWA 2MQGA 4K7PX 1NAKL 2GSIB 4U2YA 4BK5C 2FECL 3MYJA 2V9RA 5IMMA 4BH7B 4FP8L 3PV6A 1D5IH 4OB5H 2IFFH 1D5RA 1H6TA 4MA3A 4FLSA 3L9BA 5ES4B 4JM2C 3ZPDA 2EDTA 4ILDA 4E68A 1UA3A 5A6MA 2ZOKA 5JHMA 3BAJA 3QRLA 1JNLH 4YVUA 2XBDA 5DWPA 1XAUA 4X5QA 4BZ1A 2G4GA 4OQTL 3DV4A 4MB4A 5GRJH 1FL3A 1E2VA 4WIQA 1ZLWH 4MNQE 4R8WH 4HXBH 3NIFE 2BNQB 4RMQA 1DSFH 2Q8AH 2VM3A 4Z77A 1ZHNB 1OAYH 2C7FA 3G5ZB 1WG3A 5JXED 3HI5L 1F3DH 2Q10A 3KPOB 4EIUA 2BIHA 3KJ6L 4YBLC 1DQIA 4JE4B 4Z0BH 3POCA 3EYOA 1KXQE 4P3WA 7CGTA 5D7LB 3PWPB 2JWYA 3ET9F 3D69B 4E9TA 4EO5A 4BFBD 5JNYA 3SGKC 1CFSA 3IJSB 3FFDA 1YN6A 5EFIB 3IDGA 1TJMA 3ZL4H 4JLRB 5HTSA 2E9BA 4Z3HA 2Z31B 3I84A 3K6OA 1X5IA 3N43B 2Z8WC 2ZTBA 3OKDB 1BAGA 1OLZA 1ZA6A 4WFHD 4MMXA 4I0PD 1E8XA 4RMSA 5BQ7A 2XN0A 4Z7UE 2IPKB 2I9TB 1LK2B 3QEUA 1TU2B 1SN0A 5D1XB 2ILLA 5C9KA 3PV7A 1XF1A 4XVJH 1SOKA 3B7RL 2R56H 3DO4A 1A7OL 5IVXA 4HU8A 4JM2A 4HWZB 5DHEA 2NY0B 3PWLA 4D94A 2GUYA 4NQEE 3F64A 4BBWA 4XN4A 4K8RH 4P5TB 4U1HB 2CM5A 1DBJH 1E4WH 2WQWA 1H8LA 4HWEL 4F3FA 1OK0A 2YKLL 3LH8A 1CPUA 3T8XA 3B5HA 3F12B 4QHUB 1YA5A 4Y4FB 3LRMA 3RJOA 4OGZA 2H2PC 1PCXA 1WVZA 4Y4HC 4YK4C 3V4PB 3ATEA 4PV9A 1H3GA 3KDPB 5GHWH 1LGVA 5JHDE 3VXTA 5EWIH 1JE6A 4F8NA 1B0GB 3TWCH 4RVBA 1RZKC 1NBVH 2XN9B 1S78D 5GS0C 4IIQB 1TUPA 3VGFA 2WSPA 2QKSA 2W0FB 3T4AB 1EK3A 3HS8A 4F33A 5KVFL 2M83A 2L7UA 3QJSB 1TCRA 1X7QB 4AH2A 5HGBA 1GJWA 1VADB 4UB0L 2WLKA 4C56D 2VXSL 5EUOB 4HDIA 1ZRUA 3F84A 1RZ7H 3LQMA 5INCB 4OZIB 4LSUH 3UO1L 3PQYB 1A3QA 3OXRA 5JYMA 2O5ZL 1IGFL 1T89A 2CM6A 3V0JA 2IWGA 3BN3B 1PBYA 5DRNA 1NFDA 1RZIB 4IKIA 3HFML 4KKRA 2EUXA 1M2OA 4XAKD 3US9A 2NY3C 2XWCA 2XNAB 3EYFA 3H9ZA 5FF6B 3OV6A 1DLHA 1MRCH 1B0RB 1NFDE 3EFOB 4X0KA 5E94A 