2B3UA

Human spermine spermidine acetyltransferase k26r mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
162
Chain Sequence
AKFVIRPATAADCSDILRLIKELAQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3uA00
4UWIA 4JWPA 2ZW7A 5ISVA 2B5GB 2QIRA 4X5KA 2BSWA 3TTHA 3UY5A 1S7FA 1YR0A 2ZPAA 4R3KA 4XPLA 1Z4RA 1NSLA 1S7NA 5KTAA 4KOTA 2B4DA 4DNCA 3DR8A 1B6BA 4YFJA 5CNPA 1YGHA 4RS2A 4KOUA 4L8AA 2JLMA 3I9SA 2CY2A 1M4IA 4NCZA 5F49A 3E0KA 3SXNA 3W6XA 2GE3A 5J8CA 4XNHB 5H84A 3NE7A 2G0BA 2CNSA 1QSOA 3FRMA 3CXQA 2VZYA 2FIWA 5EBVA 4E2AA 4YGOA 4QUSA 2FCKA 3S6KA 2BUEA 3P2HA 2Q44A 3R9EA 3W6SA 1IB1E 4KLWA 1R57A 4NEXA 2AE6A 1QSMA 2VQYA 3QB8A 4OLLA 4EVYA 3LD2A 2EVNA 1I21A 2ATRA 4KORA 1ON0A 4MY3A 3TO6A 2REFA 3WR7A 1YK3A 3P2FA 1YVKA 1RO5A 3FNCA 4I49A 2HV2A 3QAHA 3C26A 3CXPA 2JEVA 4QB9A 2BL1A 3JVNA 4HNYB 3TFYA 4KOXA 4GS4A 5I0CA 2PR8A 5J8FA 4AG9A 4NXYA 3EXNA 3BLNA 4F0YA 3DSBA 3FXTA 1LRZA 3DDDA 3TT2A 2Q04A 2REEA 3FBUA 1QSTA 4JXQA 4XPKA 2Q7BA 5IB0A 4HNWB 2H5MA 3RYOA 4UWJA 2B3UA 4HKFA 4KOYA 1VKCA 1RXTA 2OZGA 4MJ8A 1S7KA 1TIQA 3F5BA 5E96A 2FT0A 4UBRA 1M44A 3MGDA 4FD6A 5HH1A 4CRYB 5C88A 2G3TA 2WPWA 1P0HA 4RI1A 4BMHA 1S3ZA 2B5GA 5JQ4A 1WWZA 5H86A 4AG7A 4PSXA 1XF8A 1KZFA 4NF1A 5KTDA 4LUAA 1B87A 1N71A 4FD4A 3T9YA 4B5PA 3R9GA 1I1DA 4ORFA 2Q4VA 1CM0A 3EO4A 3FYNA 2EUIA 1YVOA 3GYAA 1Q2DA 5F47A 1MJAA 3ZJ0A 4B5PB 2J8NA 1PUAA 3GY9A 4K30A 4UA3A 4KUBA 1MK4A 4H6UA 2C27A 4KOWA 1Z4EA 3VWEA 3B8GA 2F5IA 5KTCA 4KLVA 1XIXA 4MHDA 2Q4YA 1CJWA 1YREA 4JD6A 3KKWA 4CAVA 2JDCA 5F48A 3BJ7A 4U5YA 1V0CA 2CNTA 2K5TA 3F0AA 3G3SA 1KUXA 1S5KA 4IF5A 4PK2A 4ZBGA 2R8VA 3PZJA 4R9MA 4B5OA 1BOBA 2HQYA 1S60A 4MI4A 2O28A 1XEBA 1J4JA 2ZW4A 2NMTA 2WPXA 2PSWA 4KVXA 3PGPA 1QSRA 5HMNA 4R87A 4ONUA 1NE9A 3FB3A 5FVJA 3S6FA 4AVCA 4AVBA 4JJXA 2GANA 3FIXA 1P4NA 2DXQA 2R98A 4AVAA 4Y49B 2X7BA 3JUWA 3H4QA 2QMLA 1SQHA 1XE4A 1YLEA 3TE4A 4PK3A 1M4GA 3SHPA 3EY5A 2CNMA 3IGRA 2Q0YA 5DWNA 2PC1A 2OU2A 3D2MA 2P0WA 1M4DA 2BEIA 4FD5A 4E8OA 1MJBA 2GIVA 2PQ8A 4AB7A 5EC4A 3TOAA 3S6GA 3TO7A 2VBQA 4KVOE 2FL4A 2OH1A 1XMTA 1FY7A 4KOSA 1K4JA 1QSNA 2P6FA 3R9FA 2PRBA 2J8MA 3SXOA 4HNXB 3DNSA 2D4OA 4KZTA 4OAEA 3TO9A 5JPHA 3PP9A 2ARHA 4JLYA 4M3SA 1OZPA 1IYKA 4H6ZA 4QBJA 1KUVA 3VWDA 4KVME 4PV6A 2R1IA 3R95A 2PR1A 4LX9A 2ZW6A 4Y49C 2FXFA 2AJ6A 3N7ZA 1Y7RA 2R7HA 2Y0MA 3BJ8A 4CS0B 5IX3A 4II9A 2B58A 4U9YA 3TCVA 1I12A 1IICA 2B4DB 1IIDA 3EFAA 4QC6A 3K9UA 2Z0ZA 3R1KA 4PSWA 2IL4A 2I00A 3G8WA 1U6MA 1YX0A 4R57A 2B3VA 2FE7A 2Z10A 4MBUA 1Z9UA 5F46A 3F8KA 3R96A 1BO4A 3EC4A 5GCNA 4L89A 4E0AA 5IV0A 3D8PA 3GKRA 4M85A 2Z11A 3OWCA 4CAWA 1S7LA 2FS5A 3IWGA 1Y9KA 2D4PA 4XPDC 2VXKA 3CXSA 2OB0A 3ZZIA 2VI7A 2PDOA 2ZW5A 3T90A 3S6HA 1Q2CA 2VZZA 5DWMA 4IUSA 2J8RA 1NMTA 1UFHA 4YRHA 2B4BA 2RC4A 4OADA 2KCWA 4J3GA 2OZHA 1Y9WA 4MY0A 3D3SA 3TOBA 2JDDA 2A4NA 1VHSA 4NSQA 3D2PA 4KOVA 5C82A 1IYLA 4JXRA 1WK4A 2FIAA 4XNHC 2QECA 2VEZA 1KUYA 4FD7A 2HUZA 3LODA 1M1DA 3W91A 1PU9A 2P6GA 4CRZB 4QVTA 3V8IA 2I79A 3I3GA 4KUAA 2G3AA 4R3LA 4XPDB 4H89A 2FSRA 1GHEA 1Q2YA 1L0CA 3DR6A 4F6AA 4U9ZA 2ZXVA 2P6EA 2OZUA 4CAXA 1MJ9A
chains in the Genus database with same CATH superfamily
