2B3KA

Crystal structure of human methionine aminopeptidase type i in the holo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3kA00
2GG0A 4QR8A 2GU5A 2BB7A 1JAWA 3IU7A 3IG4A 3PKEA 2GG3A 2Q8KA 1QXZA 4B28A 2Q95A 2Q94A 4IKTA 4RZYA 4R60A 2BWUA 5JI6A 4IPAA 4FLLA 4U6EA 3TAVA 1C22A 3IU8A 2MATA 1YW8A 2EVCA 4IU6A 2GGBA 2ZSGA 2Q96A 1QZYA 3IU9A 3FMQA 1WL9A 2HOWA 1MATA 3PKBA 4IKSA 2BN7A 4IKRA 1XGNA 1QXYA 2P99A 1Y1NA 2P9AA 3BIPA 4HXXA 2GG9A 2NQ6A 3BIQA 2BHAA 4RGZ1 1XGMA 2GA2A 5CE6A 1BN5A 1WKMA 2B3LA 4OOKA 4S2TP 4U75A 2ADUA 1R5HA 2BWSA 3Q6DA 4U76A 3S6BA 4FO8A 3BITA 2BWXA 3MATA 3FM3A 2GZ5A 2B3KA 3PKCA 4FUKA 4U69A 3CB5A 2GU6A 4A6VA 4JUQA 1WL6A 1YVMA 1WY2A 5D6EA 1XNZA 4MATA 1KQ9A 4U6WA 2NQ7A 1BOAA 2BHDA 2GG7A 1W2MA 2GG8A 1WLRA 2EA4A 2V3ZA 4ZWPA 1B6AA 3CB6A 4U6ZA 4FO7A 1C27A 5E5BA 1CHMA 4RZZA 4U1BA 4IKUA 4FLJA 2BWWA 1N51A 1B59A 3L7GA 1PV9A 3PKAA 4U6CA 1QXWA 1M35A 5CIKA 4ZWUA 4Z7MA 2EVOA 5FCHA 2DFIA 2BHCA 2OAZA 2GG5A 4EGEA 5JHUA 4FKCA 2IW2A 2P98A 2GG2A 2V3YA 4KM3A 1KP0A 1C23A 1C21A 1YW7A 1XGSA 2G6PA 3MX6A 1KQ0A 3CTZA 4ZWOA 4IF7A 1R5GA 5CDEA 4U73A 2OKNA 2V3XA 1YJ3A 4ZNGA 2GU7A 3RVAA 5FCFA 4FLIA 5CDVA 4PNCA 1C24A 4A6WA 4IECA 2GU4A 2B3HA 1O0XA 1WN1A 3MR1A 1WBQA 4U70A 2BH3A 4U6JA 1YW9A 2V6CA 2BWTA 5CDLA 4S01A 1XGOA 4U71A 4S2RP 1W7VA 2GGCA 2GTXA 3L24A 3PKDA 2EVMA 3FMRA 2BHBA 2Q93A 2BWYA 4FLKA 4PV4A 4S00A 5CNXA 4IDYA 5JFRA 2BWVA 5CLSA 3TB5A 1A16A 3D27A 2EA2A 5D6FA 3RORA 1R58A 2Q92A
chains in the Genus database with same CATH superfamily
2GG0A 4QR8A 2GU5A 2BB7A 1JAWA 3IU7A 3IG4A 3PKEA 2GG3A 2Q8KA 1QXZA 4B28A 2Q95A 2Q94A 4IKTA 4RZYA 4R60A 2BWUA 5JI6A 4IPAA 4FLLA 4U6EA 3TAVA 1C22A 3IU8A 2MATA 1YW8A 2EVCA 4IU6A 2GGBA 2ZSGA 2Q96A 1QZYA 3IU9A 3FMQA 1WL9A 2HOWA 1MATA 3PKBA 4IKSA 2BN7A 4IKRA 1XGNA 1QXYA 2P99A 1Y1NA 2P9AA 3BIPA 4HXXA 2GG9A 2NQ6A 3BIQA 2BHAA 4RGZ1 1XGMA 2GA2A 5CE6A 1BN5A 1WKMA 2B3LA 4OOKA 4S2TP 4U75A 2ADUA 1R5HA 2BWSA 3Q6DA 4U76A 3S6BA 4FO8A 3BITA 2BWXA 3MATA 3FM3A 2GZ5A 2B3KA 3PKCA 4FUKA 4U69A 3CB5A 2GU6A 4A6VA 4JUQA 1WL6A 1YVMA 1WY2A 5D6EA 