2B3KA

Crystal structure of human methionine aminopeptidase type i in the holo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3kA00
3BIQA 2G6PA 2V6CA 4IKRA 1BN5A 3FMRA 1C22A 4FO7A 5JFRA 2EVMA 3BITA 2GU5A 2IW2A 4IECA 2BWYA 1A16A 3Q6DA 4U6EA 4B28A 4RZYA 4U70A 2GG7A 2Q96A 5CNXA 2HOWA 3IG4A 3BIPA 1BOAA 2EVOA 1C23A 1CHMA 3PKEA 3MX6A 2NQ6A 5JI6A 2GU7A 1XGSA 1B6AA 2V3YA 4A6VA 2GA2A 1B59A 2P98A 1XGNA 4U69A 4ZWPA 4Z7MA 2B3KA 3TAVA 4U6CA 5CIKA 5D6FA 4FLKA 3FMQA 3MR1A 4U6ZA 2GG0A 2BN7A 3L7GA 2ADUA 3CB6A 4KM3A 4ZNGA 4IKTA 2GGBA 4U6WA 3IU7A 5CDEA 4FKCA 5JHUA 5FCHA 2GG5A 5CE6A 4S01A 1KP0A 2Q8KA 1YJ3A 2NQ7A 3IU9A 3RVAA 5E5BA 1M35A 1R58A 2BWWA 1WLRA 1N51A 2BWVA 4U73A 2GU4A 2V3ZA 3S6BA 2GU6A 4U76A 1YW8A 3L24A 3PKCA 1QZYA 2BHCA 2Q92A 2DFIA 4S2TP 2MATA 1YW9A 4IU6A 5CLSA 2GG3A 1KQ0A 1WL6A 1QXYA 4EGEA 4U6JA 1WL9A 2EVCA 2GZ5A 4MATA 2Q95A 1W2MA 2BB7A 1MATA 2BHDA 2Q94A 4FLJA 4FUKA 1KQ9A 2BWTA 4R60A 4FLLA 4A6WA 2BH3A 1C21A 2P9AA 5FCFA 5CDLA 2GGCA 1YVMA 1XNZA 3D27A 4RZZA 1WKMA 1C24A 2BHAA 1R5HA 3PKDA 2BWXA 1R5GA 3TB5A 3IU8A 3PKAA 2B3LA 4QR8A 2GG9A 4HXXA 4JUQA 4RGZ1 4IKUA 2V3XA 4IKSA 3CB5A 2OAZA 4ZWUA 1WBQA 2Q93A 2BHBA 4S2RP 4PNCA 4FO8A 4U75A 1C27A 1O0XA 2GG8A 4IDYA 4S00A 5CDVA 2EA2A 4U1BA 1Y1NA 3MATA 1WN1A 3CTZA 2BWSA 4PV4A 4ZWOA 2OKNA 1YW7A 2GG2A 1XGOA 1JAWA 2GTXA 1XGMA 4U71A 3PKBA 3RORA 2EA4A 1PV9A 1W7VA 1QXWA 2P99A 4IF7A 4OOKA 1QXZA 4IPAA 3FM3A 2B3HA 4FLIA 2BWUA 2ZSGA 5D6EA 1WY2A
chains in the Genus database with same CATH superfamily
3BIQA 2G6PA 2V6CA 4IKRA 1BN5A 3FMRA 1C22A 4FO7A 5JFRA 2EVMA 3BITA 2GU5A 2IW2A 4IECA 2BWYA 1A16A 3Q6DA 4U6EA 4B28A 4RZYA 4U70A 2GG7A 2Q96A 5CNXA 2HOWA 3IG4A 3BIPA 1BOAA 2EVOA 1C23A 1CHMA 3PKEA 3MX6A 2NQ6A 5JI6A 2GU7A 1XGSA 1B6AA 2V3YA 4A6VA 2GA2A 1B59A 2P98A 1XGNA 4U69A 4ZWPA 4Z7MA 2B3KA 3TAVA 4U6CA 5CIKA 5D6FA 4FLKA 3FMQA 3MR1A 4U6ZA 2GG0A 2BN7A 3L7GA 2ADUA 3CB6A 4KM3A 4ZNGA 4IKTA 2GGBA 4U6WA 3IU7A 5CDEA 4FKCA 5JHUA 5FCHA 2GG5A 5CE6A 4S01A 1KP0A 2Q8KA 1YJ3A 2NQ7A 3IU9A 3RVAA 5E5BA 1M35A 1R58A 2BWWA 1WLRA 1N51A 