2B3KA

Crystal structure of human methionine aminopeptidase type i in the holo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3kA00
3L7GA 5CE6A 3RORA 2B3LA 4R60A 4U70A 4PNCA 2EVMA 1XGNA 1CHMA 4IKSA 1QXYA 4U6JA 2GG7A 4FO8A 5CDEA 4FKCA 4FLKA 1B59A 4U1BA 1R58A 2V6CA 3IU7A 4S2RP 4IKUA 3FMRA 1WLRA 2BH3A 3PKBA 4PV4A 1JAWA 2IW2A 3PKDA 3BITA 2Q94A 1C27A 1YJ3A 5D6FA 1QXZA 4A6WA 2V3XA 5CLSA 1YVMA 4IU6A 1W7VA 1YW9A 4FLLA 1B6AA 1XGSA 2BHAA 3CTZA 3CB5A 4U71A 2V3ZA 3IG4A 4S00A 2GG0A 1BOAA 4U75A 1C24A 1C21A 2BWTA 2DFIA 2BWSA 1R5HA 3PKAA 4IF7A 4U6CA 2P9AA 2P99A 4U76A 3BIQA 4U69A 2BB7A 4IKRA 5CIKA 2BHBA 1WKMA 3PKEA 1O0XA 3D27A 2G6PA 3IU8A 4A6VA 2B3HA 1XNZA 4FLIA 4HXXA 4IKTA 3MATA 2BWWA 2GGCA 5JHUA 4IDYA 4OOKA 2GU4A 2GG8A 4Z7MA 5E5BA 1R5GA 3S6BA 5FCFA 1WL9A 2GGBA 4RZZA 2GG3A 1KQ0A 2BN7A 2OKNA 2Q8KA 5D6EA 4EGEA 2EVOA 4S01A 2BWVA 1N51A 1YW8A 1QZYA 3PKCA 4ZWUA 1KQ9A 1KP0A 2EA4A 4RZYA 2Q92A 1Y1NA 2HOWA 2P98A 2ZSGA 2GG5A 2GTXA 4ZNGA 2GU7A 2Q96A 2GA2A 1WN1A 4U6ZA 5CNXA 5JFRA 1W2MA 4FO7A 2GU6A 2B3KA 3MR1A 1MATA 1YW7A 3CB6A 2BHCA 4FLJA 3BIPA 4IPAA 4RGZ1 5CDLA 1A16A 3RVAA 4U73A 3TAVA 4MATA 4QR8A 3FM3A 2NQ7A 1C23A 1C22A 5FCHA 2V3YA 2BWYA 2MATA 2EA2A 4U6WA 1XGOA 2Q95A 2BWUA 4ZWPA 4JUQA 3L24A 4ZWOA 4IECA 3TB5A 2BHDA 5JI6A 4FUKA 1QXWA 3MX6A 2ADUA 4B28A 1BN5A 2NQ6A 3FMQA 2GG2A 2GG9A 2BWXA 5CDVA 2OAZA 1PV9A 2GZ5A 3IU9A 3Q6DA 1WBQA 4KM3A 1M35A 2Q93A 4U6EA 2GU5A 2EVCA 1XGMA 1WY2A 1WL6A 4S2TP
chains in the Genus database with same CATH superfamily
3L7GA 5CE6A 3RORA 2B3LA 4R60A 4U70A 4PNCA 2EVMA 1XGNA 1CHMA 4IKSA 1QXYA 4U6JA 2GG7A 4FO8A 5CDEA 4FKCA 4FLKA 1B59A 4U1BA 1R58A 2V6CA 3IU7A 4S2RP 4IKUA 3FMRA 1WLRA 2BH3A 3PKBA 4PV4A 1JAWA 2IW2A 3PKDA 3BITA 2Q94A 1C27A 1YJ3A 5D6FA 1QXZA 4A6WA 2V3XA 5CLSA 1YVMA 4IU6A 1W7VA 1YW9A 4FLLA 1B6AA 1XGSA 2BHAA 3CTZA 3CB5A 4U71A 2V3ZA 3IG4A 4S00A 2GG0A 1BOAA 4U75A 1C24A 1C21A 2BWTA 2DFIA 2BWSA 1R5HA 3PKAA 4IF7A 4U6CA 2P9AA 2P99A 4U76A 3BIQA 4U69A 2BB7A 4IKRA 5CIKA 2BHBA 1WKMA 3PKEA 1O0XA 3D27A 2G6PA 3IU8A 4A6VA 2B3HA 1XNZA 4FLIA 