2B3PA

Crystal structure of a superfolder green fluorescent protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
229
structure length
228
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords green fluorescent protein
publication title Engineering and characterization of a superfolder green fluorescent protein.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 63
structure length 228
sequence length 229
ec nomenclature
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2b3pA00
3ZUJA 3DQAA 3LVCA 3SSKA 4XGYA 4JFGA 2H5QA 2O29A 4W6KA 1OXDA 3ZULA 2ZO6A 5DPHA 3U8CA 4ZF4A 5LTPA 5HZUA 4N3DA 2G6YA 4L12A 3CGLA 3DQ1A 1RM9A 3EVUA 5EXCI 3U0NA 2DD9A 4DKMA 3U0KA 1GL4A 3U0MA 4DXOA 1Q73A 2AWLA 3P8UA 5DTXA 3NEZA 3SVDA 4IK1A 1MOVA 3PIBA 4H47A 4XVPA 4U2VA 4W6RA 4PPLA 1XSSA 4IZNA 2DUHA 2OTEA 1RMMA 1HCJA 4OQWA 3DQ2A 1CV7A 2HFCA 3E5VA 5DQBA 4XOVA 4KW4A 1H4UA 3CFAA 2IB5A 4ZINA 3DQMA 2O24A 2H5RA 4RTCA 2Q57A 4LQTA 2A50B 2DD7A 5DY6A 3EKHA 2V4EA 4W74A 2IB6A 1JC0A 3SSLA 1RMOA 5DPJA 3ZTFA 2V4EB 1EMBA 4ANJA 5DTLA 3P28A 4KGEA 3EK8A 4W7CA 5LTRA 3GJ2A 5DTZA 3RWAA 1UISA 1QXTA 2A53B 3DQ5A 3H1OA 1W7SA 2QRFA 5AQBB 5HZTA 4H3NA 3SVCA 4ZF5A 1RMPA 1ZUXA 3DQFA 5DQMA 2ZMWA 3AI5A 4KW9A 2IE2A 2Z6YA 2G6XA 4GESB 4Q7RA 4LJCA 3I19A 1KYSA 4W7XA 2EMNA 2PXSA 2BTJA 4W6MA 2DUFA 4W6HA 3SSYA 4AR7A 4DKNA 4RYWA 5EXUA 1XMZA 3DQDA 5BT0A 1OXFA 3NF0A 2Q6PA 4EDOA 4H3MA 2H5OA 4W7EA 4J88A 2GW4B 2AWMA 3MGFA 4W6PA 1S6ZA 4TZAA 3WLDA 2OKWA 3CD1A 4XL5A 3DQNA 3DQIA 4Q9XA 2HGDA 3BX9A 4PPJA 1OXEA 3DQCA 4Z4MA 1W7UA 3OGOA 2A54B 4KF5A 4EDSA 1Q4DA 2WISA 3U8AA 1QYFA 5FHVA 1QY3A 2FZUA 1JBZA 5LTQA 1QYOA 4KF4A 2FL1A 2GX0A 4GOBA 3DQ7A 4Q9WA 3SSHA 4LJDA 1JBYA 3M24A 4HQ9A 1EMCA 4HQCA 2OJKA 3CBEA 3DQKA 4L1IA 2WIQA 3W1CA 2VVHA 3AI4A 1Z1QA 2H9WA 1XA9A 5EB7A 3SG3A 2YE1A 3SVOA 4DXNA 3KCTA 5HBDA 1Q4CA 2A56B 4W72A 4LW5A 3LSAA 4HQ8A 3ST4A 4ZBLA 3SSPA 1H6RA 4R6BA 3LS3A 3ADFA 2WHTA 2G3DB 2ZO7A 3U0LA 3DQ9A 5H87A 2H6VA 4W6BA 2DDDA 5T3IA 4KEXA 2C9JA 4JEOA 3EVRA 4W6GA 3LVAA 4ORNA 4H48A 1F09A 4EN1A 3EVVA 4ZB1A 3GEXA 5FVFA 1ZGOA 4KAGA 4I2YA 1Z1PA 4DXPA 3OSQA 2FWQA 3CFHA 5H89A 5H88A 4HE4A 3SVEA 2DUGA 2AH8A 1KYPA 4W7DA 1ZGQA 1W7TA 2A52B 3SG4A 4OGSA 3NT9A 1EMLA 4UTSA 4W6SA 3SVRA 4J8AA 4PFEA 4W6CA 4EULA 1JC1A 3LA1A 4W73A 2HQKA 4OJ0A 4W7FA 1EMEA 1HUYA 4EMQA 3PJ5A 3IP2A 5DRGA 3DQUA 3WCKA 1BFPA 2HRSA 2Y0GA 4W75A 3EK7A 4PPKA 4JGEA 2HPWA 5DU0A 3O78A 4L13A 2H5PA 3ST2A 4ZF3A 3CFFA 3SG2A 2IOVA 5HZSA 2O2BA 1MOUA 2WURA 3TMTA 2B3PA 1YJ2A 2QU1A 3ST0A 2POXA 4XOWA 3DQ8A 4P76A 4W6FA 4Z4KA 1KYRA 3W1DA 5EBJA 3EVPA 3SVBA 2YFPA 2A46A 2HCGA 4IK8A 4B5YA 3CD9A 3DPZA 4W7RA 2A48A 2B3QA 1Q4AA 2QZ0A 3U8PA 5F9GA 2Z6ZA 5FVIA 2VVIA 2JADA 2AWKA 4W6OA 3ZUFA 3LF4B 3BXAA 1G7KA 3KCSA 3GB3A 1MYWA 4W6AA 3EKJA 1YHGA 3G9AA 3O77A 4ZFSA 5EHUA 2G2SB 3VICA 4OHSA 4DXIA 1QYQA 1XAEA 5DPGA 5FVGA 4LJBA 1XQMA 4KGFA 4J89A 2V4EC 2ZMUA 2EMOA 2QT2A 4H3LA 4KA9A 4KPIA 3RWTA 3LF3A 3IR8A 4Q7TA 3PJ7A 4W6TA 2VAEA 2VVJA 1GGXA 2AHAA 3SS0A 3DPWA 1YJFA 3NEDA 3WLCA 5HZOA 4W6JA 5HW9A 3ST3A 3SVSA 2P4MA 2DDCA 4W6DA 3A8SA 1YZWA 5HGEA 2G16B 3V3DA 1RRXA 1EMKA 5EXBA 2EMDA 3UFZA 5DRFA 2DUIA 4R6DA 2A47A 5KTGA 1YHHA 2OTBA 4IK5A 3SRYA 1Q4EA 3S05A 3DQJA 1F0BA 3ED8A 3DQ3A 2Z6XA 2AWJA 5EJUA 3DQLA 3E5WA 5LK4A 4JF9A 2QLIA 3DQOA 3SSTA 3UG0A 2OKYA 2QLGA 2WHUA 5BTTA 2G5ZB 2GW3A 1ZGPA 3BXBA 4NWSA 2QLGB 5BTTB 4IK3A 