5D1QA 3KPSB 4EI5B 2WQ8A 1AGFB 2WLZA 1E28A 3CZJA 3QWOA 4NC1C 3QJTB 3VFVA 3DBXA 1OTUD 1W2KT 4RDQG 5AZ2H 3RPIB 1AHMA 2W9LA 4GRMA 1J9CT 5C2UB 3GINA 4CSTA 2GJZB 1FRGL 5I1IH 1U8HB 3BVUA 2IAND 3ECVA 1KLGB 1WO2A 2QHRH 2CUAA 1CGSL 1IBDA 2TRYA 4AOFA 4NDMA 4KROB 5KVMC 1F97A 1N68A 1R3IL 4Z76B 1GGBH 1KXVC 2WBJC 4BRVA 3FO2B 4JJOA 3TN0C 1A5FH 1MW3A 5J12B 4XN5A 2FNWA 4G7RB 3VI3E 1QI4A 1SGKA 4ENZA 1J0JA 1NGYB 4Y9EA 3JWNC 1ZHKB 1K72A 1IGIL 4FYQA 1Q0XL 5I0ZA 2P4AB 3GSRB 2WLIA 5L7XL 4C83A 4Y1AE 1QOKA 4JRYA 3H2PA 1F2QA 2PR9A 4I9XA 3IFNH 5PAZA 4JKPH 3PDOB 2YSSB 1HE7A 3MX0B 3MV11 3QUYA 3MJ7A 4YXKH 3WFDH 2ETWA 3MRFA 2EDEA 2G0KA 5JZ7D 5BVJB 2ADJA 2NDFA 5GRUH 4WUKH 1XGUB 1M7IA 2GSMB 2XCMC 4U1JA 1A65A 4OJFH 5GGUA 1EO8H 2WNGA 3GI8L 2P5WE 4YHPB 3VWKA 1ZVSB 3ULVE 5EBLB 1A0QL 2AJYH 2AXFB 4IU2A 5I6LA 1LEGB 1HEZB 5IQNA 1P5VA 1UGNA 5C8JB 4W9EC 3ZE2F 3ULSB 4BFKA 4JO8A 5C92A 1V5JA 3CZFB 4A2LA 43C9B 4DPBX 1MCEA 1YEGL 4MHHG 3GSVA 4IJ3B 3VQMA 2UY6B 3VFRA 3MLYH 4KVNH 3MRQB 1JGVL 1E3FA 2Z64C 4LEOA 3QEQB 3DYPA 3HG1A 3I74A 1DBKL 3BKCL 3LSOA 2DICA 3IMVA 2IBBA 4L3ED 4RFOL 1MJJA 3ZDYF 4PV1C 3MCYA 1PJWA 4PJDE 1MWAL 2ED9A 1KLUB 2NR6D 3IYLW 2CDFA 4D0DB 1PAMA 2Z4QA 5FKAA 1A1OB 3FUNA 2E27H 1MIMH 4J3OD 1G7PA 2Q6WA 5I26A 1KCUL 4KHXL 5GGRB 1ET7A 3HFFA 4MKMA 4MASA 2GG1A 1H5BA 2PWFA 3FC8A 4FNRA 4PBVC 2UY7A 2MQCA 3CBRA 4N1HB 1GYUA 1SN5A 3DMMD 2EDNA 2HPTA 5F96H 4ZNEE 1QBBA 2ZD0A 1TNNA 2VZ1A 3HAEG 3DXAB 3F01A 1FDLH 4JDVB 1UGKA 3RVWC 5C0BD 1FZKB 4ONOA 4TQEL 4A7GF 2DQCL 2PLTA 1A6AB 2BWDA 3HE6B 3SBRA 1T83C 2C34A 3LJ3A 4CMHC 3WJJC 4DT2A 2X28A 3NFNA 3C09B 4B3EA 4PJGE 3Q43A 4BZ2H 4OCWH 4HIIA 4W1TA 1FNSL 2R0KH 1NIEA 3SKMB 1TQBB 1UKTA 3SE3C 3QDMD 3TNMA 3KPLB 