2B3KA

Crystal structure of human methionine aminopeptidase type i in the holo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3kA00
2GG7A 3TAVA 2P99A 4ZWOA 4S01A 4S2RP 1WBQA 2GG5A 4IKTA 2Q8KA 1M35A 4U75A 4U73A 5CDEA 5JI6A 3BIQA 2EA2A 5CNXA 3CB6A 3MR1A 1R58A 2GA2A 1BOAA 4FLIA 2NQ7A 1CHMA 1B6AA 3RORA 2B3KA 3BIPA 4FO7A 4A6VA 4KM3A 1N51A 5D6EA 2V3YA 4ZWPA 2ADUA 1W2MA 2GU7A 5JFRA 2BHAA 4OOKA 1WKMA 1WN1A 2EVMA 2BB7A 1C24A 2GGCA 2Q96A 2G6PA 4EGEA 4U1BA 2GU4A 1WY2A 1QXWA 4MATA 4IF7A 2OAZA 3MX6A 1B59A 3FM3A 4FKCA 1KP0A 3BITA 3D27A 4IDYA 1XGSA 5CIKA 2EVOA 4U6JA 2B3LA 1R5HA 1WLRA 1WL6A 3L7GA 4IKUA 5CLSA 2Q94A 2BWSA 1YW9A 5E5BA 2GG2A 4B28A 2Q93A 4PNCA 4ZNGA 1PV9A 4IKRA 4FLLA 2GG0A 4U6ZA 4ZWUA 1YW7A 2EA4A 4RZZA 2GGBA 2BHCA 1KQ0A 2GG8A 3PKAA 1YW8A 4IECA 4IKSA 2NQ6A 4JUQA 2B3HA 3Q6DA 1XGOA 2GG9A 4RZYA 3PKDA 1C21A 3PKCA 3PKBA 2ZSGA 1QZYA 1XGNA 1C23A 2P98A 4FLKA 3FMRA 4HXXA 4S2TP 2Q95A 4PV4A 5CDLA 4S00A 1QXZA 1W7VA 3S6BA 4A6WA 1MATA 1KQ9A 2GZ5A 4FO8A 2BWYA 2P9AA 1R5GA 2BWWA 2Q92A 1XGMA 3IG4A 3CB5A 1JAWA 2BHBA 4U69A 4U6CA 2BH3A 3IU7A 2V3ZA 4R60A 4U6WA 2HOWA 2OKNA 4QR8A 2IW2A 3TB5A 1YVMA 1WL9A 4IU6A 1XNZA 1BN5A 2DFIA 5FCFA 1QXYA 1YJ3A 3CTZA 3L24A 5CDVA 5D6FA 2BWUA 2BWVA 2V3XA 4U6EA 2BHDA 2GU6A 3IU9A 2GU5A 1O0XA 2V6CA 2MATA 2GG3A 2BN7A 4FLJA 5CE6A 1C27A 2BWXA 3IU8A 4U71A 1A16A 1Y1NA 4Z7MA 4U70A 5JHUA 4FUKA 2EVCA 2BWTA 3PKEA 3FMQA 3MATA 3RVAA 4IPAA 2GTXA 5FCHA 1C22A 4RGZ1 4U76A
chains in the Genus database with same CATH superfamily
2GG7A 3TAVA 2P99A 4ZWOA 4S01A 4S2RP 1WBQA 2GG5A 4IKTA 2Q8KA 1M35A 4U75A 4U73A 5CDEA 5JI6A 3BIQA 2EA2A 5CNXA 3CB6A 3MR1A 1R58A 2GA2A 1BOAA 4FLIA 2NQ7A 1CHMA 1B6AA 3RORA 2B3KA 3BIPA 4FO7A 4A6VA 4KM3A 1N51A 5D6EA 2V3YA 4ZWPA 2ADUA 1W2MA 2GU7A 5JFRA 2BHAA 4OOKA 1WKMA 1WN1A 2EVMA 2BB7A 1C24A 2GGCA 2Q96A 2G6PA 4EGEA 4U1BA 2GU4A 1WY2A 1QXWA 4MATA 4IF7A 2OAZA 3MX6A 1B59A 3FM3A 4FKCA 1KP0A 3BITA 3D27A 4IDYA 1XGSA 5CIKA 2EVOA 4U6JA 2B3LA 1R5HA 1WLRA 1WL6A 3L7GA 4IKUA 5CLSA 2Q94A 2BWSA 1YW9A 5E5BA 2GG2A 4B28A 2Q93A 4PNCA 4ZNGA 