2BWVA 4U73A 2GU4A 2V3ZA 3S6BA 2GU6A 4U76A 1YW8A 3L24A 3PKCA 1QZYA 2BHCA 2Q92A 2DFIA 4S2TP 2MATA 1YW9A 4IU6A 5CLSA 2GG3A 1KQ0A 1WL6A 1QXYA 4EGEA 4U6JA 1WL9A 2EVCA 2GZ5A 4MATA 2Q95A 1W2MA 2BB7A 1MATA 2BHDA 2Q94A 4FLJA 4FUKA 1KQ9A 2BWTA 4R60A 4FLLA 4A6WA 2BH3A 1C21A 2P9AA 5FCFA 5CDLA 2GGCA 1YVMA 1XNZA 3D27A 4RZZA 1WKMA 1C24A 2BHAA 1R5HA 3PKDA 2BWXA 1R5GA 3TB5A 3IU8A 3PKAA 2B3LA 4QR8A 2GG9A 4HXXA 4JUQA 4RGZ1 4IKUA 2V3XA 4IKSA 3CB5A 2OAZA 4ZWUA 1WBQA 2Q93A 2BHBA 4S2RP 4PNCA 4FO8A 4U75A 1C27A 1O0XA 2GG8A 4IDYA 4S00A 5CDVA 2EA2A 4U1BA 1Y1NA 3MATA 1WN1A 3CTZA 2BWSA 4PV4A 4ZWOA 2OKNA 1YW7A 2GG2A 1XGOA 1JAWA 2GTXA 1XGMA 4U71A 3PKBA 3RORA 2EA4A 1PV9A 1W7VA 1QXWA 2P99A 4IF7A 4OOKA 1QXZA 4IPAA 3FM3A 2B3HA 4FLIA 2BWUA 2ZSGA 5D6EA 1WY2A
chains in the Genus database with same CATH topology
3BIQA 2G6PA 2V6CA 4IKRA 1BN5A 3FMRA 1C22A 4FO7A 5JFRA 2EVMA 3BITA 2GU5A 2IW2A 4IECA 2BWYA 1A16A 3Q6DA 4U6EA 4B28A 4RZYA 4U70A 2GG7A 2Q96A 5CNXA 2HOWA 3IG4A 3BIPA 1BOAA 2EVOA 1C23A 1CHMA 3PKEA 3MX6A 2NQ6A 5JI6A 2GU7A 1XGSA 1B6AA 2V3YA 4A6VA 2GA2A 1B59A 2P98A 1XGNA 4U69A 4ZWPA 4Z7MA 2B3KA 3TAVA 4U6CA 5CIKA 5D6FA 4FLKA 3FMQA 3MR1A 4U6ZA 2GG0A 2BN7A 3L7GA 2ADUA 3CB6A 4KM3A 4ZNGA 4IKTA 2GGBA 4U6WA 3IU7A 5CDEA 4FKCA 5JHUA 5FCHA 2GG5A 5CE6A 4S01A 1KP0A 2Q8KA 1YJ3A 2NQ7A 3IU9A 3RVAA 5E5BA 1M35A 1R58A 2BWWA 1WLRA 1N51A 2BWVA 4U73A 2GU4A 2V3ZA 3S6BA 2GU6A 4U76A 1YW8A 3L24A 3PKCA 1QZYA 2BHCA 2Q92A 2DFIA 4S2TP 2MATA 1YW9A 4IU6A 5CLSA 2GG3A 1KQ0A 1WL6A 1QXYA 4EGEA 4U6JA 1WL9A 2EVCA 2GZ5A 4MATA 2Q95A 1W2MA 2BB7A 1MATA 2BHDA 2Q94A 4FLJA 4FUKA 1KQ9A 2BWTA 4R60A 4FLLA 4A6WA 2BH3A 1C21A 2P9AA 5FCFA 5CDLA 2GGCA 1YVMA 1XNZA 3D27A 4RZZA 1WKMA 1C24A 2BHAA 1R5HA 3PKDA 2BWXA 1R5GA 3TB5A 3IU8A 3PKAA 2B3LA 4QR8A 2GG9A 4HXXA 4JUQA 4RGZ1 4IKUA 2V3XA 4IKSA 3CB5A 2OAZA 4ZWUA 1WBQA 2Q93A 2BHBA 4S2RP 4PNCA 4FO8A 4U75A 1C27A 1O0XA 2GG8A 4IDYA 4S00A 5CDVA 2EA2A 4U1BA 1Y1NA 3MATA 1WN1A 3CTZA 2BWSA 4PV4A 4ZWOA 2OKNA 1YW7A 2GG2A 1XGOA 1JAWA 2GTXA 1XGMA 4U71A 3PKBA 3RORA 2EA4A 1PV9A 1W7VA 