1XNZA 4MATA 1KQ9A 4U6WA 2NQ7A 1BOAA 2BHDA 2GG7A 1W2MA 2GG8A 1WLRA 2EA4A 2V3ZA 4ZWPA 1B6AA 3CB6A 4U6ZA 4FO7A 1C27A 5E5BA 1CHMA 4RZZA 4U1BA 4IKUA 4FLJA 2BWWA 1N51A 1B59A 3L7GA 1PV9A 3PKAA 4U6CA 1QXWA 1M35A 5CIKA 4ZWUA 4Z7MA 2EVOA 5FCHA 2DFIA 2BHCA 2OAZA 2GG5A 4EGEA 5JHUA 4FKCA 2IW2A 2P98A 2GG2A 2V3YA 4KM3A 1KP0A 1C23A 1C21A 1YW7A 1XGSA 2G6PA 3MX6A 1KQ0A 3CTZA 4ZWOA 4IF7A 1R5GA 5CDEA 4U73A 2OKNA 2V3XA 1YJ3A 4ZNGA 2GU7A 3RVAA 5FCFA 4FLIA 5CDVA 4PNCA 1C24A 4A6WA 4IECA 2GU4A 2B3HA 1O0XA 1WN1A 3MR1A 1WBQA 4U70A 2BH3A 4U6JA 1YW9A 2V6CA 2BWTA 5CDLA 4S01A 1XGOA 4U71A 4S2RP 1W7VA 2GGCA 2GTXA 3L24A 3PKDA 2EVMA 3FMRA 2BHBA 2Q93A 2BWYA 4FLKA 4PV4A 4S00A 5CNXA 4IDYA 5JFRA 2BWVA 5CLSA 3TB5A 1A16A 3D27A 2EA2A 5D6FA 3RORA 1R58A 2Q92A
chains in the Genus database with same CATH topology
2GG0A 4QR8A 2GU5A 2BB7A 1JAWA 3IU7A 3IG4A 3PKEA 2GG3A 2Q8KA 1QXZA 4B28A 2Q95A 2Q94A 4IKTA 4RZYA 4R60A 2BWUA 5JI6A 4IPAA 4FLLA 4U6EA 3TAVA 1C22A 3IU8A 2MATA 1YW8A 2EVCA 4IU6A 2GGBA 2ZSGA 2Q96A 1QZYA 3IU9A 3FMQA 1WL9A 2HOWA 1MATA 3PKBA 4IKSA 2BN7A 4IKRA 1XGNA 1QXYA 2P99A 1Y1NA 2P9AA 3BIPA 4HXXA 2GG9A 2NQ6A 3BIQA 2BHAA 4RGZ1 1XGMA 2GA2A 5CE6A 1BN5A 1WKMA 2B3LA 4OOKA 4S2TP 4U75A 2ADUA 1R5HA 2BWSA 3Q6DA 4U76A 3S6BA 4FO8A 3BITA 2BWXA 3MATA 3FM3A 2GZ5A 2B3KA 3PKCA 4FUKA 4U69A 3CB5A 2GU6A 4A6VA 4JUQA 1WL6A 1YVMA 1WY2A 5D6EA 1XNZA 4MATA 1KQ9A 4U6WA 2NQ7A 1BOAA 2BHDA 2GG7A 1W2MA 2GG8A 1WLRA 2EA4A 2V3ZA 4ZWPA 1B6AA 3CB6A 4U6ZA 4FO7A 1C27A 5E5BA 1CHMA 4RZZA 4U1BA 4IKUA 4FLJA 2BWWA 1N51A 1B59A 3L7GA 1PV9A 3PKAA 4U6CA 1QXWA 1M35A 5CIKA 4ZWUA 4Z7MA 2EVOA 5FCHA 2DFIA 2BHCA 2OAZA 2GG5A 4EGEA 5JHUA 4FKCA 2IW2A 2P98A 2GG2A 2V3YA 4KM3A 1KP0A 1C23A 1C21A 1YW7A 1XGSA 2G6PA 3MX6A 1KQ0A 3CTZA 4ZWOA 4IF7A 1R5GA 5CDEA 4U73A 2OKNA 2V3XA 1YJ3A 4ZNGA 2GU7A 3RVAA 5FCFA 4FLIA 5CDVA 4PNCA 1C24A 4A6WA 4IECA 2GU4A 2B3HA 1O0XA 1WN1A 3MR1A 1WBQA 4U70A 2BH3A 4U6JA 1YW9A 2V6CA 2BWTA 5CDLA 4S01A 1XGOA 4U71A 4S2RP 1W7VA 2GGCA 2GTXA 3L24A 3PKDA 2EVMA 3FMRA 2BHBA 2Q93A 2BWYA 4FLKA 4PV4A 4S00A 5CNXA 4IDYA 