3EK4A 2WSOA 1B9CA 2ARLA 3SG5A 2C9IA 4KF5C 3BXCA 4W77A 4W6NA 2DUEA 4TZGA 4B30A 2HQZA 4AS8A 2YDZA 2G6EA 4BDUA 4LQUA 3SSVA 2GX2A 4B30B 2QLHA 3CB9A 4LJDC 2HJOA 3DQHA 2HGYA 1KP5A 4DXMA 1YFPA 4KW8A 1EMFA 3OSRA 3K1KA 2PXWA 4W6UA 2VADA 4JRBA 3GJ1A 3DPXA 3DQEA 3H1RA 1YHIA 1C4FA 5J2OA 4W7AA 5DPIA 2ICRA 3GL4A 3TMRA 3AKOA 4W76A 2RH7A 1GFLA 4IK4A 2WSNA 5DTYA 1EMMA 3LVDA 4GF6B 3VHTA 4W6LA 3PJBA 2G3OA 4ZIOA 5BQLA 2Z1OA 3DQ4A 3SVUA 3VHTB 1EMGA 1Q4BA 3NT3A 4DXQA 4P1QA 3SG6A 4OY4A 4W69A 4W6IA 3E5TA 2YE0A 4RYSA 4HVFA 4Q7UA 1EMAA 2WHSA 3SV5A 5EB6A 2VZXA 4IK9A 3VK1A 3M22A 4JC2A 2H8QA 3SVNA 2OGRA 3DQ6A 2QLEA 3SG7A
chains in the Genus database with same CATH superfamily
3ZUJA 3DQAA 3LVCA 3SSKA 4XGYA 4JFGA 2H5QA 2O29A 4W6KA 1OXDA 3ZULA 2ZO6A 5DPHA 3U8CA 4ZF4A 5LTPA 5HZUA 4N3DA 2G6YA 4L12A 3CGLA 3DQ1A 1RM9A 3EVUA 5EXCI 3U0NA 2DD9A 4DKMA 3U0KA 1GL4A 3U0MA 4DXOA 1Q73A 2AWLA 3P8UA 5DTXA 3NEZA 3SVDA 4IK1A 1MOVA 3PIBA 4H47A 4XVPA 4U2VA 4W6RA 4PPLA 1XSSA 4IZNA 2DUHA 2OTEA 1RMMA 1HCJA 4OQWA 3DQ2A 1CV7A 2HFCA 3E5VA 5DQBA 4XOVA 4KW4A 1H4UA 3CFAA 2IB5A 4ZINA 3DQMA 2O24A 2H5RA 4RTCA 2Q57A 4LQTA 2A50B 2DD7A 5DY6A 3EKHA 2V4EA 4W74A 2IB6A 1JC0A 3SSLA 1RMOA 5DPJA 3ZTFA 2V4EB 1EMBA 4ANJA 5DTLA 3P28A 4KGEA 3EK8A 4W7CA 5LTRA 3GJ2A 5DTZA 3RWAA 1UISA 1QXTA 2A53B 3DQ5A 3H1OA 1W7SA 2QRFA 5AQBB 5HZTA 4H3NA 3SVCA 4ZF5A 1RMPA 1ZUXA 3DQFA 5DQMA 2ZMWA 3AI5A 4KW9A 2IE2A 2Z6YA 2G6XA 4GESB 4Q7RA 4LJCA 3I19A 1KYSA 4W7XA 2EMNA 2PXSA 2BTJA 4W6MA 2DUFA 4W6HA 3SSYA 4AR7A 4DKNA 4RYWA 5EXUA 1XMZA 3DQDA 5BT0A 1OXFA 3NF0A 2Q6PA 4EDOA 4H3MA 2H5OA 4W7EA 4J88A 2GW4B 2AWMA 3MGFA 4W6PA 1S6ZA 4TZAA 3WLDA 2OKWA 3CD1A 4XL5A 3DQNA 3DQIA 4Q9XA 2HGDA 3BX9A 4PPJA 1OXEA 3DQCA 4Z4MA 1W7UA 3OGOA 2A54B 4KF5A 4EDSA 1Q4DA 2WISA 3U8AA 1QYFA 5FHVA 1QY3A 2FZUA 1JBZA 5LTQA 1QYOA 4KF4A 2FL1A 2GX0A 4GOBA 3DQ7A 4Q9WA 3SSHA 4LJDA 1JBYA 3M24A 4HQ9A 1EMCA 4HQCA 2OJKA 3CBEA 3DQKA 4L1IA 2WIQA 3W1CA 2VVHA 3AI4A 1Z1QA 2H9WA 1XA9A 5EB7A 3SG3A 2YE1A 3SVOA 4DXNA 3KCTA 5HBDA 1Q4CA 2A56B 4W72A 4LW5A 3LSAA 4HQ8A 3ST4A 4ZBLA 3SSPA 1H6RA 4R6BA 3LS3A 3ADFA 2WHTA 2G3DB 2ZO7A 3U0LA 3DQ9A 5H87A 2H6VA 4W6BA 2DDDA 5T3IA 4KEXA 2C9JA 4JEOA 3EVRA 4W6GA 3LVAA 4ORNA 4H48A 1F09A 4EN1A 3EVVA 4ZB1A 3GEXA 5FVFA 1ZGOA 4KAGA 4I2YA 1Z1PA 4DXPA 3OSQA 2FWQA 3CFHA 5H89A 5H88A 4HE4A 3SVEA 2DUGA 2AH8A 1KYPA 4W7DA 1ZGQA 1W7TA 2A52B 3SG4A 4OGSA 3NT9A 1EMLA 4UTSA 4W6SA 3SVRA 4J8AA 4PFEA 4W6CA 4EULA 1JC1A 3LA1A 4W73A 2HQKA 4OJ0A 4W7FA 1EMEA 1HUYA 4EMQA 3PJ5A 3IP2A 5DRGA 3DQUA 3WCKA 1BFPA 2HRSA 2Y0GA 4W75A 3EK7A 4PPKA 4JGEA 2HPWA 5DU0A 3O78A 4L13A 2H5PA 3ST2A 4ZF3A 3CFFA 3SG2A 2IOVA 5HZSA 2O2BA 1MOUA 2WURA 3TMTA 2B3PA 1YJ2A 2QU1A 3ST0A 2POXA 4XOWA 3DQ8A 4P76A 4W6FA 4Z4KA 1KYRA 3W1DA 5EBJA 3EVPA 3SVBA 2YFPA 2A46A 2HCGA 4IK8A 4B5YA 3CD9A 3DPZA 4W7RA 2A48A 2B3QA 1Q4AA 2QZ0A 3U8PA 5F9GA 2Z6ZA 5FVIA 2VVIA 2JADA 2AWKA 4W6OA 3ZUFA 3LF4B 3BXAA 1G7KA 3KCSA 3GB3A 1MYWA 4W6AA 3EKJA 1YHGA 3G9AA 3O77A 4ZFSA 5EHUA 2G2SB 3VICA 4OHSA 4DXIA 1QYQA 1XAEA 5DPGA 5FVGA 4LJBA 1XQMA 4KGFA 4J89A 2V4EC 2ZMUA 2EMOA 2QT2A 4H3LA 4KA9A 4KPIA 3RWTA 3LF3A 3IR8A 4Q7TA 3PJ7A 4W6TA 2VAEA 2VVJA 1GGXA 2AHAA 3SS0A 3DPWA 1YJFA 3NEDA 3WLCA 5HZOA 4W6JA 5HW9A 3ST3A 3SVSA 2P4MA 2DDCA 4W6DA 3A8SA 1YZWA 5HGEA 2G16B 3V3DA 1RRXA 1EMKA 5EXBA 2EMDA 3UFZA 5DRFA 2DUIA 4R6DA 2A47A 5KTGA 1YHHA 2OTBA 4IK5A 3SRYA 1Q4EA 3S05A 