4HXXA 4IKTA 3MATA 2BWWA 2GGCA 5JHUA 4IDYA 4OOKA 2GU4A 2GG8A 4Z7MA 5E5BA 1R5GA 3S6BA 5FCFA 1WL9A 2GGBA 4RZZA 2GG3A 1KQ0A 2BN7A 2OKNA 2Q8KA 5D6EA 4EGEA 2EVOA 4S01A 2BWVA 1N51A 1YW8A 1QZYA 3PKCA 4ZWUA 1KQ9A 1KP0A 2EA4A 4RZYA 2Q92A 1Y1NA 2HOWA 2P98A 2ZSGA 2GG5A 2GTXA 4ZNGA 2GU7A 2Q96A 2GA2A 1WN1A 4U6ZA 5CNXA 5JFRA 1W2MA 4FO7A 2GU6A 2B3KA 3MR1A 1MATA 1YW7A 3CB6A 2BHCA 4FLJA 3BIPA 4IPAA 4RGZ1 5CDLA 1A16A 3RVAA 4U73A 3TAVA 4MATA 4QR8A 3FM3A 2NQ7A 1C23A 1C22A 5FCHA 2V3YA 2BWYA 2MATA 2EA2A 4U6WA 1XGOA 2Q95A 2BWUA 4ZWPA 4JUQA 3L24A 4ZWOA 4IECA 3TB5A 2BHDA 5JI6A 4FUKA 1QXWA 3MX6A 2ADUA 4B28A 1BN5A 2NQ6A 3FMQA 2GG2A 2GG9A 2BWXA 5CDVA 2OAZA 1PV9A 2GZ5A 3IU9A 3Q6DA 1WBQA 4KM3A 1M35A 2Q93A 4U6EA 2GU5A 2EVCA 1XGMA 1WY2A 1WL6A 4S2TP
chains in the Genus database with same CATH topology
3L7GA 5CE6A 3RORA 2B3LA 4R60A 4U70A 4PNCA 2EVMA 1XGNA 1CHMA 4IKSA 1QXYA 4U6JA 2GG7A 4FO8A 5CDEA 4FKCA 4FLKA 1B59A 4U1BA 1R58A 2V6CA 3IU7A 4S2RP 4IKUA 3FMRA 1WLRA 2BH3A 3PKBA 4PV4A 1JAWA 2IW2A 3PKDA 3BITA 2Q94A 1C27A 1YJ3A 5D6FA 1QXZA 4A6WA 2V3XA 5CLSA 1YVMA 4IU6A 1W7VA 1YW9A 4FLLA 1B6AA 1XGSA 2BHAA 3CTZA 3CB5A 4U71A 2V3ZA 3IG4A 4S00A 2GG0A 1BOAA 4U75A 1C24A 1C21A 2BWTA 2DFIA 2BWSA 1R5HA 3PKAA 4IF7A 4U6CA 2P9AA 2P99A 4U76A 3BIQA 4U69A 2BB7A 4IKRA 5CIKA 2BHBA 1WKMA 3PKEA 1O0XA 3D27A 2G6PA 3IU8A 4A6VA 2B3HA 1XNZA 4FLIA 4HXXA 4IKTA 3MATA 2BWWA 2GGCA 5JHUA 4IDYA 4OOKA 2GU4A 2GG8A 4Z7MA 5E5BA 1R5GA 3S6BA 5FCFA 1WL9A 2GGBA 4RZZA 2GG3A 1KQ0A 2BN7A 2OKNA 2Q8KA 5D6EA 4EGEA 2EVOA 4S01A 2BWVA 1N51A 1YW8A 1QZYA 3PKCA 4ZWUA 1KQ9A 1KP0A 2EA4A 4RZYA 2Q92A 1Y1NA 2HOWA 2P98A 2ZSGA 2GG5A 2GTXA 4ZNGA 2GU7A 2Q96A 2GA2A 1WN1A 4U6ZA 5CNXA 5JFRA 1W2MA 4FO7A 2GU6A 2B3KA 3MR1A 1MATA 1YW7A 3CB6A 2BHCA 4FLJA 3BIPA 4IPAA 4RGZ1 5CDLA 1A16A 3RVAA 4U73A 3TAVA 4MATA 4QR8A 3FM3A 2NQ7A 1C23A 1C22A 5FCHA 2V3YA 2BWYA 2MATA 2EA2A 4U6WA 1XGOA 2Q95A 2BWUA 4ZWPA 4JUQA 3L24A 4ZWOA 4IECA 3TB5A 2BHDA 5JI6A 4FUKA 1QXWA 3MX6A 2ADUA 4B28A 1BN5A 2NQ6A 3FMQA 2GG2A 2GG9A 2BWXA 5CDVA 2OAZA 1PV9A 2GZ5A 3IU9A 3Q6DA 1WBQA 