5JFRA 2BWVA 5CLSA 3TB5A 1A16A 3D27A 2EA2A 5D6FA 3RORA 1R58A 2Q92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG0 A;  4QR8 A;  2GU5 A;  2BB7 A;  1JAW A;  3IU7 A;  3IG4 A;  3PKE A;  2GG3 A;  2Q8K A;  1QXZ A;  4B28 A;  2Q95 A;  2Q94 A;  4IKT A;  4RZY A;  4R60 A;  2BWU A;  5JI6 A;  4IPA A;  4FLL A;  4U6E A;  3TAV A;  1C22 A;  3IU8 A;  2MAT A;  1YW8 A;  2EVC A;  4IU6 A;  2GGB A;  2ZSG A;  2Q96 A;  1QZY A;  3IU9 A;  3FMQ A;  1WL9 A;  2HOW A;  1MAT A;  3PKB A;  4IKS A;  2BN7 A;  4IKR A;  1XGN A;  1QXY A;  2P99 A;  1Y1N A;  2P9A A;  3BIP A;  4HXX A;  2GG9 A;  2NQ6 A;  3BIQ A;  2BHA A;  4RGZ 1;  1XGM A;  2GA2 A;  5CE6 A;  1BN5 A;  1WKM A;  2B3L A;  4OOK A;  4S2T P;  4U75 A;  2ADU A;  1R5H A;  2BWS A;  3Q6D A;  4U76 A;  3S6B A;  4FO8 A;  3BIT A;  2BWX A;  3MAT A;  3FM3 A;  2GZ5 A;  2B3K A;  3PKC A;  4FUK A;  4U69 A;  3CB5 A;  2GU6 A;  4A6V A;  4JUQ A;  1WL6 A;  1YVM A;  1WY2 A;  5D6E A;  1XNZ A;  4MAT A;  1KQ9 A;  4U6W A;  2NQ7 A;  1BOA A;  2BHD A;  2GG7 A;  1W2M A;  2GG8 A;  1WLR A;  2EA4 A;  2V3Z A;  4ZWP A;  1B6A A;  3CB6 A;  4U6Z A;  4FO7 A;  1C27 A;  5E5B A;  1CHM A;  4RZZ A;  4U1B A;  4IKU A;  4FLJ A;  2BWW A;  1N51 A;  1B59 A;  3L7G A;  1PV9 A;  3PKA A;  4U6C A;  1QXW A;  1M35 A;  5CIK A;  4ZWU A;  4Z7M A;  2EVO A;  5FCH A;  2DFI A;  2BHC A;  2OAZ A;  2GG5 A;  4EGE A;  5JHU A;  4FKC A;  2IW2 A;  2P98 A;  2GG2 A;  2V3Y A;  4KM3 A;  1KP0 A;  1C23 A;  1C21 A;  1YW7 A;  1XGS A;  2G6P A;  3MX6 A;  1KQ0 A;  3CTZ A;  4ZWO A;  4IF7 A;  1R5G A;  5CDE A;  4U73 A;  2OKN A;  2V3X A;  1YJ3 A;  4ZNG A;  2GU7 A;  3RVA A;  5FCF A;  4FLI A;  5CDV A;  4PNC A;  1C24 A;  4A6W A;  4IEC A;  2GU4 A;  2B3H A;  1O0X A;  1WN1 A;  3MR1 A;  1WBQ A;  4U70 A;  2BH3 A;  4U6J A;  1YW9 A;  2V6C A;  2BWT A;  5CDL A;  4S01 A;  1XGO A;  4U71 A;  4S2R P;  1W7V A;  2GGC A;  2GTX A;  3L24 A;  3PKD A;  2EVM A;  3FMR A;  2BHB A;  2Q93 A;  2BWY A;  4FLK A;  4PV4 A;  4S00 A;  5CNX A;  4IDY A;  5JFR A;  2BWV A;  5CLS A;  3TB5 A;  1A16 A;  3D27 A;  2EA2 A;  5D6F A;  3ROR A;  1R58 A;  2Q92 A; 