3DQJA 1F0BA 3ED8A 3DQ3A 2Z6XA 2AWJA 5EJUA 3DQLA 3E5WA 5LK4A 4JF9A 2QLIA 3DQOA 3SSTA 3UG0A 2OKYA 2QLGA 2WHUA 5BTTA 2G5ZB 2GW3A 1ZGPA 3BXBA 4NWSA 2QLGB 5BTTB 4IK3A 3EK4A 2WSOA 1B9CA 2ARLA 3SG5A 2C9IA 4KF5C 3BXCA 4W77A 4W6NA 2DUEA 4TZGA 4B30A 2HQZA 4AS8A 2YDZA 2G6EA 4BDUA 4LQUA 3SSVA 2GX2A 4B30B 2QLHA 3CB9A 4LJDC 2HJOA 3DQHA 2HGYA 1KP5A 4DXMA 1YFPA 4KW8A 1EMFA 3OSRA 3K1KA 2PXWA 4W6UA 2VADA 4JRBA 3GJ1A 3DPXA 3DQEA 3H1RA 1YHIA 1C4FA 5J2OA 4W7AA 5DPIA 2ICRA 3GL4A 3TMRA 3AKOA 4W76A 2RH7A 1GFLA 4IK4A 2WSNA 5DTYA 1EMMA 3LVDA 4GF6B 3VHTA 4W6LA 3PJBA 2G3OA 4ZIOA 5BQLA 2Z1OA 3DQ4A 3SVUA 3VHTB 1EMGA 1Q4BA 3NT3A 4DXQA 4P1QA 3SG6A 4OY4A 4W69A 4W6IA 3E5TA 2YE0A 4RYSA 4HVFA 4Q7UA 1EMAA 2WHSA 3SV5A 5EB6A 2VZXA 4IK9A 3VK1A 3M22A 4JC2A 2H8QA 3SVNA 2OGRA 3DQ6A 2QLEA 3SG7A
chains in the Genus database with same CATH topology
3ZUJA 3DQAA 3LVCA 3SSKA 4XGYA 4JFGA 2H5QA 2O29A 4W6KA 1OXDA 3ZULA 2ZO6A 5DPHA 3U8CA 4ZF4A 5LTPA 5HZUA 4N3DA 2G6YA 4L12A 3CGLA 3DQ1A 1RM9A 3EVUA 5EXCI 3U0NA 2DD9A 4DKMA 3U0KA 1GL4A 3U0MA 4DXOA 1Q73A 2AWLA 3P8UA 5DTXA 3NEZA 3SVDA 4IK1A 1MOVA 3PIBA 4H47A 4XVPA 4U2VA 4W6RA 4PPLA 1XSSA 4IZNA 2DUHA 2OTEA 1RMMA 1HCJA 4OQWA 3DQ2A 1CV7A 2HFCA 3E5VA 5DQBA 4XOVA 4KW4A 1H4UA 3CFAA 2IB5A 4ZINA 3DQMA 2O24A 2H5RA 4RTCA 2Q57A 4LQTA 2A50B 2DD7A 5DY6A 3EKHA 2V4EA 4W74A 2IB6A 1JC0A 3SSLA 1RMOA 5DPJA 3ZTFA 2V4EB 1EMBA 4ANJA 5DTLA 3P28A 4KGEA 3EK8A 4W7CA 5LTRA 3GJ2A 5DTZA 3RWAA 1UISA 1QXTA 2A53B 3DQ5A 3H1OA 1W7SA 2QRFA 5AQBB 5HZTA 4H3NA 3SVCA 4ZF5A 1RMPA 1ZUXA 3DQFA 5DQMA 2ZMWA 3AI5A 4KW9A 2IE2A 2Z6YA 2G6XA 4GESB 4Q7RA 4LJCA 3I19A 1KYSA 4W7XA 2EMNA 2PXSA 2BTJA 4W6MA 2DUFA 4W6HA 3SSYA 4AR7A 4DKNA 4RYWA 5EXUA 1XMZA 3DQDA 5BT0A 1OXFA 3NF0A 2Q6PA 4EDOA 4H3MA 2H5OA 4W7EA 4J88A 2GW4B 2AWMA 3MGFA 4W6PA 1S6ZA 4TZAA 3WLDA 2OKWA 3CD1A 4XL5A 3DQNA 3DQIA 4Q9XA 2HGDA 3BX9A 4PPJA 1OXEA 3DQCA 4Z4MA 1W7UA 3OGOA 2A54B 4KF5A 4EDSA 1Q4DA 2WISA 3U8AA 1QYFA 5FHVA 1QY3A 2FZUA 1JBZA 5LTQA 1QYOA 4KF4A 2FL1A 2GX0A 4GOBA 3DQ7A 4Q9WA 3SSHA 4LJDA 1JBYA 3M24A 4HQ9A 1EMCA 4HQCA 2OJKA 3CBEA 3DQKA 4L1IA 2WIQA 3W1CA 2VVHA 3AI4A 1Z1QA 2H9WA 1XA9A 5EB7A 3SG3A 2YE1A 3SVOA 4DXNA 3KCTA 5HBDA 1Q4CA 2A56B 4W72A 4LW5A 3LSAA 4HQ8A 3ST4A 4ZBLA 3SSPA 1H6RA 4R6BA 3LS3A 3ADFA 2WHTA 2G3DB 2ZO7A 3U0LA 3DQ9A 5H87A 2H6VA 4W6BA 2DDDA 5T3IA 4KEXA 2C9JA 4JEOA 3EVRA 4W6GA 3LVAA 4ORNA 4H48A 1F09A 4EN1A 3EVVA 4ZB1A 3GEXA 5FVFA 1ZGOA 4KAGA 4I2YA 1Z1PA 4DXPA 3OSQA 2FWQA 3CFHA 5H89A 5H88A 4HE4A 3SVEA 2DUGA 2AH8A 1KYPA 4W7DA 1ZGQA 1W7TA 2A52B 3SG4A 4OGSA 3NT9A 1EMLA 4UTSA 4W6SA 3SVRA 4J8AA 4PFEA 4W6CA 4EULA 1JC1A 3LA1A 4W73A 2HQKA 4OJ0A 4W7FA 1EMEA 1HUYA 4EMQA 3PJ5A 3IP2A 5DRGA 3DQUA 3WCKA 1BFPA 2HRSA 2Y0GA 4W75A 3EK7A 4PPKA 4JGEA 2HPWA 5DU0A 3O78A 4L13A 2H5PA 3ST2A 4ZF3A 3CFFA 3SG2A 2IOVA 5HZSA 2O2BA 1MOUA 2WURA 3TMTA 2B3PA 1YJ2A 2QU1A 3ST0A 2POXA 4XOWA 3DQ8A 4P76A 4W6FA 4Z4KA 1KYRA 3W1DA 5EBJA 3EVPA 3SVBA 2YFPA 2A46A 2HCGA 4IK8A 4B5YA 3CD9A 3DPZA 4W7RA 2A48A 2B3QA 1Q4AA 2QZ0A 3U8PA 5F9GA 2Z6ZA 5FVIA 2VVIA 2JADA 2AWKA 4W6OA 3ZUFA 3LF4B 3BXAA 1G7KA 3KCSA 3GB3A 1MYWA 4W6AA 3EKJA 1YHGA 3G9AA 3O77A 4ZFSA 5EHUA 2G2SB 3VICA 4OHSA 4DXIA 1QYQA 1XAEA 5DPGA 5FVGA 4LJBA 1XQMA 4KGFA 4J89A 2V4EC 2ZMUA 2EMOA 2QT2A 4H3LA 4KA9A 4KPIA 3RWTA 3LF3A 3IR8A 4Q7TA 3PJ7A 4W6TA 2VAEA 2VVJA 1GGXA 2AHAA 3SS0A 3DPWA 1YJFA 3NEDA 3WLCA 5HZOA 4W6JA 5HW9A 