4KM3A 1M35A 2Q93A 4U6EA 2GU5A 2EVCA 1XGMA 1WY2A 1WL6A 4S2TP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7G A;  5CE6 A;  3ROR A;  2B3L A;  4R60 A;  4U70 A;  4PNC A;  2EVM A;  1XGN A;  1CHM A;  4IKS A;  1QXY A;  4U6J A;  2GG7 A;  4FO8 A;  5CDE A;  4FKC A;  4FLK A;  1B59 A;  4U1B A;  1R58 A;  2V6C A;  3IU7 A;  4S2R P;  4IKU A;  3FMR A;  1WLR A;  2BH3 A;  3PKB A;  4PV4 A;  1JAW A;  2IW2 A;  3PKD A;  3BIT A;  2Q94 A;  1C27 A;  1YJ3 A;  5D6F A;  1QXZ A;  4A6W A;  2V3X A;  5CLS A;  1YVM A;  4IU6 A;  1W7V A;  1YW9 A;  4FLL A;  1B6A A;  1XGS A;  2BHA A;  3CTZ A;  3CB5 A;  4U71 A;  2V3Z A;  3IG4 A;  4S00 A;  2GG0 A;  1BOA A;  4U75 A;  1C24 A;  1C21 A;  2BWT A;  2DFI A;  2BWS A;  1R5H A;  3PKA A;  4IF7 A;  4U6C A;  2P9A A;  2P99 A;  4U76 A;  3BIQ A;  4U69 A;  2BB7 A;  4IKR A;  5CIK A;  2BHB A;  1WKM A;  3PKE A;  1O0X A;  3D27 A;  2G6P A;  3IU8 A;  4A6V A;  2B3H A;  1XNZ A;  4FLI A;  4HXX A;  4IKT A;  3MAT A;  2BWW A;  2GGC A;  5JHU A;  4IDY A;  4OOK A;  2GU4 A;  2GG8 A;  4Z7M A;  5E5B A;  1R5G A;  3S6B A;  5FCF A;  1WL9 A;  2GGB A;  4RZZ A;  2GG3 A;  1KQ0 A;  2BN7 A;  2OKN A;  2Q8K A;  5D6E A;  4EGE A;  2EVO A;  4S01 A;  2BWV A;  1N51 A;  1YW8 A;  1QZY A;  3PKC A;  4ZWU A;  1KQ9 A;  1KP0 A;  2EA4 A;  4RZY A;  2Q92 A;  1Y1N A;  2HOW A;  2P98 A;  2ZSG A;  2GG5 A;  2GTX A;  4ZNG A;  2GU7 A;  2Q96 A;  2GA2 A;  1WN1 A;  4U6Z A;  5CNX A;  5JFR A;  1W2M A;  4FO7 A;  2GU6 A;  2B3K A;  3MR1 A;  1MAT A;  1YW7 A;  3CB6 A;  2BHC A;  4FLJ A;  3BIP A;  4IPA A;  4RGZ 1;  5CDL A;  1A16 A;  3RVA A;  4U73 A;  3TAV A;  4MAT A;  4QR8 A;  3FM3 A;  2NQ7 A;  1C23 A;  1C22 A;  5FCH A;  2V3Y A;  2BWY A;  2MAT A;  2EA2 A;  4U6W A;  1XGO A;  2Q95 A;  2BWU A;  4ZWP A;  4JUQ A;  3L24 A;  4ZWO A;  4IEC A;  3TB5 A;  2BHD A;  5JI6 A;  4FUK A;  1QXW A;  3MX6 A;  2ADU A;  4B28 A;  1BN5 A;  2NQ6 A;  3FMQ A;  2GG2 A;  2GG9 A;  2BWX A;  5CDV A;  2OAZ A;  1PV9 A;  2GZ5 A;  3IU9 A;  3Q6D A;  1WBQ A;  4KM3 A;  1M35 A;  2Q93 A;  4U6E A;  2GU5 A;  2EVC A;  1XGM A;  1WY2 A;  1WL6 A;  4S2T P; 