1QXWA 2P99A 4IF7A 4OOKA 1QXZA 4IPAA 3FM3A 2B3HA 4FLIA 2BWUA 2ZSGA 5D6EA 1WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  2G6P A;  2V6C A;  4IKR A;  1BN5 A;  3FMR A;  1C22 A;  4FO7 A;  5JFR A;  2EVM A;  3BIT A;  2GU5 A;  2IW2 A;  4IEC A;  2BWY A;  1A16 A;  3Q6D A;  4U6E A;  4B28 A;  4RZY A;  4U70 A;  2GG7 A;  2Q96 A;  5CNX A;  2HOW A;  3IG4 A;  3BIP A;  1BOA A;  2EVO A;  1C23 A;  1CHM A;  3PKE A;  3MX6 A;  2NQ6 A;  5JI6 A;  2GU7 A;  1XGS A;  1B6A A;  2V3Y A;  4A6V A;  2GA2 A;  1B59 A;  2P98 A;  1XGN A;  4U69 A;  4ZWP A;  4Z7M A;  2B3K A;  3TAV A;  4U6C A;  5CIK A;  5D6F A;  4FLK A;  3FMQ A;  3MR1 A;  4U6Z A;  2GG0 A;  2BN7 A;  3L7G A;  2ADU A;  3CB6 A;  4KM3 A;  4ZNG A;  4IKT A;  2GGB A;  4U6W A;  3IU7 A;  5CDE A;  4FKC A;  5JHU A;  5FCH A;  2GG5 A;  5CE6 A;  4S01 A;  1KP0 A;  2Q8K A;  1YJ3 A;  2NQ7 A;  3IU9 A;  3RVA A;  5E5B A;  1M35 A;  1R58 A;  2BWW A;  1WLR A;  1N51 A;  2BWV A;  4U73 A;  2GU4 A;  2V3Z A;  3S6B A;  2GU6 A;  4U76 A;  1YW8 A;  3L24 A;  3PKC A;  1QZY A;  2BHC A;  2Q92 A;  2DFI A;  4S2T P;  2MAT A;  1YW9 A;  4IU6 A;  5CLS A;  2GG3 A;  1KQ0 A;  1WL6 A;  1QXY A;  4EGE A;  4U6J A;  1WL9 A;  2EVC A;  2GZ5 A;  4MAT A;  2Q95 A;  1W2M A;  2BB7 A;  1MAT A;  2BHD A;  2Q94 A;  4FLJ A;  4FUK A;  1KQ9 A;  2BWT A;  4R60 A;  4FLL A;  4A6W A;  2BH3 A;  1C21 A;  2P9A A;  5FCF A;  5CDL A;  2GGC A;  1YVM A;  1XNZ A;  3D27 A;  4RZZ A;  1WKM A;  1C24 A;  2BHA A;  1R5H A;  3PKD A;  2BWX A;  1R5G A;  3TB5 A;  3IU8 A;  3PKA A;  2B3L A;  4QR8 A;  2GG9 A;  4HXX A;  4JUQ A;  4RGZ 1;  4IKU A;  2V3X A;  4IKS A;  3CB5 A;  2OAZ A;  4ZWU A;  1WBQ A;  2Q93 A;  2BHB A;  4S2R P;  4PNC A;  4FO8 A;  4U75 A;  1C27 A;  1O0X A;  2GG8 A;  4IDY A;  4S00 A;  5CDV A;  2EA2 A;  4U1B A;  1Y1N A;  3MAT A;  1WN1 A;  3CTZ A;  2BWS A;  4PV4 A;  4ZWO A;  2OKN A;  1YW7 A;  2GG2 A;  1XGO A;  1JAW A;  2GTX A;  1XGM A;  4U71 A;  3PKB A;  3ROR A;  2EA4 A;  1PV9 A;  1W7V A;  1QXW A;  2P99 A;  4IF7 A;  4OOK A;  1QXZ A;  4IPA A;  3FM3 A;  2B3H A;  4FLI A;  