1PV9A 4IKRA 4FLLA 2GG0A 4U6ZA 4ZWUA 1YW7A 2EA4A 4RZZA 2GGBA 2BHCA 1KQ0A 2GG8A 3PKAA 1YW8A 4IECA 4IKSA 2NQ6A 4JUQA 2B3HA 3Q6DA 1XGOA 2GG9A 4RZYA 3PKDA 1C21A 3PKCA 3PKBA 2ZSGA 1QZYA 1XGNA 1C23A 2P98A 4FLKA 3FMRA 4HXXA 4S2TP 2Q95A 4PV4A 5CDLA 4S00A 1QXZA 1W7VA 3S6BA 4A6WA 1MATA 1KQ9A 2GZ5A 4FO8A 2BWYA 2P9AA 1R5GA 2BWWA 2Q92A 1XGMA 3IG4A 3CB5A 1JAWA 2BHBA 4U69A 4U6CA 2BH3A 3IU7A 2V3ZA 4R60A 4U6WA 2HOWA 2OKNA 4QR8A 2IW2A 3TB5A 1YVMA 1WL9A 4IU6A 1XNZA 1BN5A 2DFIA 5FCFA 1QXYA 1YJ3A 3CTZA 3L24A 5CDVA 5D6FA 2BWUA 2BWVA 2V3XA 4U6EA 2BHDA 2GU6A 3IU9A 2GU5A 1O0XA 2V6CA 2MATA 2GG3A 2BN7A 4FLJA 5CE6A 1C27A 2BWXA 3IU8A 4U71A 1A16A 1Y1NA 4Z7MA 4U70A 5JHUA 4FUKA 2EVCA 2BWTA 3PKEA 3FMQA 3MATA 3RVAA 4IPAA 2GTXA 5FCHA 1C22A 4RGZ1 4U76A
chains in the Genus database with same CATH topology
2GG7A 3TAVA 2P99A 4ZWOA 4S01A 4S2RP 1WBQA 2GG5A 4IKTA 2Q8KA 1M35A 4U75A 4U73A 5CDEA 5JI6A 3BIQA 2EA2A 5CNXA 3CB6A 3MR1A 1R58A 2GA2A 1BOAA 4FLIA 2NQ7A 1CHMA 1B6AA 3RORA 2B3KA 3BIPA 4FO7A 4A6VA 4KM3A 1N51A 5D6EA 2V3YA 4ZWPA 2ADUA 1W2MA 2GU7A 5JFRA 2BHAA 4OOKA 1WKMA 1WN1A 2EVMA 2BB7A 1C24A 2GGCA 2Q96A 2G6PA 4EGEA 4U1BA 2GU4A 1WY2A 1QXWA 4MATA 4IF7A 2OAZA 3MX6A 1B59A 3FM3A 4FKCA 1KP0A 3BITA 3D27A 4IDYA 1XGSA 5CIKA 2EVOA 4U6JA 2B3LA 1R5HA 1WLRA 1WL6A 3L7GA 4IKUA 5CLSA 2Q94A 2BWSA 1YW9A 5E5BA 2GG2A 4B28A 2Q93A 4PNCA 4ZNGA 1PV9A 4IKRA 4FLLA 2GG0A 4U6ZA 4ZWUA 1YW7A 2EA4A 4RZZA 2GGBA 2BHCA 1KQ0A 2GG8A 3PKAA 1YW8A 4IECA 4IKSA 2NQ6A 4JUQA 2B3HA 3Q6DA 1XGOA 2GG9A 4RZYA 3PKDA 1C21A 3PKCA 3PKBA 2ZSGA 1QZYA 1XGNA 1C23A 2P98A 4FLKA 3FMRA 4HXXA 4S2TP 2Q95A 4PV4A 5CDLA 4S00A 1QXZA 1W7VA 3S6BA 4A6WA 1MATA 1KQ9A 2GZ5A 4FO8A 2BWYA 2P9AA 1R5GA 2BWWA 2Q92A 1XGMA 3IG4A 3CB5A 1JAWA 2BHBA 4U69A 4U6CA 2BH3A 3IU7A 2V3ZA 4R60A 4U6WA 2HOWA 2OKNA 4QR8A 2IW2A 3TB5A 1YVMA 1WL9A 4IU6A 1XNZA 1BN5A 2DFIA 5FCFA 1QXYA 1YJ3A 3CTZA 3L24A 5CDVA 5D6FA 2BWUA 2BWVA 2V3XA 4U6EA 2BHDA 2GU6A 3IU9A 2GU5A 1O0XA 2V6CA 2MATA 2GG3A 2BN7A 4FLJA 5CE6A 1C27A 2BWXA 3IU8A 4U71A 1A16A 1Y1NA 4Z7MA 4U70A 5JHUA 4FUKA 2EVCA 