4MFKA 3B2YA 4UWIA 2PJ1A 2ZW7A 3H5ZA 4JWPA 4KSAA 2C1CA 4NGMA 5ISVA 2B5GB 2QIRA 4X5KA 2BSWA 3TTHA 2NYQA 3UY5A 1S7FA 3RZAA 4MCPA 3FJUA 5LRKA 1YR0A 2ZPAA 4R3KA 4XPLA 5LRGA 4A37A 1X12A 2PJ5A 2ABZA 1Z4RA 4CAEA 1NSLA 1S7NA 1VIXA 5JGFA 2WZNA 4MMOA 5KTAA 4KOTA 2B4DA 4CAFA 4DNCA 3DR8A 1B6BA 4YFJA 5CNPA 1YGHA 2YGWA 4RS2A 2C6PA 1NSAA 2ZEEA 4KOUA 4L8AA 1TXRA 2JLMA 3I9SA 3K2KA 4C7HA 4ZYQA 1IOIA 1M4IA 2CY2A 2JEWA 3H8GA 4NCZA 5F49A 4O23A 3E0KA 3SXNA 4NFRA 3W6XA 2AFOA 2AFMA 2GE3A 1OBRA 1BLLE 2AFSA 2Q43A 5LRJA 3D7GA 4KSIA 5J8CA 4XNHB 5H84A 2WYRA 3NE7A 2G0BA 2PJ7A 2CNSA 2ODFA 3TX8A 3S9LA 1QSOA 3FRMA 3CXQA 2VZYA 4UFWA 5G21A 2FIWA 3FMCA 1YMEA 5EBVA 4E2AA 2ZEDA 2PRQA 4YGOA 4P4FA 4QUSA 2FCKA 3S6KA 2J9AA 3FEDA 2BUEA 1HEEA 5G1ZA 4EWTA 3FVLA 3P2HA 2Q44A 3R9EA 4A30A 3W6SA 1IB1E 1DE4C 2PJBA 3NH4A 4KLWA 1R57A 4NEXA 3WC6A 2AE6A 2V8VA 2V8DA 3PBBA 1QSMA 2VQYA 1Z8WA 2Q51A 3QB8A 4UEZA 5G22A 4Z65A 4DUKA 3KASA 4OLLA 4EVYA 5K8MA 3LD2A 3NH5A 2EVNA 1I21A 3FECA 1PYTB 2HB6A 4A33A 2ATRA 1ARLA 4KORA 1ON0A 3B3CA 4TWEA 4MY3A 3TO6A 3SI1A 2REFA 3WR7A 5BWAB 1YK3A 1HDUA 1ARMA 3P2FA 1YVKA 1RO5A 3FNCA 4I49A 2HV2A 2DPTA 3FX6A 3QAHA 1QQ9A 3HUVA 4HPSA 4CYQA 3C26A 3CXPA 3HLPA 1KWMA 1YW4A 2JEVA 4QB9A 4F8ZA 3L2NA 5I4MA 1ZLHA 1JQGA 1H8LA 1Q7LA 2BL1A 3JVNA 4OC4A 4ZGYB 4OIDA 4HNYB 3TFYA 3N5FA 3IEHA 4KOXA 3V38A 4WJBA 4GS4A 4NGPA 5I0CA 1CP6A 2PR8A 3PBEA 4R8FA 5A27A 2PIYA 3BHXA 5J8FA 3S9NA 3B3VA 3PB6X 2Q4ZA 4AG9A 1ZG7A 1ZLIA 3A9LA 4NXYA 3EXNA 2Z3KA 2EWBA 3BLNA 4F0YA 4GM5A 4B13A 2ZEFA 2JBKA 2YNEA 3DSBA 3FXTA 5AG5A 2HC9A 4R76A 4A2ZA 2PIZA 1Z5RA 1LRZA 1YQEA 3DDDA 3TT2A 2Q04A 4CGNA 2QJ8A 2Z3MA 2REEA 3FBUA 1QSTA 3IU2A 4JXQA 4XPKA 2Q7BA 1IY7A 4HNWB 5IB0A 2H5MA 5AG6A 3RYOA 3SJGA 2PJ3A 2XEIA 4UWJA 2YNCC 2B3UA 4HKFA 8CPAA 4KOYA 2Z3PA 1RTQA 1RXTA 1VKCA 2OZGA 4MJ8A 4ZY0A 4OC5A 5HXDA 4ONWA 1LANA 1S7KA 3PB4X 1TIQA 3VATA 3F5BA 5E96A 2FT0A 2RFHA 4UBRA 1M44A 3MGDA 4P45A 3B3WA 4FD6A 2ZOFA 5HH1A 5LYIA 4CRYB 4RN7A 5C88A 2QVPA 2G3TA 1LFWA 4IHMA 3IC1A 2ZOGA 2WPWA 3H8EA 4BD9A 3PFOA 1P0HA 4KS9A 4OP4A 4RI1A 4FWUA 4BMHA 1S3ZA 1Y0YA 2B5GA 2BO9A 2Q7SA 4DJLA 2CF4A 1TF9A 5J1QA 4P10A 5JQ4A 2POKA 1WWZA 5H86A 3DLJA 2OOTA 4AG7A 3D67A 4PSXA 1XF8A 5K8OA 1KZFA 3QAYA 4NF1A 5KTDA 4LUAA 1B87A 1N71A 2PE3A 1LCPA 3KHXA 5HVHA 3S9MA 4FD4A 4MFLA 1A2ZA 3T9YA 4B5PA 4UCMA 5HVGA 4A39A 5EMIA 1CBXA 3CDXA 3R9GA 1I1DA 1IOFA 3DGVA 4ORFA 1ZG8A 2Q4VA 1CM0A 5JH9A 3EO4A 3D7DA 2EUIA 1X10A 1YVOA 3FYNA 4OC2A 3V7ZA 3GYAA 1Q2DA 4CYNA 5F47A 4OMEA 4BINA 1CPXA 1CX8A 1MJAA 2YNCA 4R7MA 3ZJ0A 4B5PB 2J8NA 1PUAA 3GY9A 4K30A 4UA3A 4KUBA 3LWUA 1CP7A 1MK4A 4H6UA 2C27A 4KOWA 1Z4EA 2V8GA 4ZY2A 4B6ZA 3SI2A 4EFDA 3VWEA 3IIBA 4EMEA 3B8GA 2F5IA 5KTCA 4BBHA 2YNDA 4KLVA 2XEGA 1XIXA 5AG7A 4MHDA 5DS0A 1TF8A 2Q4YA 1CJWA 5THWA 5IB9A 1YREA 4MFPA 4JD6A 3KKWA 5LYDA 4M6IA 3VARA 4CAVA 1VHEA 2GFQA 2JDCA 5F48A 3BJ7A 4U5YA 2BOAA 1V0CA 2CNTA 4YWYA 3K9TA 2K5TA 3F0AA 3G3SA 4NGNA 4AXVA 4UFVA 4IK2A 4MCSA 2G9DA 3IJ3A 1KUXA 1S5KA 4IF5A 5A28A 4NGQA 2XEJA 3JRUA 1ELMP 4PK2A 4PQAA 4ZBGA 2R8VA 3PZJA 1VHOA 2ZELA 3KQXA 1CPSA 4A95A 4R9MA 4B5OA 1BOBA 3NA6A 4K3NA 3WT4A 2HQYA 4MXUA 1S60A 4MI4A 2O28A 1XEBA 