1LHZA 2GCYB 4LSPH 1B9KA 4L2LA 5J6HA 5DFWH 2W92A 2F15A 1OIOA 5AW3B 2XYCA 3Q8BA 2X7LA 2Q5BA 1KN2H 2UZYB 5DHVH 4WQOA 3GXUB 4LLWB 3KCPB 1KGUA 1OCCB 5D2NA 3WV0A 1TPXC 1NBQA 4OUOA 1A3ZA 7FABL 3E6HA 2GYSA 1W0WA 1DL7H 1BG9A 3AY4C 3N06B 4D8OA 2VH5H 1OPGL 2D31B 2KS0A 5D7JC 5M94B 3O2DH 2ZXEB 5BV7H 3LIZA 4MD5B 2MFNA 5DMGD 4YO0A 1OSYA 4YHNA 3RZCA 1T1ZB 3NRQA 3TBYA 1GR7A 1R3HB 5F1NB 4BWTA 3CSGA 4NSKB 4AZUA 4NJAH 3EUDA 2O61A 5JXAL 4DERA 5ICXB 3GSXB 1UT2A 1A7NL 3H9SB 1T04A 4L8CA 3EFDL 4C58B 5BVPH 4ZD3L 3HHRB 5D7LA 1NCBH 1YY8A 2ZPKL 2IADB 3D2UB 3STLA 3UGUA 2WNWA 4JFDD 4P5KB 5E8OB 2QDWA 5CU9A 4NHUA 1CGWA 3N1GC 4UQIM 3VTMA 2CRMA 2XVLA 1KACB 2WOYA 5EU4B 2K6ZA 2YGQA 3D3VE 3NSJA 4Y2DC 4R26L 5HHQB 3SBWC 4HGKC 3WIFB 1N5AA 4BH7A 3BP4A 4M6OH 5F9AC 3BT0A 3UPRB 3MXVL 4NLHA 2MOQA 2MCMA 4HKBB 5GZNA 3L7FB 3IJYB 4JQXA 5DK3A 3CFCH 3F2LA 3MGOA 2VUOA 3APNA 1QI3A 2AJXH 4Y9GA 3CVBA 1GMEA 1KTCA 1MFEL 1SMAA 3NA9L 3FN0L 4WW1A 1U8QB 2Y9RT 1A6VL 1LO4L 3AGWA 4WJ5B 1KFGA 4NWTL 1Q1PA 4WK2B 4KY1L 3W56A 2K8QA 5HY9A 2CBPA 1JNNL 3RIFK 1R0AH 3O3EA 4LPYA 1ZHBB 2R2HA 3TZVC 1Y18B 5DQDL 1Q94A 1RVFL 5FS5A 1Q38A 4K73A 1F6FB 5I6XC 3U4EA 4B9JA 3EYVA 3QNZA 1L7TH 2DJMA 2EADA 3ULUF 3WN5C 4GKNA 4R4BA 1CK0H 2ZYHA 2Q86B 1G9MH 4AXWB 1LEKB 3DX8A 2BY1A 3GRWA 4Z7OB 3GPEA 4AX3A 3VXRB 4K94L 4H25A 3BZDA 4HH9B 1NLDL 3HLAA 3WG7B 1VEOA 3TL5A 2EEDA 1IAIL 5I24A 1IFHH 1T1YB 1CYGA 4Z7UB 1KTLB 1NGWB 2ADGB 2TRHA 4DTGH 4M1CD 1ZA6B 2QPDB 2AW2A 3DJTA 2CU9A 3KPRD 4LVHB 4C4KO 4PRID 4MB5A 5FR3A 3CE1A 3IJEB 3GSOB 2JCCF 3N2JA 4FXGB 4LLUA 3MJ9A 1RULL 3BDYH 3LNFA 2JJTC 2H47C 3SE4C 2HG5B 2V2XB 2AGJL 3ATAA 3F6IA 2E7HA 1TJGH 2WKLA 3CXHJ 3QZNA 3NH7H 4M6NL 3FB6A 1S7TA 5IM7B 2M26A 5AW2B 