2BWTA 3PKEA 3FMQA 3MATA 3RVAA 4IPAA 2GTXA 5FCHA 1C22A 4RGZ1 4U76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG7 A;  3TAV A;  2P99 A;  4ZWO A;  4S01 A;  4S2R P;  1WBQ A;  2GG5 A;  4IKT A;  2Q8K A;  1M35 A;  4U75 A;  4U73 A;  5CDE A;  5JI6 A;  3BIQ A;  2EA2 A;  5CNX A;  3CB6 A;  3MR1 A;  1R58 A;  2GA2 A;  1BOA A;  4FLI A;  2NQ7 A;  1CHM A;  1B6A A;  3ROR A;  2B3K A;  3BIP A;  4FO7 A;  4A6V A;  4KM3 A;  1N51 A;  5D6E A;  2V3Y A;  4ZWP A;  2ADU A;  1W2M A;  2GU7 A;  5JFR A;  2BHA A;  4OOK A;  1WKM A;  1WN1 A;  2EVM A;  2BB7 A;  1C24 A;  2GGC A;  2Q96 A;  2G6P A;  4EGE A;  4U1B A;  2GU4 A;  1WY2 A;  1QXW A;  4MAT A;  4IF7 A;  2OAZ A;  3MX6 A;  1B59 A;  3FM3 A;  4FKC A;  1KP0 A;  3BIT A;  3D27 A;  4IDY A;  1XGS A;  5CIK A;  2EVO A;  4U6J A;  2B3L A;  1R5H A;  1WLR A;  1WL6 A;  3L7G A;  4IKU A;  5CLS A;  2Q94 A;  2BWS A;  1YW9 A;  5E5B A;  2GG2 A;  4B28 A;  2Q93 A;  4PNC A;  4ZNG A;  1PV9 A;  4IKR A;  4FLL A;  2GG0 A;  4U6Z A;  4ZWU A;  1YW7 A;  2EA4 A;  4RZZ A;  2GGB A;  2BHC A;  1KQ0 A;  2GG8 A;  3PKA A;  1YW8 A;  4IEC A;  4IKS A;  2NQ6 A;  4JUQ A;  2B3H A;  3Q6D A;  1XGO A;  2GG9 A;  4RZY A;  3PKD A;  1C21 A;  3PKC A;  3PKB A;  2ZSG A;  1QZY A;  1XGN A;  1C23 A;  2P98 A;  4FLK A;  3FMR A;  4HXX A;  4S2T P;  2Q95 A;  4PV4 A;  5CDL A;  4S00 A;  1QXZ A;  1W7V A;  3S6B A;  4A6W A;  1MAT A;  1KQ9 A;  2GZ5 A;  4FO8 A;  2BWY A;  2P9A A;  1R5G A;  2BWW A;  2Q92 A;  1XGM A;  3IG4 A;  3CB5 A;  1JAW A;  2BHB A;  4U69 A;  4U6C A;  2BH3 A;  3IU7 A;  2V3Z A;  4R60 A;  4U6W A;  2HOW A;  2OKN A;  4QR8 A;  2IW2 A;  3TB5 A;  1YVM A;  1WL9 A;  4IU6 A;  1XNZ A;  1BN5 A;  2DFI A;  5FCF A;  1QXY A;  1YJ3 A;  3CTZ A;  3L24 A;  5CDV A;  5D6F A;  2BWU A;  2BWV A;  2V3X A;  4U6E A;  2BHD A;  2GU6 A;  3IU9 A;  2GU5 A;  1O0X A;  2V6C A;  2MAT A;  2GG3 A;  2BN7 A;  4FLJ A;  5CE6 A;  1C27 A;  2BWX A;  3IU8 A;  4U71 A;  1A16 A;  1Y1N A;  4Z7M A;  4U70 A;  5JHU A;  4FUK A;  2EVC A;  2BWT A;  3PKE A;  3FMQ A;  3MAT A;  3RVA A;  4IPA A;  2GTX A;  5FCH A;  1C22 A;  4RGZ 1;  4U76 A; 