2O4HA 1J4JA 1HDQA 4ZI6A 4LQ6A 2ZW4A 5G20A 2NMTA 2ZEGA 2C6CA 2CXAA 2WPXA 2PSWA 4KVXA 4B11A 3PGPA 5D8NA 3TC8A 1QSRA 4B12A 5HMNA 4P4JA 5JM6A 4CGPA 4R87A 4CYPA 3LACA 3FEEA 4UFXA 4MHYA 4P44A 1XJOA 4ONUA 1NE9A 3FB3A 3KL9A 5FVJA 3S6FA 4AVCA 4AVBA 1JWQA 4JJXA 2F8HA 2GANA 2GREA 3FIXA 3MN8A 4UF4A 1P4NA 7CPAA 2AFXA 4OC0A 3IWWA 2DXQA 4JZ0A 2PJCA 4JYWA 1YSJA 2R98A 4AVAA 4C68A 4Y49B 2X7BA 2XEFA 3H4QA 1IGBA 2QMLA 3H8FA 3JUWA 5AGEA 3PB8X 3GUXA 1SQHA 4MCRA 1XE4A 1YLEA 1TKJA 2AFUA 1IU8A 4DYOA 3CPXA 3TE4A 4PK3A 1M4GA 2VL1A 2EK9A 1Y7EA 3KR5A 3SHPA 3EY5A 2CNMA 1YLOA 3B3SA 3CT9A 3D66A 1YW6A 4M6GA 3IGRA 4IAVA 1R3NA 2Q0YA 4A31A 2DF5A 1LAPA 5DWNA 2PC1A 2DEAA 5CPAA 2OU2A 4CPAA 2ZEHA 3D2MA 3B7IA 1Y0RA 3FH4A 5K8PA 2WSAA 2PJAA 3KGQA 1CG2A 2P0WA 2EO8A 1M4DA 2BEIA 3D7HA 4FD5A 4E8OA 1MJBA 2GIVA 2PQ8A 3PFEA 4M6HA 4AB7A 5EC4A 3KI9A 4OIWA 2PCUA 3PRTA 4X8IA 2PJ2A 4P4BA 3TOAA 3S6GA 3TO7A 2VBQA 3ISZA 2EBJA 3CPAA 4KVOE 5K8NA 2FL4A 2OH1A 1XMTA 4ZY1A 1FY7A 2QYVA 4KOSA 1K4JA 4UCNA 1LAMA 2CIJA 1QSNA 2IJZA 5ELYA 5HVFA 4CGMA 3KR4A 2P6FA 4OC1A 2WUUA 2PRBA 2J8MA 4OKOA 3R9FA 3SXOA 2V8HA 4HNXB 3MRUA 1F2OA 3DNSA 5CBMA 2D4OA 3SI0A 2ZEPA 3PEIA 4KZTA 4OAEA 4NJQA 4UIBA 3TO9A 5F09A 5JPHA 3PP9A 3WC5A 4MHPA 1BAVA 1BPMA 2ARHA 4UEFA 4X3RA 4PXEA 3I1UA 4JLYA 2ZEOA 4M3SA 1OZPA 1XOVA 2PVVA 1IYKA 1XMBA 4H6ZA 4QBJA 1KUVA 3KZWA 3VWDA 2I3CA 4FBEA 4RUHA 3IO1A 4CYOA 4KVME 3D4UA 2R1IA 4PV6A 3R95A 2PR1A 3BI1A 4PXDA 3ISXA 2ZW6A 3D7FA 4LX9A 4UEEA 4UIAA 4Y49C 2FXFA 1F2PA 2AJ6A 3GB0A 3N7ZA 4A94A 2BCOA 1Y7RA 2R7HA 2AFZA 2Y0MA 3BJ8A 4CS0B 4TNUA 3IU1A 4CGLA 5IX3A 4II9A 3BXMA 4LQGA 3D68A 1FNOA 1EE3P 1TKFA 2B58A 4W9YA 4C2YA 2JBJA 4U9YA 3TCVA 4PPZA 1I12A 1IICA 3SJFA 5LYLA 4P6YA 3BI0A 2B4DB 1IIDA 3EFAA 4NGRA 4ZX8A 3WABA 3QNVA 4YU9A 4F9UA 3RNZA 4NGSA 1ELLP 4QC6A 2EK8A 3K9UA 3LMSA 4Q7AA 2Z0ZA 3R1KA 4PSWA 3JTKA 5LYFA 2IL4A 4X2TA 2GU2A 2C6GA 2I00A 3G8WA 1U6MA 1YX0A 4R57A 4MFZA 2B3VA 4CGOA 4NGTA 2Z3NA 5AG4A 2FE7A 3GIUA 2Z10A 4F0XA 1Z8LA 4MBUA 1Z9UA 5F46A 4PXCA 3F8KA 4NJRA 2AFWA 3R96A 4FUUA 1BO4A 3EC4A 1XBUA 5GCNA 4OC3A 2PJ9A 4H2KA 1LOKA 2ZEMA 4L89A 4MFJA 4ZX9A 4E0AA 4MFQA 4UCPA 5IV0A 2F7VA 2Z3LA 3D8PA 3GKRA 4M85A 2IMOA 2Z11A 3OWCA 3PB9X 3NFZA 3T8WA 2PJ4A 4Q36A 4A38A 1F57A 4C2XA 4CAWA 1S7LA 2FS5A 3IWGA 1Y9KA 2GLFA 4GXHA 2D4PA 3KHZA 4XPDC 2VXKA 2ANPA 1R43A 3CXSA 4Q38A 1ZG9A 2OB0A 3RO0A 3ZZIA 1BPNA 2PDOA 2VI7A 3RBUA 1AYEA 1PCAA 1VGYA 2ZW5A 3T90A 4F9VA 3S6HA 1Q2CA 1AMPA 2VZZA 4P4IA 4R6TA 5DWMA 4IUSA 1QMUA 2J8RA 1NMTA 1UFHA 2GLJA 4YRHA 2B4BA 2RC4A 6CPAA 4OADA 3PB7X 2KCWA 2PVWA 2PJ6A 3NE8A 4WWVA 2CTCA 2RB7A 4J3GA 2OZHA 1Y9WA 1Z8XA 2FVGA 4MHNA 3SJXA 4MY0A 3VH9A 3D3SA 3TOBA 2CTBA 1M4LA 1ZO0A 2O53A 2V77A 2OR4A 3WC7A 4PXBA 2JDDA 3B35A 4B14A 2A4NA 1VHSA 1XRYA 4NSQA 3D2PA 1FT7A 4KOVA 5C82A 1IYLA 3KQZA 1Z8TA 3CZXA 3RAMA 4JXRA 4MRIA 5D29A 1WK4A 2FIAA 4XNHC 2DPSA 2QECA 3FF3A 2VEZA 2IQ6A 4KSFA 1KUYA 4C2ZA 4FD7A 1AUGA 2HUZA 1Z2LA 1DTDA 1GYTA 3LODA 4B10A 1M1DA 4P4EA 2ZENA 3W91A 1PU9A 2P6GA 2NSMA 4CRZB 3B3TA 2PJ0A 4G1PA 4QVTA 3V8IA 4MHZA 4A32A 2I79A 1XFOA 4MCQA 3I3GA 4KUAA 2G3AA 4C7IA 3SJEA 4R3LA 4P4DA 4XPDB 4H89A 2FSRA 3IFEA 1TKHA 1GHEA 2Z3OA 1Q2YA 2PJ8A 1L0CA 3IWEA 3NH8A 3DR6A 4F6AA 3GLJA 1UWYA 2ZXVA 4U9ZA 4FAIA 2P6EA 2OZUA 4CAXA 1MJ9A