3ST3A 3SVSA 2P4MA 2DDCA 4W6DA 3A8SA 1YZWA 5HGEA 2G16B 3V3DA 1RRXA 1EMKA 5EXBA 2EMDA 3UFZA 5DRFA 2DUIA 4R6DA 2A47A 5KTGA 1YHHA 2OTBA 4IK5A 3SRYA 1Q4EA 3S05A 3DQJA 1F0BA 3ED8A 3DQ3A 2Z6XA 2AWJA 5EJUA 3DQLA 3E5WA 5LK4A 4JF9A 2QLIA 3DQOA 3SSTA 3UG0A 2OKYA 2QLGA 2WHUA 5BTTA 2G5ZB 2GW3A 1ZGPA 3BXBA 4NWSA 2QLGB 5BTTB 4IK3A 3EK4A 2WSOA 1B9CA 2ARLA 3SG5A 2C9IA 4KF5C 3BXCA 4W77A 4W6NA 2DUEA 4TZGA 4B30A 2HQZA 4AS8A 2YDZA 2G6EA 4BDUA 4LQUA 3SSVA 2GX2A 4B30B 2QLHA 3CB9A 4LJDC 2HJOA 3DQHA 2HGYA 1KP5A 4DXMA 1YFPA 4KW8A 1EMFA 3OSRA 3K1KA 2PXWA 4W6UA 2VADA 4JRBA 3GJ1A 3DPXA 3DQEA 3H1RA 1YHIA 1C4FA 5J2OA 4W7AA 5DPIA 2ICRA 3GL4A 3TMRA 3AKOA 4W76A 2RH7A 1GFLA 4IK4A 2WSNA 5DTYA 1EMMA 3LVDA 4GF6B 3VHTA 4W6LA 3PJBA 2G3OA 4ZIOA 5BQLA 2Z1OA 3DQ4A 3SVUA 3VHTB 1EMGA 1Q4BA 3NT3A 4DXQA 4P1QA 3SG6A 4OY4A 4W69A 4W6IA 3E5TA 2YE0A 4RYSA 4HVFA 4Q7UA 1EMAA 2WHSA 3SV5A 5EB6A 2VZXA 4IK9A 3VK1A 3M22A 4JC2A 2H8QA 3SVNA 2OGRA 3DQ6A 2QLEA 3SG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUJ A;  3DQA A;  3LVC A;  3SSK A;  4XGY A;  4JFG A;  2H5Q A;  2O29 A;  4W6K A;  1OXD A;  3ZUL A;  2ZO6 A;  5DPH A;  3U8C A;  4ZF4 A;  5LTP A;  5HZU A;  4N3D A;  2G6Y A;  4L12 A;  3CGL A;  3DQ1 A;  1RM9 A;  3EVU A;  5EXC I;  3U0N A;  2DD9 A;  4DKM A;  3U0K A;  1GL4 A;  3U0M A;  4DXO A;  1Q73 A;  2AWL A;  3P8U A;  5DTX A;  3NEZ A;  3SVD A;  4IK1 A;  1MOV A;  3PIB A;  4H47 A;  4XVP A;  4U2V A;  4W6R A;  4PPL A;  1XSS A;  4IZN A;  2DUH A;  2OTE A;  1RMM A;  1HCJ A;  4OQW A;  3DQ2 A;  1CV7 A;  2HFC A;  3E5V A;  5DQB A;  4XOV A;  4KW4 A;  1H4U A;  3CFA A;  2IB5 A;  4ZIN A;  3DQM A;  2O24 A;  2H5R A;  4RTC A;  2Q57 A;  4LQT A;  2A50 B;  2DD7 A;  5DY6 A;  3EKH A;  2V4E A;  4W74 A;  2IB6 A;  1JC0 A;  3SSL A;  1RMO A;  5DPJ A;  3ZTF A;  2V4E B;  1EMB A;  4ANJ A;  5DTL A;  3P28 A;  4KGE A;  3EK8 A;  4W7C A;  5LTR A;  3GJ2 A;  5DTZ A;  3RWA A;  1UIS A;  1QXT A;  2A53 B;  3DQ5 A;  3H1O A;  1W7S A;  2QRF A;  5AQB B;  5HZT A;  4H3N A;  3SVC A;  4ZF5 A;  1RMP A;  1ZUX A;  3DQF A;  5DQM A;  2ZMW A;  3AI5 A;  4KW9 A;  2IE2 A;  2Z6Y A;  2G6X A;  4GES B;  4Q7R A;  4LJC A;  3I19 A;  1KYS A;  4W7X A;  2EMN A;  2PXS A;  2BTJ A;  4W6M A;  2DUF A;  4W6H A;  3SSY A;  4AR7 A;  4DKN A;  4RYW A;  5EXU A;  1XMZ A;  3DQD A;  5BT0 A;  1OXF A;  3NF0 A;  2Q6P A;  4EDO A;  4H3M A;  2H5O A;  4W7E A;  4J88 A;  2GW4 B;  2AWM A;  3MGF A;  4W6P A;  1S6Z A;  4TZA A;  3WLD A;  2OKW A;  3CD1 A;  4XL5 A;  3DQN A;  3DQI A;  4Q9X A;  2HGD A;  3BX9 A;  4PPJ A;  1OXE A;  3DQC A;  4Z4M A;  1W7U A;  3OGO A;  2A54 B;  4KF5 A;  4EDS A;  1Q4D A;  2WIS A;  3U8A A;  1QYF A;  5FHV A;  1QY3 A;  2FZU A;  1JBZ A;  5LTQ A;  1QYO A;  4KF4 A;  2FL1 A;  2GX0 A;  4GOB A;  3DQ7 A;  4Q9W A;  3SSH A;  4LJD A;  1JBY A;  3M24 A;  4HQ9 A;  1EMC A;  4HQC A;  2OJK A;  3CBE A;  3DQK A;  4L1I A;  2WIQ A;  3W1C A;  2VVH A;  3AI4 A;  1Z1Q A;  2H9W A;  1XA9 A;  5EB7 A;  3SG3 A;  2YE1 A;  3SVO A;  4DXN A;  3KCT A;  5HBD A;  1Q4C A;  2A56 B;  4W72 A;  4LW5 A;  3LSA A;  4HQ8 A;  3ST4 A;  4ZBL A;  3SSP A;  1H6R A;  4R6B A;  3LS3 A;  3ADF A;  2WHT A;  2G3D B;  2ZO7 A;  3U0L A;  3DQ9 A;  5H87 A;  2H6V A;  4W6B A;  2DDD A;  5T3I A;  4KEX A;  2C9J A;  4JEO A;  3EVR A;  4W6G A;  3LVA A;  4ORN A;  4H48 A;  1F09 A;  4EN1 A;  3EVV A;  4ZB1 A;  3GEX A;  5FVF A;  1ZGO A;  4KAG A;  