#chains in the Genus database with same CATH topology
 2GG0 A;  4QR8 A;  2GU5 A;  2BB7 A;  1JAW A;  3IU7 A;  3IG4 A;  3PKE A;  2GG3 A;  2Q8K A;  1QXZ A;  4B28 A;  2Q95 A;  2Q94 A;  4IKT A;  4RZY A;  4R60 A;  2BWU A;  5JI6 A;  4IPA A;  4FLL A;  4U6E A;  3TAV A;  1C22 A;  3IU8 A;  2MAT A;  1YW8 A;  2EVC A;  4IU6 A;  2GGB A;  2ZSG A;  2Q96 A;  1QZY A;  3IU9 A;  3FMQ A;  1WL9 A;  2HOW A;  1MAT A;  3PKB A;  4IKS A;  2BN7 A;  4IKR A;  1XGN A;  1QXY A;  2P99 A;  1Y1N A;  2P9A A;  3BIP A;  4HXX A;  2GG9 A;  2NQ6 A;  3BIQ A;  2BHA A;  4RGZ 1;  1XGM A;  2GA2 A;  5CE6 A;  1BN5 A;  1WKM A;  2B3L A;  4OOK A;  4S2T P;  4U75 A;  2ADU A;  1R5H A;  2BWS A;  3Q6D A;  4U76 A;  3S6B A;  4FO8 A;  3BIT A;  2BWX A;  3MAT A;  3FM3 A;  2GZ5 A;  2B3K A;  3PKC A;  4FUK A;  4U69 A;  3CB5 A;  2GU6 A;  4A6V A;  4JUQ A;  1WL6 A;  1YVM A;  1WY2 A;  5D6E A;  1XNZ A;  4MAT A;  1KQ9 A;  4U6W A;  2NQ7 A;  1BOA A;  2BHD A;  2GG7 A;  1W2M A;  2GG8 A;  1WLR A;  2EA4 A;  2V3Z A;  4ZWP A;  1B6A A;  3CB6 A;  4U6Z A;  4FO7 A;  1C27 A;  5E5B A;  1CHM A;  4RZZ A;  4U1B A;  4IKU A;  4FLJ A;  2BWW A;  1N51 A;  1B59 A;  3L7G A;  1PV9 A;  3PKA A;  4U6C A;  1QXW A;  1M35 A;  5CIK A;  4ZWU A;  4Z7M A;  2EVO A;  5FCH A;  2DFI A;  2BHC A;  2OAZ A;  2GG5 A;  4EGE A;  5JHU A;  4FKC A;  2IW2 A;  2P98 A;  2GG2 A;  2V3Y A;  4KM3 A;  1KP0 A;  1C23 A;  1C21 A;  1YW7 A;  1XGS A;  2G6P A;  3MX6 A;  1KQ0 A;  3CTZ A;  4ZWO A;  4IF7 A;  1R5G A;  5CDE A;  4U73 A;  2OKN A;  2V3X A;  1YJ3 A;  4ZNG A;  2GU7 A;  3RVA A;  5FCF A;  4FLI A;  5CDV A;  4PNC A;  1C24 A;  4A6W A;  4IEC A;  2GU4 A;  2B3H A;  1O0X A;  1WN1 A;  3MR1 A;  1WBQ A;  4U70 A;  2BH3 A;  4U6J A;  1YW9 A;  2V6C A;  2BWT A;  5CDL A;  4S01 A;  1XGO A;  4U71 A;  4S2R P;  1W7V A;  2GGC A;  2GTX A;  3L24 A;  3PKD A;  2EVM A;  3FMR A;  2BHB A;  2Q93 A;  2BWY A;  4FLK A;  4PV4 A;  4S00 A;  5CNX A;  4IDY A;  5JFR A;  2BWV A;  5CLS A;  3TB5 A;  1A16 A;  3D27 A;  2EA2 A;  5D6F A;  3ROR A;  1R58 A;  2Q92 A; 