chains in the Genus database with same CATH topology
4MFKA 4UWIA 3H5ZA 2ZW7A 4JWPA 4KSAA 5ISVA 2B5GB 2QIRA 4X5KA 2BSWA 3TTHA 3UY5A 1S7FA 1YR0A 2ZPAA 4R3KA 4XPLA 4CAEA 1Z4RA 1NSLA 1S7NA 5KTAA 4KOTA 2B4DA 4CAFA 4DNCA 3DR8A 1B6BA 4YFJA 5CNPA 1YGHA 2YGWA 4RS2A 4KOUA 4C7HA 4L8AA 2JLMA 3I9SA 2CY2A 1M4IA 4NCZA 5F49A 3E0KA 3SXNA 3W6XA 2GE3A 5J8CA 4XNHB 5H84A 3NE7A 2G0BA 2CNSA 1QSOA 3FRMA 3CXQA 2VZYA 4UFWA 5G21A 2FIWA 5EBVA 4E2AA 4YGOA 4QUSA 2FCKA 3S6KA 2BUEA 5G1ZA 3P2HA 2Q44A 3R9EA 4A30A 3W6SA 1IB1E 4KLWA 1R57A 4NEXA 2AE6A 1QSMA 2VQYA 3QB8A 5G22A 4OLLA 4EVYA 3LD2A 2EVNA 1I21A 4A33A 2ATRA 4KORA 1ON0A 4MY3A 3TO6A 2REFA 3WR7A 5BWAB 1YK3A 3P2FA 1YVKA 1RO5A 3FNCA 4I49A 2HV2A 2DPTA 3QAHA 4CYQA 3C26A 3CXPA 2JEVA 4QB9A 2BL1A 4ZGYB 3JVNA 4HNYB 3TFYA 4KOXA 4GS4A 5I0CA 2PR8A 5A27A 5J8FA 4AG9A 3A9LA 4NXYA 3EXNA 2Z3KA 3BLNA 4F0YA 4B13A 2YNEA 3DSBA 3FXTA 5AG5A 4A2ZA 1LRZA 3DDDA 3TT2A 2Q04A 4CGNA 2Z3MA 2REEA 3FBUA 1QSTA 3IU2A 4JXQA 4XPKA 2Q7BA 5IB0A 4HNWB 2H5MA 5AG6A 3RYOA 4UWJA 2YNCC 2B3UA 4HKFA 4KOYA 2Z3PA 1VKCA 1RXTA 2OZGA 4MJ8A 1S7KA 1TIQA 3F5BA 5E96A 2FT0A 4UBRA 1M44A 3MGDA 4FD6A 5HH1A 4CRYB 5C88A 2G3TA 2WPWA 1P0HA 4KS9A 4RI1A 4BMHA 1S3ZA 2B5GA 5JQ4A 1WWZA 5H86A 4AG7A 4PSXA 1XF8A 1KZFA 4NF1A 5KTDA 4LUAA 1B87A 1N71A 4FD4A 4MFLA 3T9YA 4B5PA 4UCMA 3R9GA 1I1DA 4ORFA 2Q4VA 1CM0A 3EO4A 3FYNA 2EUIA 1YVOA 4CYNA 3GYAA 1Q2DA 5F47A 2YNCA 1MJAA 3ZJ0A 4B5PB 2J8NA 1PUAA 3GY9A 4K30A 4UA3A 4KUBA 1MK4A 4H6UA 2C27A 4KOWA 1Z4EA 3VWEA 3B8GA 2F5IA 5KTCA 4BBHA 2YNDA 4KLVA 1XIXA 5AG7A 4MHDA 2Q4YA 1CJWA 1YREA 4MFPA 4JD6A 3KKWA 4CAVA 2JDCA 5F48A 3BJ7A 4U5YA 1V0CA 2CNTA 2K5TA 3F0AA 3G3SA 4UFVA 1KUXA 1S5KA 4IF5A 5A28A 4PK2A 4ZBGA 2R8VA 3PZJA 4A95A 4R9MA 4B5OA 1BOBA 2HQYA 1S60A 4MI4A 2O28A 1XEBA 1J4JA 2ZW4A 5G20A 2NMTA 2CXAA 2WPXA 2PSWA 4KVXA 4B11A 3PGPA 1QSRA 4B12A 5HMNA 4CGPA 4R87A 4CYPA 4UFXA 4ONUA 1NE9A 3FB3A 5FVJA 3S6FA 4AVCA 4AVBA 4JJXA 2GANA 3FIXA 1P4NA 2DXQA 2R98A 4AVAA 4C68A 4Y49B 2X7BA 3JUWA 3H4QA 2QMLA 5AGEA 1SQHA 1XE4A 1YLEA 3TE4A 4PK3A 1M4GA 3SHPA 3EY5A 2CNMA 3IGRA 2Q0YA 4A31A 5DWNA 2PC1A 2OU2A 3D2MA 2WSAA 2P0WA 1M4DA 2BEIA 4FD5A 4E8OA 1MJBA 2GIVA 2PQ8A 4AB7A 5EC4A 3TOAA 3S6GA 3TO7A 2VBQA 4KVOE 2FL4A 2OH1A 1XMTA 1FY7A 4KOSA 1K4JA 4UCNA 1QSNA 4CGMA 2P6FA 2WUUA 2PRBA 2J8MA 3R9FA 3SXOA 4HNXB 3DNSA 2D4OA 4KZTA 4OAEA 3TO9A 5JPHA 3PP9A 2ARHA 4JLYA 4M3SA 1OZPA 1IYKA 4H6ZA 4QBJA 1KUVA 3VWDA 4CYOA 4KVME 4PV6A 2R1IA 3R95A 2PR1A 4LX9A 2ZW6A 4Y49C 2FXFA 2AJ6A 3N7ZA 1Y7RA 2R7HA 2Y0MA 3BJ8A 4CS0B 3IU1A 4CGLA 5IX3A 4II9A 2B58A 4C2YA 4U9YA 3TCVA 1I12A 1IICA 2B4DB 1IIDA 3EFAA 4QC6A 3K9UA 2Z0ZA 3R1KA 4PSWA 3JTKA 2IL4A 2I00A 3G8WA 1U6MA 1YX0A 4R57A 4MFZA 2B3VA 4CGOA 2Z3NA 5AG4A 2FE7A 2Z10A 4F0XA 4MBUA 1Z9UA 5F46A 3F8KA 3R96A 1BO4A 3EC4A 5GCNA 4L89A 4MFJA 4E0AA 4MFQA 4UCPA 5IV0A 2Z3LA 3D8PA 3GKRA 4M85A 2Z11A 3OWCA 4Q36A 4CAWA 4C2XA 1S7LA 2FS5A 3IWGA 1Y9KA 2D4PA 4XPDC 2VXKA 3CXSA 4Q38A 2OB0A 3ZZIA 2VI7A 2PDOA 2ZW5A 3T90A 3S6HA 1Q2CA 2VZZA 5DWMA 4IUSA 2J8RA 1NMTA 1UFHA 