4I2Y A;  1Z1P A;  4DXP A;  3OSQ A;  2FWQ A;  3CFH A;  5H89 A;  5H88 A;  4HE4 A;  3SVE A;  2DUG A;  2AH8 A;  1KYP A;  4W7D A;  1ZGQ A;  1W7T A;  2A52 B;  3SG4 A;  4OGS A;  3NT9 A;  1EML A;  4UTS A;  4W6S A;  3SVR A;  4J8A A;  4PFE A;  4W6C A;  4EUL A;  1JC1 A;  3LA1 A;  4W73 A;  2HQK A;  4OJ0 A;  4W7F A;  1EME A;  1HUY A;  4EMQ A;  3PJ5 A;  3IP2 A;  5DRG A;  3DQU A;  3WCK A;  1BFP A;  2HRS A;  2Y0G A;  4W75 A;  3EK7 A;  4PPK A;  4JGE A;  2HPW A;  5DU0 A;  3O78 A;  4L13 A;  2H5P A;  3ST2 A;  4ZF3 A;  3CFF A;  3SG2 A;  2IOV A;  5HZS A;  2O2B A;  1MOU A;  2WUR A;  3TMT A;  2B3P A;  1YJ2 A;  2QU1 A;  3ST0 A;  2POX A;  4XOW A;  3DQ8 A;  4P76 A;  4W6F A;  4Z4K A;  1KYR A;  3W1D A;  5EBJ A;  3EVP A;  3SVB A;  2YFP A;  2A46 A;  2HCG A;  4IK8 A;  4B5Y A;  3CD9 A;  3DPZ A;  4W7R A;  2A48 A;  2B3Q A;  1Q4A A;  2QZ0 A;  3U8P A;  5F9G A;  2Z6Z A;  5FVI A;  2VVI A;  2JAD A;  2AWK A;  4W6O A;  3ZUF A;  3LF4 B;  3BXA A;  1G7K A;  3KCS A;  3GB3 A;  1MYW A;  4W6A A;  3EKJ A;  1YHG A;  3G9A A;  3O77 A;  4ZFS A;  5EHU A;  2G2S B;  3VIC A;  4OHS A;  4DXI A;  1QYQ A;  1XAE A;  5DPG A;  5FVG A;  4LJB A;  1XQM A;  4KGF A;  4J89 A;  2V4E C;  2ZMU A;  2EMO A;  2QT2 A;  4H3L A;  4KA9 A;  4KPI A;  3RWT A;  3LF3 A;  3IR8 A;  4Q7T A;  3PJ7 A;  4W6T A;  2VAE A;  2VVJ A;  1GGX A;  2AHA A;  3SS0 A;  3DPW A;  1YJF A;  3NED A;  3WLC A;  5HZO A;  4W6J A;  5HW9 A;  3ST3 A;  3SVS A;  2P4M A;  2DDC A;  4W6D A;  3A8S A;  1YZW A;  5HGE A;  2G16 B;  3V3D A;  1RRX A;  1EMK A;  5EXB A;  2EMD A;  3UFZ A;  5DRF A;  2DUI A;  4R6D A;  2A47 A;  5KTG A;  1YHH A;  2OTB A;  4IK5 A;  3SRY A;  1Q4E A;  3S05 A;  3DQJ A;  1F0B A;  3ED8 A;  3DQ3 A;  2Z6X A;  2AWJ A;  5EJU A;  3DQL A;  3E5W A;  5LK4 A;  4JF9 A;  2QLI A;  3DQO A;  3SST A;  3UG0 A;  2OKY A;  2QLG A;  2WHU A;  5BTT A;  2G5Z B;  2GW3 A;  1ZGP A;  3BXB A;  4NWS A;  2QLG B;  5BTT B;  4IK3 A;  3EK4 A;  2WSO A;  1B9C A;  2ARL A;  3SG5 A;  2C9I A;  4KF5 C;  3BXC A;  4W77 A;  4W6N A;  2DUE A;  4TZG A;  4B30 A;  2HQZ A;  4AS8 A;  2YDZ A;  2G6E A;  4BDU A;  4LQU A;  3SSV A;  2GX2 A;  4B30 B;  2QLH A;  3CB9 A;  4LJD C;  2HJO A;  3DQH A;  2HGY A;  1KP5 A;  4DXM A;  1YFP A;  4KW8 A;  1EMF A;  3OSR A;  3K1K A;  2PXW A;  4W6U A;  2VAD A;  4JRB A;  3GJ1 A;  3DPX A;  3DQE A;  3H1R A;  1YHI A;  1C4F A;  5J2O A;  4W7A A;  5DPI A;  2ICR A;  3GL4 A;  3TMR A;  3AKO A;  4W76 A;  2RH7 A;  1GFL A;  4IK4 A;  2WSN A;  5DTY A;  1EMM A;  3LVD A;  4GF6 B;  3VHT A;  4W6L A;  3PJB A;  2G3O A;  4ZIO A;  5BQL A;  2Z1O A;  3DQ4 A;  3SVU A;  3VHT B;  1EMG A;  1Q4B A;  3NT3 A;  4DXQ A;  4P1Q A;  3SG6 A;  4OY4 A;  4W69 A;  4W6I A;  3E5T A;  2YE0 A;  4RYS A;  4HVF A;  4Q7U A;  1EMA A;  2WHS A;  3SV5 A;  5EB6 A;  2VZX A;  4IK9 A;  3VK1 A;  3M22 A;  4JC2 A;  2H8Q A;  3SVN A;  2OGR A;  3DQ6 A;  2QLE A;  3SG7 A; 
#chains in the Genus database with same CATH topology