1X4YA 1PX4A 3IMUA 5D4QA 5D1ZA 4AKQA 4G8GE 2B9BA 2J6EA 3BFWA 4NJ9L 4UYPA 4LPCA 5DFTA 3RI5K 2V9TA 3U6RB 1AG6A 3PL6D 3C2AL 3ZHDA 3TGXA 1I31A 4FZ8L 2H3XC 4XN2A 4P57A 2PNDA 4NP4H 3W82A 4YHLL 5CD5D 4PJBE 3LRKA 3V4PA 3MJ6A 3SGJC 1WSST 1DFBH 3NFPA 4XP1L 3RNKA 3OJ2C 4EPSA 1LYQA 4KK6D 3T4AA 2YN3A 4F3FB 3GXPA 4PAZA 1JK9B 3EG9B 2FCBA 4XPHL 3ETBJ 2D3VA 1AH1A 4U7KA 4R7NB 5LBSH 4MRBA 4DGYH 1PLCA 3ZQWA 3HI6H 1BXVA 1CLYH 2ZNWA 3CQPA 3DJZA 4FQQB 1HT6A 5LO7A 4J6RL 1D7DA 3V8OA 2YD7A 3BC9A 4JKKA 2QMKA 4HV8A 5ABAA 2N0KA 1ZGLB 4ZO7A 5K9QG 2PF6A 4I48A 1Y6KR 3X3FL 3L3KA 2G9KA 1NMAH 5C0EB 1DVSA 1MPAL 4OZFB 4KJYA 3V0VB 4IOFD 4XO9A 3AACA 4N3UA 5IMOB 3S4SG 2XWJA 4RSYA 1CE6B 3CDGB 1Z9SA 3MRNB 3DBXB 2CJUH 1Y1DA 1BX2A 4X98B 1YECH 2NY0C 1KN4H 5MP6H 1INQA 1XCTB 2CH8A 3H54A 3IMSA 2BC4B 4OKVB 5I8OL 4GUCA 4JZJC 2K9UA 1S3KL 4UQAA 1HKLH 3WEBA 3APFA 4DKTA 1E30A 2IGFH 5D1XC 1ZLVH 1ZVNA 5T5FA 3EYSL 2OTPA 1DLFH 1NANI 2A6JA 1MHPL 5IFJA 4PGBB 2DKSA 5DC0A 2X05A 2WQSA 4MZIA 2VAJA 4ZXBB 3CTTA 4OZIE 5IB5B 4R3SB 2DQHH 5G4MA 3QR2A 2MRYA 3KH3A 3D0VB 4OU3A 1RJZA 2YAHA 4C4BA 4XBPB 4QGTA 2XZAH 4G1EB 4LSQL 3SZKC 1SJXA 1EAJA 2EDKA 3JVGC 5JOFB 1HZLA 1JHKL 3FU7A 4NOBA 3ZRCC 3WSQL 3MLTA 4L29A 4UI2A 5IOPB 3NEEA 2XOTA 3L17A 3VRIA 5C2BH 4QCIA 4YHYC 3NJXA 4YBLB 1AO7E 4FA6A 3ALPA 3P73B 3BI9X 5FO8B 2DKUA 2VDNB 1USQA 4HJSA 4P4RA 5TE7L 1WE5A 1WZKA 4FYSA 1FH5L 4W9LC 3NVQA 5L2KA 5DR5L 3ZN6A 1RMFH 3QXDB 2VDQH 3A47A 4QRUB 5CJOL 2Q7YB 2EIBA 3Q6GH 1KJ2A 1RZJC 5D2NE 2EDRA 3TNMB 4DUXA 2GCYA 1NCAL 3EW3B 3DI3B 2F08A 4FFZH 4FL4C 5DT1H 2ZP8A 4IM8A 2FO1A 3VFNA 2WUCH 2WQAA 2X6UA 4M1DL 1YNTF 2ENYA 1N5YH 4L4JA 4NO2B 1CB4A 1Z3RA 4LP5A 3DIFA 4R0LB 2VDML 1DEEB 4NT6A 5FV1L 3SJVB 2LLGA 