4YRHA 2B4BA 2RC4A 4OADA 2KCWA 4J3GA 2OZHA 1Y9WA 4MY0A 3D3SA 3TOBA 1ZO0A 2JDDA 4B14A 2A4NA 1VHSA 4NSQA 3D2PA 4KOVA 5C82A 1IYLA 4JXRA 1WK4A 2FIAA 4XNHC 2DPSA 2QECA 2VEZA 4KSFA 1KUYA 4C2ZA 4FD7A 2HUZA 4B10A 3LODA 1M1DA 3W91A 1PU9A 2P6GA 4CRZB 4QVTA 3V8IA 4A32A 2I79A 3I3GA 4KUAA 2G3AA 4C7IA 4R3LA 4XPDB 4H89A 2FSRA 1GHEA 2Z3OA 1Q2YA 3IWEA 1L0CA 3DR6A 4F6AA 4U9ZA 2ZXVA 2P6EA 2OZUA 4CAXA 1MJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWI A;  4JWP A;  2ZW7 A;  5ISV A;  2B5G B;  2QIR A;  4X5K A;  2BSW A;  3TTH A;  3UY5 A;  1S7F A;  1YR0 A;  2ZPA A;  4R3K A;  4XPL A;  1Z4R A;  1NSL A;  1S7N A;  5KTA A;  4KOT A;  2B4D A;  4DNC A;  3DR8 A;  1B6B A;  4YFJ A;  5CNP A;  1YGH A;  4RS2 A;  4KOU A;  4L8A A;  2JLM A;  3I9S A;  2CY2 A;  1M4I A;  4NCZ A;  5F49 A;  3E0K A;  3SXN A;  3W6X A;  2GE3 A;  5J8C A;  4XNH B;  5H84 A;  3NE7 A;  2G0B A;  2CNS A;  1QSO A;  3FRM A;  3CXQ A;  2VZY A;  2FIW A;  5EBV A;  4E2A A;  4YGO A;  4QUS A;  2FCK A;  3S6K A;  2BUE A;  3P2H A;  2Q44 A;  3R9E A;  3W6S A;  1IB1 E;  4KLW A;  1R57 A;  4NEX A;  2AE6 A;  1QSM A;  2VQY A;  3QB8 A;  4OLL A;  4EVY A;  3LD2 A;  2EVN A;  1I21 A;  2ATR A;  4KOR A;  1ON0 A;  4MY3 A;  3TO6 A;  2REF A;  3WR7 A;  1YK3 A;  3P2F A;  1YVK A;  1RO5 A;  3FNC A;  4I49 A;  2HV2 A;  3QAH A;  3C26 A;  3CXP A;  2JEV A;  4QB9 A;  2BL1 A;  3JVN A;  4HNY B;  3TFY A;  4KOX A;  4GS4 A;  5I0C A;  2PR8 A;  5J8F A;  4AG9 A;  4NXY A;  3EXN A;  3BLN A;  4F0Y A;  3DSB A;  3FXT A;  1LRZ A;  3DDD A;  3TT2 A;  2Q04 A;  2REE A;  3FBU A;  1QST A;  4JXQ A;  4XPK A;  2Q7B A;  5IB0 A;  4HNW B;  2H5M A;  3RYO A;  4UWJ A;  2B3U A;  4HKF A;  4KOY A;  1VKC A;  1RXT A;  2OZG A;  4MJ8 A;  1S7K A;  1TIQ A;  3F5B A;  5E96 A;  2FT0 A;  4UBR A;  1M44 A;  3MGD A;  4FD6 A;  5HH1 A;  4CRY B;  5C88 A;  2G3T A;  2WPW A;  1P0H A;  4RI1 A;  4BMH A;  1S3Z A;  2B5G A;  5JQ4 A;  1WWZ A;  5H86 A;  4AG7 A;  4PSX A;  1XF8 A;  1KZF A;  4NF1 A;  5KTD A;  4LUA A;  1B87 A;  1N71 A;  4FD4 A;  3T9Y A;  4B5P A;  3R9G A;  1I1D A;  4ORF A;  2Q4V A;  1CM0 A;  3EO4 A;  3FYN A;  2EUI A;  1YVO A;  3GYA A;  1Q2D A;  5F47 A;  1MJA A;  3ZJ0 A;  4B5P B;  2J8N A;  1PUA A;  3GY9 A;  4K30 A;  4UA3 A;  4KUB A;  1MK4 A;  4H6U A;  2C27 A;  4KOW A;  1Z4E A;  3VWE A;  3B8G A;  2F5I A;  5KTC A;  4KLV A;  1XIX A;  4MHD A;  2Q4Y A;  1CJW A;  1YRE A;  4JD6 A;  3KKW A;  4CAV A;  2JDC A;  5F48 A;  3BJ7 A;  4U5Y A;  1V0C A;  2CNT A;  2K5T A;  3F0A A;  3G3S A;  1KUX A;  1S5K A;  4IF5 A;  4PK2 A;  4ZBG A;  2R8V A;  3PZJ A;  4R9M A;  4B5O A;  1BOB A;  2HQY A;  1S60 A;  4MI4 A;  2O28 A;  1XEB A;  1J4J A;  2ZW4 A;  2NMT A;  2WPX A;  2PSW A;  4KVX A;  3PGP A;  1QSR A;  5HMN A;  4R87 A;  4ONU A;  1NE9 A;  3FB3 A;  5FVJ A;  3S6F A;  4AVC A;  4AVB A;  4JJX A;  2GAN A;  3FIX A;  1P4N A;  2DXQ A;  2R98 A;  4AVA A;  4Y49 B;  2X7B A;  3JUW A;  3H4Q A;  2QML A;  1SQH A;  1XE4 A;  1YLE A;  3TE4 A;  4PK3 A;  1M4G A;  3SHP A;  3EY5 A;  2CNM A;  3IGR A;  2Q0Y A;  5DWN A;  2PC1 A;  2OU2 A;  3D2M A;  2P0W A;  1M4D A;  2BEI A;  4FD5 A;  4E8O A;  1MJB A;  2GIV A;  2PQ8 A;  4AB7 A;  5EC4 