 3ZUJ A;  3DQA A;  3LVC A;  3SSK A;  4XGY A;  4JFG A;  2H5Q A;  2O29 A;  4W6K A;  1OXD A;  3ZUL A;  2ZO6 A;  5DPH A;  3U8C A;  4ZF4 A;  5LTP A;  5HZU A;  4N3D A;  2G6Y A;  4L12 A;  3CGL A;  3DQ1 A;  1RM9 A;  3EVU A;  5EXC I;  3U0N A;  2DD9 A;  4DKM A;  3U0K A;  1GL4 A;  3U0M A;  4DXO A;  1Q73 A;  2AWL A;  3P8U A;  5DTX A;  3NEZ A;  3SVD A;  4IK1 A;  1MOV A;  3PIB A;  4H47 A;  4XVP A;  4U2V A;  4W6R A;  4PPL A;  1XSS A;  4IZN A;  2DUH A;  2OTE A;  1RMM A;  1HCJ A;  4OQW A;  3DQ2 A;  1CV7 A;  2HFC A;  3E5V A;  5DQB A;  4XOV A;  4KW4 A;  1H4U A;  3CFA A;  2IB5 A;  4ZIN A;  3DQM A;  2O24 A;  2H5R A;  4RTC A;  2Q57 A;  4LQT A;  2A50 B;  2DD7 A;  5DY6 A;  3EKH A;  2V4E A;  4W74 A;  2IB6 A;  1JC0 A;  3SSL A;  1RMO A;  5DPJ A;  3ZTF A;  2V4E B;  1EMB A;  4ANJ A;  5DTL A;  3P28 A;  4KGE A;  3EK8 A;  4W7C A;  5LTR A;  3GJ2 A;  5DTZ A;  3RWA A;  1UIS A;  1QXT A;  2A53 B;  3DQ5 A;  3H1O A;  1W7S A;  2QRF A;  5AQB B;  5HZT A;  4H3N A;  3SVC A;  4ZF5 A;  1RMP A;  1ZUX A;  3DQF A;  5DQM A;  2ZMW A;  3AI5 A;  4KW9 A;  2IE2 A;  2Z6Y A;  2G6X A;  4GES B;  4Q7R A;  4LJC A;  3I19 A;  1KYS A;  4W7X A;  2EMN A;  2PXS A;  2BTJ A;  4W6M A;  2DUF A;  4W6H A;  3SSY A;  4AR7 A;  4DKN A;  4RYW A;  5EXU A;  1XMZ A;  3DQD A;  5BT0 A;  1OXF A;  3NF0 A;  2Q6P A;  4EDO A;  4H3M A;  2H5O A;  4W7E A;  4J88 A;  2GW4 B;  2AWM A;  3MGF A;  4W6P A;  1S6Z A;  4TZA A;  3WLD A;  2OKW A;  3CD1 A;  4XL5 A;  3DQN A;  3DQI A;  4Q9X A;  2HGD A;  3BX9 A;  4PPJ A;  1OXE A;  3DQC A;  4Z4M A;  1W7U A;  3OGO A;  2A54 B;  4KF5 A;  4EDS A;  1Q4D A;  2WIS A;  3U8A A;  1QYF A;  5FHV A;  1QY3 A;  2FZU A;  1JBZ A;  5LTQ A;  1QYO A;  4KF4 A;  2FL1 A;  2GX0 A;  4GOB A;  3DQ7 A;  4Q9W A;  3SSH A;  4LJD A;  1JBY A;  3M24 A;  4HQ9 A;  1EMC A;  4HQC A;  2OJK A;  3CBE A;  3DQK A;  4L1I A;  2WIQ A;  3W1C A;  2VVH A;  3AI4 A;  1Z1Q A;  2H9W A;  1XA9 A;  5EB7 A;  3SG3 A;  2YE1 A;  3SVO A;  4DXN A;  3KCT A;  5HBD A;  1Q4C A;  2A56 B;  4W72 A;  4LW5 A;  3LSA A;  4HQ8 A;  3ST4 A;  4ZBL A;  3SSP A;  1H6R A;  4R6B A;  3LS3 A;  3ADF A;  2WHT A;  2G3D B;  2ZO7 A;  3U0L A;  3DQ9 A;  5H87 A;  2H6V A;  4W6B A;  2DDD A;  5T3I A;  4KEX A;  2C9J A;  4JEO A;  3EVR A;  4W6G A;  3LVA A;  4ORN A;  4H48 A;  1F09 A;  4EN1 A;  3EVV A;  4ZB1 A;  3GEX A;  5FVF A;  1ZGO A;  4KAG A;  4I2Y A;  1Z1P A;  4DXP A;  3OSQ A;  2FWQ A;  3CFH A;  5H89 A;  5H88 A;  4HE4 A;  3SVE A;  2DUG A;  2AH8 A;  1KYP A;  4W7D A;  1ZGQ A;  1W7T A;  2A52 B;  3SG4 A;  4OGS A;  3NT9 A;  1EML A;  4UTS A;  4W6S A;  3SVR A;  4J8A A;  4PFE A;  4W6C A;  4EUL A;  1JC1 A;  3LA1 A;  4W73 A;  2HQK A;  4OJ0 A;  4W7F A;  1EME A;  1HUY A;  4EMQ A;  3PJ5 A;  3IP2 A;  5DRG A;  3DQU A;  3WCK A;  1BFP A;  2HRS A;  2Y0G A;  4W75 A;  3EK7 A;  4PPK A;  4JGE A;  2HPW A;  5DU0 A;  3O78 A;  4L13 A;  2H5P A;  3ST2 A;  4ZF3 A;  3CFF A;  3SG2 A;  2IOV A;  5HZS A;  2O2B A;  1MOU A;  2WUR A;  3TMT A;  2B3P A;  1YJ2 A;  2QU1 A;  3ST0 A;  2POX A;  4XOW A;  3DQ8 A;  4P76 A;  4W6F A;  4Z4K A;  1KYR A;  3W1D A;  5EBJ A;  3EVP A;  3SVB A;  2YFP A;  2A46 A;  2HCG A;  4IK8 A;  4B5Y A;  3CD9 A;  3DPZ A;  4W7R A;  2A48 A;  2B3Q A;  1Q4A A;  2QZ0 A;  3U8P A;  5F9G A;  2Z6Z A;  5FVI A;  2VVI A;  2JAD A;  2AWK A;  4W6O A;  3ZUF A;  3LF4 B;  3BXA A;  1G7K A;  3KCS A;  3GB3 A;  1MYW A;  4W6A A;  3EKJ A;  1YHG A;  3G9A A;  3O77 A;  4ZFS A;  5EHU A;  2G2S B;  3VIC A;  4OHS A;  4DXI A;  1QYQ A;  1XAE A;  5DPG A;  5FVG A;  4LJB A;  1XQM A;  4KGF A;  4J89 A;  2V4E C;  2ZMU A;  2EMO A;  2QT2 A;  4H3L A;  4KA9 A;  4KPI A;  3RWT A;  3LF3 A;  3IR8 A;  4Q7T A;  3PJ7 A;  4W6T A;  2VAE A;  2VVJ A;  1GGX A;  2AHA A;  3SS0 A;  3DPW A;  1YJF A;  3NED A;  3WLC A;  5HZO A;  4W6J A;  5HW9 A;  3ST3 A;  3SVS A;  2P4M A;  2DDC A;  4W6D