#chains in the Genus database with same CATH topology
 3L7G A;  5CE6 A;  3ROR A;  2B3L A;  4R60 A;  4U70 A;  4PNC A;  2EVM A;  1XGN A;  1CHM A;  4IKS A;  1QXY A;  4U6J A;  2GG7 A;  4FO8 A;  5CDE A;  4FKC A;  4FLK A;  1B59 A;  4U1B A;  1R58 A;  2V6C A;  3IU7 A;  4S2R P;  4IKU A;  3FMR A;  1WLR A;  2BH3 A;  3PKB A;  4PV4 A;  1JAW A;  2IW2 A;  3PKD A;  3BIT A;  2Q94 A;  1C27 A;  1YJ3 A;  5D6F A;  1QXZ A;  4A6W A;  2V3X A;  5CLS A;  1YVM A;  4IU6 A;  1W7V A;  1YW9 A;  4FLL A;  1B6A A;  1XGS A;  2BHA A;  3CTZ A;  3CB5 A;  4U71 A;  2V3Z A;  3IG4 A;  4S00 A;  2GG0 A;  1BOA A;  4U75 A;  1C24 A;  1C21 A;  2BWT A;  2DFI A;  2BWS A;  1R5H A;  3PKA A;  4IF7 A;  4U6C A;  2P9A A;  2P99 A;  4U76 A;  3BIQ A;  4U69 A;  2BB7 A;  4IKR A;  5CIK A;  2BHB A;  1WKM A;  3PKE A;  1O0X A;  3D27 A;  2G6P A;  3IU8 A;  4A6V A;  2B3H A;  1XNZ A;  4FLI A;  4HXX A;  4IKT A;  3MAT A;  2BWW A;  2GGC A;  5JHU A;  4IDY A;  4OOK A;  2GU4 A;  2GG8 A;  4Z7M A;  5E5B A;  1R5G A;  3S6B A;  5FCF A;  1WL9 A;  2GGB A;  4RZZ A;  2GG3 A;  1KQ0 A;  2BN7 A;  2OKN A;  2Q8K A;  5D6E A;  4EGE A;  2EVO A;  4S01 A;  2BWV A;  1N51 A;  1YW8 A;  1QZY A;  3PKC A;  4ZWU A;  1KQ9 A;  1KP0 A;  2EA4 A;  4RZY A;  2Q92 A;  1Y1N A;  2HOW A;  2P98 A;  2ZSG A;  2GG5 A;  2GTX A;  4ZNG A;  2GU7 A;  2Q96 A;  2GA2 A;  1WN1 A;  4U6Z A;  5CNX A;  5JFR A;  1W2M A;  4FO7 A;  2GU6 A;  2B3K A;  3MR1 A;  1MAT A;  1YW7 A;  3CB6 A;  2BHC A;  4FLJ A;  3BIP A;  4IPA A;  4RGZ 1;  5CDL A;  1A16 A;  3RVA A;  4U73 A;  3TAV A;  4MAT A;  4QR8 A;  3FM3 A;  2NQ7 A;  1C23 A;  1C22 A;  5FCH A;  2V3Y A;  2BWY A;  2MAT A;  2EA2 A;  4U6W A;  1XGO A;  2Q95 A;  2BWU A;  4ZWP A;  4JUQ A;  3L24 A;  4ZWO A;  4IEC A;  3TB5 A;  2BHD A;  5JI6 A;  4FUK A;  1QXW A;  3MX6 A;  2ADU A;  4B28 A;  1BN5 A;  2NQ6 A;  3FMQ A;  2GG2 A;  2GG9 A;  2BWX A;  5CDV A;  2OAZ A;  1PV9 A;  2GZ5 A;  3IU9 A;  3Q6D A;  1WBQ A;  4KM3 A;  1M35 A;  2Q93 A;  4U6E A;  2GU5 A;  2EVC A;  1XGM A;  1WY2 A;  1WL6 A;  4S2T P; 