#chains in the Genus database with same CATH homology
 2GG0 A;  4QR8 A;  2GU5 A;  2BB7 A;  1JAW A;  3IU7 A;  3IG4 A;  3PKE A;  2GG3 A;  2Q8K A;  1QXZ A;  4B28 A;  2Q95 A;  2Q94 A;  4IKT A;  4RZY A;  4R60 A;  2BWU A;  5JI6 A;  4IPA A;  4FLL A;  4U6E A;  3TAV A;  1C22 A;  3IU8 A;  2MAT A;  1YW8 A;  2EVC A;  4IU6 A;  2GGB A;  2ZSG A;  2Q96 A;  1QZY A;  3IU9 A;  3FMQ A;  1WL9 A;  2HOW A;  1MAT A;  3PKB A;  4IKS A;  2BN7 A;  4IKR A;  1XGN A;  1QXY A;  2P99 A;  1Y1N A;  2P9A A;  3BIP A;  4HXX A;  2GG9 A;  2NQ6 A;  3BIQ A;  2BHA A;  4RGZ 1;  1XGM A;  2GA2 A;  5CE6 A;  1BN5 A;  1WKM A;  2B3L A;  4OOK A;  4S2T P;  4U75 A;  2ADU A;  1R5H A;  2BWS A;  3Q6D A;  4U76 A;  3S6B A;  4FO8 A;  3BIT A;  2BWX A;  3MAT A;  3FM3 A;  2GZ5 A;  2B3K A;  3PKC A;  4FUK A;  4U69 A;  3CB5 A;  2GU6 A;  4A6V A;  4JUQ A;  1WL6 A;  1YVM A;  1WY2 A;  5D6E A;  1XNZ A;  4MAT A;  1KQ9 A;  4U6W A;  2NQ7 A;  1BOA A;  2BHD A;  2GG7 A;  1W2M A;  2GG8 A;  1WLR A;  2EA4 A;  2V3Z A;  4ZWP A;  1B6A A;  3CB6 A;  4U6Z A;  4FO7 A;  1C27 A;  5E5B A;  1CHM A;  4RZZ A;  4U1B A;  4IKU A;  4FLJ A;  2BWW A;  1N51 A;  1B59 A;  3L7G A;  1PV9 A;  3PKA A;  4U6C A;  1QXW A;  1M35 A;  5CIK A;  4ZWU A;  4Z7M A;  2EVO A;  5FCH A;  2DFI A;  2BHC A;  2OAZ A;  2GG5 A;  4EGE A;  5JHU A;  4FKC A;  2IW2 A;  2P98 A;  2GG2 A;  2V3Y A;  4KM3 A;  1KP0 A;  1C23 A;  1C21 A;  1YW7 A;  1XGS A;  2G6P A;  3MX6 A;  1KQ0 A;  3CTZ A;  4ZWO A;  4IF7 A;  1R5G A;  5CDE A;  4U73 A;  2OKN A;  2V3X A;  1YJ3 A;  4ZNG A;  2GU7 A;  3RVA A;  5FCF A;  4FLI A;  5CDV A;  4PNC A;  1C24 A;  4A6W A;  4IEC A;  2GU4 A;  2B3H A;  1O0X A;  1WN1 A;  3MR1 A;  1WBQ A;  4U70 A;  2BH3 A;  4U6J A;  1YW9 A;  2V6C A;  2BWT A;  5CDL A;  4S01 A;  1XGO A;  4U71 A;  4S2R P;  1W7V A;  2GGC A;  2GTX A;  3L24 A;  3PKD A;  2EVM A;  3FMR A;  2BHB A;  2Q93 A;  2BWY A;  4FLK A;  4PV4 A;  4S00 A;  5CNX A;  4IDY A;  5JFR A;  2BWV A;  5CLS A;  3TB5 A;  1A16 A;  3D27 A;  2EA2 A;  5D6F A;  3ROR A;  1R58 A;  2Q92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...