4B50A 1KXQA 2ROXA 4K9EH 5T1DL 4XVUC 3BN9C 1TZIB 1G7MA 3QNXA 4I5BB 1A6WL 1U8JB 1FIGL 3HPLB 4BD4A 4GAFB 2ZWLT 1MCQA 5FW8A 5C0AA 3EHBB 4P9MH 4XMKL 2C26A 2HN7B 3AFLA 4UM8A 4R5VA 4KRPC 3K3QA 5IEKB 4A2GA 2Y5EA 4L4TB 2FB4H 4WNSA 3EFFB 3FOMB 2DQIH 4FXLA 5IKCB 1H5BB 3GMLA 3UL4A 2VJ0A 1BYOA 5HHPB 3L1OL 2D4FA 1UATA 4X4KA 5I73B 3UAJA 1T2QL 3RE0A 3QIBC 4P07A 2P52A 4HPYL 4UTCA 4S1SH 5EEXA 3SOBL 3V5DB 1A1MB 2ZKHL 5AUMA 4KMQA 2ALWA 3V9FA 1S7WA 4M5ZL 4UINL 1CG9A 2KZBA 3JWNH 1C5BH 3IGUA 5B3JF 3KNBB 1RUKL 3EO1A 4NHUB 1KJ3L 1FVDA 4R7XA 2G9HB 5DWUL 32C2B 3MAWA 5INDA 4GRLB 2YO3A 5F7BA 1W80A 1KJMB 1HCFX 1OF0A 3DROB 4JB9L 5HP5A 5IP4A 3P2DA 4OLUH 4L9LC 2BDNL 1BHGA 2V7NA 2WVVB 1WFOA 4G7VL 3SEPA 1HHGB 1HKFA 1ORSB 2MKLC 2X9ZA 3C5ZA 3IXAB 1MW0A 3ULSA 2AABH 1UACH 4OVUA 5I9QB 1KWGA 2OFQA 1MXGA 1C9SA 1XQ4A 1JWSA 2X7LB 3DX3A 4KK6C 2CK2A 4TLTA 3FNKA 4V2BA 4LOFA 4TUOB 3IGLA 3DVGB 1QTSA 4IIZA 5HYJD 5IROC 4XAWL 5E9DD 4H13C 5D1ZD 3WOVA 4UV7L 3ZTNH 5GSRB 5FYJH 1ZIBA 4RMUA 2PABA 3DYOA 3GBLA 4K71C 1L7IL 4QLWA 3VO0A 4PVMA 4WUUB 2UWEE 4JREB 3HE7B 2N1TE 3ZDWA 4ANXA 4C4KT 4GW4A 4XMTA 1AMXA 4LFHD 2KPWA 3LPWA 2DLTA 3ME0A 3O11A 3O6FC 1C7SA 5BRZB 2JB5H 2R29A 3WE6B 3HZ3A 1KEML 2QLVB 1U2YA 3KPMA 1KPRB 5E6IC 3VXUD 3WIIH 4LPXA 1U93B 4JO1H 1JHTA 4YHZL 4YNYB 4PRNB 3FO0L 4KXCA 4G9DA 4U6YB 2H26A 1U8CA 2FX9L 3GZQA 3LXAA 5I30H 3V9EA 1GC1C 3M7FB 1E9PB 1FLRH 2Q7AA 3IDUA 4E41A 1AJ7L 3ABZA 3CFBA 1EHXA 1AS8A 2VMEA 4FLQA 4JM4H 3HMXL 2RA1A 1L4IA 1J8SA 4XHQA 2XICA 4PS3A 5B1BB 3V0AC 3DECA 1OALA 2IBZX 1GAFH 4AW4A 3GXFA 4M5TA 2EIKB 4XMUA 4A39A 4AJ0A 1J86A 4GKZB 2YPLD 1QYGH 3MV9D 2DLIA 1L9OA 1WT5A 2CHXA 3BE1H 1J5IA 4M9OA 3FB6B 3QPQD 1V3JA 3G6DH 4GW1A 4KU1A 4WHYG 