A;  3A8S A;  1YZW A;  5HGE A;  2G16 B;  3V3D A;  1RRX A;  1EMK A;  5EXB A;  2EMD A;  3UFZ A;  5DRF A;  2DUI A;  4R6D A;  2A47 A;  5KTG A;  1YHH A;  2OTB A;  4IK5 A;  3SRY A;  1Q4E A;  3S05 A;  3DQJ A;  1F0B A;  3ED8 A;  3DQ3 A;  2Z6X A;  2AWJ A;  5EJU A;  3DQL A;  3E5W A;  5LK4 A;  4JF9 A;  2QLI A;  3DQO A;  3SST A;  3UG0 A;  2OKY A;  2QLG A;  2WHU A;  5BTT A;  2G5Z B;  2GW3 A;  1ZGP A;  3BXB A;  4NWS A;  2QLG B;  5BTT B;  4IK3 A;  3EK4 A;  2WSO A;  1B9C A;  2ARL A;  3SG5 A;  2C9I A;  4KF5 C;  3BXC A;  4W77 A;  4W6N A;  2DUE A;  4TZG A;  4B30 A;  2HQZ A;  4AS8 A;  2YDZ A;  2G6E A;  4BDU A;  4LQU A;  3SSV A;  2GX2 A;  4B30 B;  2QLH A;  3CB9 A;  4LJD C;  2HJO A;  3DQH A;  2HGY A;  1KP5 A;  4DXM A;  1YFP A;  4KW8 A;  1EMF A;  3OSR A;  3K1K A;  2PXW A;  4W6U A;  2VAD A;  4JRB A;  3GJ1 A;  3DPX A;  3DQE A;  3H1R A;  1YHI A;  1C4F A;  5J2O A;  4W7A A;  5DPI A;  2ICR A;  3GL4 A;  3TMR A;  3AKO A;  4W76 A;  2RH7 A;  1GFL A;  4IK4 A;  2WSN A;  5DTY A;  1EMM A;  3LVD A;  4GF6 B;  3VHT A;  4W6L A;  3PJB A;  2G3O A;  4ZIO A;  5BQL A;  2Z1O A;  3DQ4 A;  3SVU A;  3VHT B;  1EMG A;  1Q4B A;  3NT3 A;  4DXQ A;  4P1Q A;  3SG6 A;  4OY4 A;  4W69 A;  4W6I A;  3E5T A;  2YE0 A;  4RYS A;  4HVF A;  4Q7U A;  1EMA A;  2WHS A;  3SV5 A;  5EB6 A;  2VZX A;  4IK9 A;  3VK1 A;  3M22 A;  4JC2 A;  2H8Q A;  3SVN A;  2OGR A;  3DQ6 A;  2QLE A;  3SG7 A; 
#chains in the Genus database with same CATH homology
 3ZUJ A;  3DQA A;  3LVC A;  3SSK A;  4XGY A;  4JFG A;  2H5Q A;  2O29 A;  4W6K A;  1OXD A;  3ZUL A;  2ZO6 A;  5DPH A;  3U8C A;  4ZF4 A;  5LTP A;  5HZU A;  4N3D A;  2G6Y A;  4L12 A;  3CGL A;  3DQ1 A;  1RM9 A;  3EVU A;  5EXC I;  3U0N A;  2DD9 A;  4DKM A;  3U0K A;  1GL4 A;  3U0M A;  4DXO A;  1Q73 A;  2AWL A;  3P8U A;  5DTX A;  3NEZ A;  3SVD A;  4IK1 A;  1MOV A;  3PIB A;  4H47 A;  4XVP A;  4U2V A;  4W6R A;  4PPL A;  1XSS A;  4IZN A;  2DUH A;  2OTE A;  1RMM A;  1HCJ A;  4OQW A;  3DQ2 A;  1CV7 A;  2HFC A;  3E5V A;  5DQB A;  4XOV A;  4KW4 A;  1H4U A;  3CFA A;  2IB5 A;  4ZIN A;  3DQM A;  2O24 A;  2H5R A;  4RTC A;  2Q57 A;  4LQT A;  2A50 B;  2DD7 A;  5DY6 A;  3EKH A;  2V4E A;  4W74 A;  2IB6 A;  1JC0 A;  3SSL A;  1RMO A;  5DPJ A;  3ZTF A;  2V4E B;  1EMB A;  4ANJ A;  5DTL A;  3P28 A;  4KGE A;  3EK8 A;  4W7C A;  5LTR A;  3GJ2 A;  5DTZ A;  3RWA A;  1UIS A;  1QXT A;  2A53 B;  3DQ5 A;  3H1O A;  1W7S A;  2QRF A;  5AQB B;  5HZT A;  4H3N A;  3SVC A;  4ZF5 A;  1RMP A;  1ZUX A;  3DQF A;  5DQM A;  2ZMW A;  3AI5 A;  4KW9 A;  2IE2 A;  2Z6Y A;  2G6X A;  4GES B;  4Q7R A;  4LJC A;  3I19 A;  1KYS A;  4W7X A;  2EMN A;  2PXS A;  2BTJ A;  4W6M A;  2DUF A;  4W6H A;  3SSY A;  4AR7 A;  4DKN A;  4RYW A;  5EXU A;  1XMZ A;  3DQD A;  5BT0 A;  1OXF A;  3NF0 A;  2Q6P A;  4EDO A;  4H3M A;  2H5O A;  4W7E A;  4J88 A;  2GW4 B;  2AWM A;  3MGF A;  4W6P A;  1S6Z A;  4TZA A;  3WLD A;  2OKW A;  3CD1 A;  4XL5 A;  3DQN A;  3DQI A;  4Q9X A;  2HGD A;  3BX9 A;  4PPJ A;  1OXE A;  3DQC A;  4Z4M A;  1W7U A;  3OGO A;  2A54 B;  4KF5 A;  4EDS A;  1Q4D A;  2WIS A;  3U8A A;  1QYF A;  5FHV A;  1QY3 A;  2FZU A;  1JBZ A;  5LTQ A;  1QYO A;  4KF4 A;  2FL1 A;  2GX0 A;  4GOB A;  3DQ7 A;  4Q9W A;  3SSH A;  4LJD A;  1JBY A;  3M24 A;  4HQ9 A;  1EMC A;  4HQC A;  2OJK A;  3CBE A;  3DQK A;  4L1I A;  2WIQ A;  3W1C A;  2VVH A;  3AI4 A;  1Z1Q A;  2H9W A;  