A;  3TOA A;  3S6G A;  3TO7 A;  2VBQ A;  4KVO E;  2FL4 A;  2OH1 A;  1XMT A;  1FY7 A;  4KOS A;  1K4J A;  1QSN A;  2P6F A;  3R9F A;  2PRB A;  2J8M A;  3SXO A;  4HNX B;  3DNS A;  2D4O A;  4KZT A;  4OAE A;  3TO9 A;  5JPH A;  3PP9 A;  2ARH A;  4JLY A;  4M3S A;  1OZP A;  1IYK A;  4H6Z A;  4QBJ A;  1KUV A;  3VWD A;  4KVM E;  4PV6 A;  2R1I A;  3R95 A;  2PR1 A;  4LX9 A;  2ZW6 A;  4Y49 C;  2FXF A;  2AJ6 A;  3N7Z A;  1Y7R A;  2R7H A;  2Y0M A;  3BJ8 A;  4CS0 B;  5IX3 A;  4II9 A;  2B58 A;  4U9Y A;  3TCV A;  1I12 A;  1IIC A;  2B4D B;  1IID A;  3EFA A;  4QC6 A;  3K9U A;  2Z0Z A;  3R1K A;  4PSW A;  2IL4 A;  2I00 A;  3G8W A;  1U6M A;  1YX0 A;  4R57 A;  2B3V A;  2FE7 A;  2Z10 A;  4MBU A;  1Z9U A;  5F46 A;  3F8K A;  3R96 A;  1BO4 A;  3EC4 A;  5GCN A;  4L89 A;  4E0A A;  5IV0 A;  3D8P A;  3GKR A;  4M85 A;  2Z11 A;  3OWC A;  4CAW A;  1S7L A;  2FS5 A;  3IWG A;  1Y9K A;  2D4P A;  4XPD C;  2VXK A;  3CXS A;  2OB0 A;  3ZZI A;  2VI7 A;  2PDO A;  2ZW5 A;  3T90 A;  3S6H A;  1Q2C A;  2VZZ A;  5DWM A;  4IUS A;  2J8R A;  1NMT A;  1UFH A;  4YRH A;  2B4B A;  2RC4 A;  4OAD A;  2KCW A;  4J3G A;  2OZH A;  1Y9W A;  4MY0 A;  3D3S A;  3TOB A;  2JDD A;  2A4N A;  1VHS A;  4NSQ A;  3D2P A;  4KOV A;  5C82 A;  1IYL A;  4JXR A;  1WK4 A;  2FIA A;  4XNH C;  2QEC A;  2VEZ A;  1KUY A;  4FD7 A;  2HUZ A;  3LOD A;  1M1D A;  3W91 A;  1PU9 A;  2P6G A;  4CRZ B;  4QVT A;  3V8I A;  2I79 A;  3I3G A;  4KUA A;  2G3A A;  4R3L A;  4XPD B;  4H89 A;  2FSR A;  1GHE A;  1Q2Y A;  1L0C A;  3DR6 A;  4F6A A;  4U9Z A;  2ZXV A;  2P6E A;  2OZU A;  4CAX A;  1MJ9 A; 
#chains in the Genus database with same CATH topology
 4MFK A;  3B2Y A;  4UWI A;  2PJ1 A;  2ZW7 A;  3H5Z A;  4JWP A;  4KSA A;  2C1C A;  4NGM A;  5ISV A;  2B5G B;  2QIR A;  4X5K A;  2BSW A;  3TTH A;  2NYQ A;  3UY5 A;  1S7F A;  3RZA A;  4MCP A;  3FJU A;  5LRK A;  1YR0 A;  2ZPA A;  4R3K A;  4XPL A;  5LRG A;  4A37 A;  1X12 A;  2PJ5 A;  2ABZ A;  1Z4R A;  4CAE A;  1NSL A;  1S7N A;  1VIX A;  5JGF A;  2WZN A;  4MMO A;  5KTA A;  4KOT A;  2B4D A;  4CAF A;  4DNC A;  3DR8 A;  1B6B A;  4YFJ A;  5CNP A;  1YGH A;  2YGW A;  4RS2 A;  2C6P A;  1NSA A;  2ZEE A;  4KOU A;  4L8A A;  1TXR A;  2JLM A;  3I9S A;  3K2K A;  4C7H A;  4ZYQ A;  1IOI A;  1M4I A;  2CY2 A;  2JEW A;  3H8G A;  4NCZ A;  5F49 A;  4O23 A;  3E0K A;  3SXN A;  4NFR A;  3W6X A;  2AFO A;  2AFM A;  2GE3 A;  1OBR A;  1BLL E;  2AFS A;  2Q43 A;  5LRJ A;  3D7G A;  4KSI A;  5J8C A;  4XNH B;  5H84 A;  2WYR A;  3NE7 A;  2G0B A;  2PJ7 A;  2CNS A;  2ODF A;  3TX8 A;  3S9L A;  1QSO A;  3FRM A;  3CXQ A;  2VZY A;  4UFW A;  5G21 A;  2FIW A;  3FMC A;  1YME A;  5EBV A;  4E2A A;  2ZED A;  2PRQ A;  4YGO A;  4P4F A;  4QUS A;  2FCK A;  3S6K A;  2J9A A;  3FED A;  2BUE A;  1HEE A;  5G1Z A;  4EWT A;  3FVL A;  3P2H A;  2Q44 A;  3R9E A;  4A30 A;  3W6S A;  1IB1 E;  1DE4 C;  2PJB A;  3NH4 A;  4KLW A;  1R57 A;  4NEX A;  3WC6 A;  2AE6 A;  2V8V A;  2V8D A;  3PBB A;  1QSM A;  2VQY A;  1Z8W A;  2Q51 A;  3QB8 A;  4UEZ A;  5G22 A;  4Z65 A;  4DUK A;  3KAS A;  4OLL A;  4EVY A;  5K8M A;  3LD2 A;  3NH5 A;  2EVN A;  1I21 A;  3FEC A;  1PYT