1IQWH 1TKWA 2W65A 5IBTL 3AU1A 5CWSB 3IWVA 4NQDB 4NO0B 4XR8C 3DDFA 4EJ1C 1Z0NA 3BO8A 4OF8A 3FONA 2PP9A 4ZSOB 4M9PA 5E0QA 2NQDA 1LP9A 1WWAX 4PR5B 3GUTB 2CE6A 1CF1A 3BUTA 4JQVA 1YMMD 1ED3A 2DQ6A 3U9PL 4LRNL 2OW7A 2DIEA 3O3EB 2LU3A 4O02H 5GS2D 3RX7A 2HVKA 1AFVH 1YEJL 4YE4L 4JZJA 3CLEH 1LO0H 2DYPA 4HZ1A 4RFNB 4WW1B 3C6LC 1D7FA 1UKQA 2ZCHH 1TTRA 2QDVA 1QKZH 3OKLB 3II2A 4YHIB 3A6BH 1T6WA 5IHBA 4KVCL 5L88L 3CQFA 4X9BA 1LE5A 1DJXA 1EFXD 4E5XB 4S1QL 5E8NA 1GPOH 4D9QE 3ARBA 3G5VA 1OQXA 3SDDA 1B88A 4N0FB 2JCCE 3MRDB 1B2WL 1A8ZA 4OZHF 3IFLL 2VLRA 5IF0B 2FIRT 1MFAH 4YFEA 1KCRL 4JFYB 4CVXA 4DHLA 1M7DB 2CDGA 4QTHB 3OJDB 2H0PA 5CM1A 5LHDA 2F7RA 4X6BA 5FYKL 1XHHA 4OI7A 4R84A 1HXMB 3B9KC 5E8DH 4KDTC 3FT1A 3IPEA 1A9BB 1QBLH 2NX5E 2CD0A 4I7ZC 5SWZE 1KYAA 4PJXE 5EFIA 3V95A 1JJUA 4HPOH 4GQ9H 1TG8A 3B1TA 4TVPE 2IDFA 3VXME 3ZL2A 1MJ7H 1EO5A 3FT3A 3ETSA 4PI2A 3UYPB 1UD6A 4BHUA 2CLRA 1BVNT 2AMUA 3MA9L 3JBG7 2V6HA 3EH4B 4FADA 1QWNA 2CKBB 1BIIA 4V1DB 1Y07A 4FN0A 1FO0A 3EH5B 5TH2B 4G1MB 2YMTA 3MNWB 3VFGL 1JNLL 3D0VA 2Q0ZX 2OMZA 4FNQA 4P5SA 2O4EA 2OLDA 1MWOA 1AXTH 1THCA 4PGDB 2XWBA 4AKOA 1YNTA 3NCYS 3H55A 3DXAE 1OP9A 4HYTB 2P8LA 4EXKA 5GRJL 4HJGB 4EUPA 3GO1L 5I16A 2Z8SA 3K2IA 4HFWB 1MFDH 1AXSB 2C3VB 4HXBL 4Q74A 1LEKA 3VAEA 4DIXA 1GH7A 2EEFA 3LN4A 1G7IB 3ESOA 1U0QA 3BCFA 4ORGB 4FI6A 2EYSB 3N6YA 1EXHA 4MDIA 3FH8A 1ZGLA 5H35A 3H2QA 3KJ6H 5JPMB 1DBAL 1C5DB 2NZ9C 3QIWC 1JFQH 5EU7E 1TCRB 3X14A 1A4CA 1ETZB 4L23A 4YDKL 2C1PA 4TSAL 2XFXB 1HL9A 3HAEB 2NSMA 1Z9NA 2O5XL 1UOLA 4MNGE 2IH1B 2QZQA 3FUFA 4I89A 1HYSD 3QIUB 1UOKA 2CPCA 4MSWB 1J8HA 3RHWK 1G87A 1I1AC 3BAXA 1K5WA 1HHIB 4WKXA 4GKSA 5DXWA 3VDBA 1AIFB 2V4LA 3L2LA 3LKQA 5CIPB 4WWID 