1XA9 A;  5EB7 A;  3SG3 A;  2YE1 A;  3SVO A;  4DXN A;  3KCT A;  5HBD A;  1Q4C A;  2A56 B;  4W72 A;  4LW5 A;  3LSA A;  4HQ8 A;  3ST4 A;  4ZBL A;  3SSP A;  1H6R A;  4R6B A;  3LS3 A;  3ADF A;  2WHT A;  2G3D B;  2ZO7 A;  3U0L A;  3DQ9 A;  5H87 A;  2H6V A;  4W6B A;  2DDD A;  5T3I A;  4KEX A;  2C9J A;  4JEO A;  3EVR A;  4W6G A;  3LVA A;  4ORN A;  4H48 A;  1F09 A;  4EN1 A;  3EVV A;  4ZB1 A;  3GEX A;  5FVF A;  1ZGO A;  4KAG A;  4I2Y A;  1Z1P A;  4DXP A;  3OSQ A;  2FWQ A;  3CFH A;  5H89 A;  5H88 A;  4HE4 A;  3SVE A;  2DUG A;  2AH8 A;  1KYP A;  4W7D A;  1ZGQ A;  1W7T A;  2A52 B;  3SG4 A;  4OGS A;  3NT9 A;  1EML A;  4UTS A;  4W6S A;  3SVR A;  4J8A A;  4PFE A;  4W6C A;  4EUL A;  1JC1 A;  3LA1 A;  4W73 A;  2HQK A;  4OJ0 A;  4W7F A;  1EME A;  1HUY A;  4EMQ A;  3PJ5 A;  3IP2 A;  5DRG A;  3DQU A;  3WCK A;  1BFP A;  2HRS A;  2Y0G A;  4W75 A;  3EK7 A;  4PPK A;  4JGE A;  2HPW A;  5DU0 A;  3O78 A;  4L13 A;  2H5P A;  3ST2 A;  4ZF3 A;  3CFF A;  3SG2 A;  2IOV A;  5HZS A;  2O2B A;  1MOU A;  2WUR A;  3TMT A;  2B3P A;  1YJ2 A;  2QU1 A;  3ST0 A;  2POX A;  4XOW A;  3DQ8 A;  4P76 A;  4W6F A;  4Z4K A;  1KYR A;  3W1D A;  5EBJ A;  3EVP A;  3SVB A;  2YFP A;  2A46 A;  2HCG A;  4IK8 A;  4B5Y A;  3CD9 A;  3DPZ A;  4W7R A;  2A48 A;  2B3Q A;  1Q4A A;  2QZ0 A;  3U8P A;  5F9G A;  2Z6Z A;  5FVI A;  2VVI A;  2JAD A;  2AWK A;  4W6O A;  3ZUF A;  3LF4 B;  3BXA A;  1G7K A;  3KCS A;  3GB3 A;  1MYW A;  4W6A A;  3EKJ A;  1YHG A;  3G9A A;  3O77 A;  4ZFS A;  5EHU A;  2G2S B;  3VIC A;  4OHS A;  4DXI A;  1QYQ A;  1XAE A;  5DPG A;  5FVG A;  4LJB A;  1XQM A;  4KGF A;  4J89 A;  2V4E C;  2ZMU A;  2EMO A;  2QT2 A;  4H3L A;  4KA9 A;  4KPI A;  3RWT A;  3LF3 A;  3IR8 A;  4Q7T A;  3PJ7 A;  4W6T A;  2VAE A;  2VVJ A;  1GGX A;  2AHA A;  3SS0 A;  3DPW A;  1YJF A;  3NED A;  3WLC A;  5HZO A;  4W6J A;  5HW9 A;  3ST3 A;  3SVS A;  2P4M A;  2DDC A;  4W6D A;  3A8S A;  1YZW A;  5HGE A;  2G16 B;  3V3D A;  1RRX A;  1EMK A;  5EXB A;  2EMD A;  3UFZ A;  5DRF A;  2DUI A;  4R6D A;  2A47 A;  5KTG A;  1YHH A;  2OTB A;  4IK5 A;  3SRY A;  1Q4E A;  3S05 A;  3DQJ A;  1F0B A;  3ED8 A;  3DQ3 A;  2Z6X A;  2AWJ A;  5EJU A;  3DQL A;  3E5W A;  5LK4 A;  4JF9 A;  2QLI A;  3DQO A;  3SST A;  3UG0 A;  2OKY A;  2QLG A;  2WHU A;  5BTT A;  2G5Z B;  2GW3 A;  1ZGP A;  3BXB A;  4NWS A;  2QLG B;  5BTT B;  4IK3 A;  3EK4 A;  2WSO A;  1B9C A;  2ARL A;  3SG5 A;  2C9I A;  4KF5 C;  3BXC A;  4W77 A;  4W6N A;  2DUE A;  4TZG A;  4B30 A;  2HQZ A;  4AS8 A;  2YDZ A;  2G6E A;  4BDU A;  4LQU A;  3SSV A;  2GX2 A;  4B30 B;  2QLH A;  3CB9 A;  4LJD C;  2HJO A;  3DQH A;  2HGY A;  1KP5 A;  4DXM A;  1YFP A;  4KW8 A;  1EMF A;  3OSR A;  3K1K A;  2PXW A;  4W6U A;  2VAD A;  4JRB A;  3GJ1 A;  3DPX A;  3DQE A;  3H1R A;  1YHI A;  1C4F A;  5J2O A;  4W7A A;  5DPI A;  2ICR A;  3GL4 A;  3TMR A;  3AKO A;  4W76 A;  2RH7 A;  1GFL A;  4IK4 A;  2WSN A;  5DTY A;  1EMM A;  3LVD A;  4GF6 B;  3VHT A;  4W6L A;  3PJB A;  2G3O A;  4ZIO A;  5BQL A;  2Z1O A;  3DQ4 A;  3SVU A;  3VHT B;  1EMG A;  1Q4B A;  3NT3 A;  4DXQ A;  4P1Q A;  3SG6 A;  4OY4 A;  4W69 A;  4W6I A;  3E5T A;  2YE0 A;  4RYS A;  4HVF A;  4Q7U A;  1EMA A;  2WHS A;  3SV5 A;  5EB6 A;  2VZX A;  4IK9 A;  3VK1 A;  3M22 A;  4JC2 A;  2H8Q A;  3SVN A;  2OGR A;  3DQ6 A;  2QLE A;  3SG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...