B;  2HB6 A;  4A33 A;  2ATR A;  1ARL A;  4KOR A;  1ON0 A;  3B3C A;  4TWE A;  4MY3 A;  3TO6 A;  3SI1 A;  2REF A;  3WR7 A;  5BWA B;  1YK3 A;  1HDU A;  1ARM A;  3P2F A;  1YVK A;  1RO5 A;  3FNC A;  4I49 A;  2HV2 A;  2DPT A;  3FX6 A;  3QAH A;  1QQ9 A;  3HUV A;  4HPS A;  4CYQ A;  3C26 A;  3CXP A;  3HLP A;  1KWM A;  1YW4 A;  2JEV A;  4QB9 A;  4F8Z A;  3L2N A;  5I4M A;  1ZLH A;  1JQG A;  1H8L A;  1Q7L A;  2BL1 A;  3JVN A;  4OC4 A;  4ZGY B;  4OID A;  4HNY B;  3TFY A;  3N5F A;  3IEH A;  4KOX A;  3V38 A;  4WJB A;  4GS4 A;  4NGP A;  5I0C A;  1CP6 A;  2PR8 A;  3PBE A;  4R8F A;  5A27 A;  2PIY A;  3BHX A;  5J8F A;  3S9N A;  3B3V A;  3PB6 X;  2Q4Z A;  4AG9 A;  1ZG7 A;  1ZLI A;  3A9L A;  4NXY A;  3EXN A;  2Z3K A;  2EWB A;  3BLN A;  4F0Y A;  4GM5 A;  4B13 A;  2ZEF A;  2JBK A;  2YNE A;  3DSB A;  3FXT A;  5AG5 A;  2HC9 A;  4R76 A;  4A2Z A;  2PIZ A;  1Z5R A;  1LRZ A;  1YQE A;  3DDD A;  3TT2 A;  2Q04 A;  4CGN A;  2QJ8 A;  2Z3M A;  2REE A;  3FBU A;  1QST A;  3IU2 A;  4JXQ A;  4XPK A;  2Q7B A;  1IY7 A;  4HNW B;  5IB0 A;  2H5M A;  5AG6 A;  3RYO A;  3SJG A;  2PJ3 A;  2XEI A;  4UWJ A;  2YNC C;  2B3U A;  4HKF A;  8CPA A;  4KOY A;  2Z3P A;  1RTQ A;  1RXT A;  1VKC A;  2OZG A;  4MJ8 A;  4ZY0 A;  4OC5 A;  5HXD A;  4ONW A;  1LAN A;  1S7K A;  3PB4 X;  1TIQ A;  3VAT A;  3F5B A;  5E96 A;  2FT0 A;  2RFH A;  4UBR A;  1M44 A;  3MGD A;  4P45 A;  3B3W A;  4FD6 A;  2ZOF A;  5HH1 A;  5LYI A;  4CRY B;  4RN7 A;  5C88 A;  2QVP A;  2G3T A;  1LFW A;  4IHM A;  3IC1 A;  2ZOG A;  2WPW A;  3H8E A;  4BD9 A;  3PFO A;  1P0H A;  4KS9 A;  4OP4 A;  4RI1 A;  4FWU A;  4BMH A;  1S3Z A;  1Y0Y A;  2B5G A;  2BO9 A;  2Q7S A;  4DJL A;  2CF4 A;  1TF9 A;  5J1Q A;  4P10 A;  5JQ4 A;  2POK A;  1WWZ A;  5H86 A;  3DLJ A;  2OOT A;  4AG7 A;  3D67 A;  4PSX A;  1XF8 A;  5K8O A;  1KZF A;  3QAY A;  4NF1 A;  5KTD A;  4LUA A;  1B87 A;  1N71 A;  2PE3 A;  1LCP A;  3KHX A;  5HVH A;  3S9M A;  4FD4 A;  4MFL A;  1A2Z A;  3T9Y A;  4B5P A;  4UCM A;  5HVG A;  4A39 A;  5EMI A;  1CBX A;  3CDX A;  3R9G A;  1I1D A;  1IOF A;  3DGV A;  4ORF A;  1ZG8 A;  2Q4V A;  1CM0 A;  5JH9 A;  3EO4 A;  3D7D A;  2EUI A;  1X10 A;  1YVO A;  3FYN A;  4OC2 A;  3V7Z A;  3GYA A;  1Q2D A;  4CYN A;  5F47 A;  4OME A;  4BIN A;  1CPX A;  1CX8 A;  1MJA A;  2YNC A;  4R7M A;  3ZJ0 A;  4B5P B;  2J8N A;  1PUA A;  3GY9 A;  4K30 A;  4UA3 A;  4KUB A;  3LWU A;  1CP7 A;  1MK4 A;  4H6U A;  2C27 A;  4KOW A;  1Z4E A;  2V8G A;  4ZY2 A;  4B6Z A;  3SI2 A;  4EFD A;  3VWE A;  3IIB A;  4EME A;  3B8G A;  2F5I A;  5KTC A;  4BBH A;  2YND A;  4KLV A;  2XEG A;  1XIX A;  5AG7 A;  4MHD A;  5DS0 A;  1TF8 A;  2Q4Y A;  1CJW A;  5THW A;  5IB9 A;  1YRE A;  4MFP A;  4JD6 A;  3KKW A;  5LYD A;  4M6I A;  3VAR A;  4CAV A;  1VHE A;  2GFQ A;  2JDC A;  5F48 A;  3BJ7 A;  4U5Y A;  2BOA A;  1V0C A;  2CNT A;  4YWY A;  3K9T A;  2K5T A;  3F0A A;  3G3S A;  4NGN A;  4AXV A;  4UFV A;  4IK2 A;  4MCS A;  2G9D A;  3IJ3 A;  1KUX A;  1S5K A;  4IF5 A;  5A28 A;  4NGQ A;  2XEJ A;  3JRU A;  1ELM P;  4PK2 A;  4PQA A;  4ZBG A;  2R8V A;  3PZJ A;  1VHO A;  2ZEL A;  3KQX A;  1CPS A;  4A95 A;  4R9M A;  4B5O A;  