3D39E 1KBGH 1T5XA 1ZPLA 1CT8B 5T1MA 2VR6A 3WTTA 1JYWA 3E3QC 3NJGA 4BE6A 1NBYB 1FC1A 2OJEA 3QORD 5LNEA 1NWOA 3INOA 3QWOB 3SCMD 3RFRA 4X4MA 1A7OH 3DOSB 4HETA 2WANA 4KRPD 5F8QC 2WZPD 2NXYD 1ZE3C 1JZ3A 4ZS6D 2D7PA 3MLTB 4L29B 3X1EA 4LOUC 2VDPL 1E4WL 3FU7B 1D9KD 4EN3C 4F80A 4DN4L 4HIHB 3H4FA 3LEXB 4FQXB 3MBWB 3SCMC 5FEBA 5MI0B 1INDH 5B4MC 3D85B 3RWHA 4X5WA 4H2AA 1C16A 4TOYL 2OJZH 4LLYB 4BFGA 3WHE1 4MCZB 1YMMB 3QYMA 1SJHA 2JV6A 2WO4A 3EIFA 3J27A 2NY5C 3OAZK 4G5ZL 4HT1L 5DQJB 4AMKL 3VWJB 4ZAKB 2D3NA 4WI5A 1G6RA 2D7MA 1WGVA 5FW7A 1E6JL 4PS4L 5L0QC 1HNGA 4JVPA 2VXSH 2WAQA 3HBQA 4F33B 3L3KB 4FYRA 1HHHB 2B4CL 2HG0A 4PB9H 1NWPA 3NMEA 4TMPA 2JKTM 2GFBA 4WV1B 2E75C 4OCSH 2O5ZH 4HDIB 2H45A 3K6DA 3VJ6B 1SXCA 3BEVA 4Y2OA 3IRCA 1NEPA 4PJIA 3HFMH 5F7LB 4ZO9A 3QWNA 1HIMH 5F7FA 5AW0B 2CKNA 3S37X 5EBLA 5C0AB 3IGAB 4I5BA 4XPTL 3WKNA 3UAAA 4KKZA 1E0OB 4XNYL 4CW1B 3BXNA 1UUSA 5F1OB 1XB6A 3AY4A 1XIWA 3K8KA 1CURA 1QRKA 4ZUVB 3ZDXE 2F0CA 5GGTL 1ZV2A 2ICWB 4O2EA 1M9WA 2VYRE 4MX7B 2FWUA 3ZKQD 4NKOA 1FFTB 2QBWA 4ZMXA 3T77A 1MFBH 1II4E 4HOXA 4PRAA 1PY9A 1FFOB 1JTPA 4AQAA 3VFMA 2XTJE 4JJ5A 4UOQA 5C07D 3ZDYE 4GOSA 1BA9A 4PY7A 1V3KA 4ZI8A 4LCCA 4U0QB 1MCOH 5K59F 5JIQA 4PRPE 1DUZA 1P7QA 2WXRA 2XZZA 1SHMA 3UP1A 5BW7C 1FGNL 4A38A 1RCYA 1Z0MA 4PHZA 2WYHA 3EAKA 1BVNP 2GQHA 5JQHC 3AGVA 1KMGA 5DJYB 2K9FB 4LCCC 5I71C 3P4NB 1DQKA 5MENA 1EFQA 4MLIA 5TF0A 5JZ7C 3U2IA 5I1GL 3A6CL 4HGWB 5JUEH 3KL5A 2BIPA 3OAYK 5C6TH 3KXFE 2VDOL 5IJVB 1U8LA 4W81A 1MVFA 4CL7A 2CRZA 3QXWA 4DKAA 2AJYL 4XB7A 5ACMA 4W9HC 3ILDA 1QATA 1M4KA 3T0DA 4N2NA 1E5CA 4HK3N 4GEJA 2GUOB 1OO2A 2P5WA 1NAMA 1YEGH 2MPVA 4Z0XB 3Q5OA 1XAKA 2P5EA 3NDYE 4HX1B 4I77L 3T6WA 5AZUA 5DD1H 5I5JA 