#chains in the Genus database with same CATH topology
 2GG7 A;  3TAV A;  2P99 A;  4ZWO A;  4S01 A;  4S2R P;  1WBQ A;  2GG5 A;  4IKT A;  2Q8K A;  1M35 A;  4U75 A;  4U73 A;  5CDE A;  5JI6 A;  3BIQ A;  2EA2 A;  5CNX A;  3CB6 A;  3MR1 A;  1R58 A;  2GA2 A;  1BOA A;  4FLI A;  2NQ7 A;  1CHM A;  1B6A A;  3ROR A;  2B3K A;  3BIP A;  4FO7 A;  4A6V A;  4KM3 A;  1N51 A;  5D6E A;  2V3Y A;  4ZWP A;  2ADU A;  1W2M A;  2GU7 A;  5JFR A;  2BHA A;  4OOK A;  1WKM A;  1WN1 A;  2EVM A;  2BB7 A;  1C24 A;  2GGC A;  2Q96 A;  2G6P A;  4EGE A;  4U1B A;  2GU4 A;  1WY2 A;  1QXW A;  4MAT A;  4IF7 A;  2OAZ A;  3MX6 A;  1B59 A;  3FM3 A;  4FKC A;  1KP0 A;  3BIT A;  3D27 A;  4IDY A;  1XGS A;  5CIK A;  2EVO A;  4U6J A;  2B3L A;  1R5H A;  1WLR A;  1WL6 A;  3L7G A;  4IKU A;  5CLS A;  2Q94 A;  2BWS A;  1YW9 A;  5E5B A;  2GG2 A;  4B28 A;  2Q93 A;  4PNC A;  4ZNG A;  1PV9 A;  4IKR A;  4FLL A;  2GG0 A;  4U6Z A;  4ZWU A;  1YW7 A;  2EA4 A;  4RZZ A;  2GGB A;  2BHC A;  1KQ0 A;  2GG8 A;  3PKA A;  1YW8 A;  4IEC A;  4IKS A;  2NQ6 A;  4JUQ A;  2B3H A;  3Q6D A;  1XGO A;  2GG9 A;  4RZY A;  3PKD A;  1C21 A;  3PKC A;  3PKB A;  2ZSG A;  1QZY A;  1XGN A;  1C23 A;  2P98 A;  4FLK A;  3FMR A;  4HXX A;  4S2T P;  2Q95 A;  4PV4 A;  5CDL A;  4S00 A;  1QXZ A;  1W7V A;  3S6B A;  4A6W A;  1MAT A;  1KQ9 A;  2GZ5 A;  4FO8 A;  2BWY A;  2P9A A;  1R5G A;  2BWW A;  2Q92 A;  1XGM A;  3IG4 A;  3CB5 A;  1JAW A;  2BHB A;  4U69 A;  4U6C A;  2BH3 A;  3IU7 A;  2V3Z A;  4R60 A;  4U6W A;  2HOW A;  2OKN A;  4QR8 A;  2IW2 A;  3TB5 A;  1YVM A;  1WL9 A;  4IU6 A;  1XNZ A;  1BN5 A;  2DFI A;  5FCF A;  1QXY A;  1YJ3 A;  3CTZ A;  3L24 A;  5CDV A;  5D6F A;  2BWU A;  2BWV A;  2V3X A;  4U6E A;  2BHD A;  2GU6 A;  3IU9 A;  2GU5 A;  1O0X A;  2V6C A;  2MAT A;  2GG3 A;  2BN7 A;  4FLJ A;  5CE6 A;  1C27 A;  2BWX A;  3IU8 A;  4U71 A;  1A16 A;  1Y1N A;  4Z7M A;  4U70 A;  5JHU A;  4FUK A;  2EVC A;  2BWT A;  3PKE A;  3FMQ A;  3MAT A;  3RVA A;  4IPA A;  2GTX A;  5FCH A;  1C22 A;  4RGZ 1;  4U76 A; 