2BWU A;  2ZSG A;  5D6E A;  1WY2 A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  2G6P A;  2V6C A;  4IKR A;  1BN5 A;  3FMR A;  1C22 A;  4FO7 A;  5JFR A;  2EVM A;  3BIT A;  2GU5 A;  2IW2 A;  4IEC A;  2BWY A;  1A16 A;  3Q6D A;  4U6E A;  4B28 A;  4RZY A;  4U70 A;  2GG7 A;  2Q96 A;  5CNX A;  2HOW A;  3IG4 A;  3BIP A;  1BOA A;  2EVO A;  1C23 A;  1CHM A;  3PKE A;  3MX6 A;  2NQ6 A;  5JI6 A;  2GU7 A;  1XGS A;  1B6A A;  2V3Y A;  4A6V A;  2GA2 A;  1B59 A;  2P98 A;  1XGN A;  4U69 A;  4ZWP A;  4Z7M A;  2B3K A;  3TAV A;  4U6C A;  5CIK A;  5D6F A;  4FLK A;  3FMQ A;  3MR1 A;  4U6Z A;  2GG0 A;  2BN7 A;  3L7G A;  2ADU A;  3CB6 A;  4KM3 A;  4ZNG A;  4IKT A;  2GGB A;  4U6W A;  3IU7 A;  5CDE A;  4FKC A;  5JHU A;  5FCH A;  2GG5 A;  5CE6 A;  4S01 A;  1KP0 A;  2Q8K A;  1YJ3 A;  2NQ7 A;  3IU9 A;  3RVA A;  5E5B A;  1M35 A;  1R58 A;  2BWW A;  1WLR A;  1N51 A;  2BWV A;  4U73 A;  2GU4 A;  2V3Z A;  3S6B A;  2GU6 A;  4U76 A;  1YW8 A;  3L24 A;  3PKC A;  1QZY A;  2BHC A;  2Q92 A;  2DFI A;  4S2T P;  2MAT A;  1YW9 A;  4IU6 A;  5CLS A;  2GG3 A;  1KQ0 A;  1WL6 A;  1QXY A;  4EGE A;  4U6J A;  1WL9 A;  2EVC A;  2GZ5 A;  4MAT A;  2Q95 A;  1W2M A;  2BB7 A;  1MAT A;  2BHD A;  2Q94 A;  4FLJ A;  4FUK A;  1KQ9 A;  2BWT A;  4R60 A;  4FLL A;  4A6W A;  2BH3 A;  1C21 A;  2P9A A;  5FCF A;  5CDL A;  2GGC A;  1YVM A;  1XNZ A;  3D27 A;  4RZZ A;  1WKM A;  1C24 A;  2BHA A;  1R5H A;  3PKD A;  2BWX A;  1R5G A;  3TB5 A;  3IU8 A;  3PKA A;  2B3L A;  4QR8 A;  2GG9 A;  4HXX A;  4JUQ A;  4RGZ 1;  4IKU A;  2V3X A;  4IKS A;  3CB5 A;  2OAZ A;  4ZWU A;  1WBQ A;  2Q93 A;  2BHB A;  4S2R P;  4PNC A;  4FO8 A;  4U75 A;  1C27 A;  1O0X A;  2GG8 A;  4IDY A;  4S00 A;  5CDV A;  2EA2 A;  4U1B A;  1Y1N A;  3MAT A;  1WN1 A;  3CTZ A;  2BWS A;  4PV4 A;  4ZWO A;  2OKN A;  1YW7 A;  2GG2 A;  1XGO A;  1JAW A;  2GTX A;  1XGM A;  4U71 A;  3PKB A;  3ROR A;  2EA4 A;  1PV9 A;  1W7V A;  1QXW A;  2P99 A;  4IF7 A;  4OOK A;  1QXZ A;  4IPA A;  3FM3 A;  2B3H A;  4FLI A;  2BWU A;  2ZSG A;  5D6E A;  1WY2 