3FO9B 4FCAA 4YIQB 4GMSL 3HI1A 5IV2A 1XGQA 2A9AA 5IW6A 1KCVL 3I6SA 3VG0L 5TJWK 5FLVA 1NOLA 2DYPB 5AKTA 5E6RB 1AIZA 5L6YH 4P49A 1E90A 2EECA 3COOA 3K8LA 3GJFK 4Y9BA 4ZDHA 4UM9A 4DVBA 3IETA 4FKHA 3EUUA 5A2JH 5AOLA 1M56B 2OYMA 3IKCB 4NN5B 3ULAB 4ONGH 2ESVE 4G42A 4KHXH 4F7CA 3DIDA 2HYMA 3EXLA 3I9GL 2X1XR 3BSHA 1I3UA 2IQAB 3APDA 4P46A 5IMKA 3TBSB 1UM6L 3GMNA 5KW9L 3RIFF 4YSAA 2QFPA 2RFXB 1WFJA 4OBRA 3ILPA 5EEYA 5IJCC 2FYYA 1ZEAL 3L5IA 4F93B 2XA8L 2DQCH 3C5ZB 5C0CD 3OF6A 1N8ZA 2XTSA 3MRGA 2XWZA 3GMQA 3N1QC 1IKNA 2XC8A 2ITFA 4JN2B 4O5LH 2N56A 5IBUG 3IAGC 1RZGB 3OZ9H 4BSWA 3OXSB 2HRLA 1N26A 4NPKA 1D5MB 4LSPL 2CCLA 5HHQA 4GBXB 2EIZA 2A1WH 3SB3A 1G4MA 3S3DB 4RZCA 5TGBB 3U9UA 4BA0A 1L3WA 1JPTH 3PHQB 1RUAL 3CZGA 1FO0B 1KPVB 2X0WA 3KE0A 5D2NC 5EC2B 5ID0A 2HJFA 4RMVA 3B3IA 5C6WH 5E03A 3NJKA 1HI6B 5GRYA 4N3TA 4OD1H 4TVPL 4LU5H 2VH5L 1HCVA 2C7UA 3U7WL 2NYZA 4OIIH 1WAAA 5CKGA 5C09D 3CG8A 3CDYA 2XXGA 2CO6A 4JFUA 1AD0B 2YIHA 2HP4A 1KGWA 2QSQA 3V4VB 4DW2H 2QPFA 4N0FA 4NJAL 2R51A 5T3XE 3BGAA 3HS0C 3TBYB 5EIIB 1QX1A 4AM0B 5F44A 1TR7A 4BGDA 4E0RB 4XPGL 2HRGA 2KZKA 2WYZA 4J3OC 2ZOUA 1I82A 1H15A 4JQIH 3EYVB 3RDTD 4ZD3H 5C08E 5FYLD 1KIQA 5KYUA 5FOJA 4BK8A 4YLBA 2FBJH 2NXZB 2DMBA 4IDLA 35C8H 3QVAA 3H3KA 1S7QA 4O2FA 5KG9B 3GSNA 4ES8A 1U91A 3WNNA 4L9DA 4K9JA 3VXSE 3U0PB 4DJMA 2KZWA 2ICEB 2JE8A 3L2MA 2ZSWB 1A7PL 5DD6B 1WZMA 4XCNB 1Y0LA 2FUTA 4Y2LA 1SQ2N 2H4EA 3JWDL 1F58H 4PJGB 4NRZA 3MNVA 1KIUB 4X99B 2B9AA 3FCUB 1U3HD 3BZ4B 4V1DA 4N0RA 3U1SH 1F4WH 3FU5A 3AC0A 4EI0A 4NAQA 5D7IB 1A1NB 1MAML 1MFEH 4MFHA 3T0XA 3UTPE 3QZLA 2XWBB 5DLMH 1UB6B 4XPBH 5D1ZB 2IG2H 2ZKMX 4NQED 4AGLA 4GT7A 4NZ8A 4HLEA 5E70A 4NWTH 4KNSA 2XQYG 4KY1H 8FABA