#chains in the Genus database with same CATH homology
 2GG7 A;  3TAV A;  2P99 A;  4ZWO A;  4S01 A;  4S2R P;  1WBQ A;  2GG5 A;  4IKT A;  2Q8K A;  1M35 A;  4U75 A;  4U73 A;  5CDE A;  5JI6 A;  3BIQ A;  2EA2 A;  5CNX A;  3CB6 A;  3MR1 A;  1R58 A;  2GA2 A;  1BOA A;  4FLI A;  2NQ7 A;  1CHM A;  1B6A A;  3ROR A;  2B3K A;  3BIP A;  4FO7 A;  4A6V A;  4KM3 A;  1N51 A;  5D6E A;  2V3Y A;  4ZWP A;  2ADU A;  1W2M A;  2GU7 A;  5JFR A;  2BHA A;  4OOK A;  1WKM A;  1WN1 A;  2EVM A;  2BB7 A;  1C24 A;  2GGC A;  2Q96 A;  2G6P A;  4EGE A;  4U1B A;  2GU4 A;  1WY2 A;  1QXW A;  4MAT A;  4IF7 A;  2OAZ A;  3MX6 A;  1B59 A;  3FM3 A;  4FKC A;  1KP0 A;  3BIT A;  3D27 A;  4IDY A;  1XGS A;  5CIK A;  2EVO A;  4U6J A;  2B3L A;  1R5H A;  1WLR A;  1WL6 A;  3L7G A;  4IKU A;  5CLS A;  2Q94 A;  2BWS A;  1YW9 A;  5E5B A;  2GG2 A;  4B28 A;  2Q93 A;  4PNC A;  4ZNG A;  1PV9 A;  4IKR A;  4FLL A;  2GG0 A;  4U6Z A;  4ZWU A;  1YW7 A;  2EA4 A;  4RZZ A;  2GGB A;  2BHC A;  1KQ0 A;  2GG8 A;  3PKA A;  1YW8 A;  4IEC A;  4IKS A;  2NQ6 A;  4JUQ A;  2B3H A;  3Q6D A;  1XGO A;  2GG9 A;  4RZY A;  3PKD A;  1C21 A;  3PKC A;  3PKB A;  2ZSG A;  1QZY A;  1XGN A;  1C23 A;  2P98 A;  4FLK A;  3FMR A;  4HXX A;  4S2T P;  2Q95 A;  4PV4 A;  5CDL A;  4S00 A;  1QXZ A;  1W7V A;  3S6B A;  4A6W A;  1MAT A;  1KQ9 A;  2GZ5 A;  4FO8 A;  2BWY A;  2P9A A;  1R5G A;  2BWW A;  2Q92 A;  1XGM A;  3IG4 A;  3CB5 A;  1JAW A;  2BHB A;  4U69 A;  4U6C A;  2BH3 A;  3IU7 A;  2V3Z A;  4R60 A;  4U6W A;  2HOW A;  2OKN A;  4QR8 A;  2IW2 A;  3TB5 A;  1YVM A;  1WL9 A;  4IU6 A;  1XNZ A;  1BN5 A;  2DFI A;  5FCF A;  1QXY A;  1YJ3 A;  3CTZ A;  3L24 A;  5CDV A;  5D6F A;  2BWU A;  2BWV A;  2V3X A;  4U6E A;  2BHD A;  2GU6 A;  3IU9 A;  2GU5 A;  1O0X A;  2V6C A;  2MAT A;  2GG3 A;  2BN7 A;  4FLJ A;  5CE6 A;  1C27 A;  2BWX A;  3IU8 A;  4U71 A;  1A16 A;  1Y1N A;  4Z7M A;  4U70 A;  5JHU A;  4FUK A;  2EVC A;  2BWT A;  3PKE A;  3FMQ A;  3MAT A;  3RVA A;  4IPA A;  2GTX A;  5FCH A;  1C22 A;  4RGZ 1;  4U76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...