#chains in the Genus database with same CATH homology
 3L7G A;  5CE6 A;  3ROR A;  2B3L A;  4R60 A;  4U70 A;  4PNC A;  2EVM A;  1XGN A;  1CHM A;  4IKS A;  1QXY A;  4U6J A;  2GG7 A;  4FO8 A;  5CDE A;  4FKC A;  4FLK A;  1B59 A;  4U1B A;  1R58 A;  2V6C A;  3IU7 A;  4S2R P;  4IKU A;  3FMR A;  1WLR A;  2BH3 A;  3PKB A;  4PV4 A;  1JAW A;  2IW2 A;  3PKD A;  3BIT A;  2Q94 A;  1C27 A;  1YJ3 A;  5D6F A;  1QXZ A;  4A6W A;  2V3X A;  5CLS A;  1YVM A;  4IU6 A;  1W7V A;  1YW9 A;  4FLL A;  1B6A A;  1XGS A;  2BHA A;  3CTZ A;  3CB5 A;  4U71 A;  2V3Z A;  3IG4 A;  4S00 A;  2GG0 A;  1BOA A;  4U75 A;  1C24 A;  1C21 A;  2BWT A;  2DFI A;  2BWS A;  1R5H A;  3PKA A;  4IF7 A;  4U6C A;  2P9A A;  2P99 A;  4U76 A;  3BIQ A;  4U69 A;  2BB7 A;  4IKR A;  5CIK A;  2BHB A;  1WKM A;  3PKE A;  1O0X A;  3D27 A;  2G6P A;  3IU8 A;  4A6V A;  2B3H A;  1XNZ A;  4FLI A;  4HXX A;  4IKT A;  3MAT A;  2BWW A;  2GGC A;  5JHU A;  4IDY A;  4OOK A;  2GU4 A;  2GG8 A;  4Z7M A;  5E5B A;  1R5G A;  3S6B A;  5FCF A;  1WL9 A;  2GGB A;  4RZZ A;  2GG3 A;  1KQ0 A;  2BN7 A;  2OKN A;  2Q8K A;  5D6E A;  4EGE A;  2EVO A;  4S01 A;  2BWV A;  1N51 A;  1YW8 A;  1QZY A;  3PKC A;  4ZWU A;  1KQ9 A;  1KP0 A;  2EA4 A;  4RZY A;  2Q92 A;  1Y1N A;  2HOW A;  2P98 A;  2ZSG A;  2GG5 A;  2GTX A;  4ZNG A;  2GU7 A;  2Q96 A;  2GA2 A;  1WN1 A;  4U6Z A;  5CNX A;  5JFR A;  1W2M A;  4FO7 A;  2GU6 A;  2B3K A;  3MR1 A;  1MAT A;  1YW7 A;  3CB6 A;  2BHC A;  4FLJ A;  3BIP A;  4IPA A;  4RGZ 1;  5CDL A;  1A16 A;  3RVA A;  4U73 A;  3TAV A;  4MAT A;  4QR8 A;  3FM3 A;  2NQ7 A;  1C23 A;  1C22 A;  5FCH A;  2V3Y A;  2BWY A;  2MAT A;  2EA2 A;  4U6W A;  1XGO A;  2Q95 A;  2BWU A;  4ZWP A;  4JUQ A;  3L24 A;  4ZWO A;  4IEC A;  3TB5 A;  2BHD A;  5JI6 A;  4FUK A;  1QXW A;  3MX6 A;  2ADU A;  4B28 A;  1BN5 A;  2NQ6 A;  3FMQ A;  2GG2 A;  2GG9 A;  2BWX A;  5CDV A;  2OAZ A;  1PV9 A;  2GZ5 A;  3IU9 A;  3Q6D A;  1WBQ A;  4KM3 A;  1M35 A;  2Q93 A;  4U6E A;  2GU5 A;  2EVC A;  1XGM A;  1WY2 A;  1WL6 A;  4S2T P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...