A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  2G6P A;  2V6C A;  4IKR A;  1BN5 A;  3FMR A;  1C22 A;  4FO7 A;  5JFR A;  2EVM A;  3BIT A;  2GU5 A;  2IW2 A;  4IEC A;  2BWY A;  1A16 A;  3Q6D A;  4U6E A;  4B28 A;  4RZY A;  4U70 A;  2GG7 A;  2Q96 A;  5CNX A;  2HOW A;  3IG4 A;  3BIP A;  1BOA A;  2EVO A;  1C23 A;  1CHM A;  3PKE A;  3MX6 A;  2NQ6 A;  5JI6 A;  2GU7 A;  1XGS A;  1B6A A;  2V3Y A;  4A6V A;  2GA2 A;  1B59 A;  2P98 A;  1XGN A;  4U69 A;  4ZWP A;  4Z7M A;  2B3K A;  3TAV A;  4U6C A;  5CIK A;  5D6F A;  4FLK A;  3FMQ A;  3MR1 A;  4U6Z A;  2GG0 A;  2BN7 A;  3L7G A;  2ADU A;  3CB6 A;  4KM3 A;  4ZNG A;  4IKT A;  2GGB A;  4U6W A;  3IU7 A;  5CDE A;  4FKC A;  5JHU A;  5FCH A;  2GG5 A;  5CE6 A;  4S01 A;  1KP0 A;  2Q8K A;  1YJ3 A;  2NQ7 A;  3IU9 A;  3RVA A;  5E5B A;  1M35 A;  1R58 A;  2BWW A;  1WLR A;  1N51 A;  2BWV A;  4U73 A;  2GU4 A;  2V3Z A;  3S6B A;  2GU6 A;  4U76 A;  1YW8 A;  3L24 A;  3PKC A;  1QZY A;  2BHC A;  2Q92 A;  2DFI A;  4S2T P;  2MAT A;  1YW9 A;  4IU6 A;  5CLS A;  2GG3 A;  1KQ0 A;  1WL6 A;  1QXY A;  4EGE A;  4U6J A;  1WL9 A;  2EVC A;  2GZ5 A;  4MAT A;  2Q95 A;  1W2M A;  2BB7 A;  1MAT A;  2BHD A;  2Q94 A;  4FLJ A;  4FUK A;  1KQ9 A;  2BWT A;  4R60 A;  4FLL A;  4A6W A;  2BH3 A;  1C21 A;  2P9A A;  5FCF A;  5CDL A;  2GGC A;  1YVM A;  1XNZ A;  3D27 A;  4RZZ A;  1WKM A;  1C24 A;  2BHA A;  1R5H A;  3PKD A;  2BWX A;  1R5G A;  3TB5 A;  3IU8 A;  3PKA A;  2B3L A;  4QR8 A;  2GG9 A;  4HXX A;  4JUQ A;  4RGZ 1;  4IKU A;  2V3X A;  4IKS A;  3CB5 A;  2OAZ A;  4ZWU A;  1WBQ A;  2Q93 A;  2BHB A;  4S2R P;  4PNC A;  4FO8 A;  4U75 A;  1C27 A;  1O0X A;  2GG8 A;  4IDY A;  4S00 A;  5CDV A;  2EA2 A;  4U1B A;  1Y1N A;  3MAT A;  1WN1 A;  3CTZ A;  2BWS A;  4PV4 A;  4ZWO A;  2OKN A;  1YW7 A;  2GG2 A;  1XGO A;  1JAW A;  2GTX A;  1XGM A;  4U71 A;  3PKB A;  3ROR A;  2EA4 A;  1PV9 A;  1W7V A;  1QXW A;  2P99 A;  4IF7 A;  4OOK A;  1QXZ A;  4IPA A;  3FM3 A;  2B3H A;  4FLI A;  2BWU A;  2ZSG A;  5D6E A;  1WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...