1BOB A;  3NA6 A;  4K3N A;  3WT4 A;  2HQY A;  4MXU A;  1S60 A;  4MI4 A;  2O28 A;  1XEB A;  2O4H A;  1J4J A;  1HDQ A;  4ZI6 A;  4LQ6 A;  2ZW4 A;  5G20 A;  2NMT A;  2ZEG A;  2C6C A;  2CXA A;  2WPX A;  2PSW A;  4KVX A;  4B11 A;  3PGP A;  5D8N A;  3TC8 A;  1QSR A;  4B12 A;  5HMN A;  4P4J A;  5JM6 A;  4CGP A;  4R87 A;  4CYP A;  3LAC A;  3FEE A;  4UFX A;  4MHY A;  4P44 A;  1XJO A;  4ONU A;  1NE9 A;  3FB3 A;  3KL9 A;  5FVJ A;  3S6F A;  4AVC A;  4AVB A;  1JWQ A;  4JJX A;  2F8H A;  2GAN A;  2GRE A;  3FIX A;  3MN8 A;  4UF4 A;  1P4N A;  7CPA A;  2AFX A;  4OC0 A;  3IWW A;  2DXQ A;  4JZ0 A;  2PJC A;  4JYW A;  1YSJ A;  2R98 A;  4AVA A;  4C68 A;  4Y49 B;  2X7B A;  2XEF A;  3H4Q A;  1IGB A;  2QML A;  3H8F A;  3JUW A;  5AGE A;  3PB8 X;  3GUX A;  1SQH A;  4MCR A;  1XE4 A;  1YLE A;  1TKJ A;  2AFU A;  1IU8 A;  4DYO A;  3CPX A;  3TE4 A;  4PK3 A;  1M4G A;  2VL1 A;  2EK9 A;  1Y7E A;  3KR5 A;  3SHP A;  3EY5 A;  2CNM A;  1YLO A;  3B3S A;  3CT9 A;  3D66 A;  1YW6 A;  4M6G A;  3IGR A;  4IAV A;  1R3N A;  2Q0Y A;  4A31 A;  2DF5 A;  1LAP A;  5DWN A;  2PC1 A;  2DEA A;  5CPA A;  2OU2 A;  4CPA A;  2ZEH A;  3D2M A;  3B7I A;  1Y0R A;  3FH4 A;  5K8P A;  2WSA A;  2PJA A;  3KGQ A;  1CG2 A;  2P0W A;  2EO8 A;  1M4D A;  2BEI A;  3D7H A;  4FD5 A;  4E8O A;  1MJB A;  2GIV A;  2PQ8 A;  3PFE A;  4M6H A;  4AB7 A;  5EC4 A;  3KI9 A;  4OIW A;  2PCU A;  3PRT A;  4X8I A;  2PJ2 A;  4P4B A;  3TOA A;  3S6G A;  3TO7 A;  2VBQ A;  3ISZ A;  2EBJ A;  3CPA A;  4KVO E;  5K8N A;  2FL4 A;  2OH1 A;  1XMT A;  4ZY1 A;  1FY7 A;  2QYV A;  4KOS A;  1K4J A;  4UCN A;  1LAM A;  2CIJ A;  1QSN A;  2IJZ A;  5ELY A;  5HVF A;  4CGM A;  3KR4 A;  2P6F A;  4OC1 A;  2WUU A;  2PRB A;  2J8M A;  4OKO A;  3R9F A;  3SXO A;  2V8H A;  4HNX B;  3MRU A;  1F2O A;  3DNS A;  5CBM A;  2D4O A;  3SI0 A;  2ZEP A;  3PEI A;  4KZT A;  4OAE A;  4NJQ A;  4UIB A;  3TO9 A;  5F09 A;  5JPH A;  3PP9 A;  3WC5 A;  4MHP A;  1BAV A;  1BPM A;  2ARH A;  4UEF A;  4X3R A;  4PXE A;  3I1U A;  4JLY A;  2ZEO A;  4M3S A;  1OZP A;  1XOV A;  2PVV A;  1IYK A;  1XMB A;  4H6Z A;  4QBJ A;  1KUV A;  3KZW A;  3VWD A;  2I3C A;  4FBE A;  4RUH A;  3IO1 A;  4CYO A;  4KVM E;  3D4U A;  2R1I A;  4PV6 A;  3R95 A;  2PR1 A;  3BI1 A;  4PXD A;  3ISX A;  2ZW6 A;  3D7F A;  4LX9 A;  4UEE A;  4UIA A;  4Y49 C;  2FXF A;  1F2P A;  2AJ6 A;  3GB0 A;  3N7Z A;  4A94 A;  2BCO A;  1Y7R A;  2R7H A;  2AFZ A;  2Y0M A;  3BJ8 A;  4CS0 B;  4TNU A;  3IU1 A;  4CGL A;  5IX3 A;  4II9 A;  3BXM A;  4LQG A;  3D68 A;  1FNO A;  1EE3 P;  1TKF A;  2B58 A;  4W9Y A;  4C2Y A;  2JBJ A;  4U9Y A;  3TCV A;  4PPZ A;  1I12 A;  1IIC A;  3SJF A;  5LYL A;  4P6Y A;  3BI0 A;  2B4D B;  1IID A;  3EFA A;  4NGR A;  4ZX8 A;  3WAB A;  3QNV A;  4YU9 A;  4F9U A;  3RNZ A;  4NGS A;  1ELL P;  4QC6 A;  2EK8 A;  3K9U A;  3LMS A;  4Q7A A;  2Z0Z A;  3R1K A;  4PSW A;  3JTK A;  5LYF A;  2IL4 A;  4X2T A;  2GU2 A;  2C6G A;  2I00 A;  3G8W A;  1U6M A;  1YX0 A;  4R57 A;  4MFZ A;  2B3V A;  4CGO A;  4NGT A;  2Z3N A;  5AG4 A;  2FE7 A;  3GIU A;  2Z10 A;  4F0X A;  1Z8L A;  4MBU A;  1Z9U A;  5F46 A;  4PXC A;  3F8K A;  4NJR A;  2AFW A;  3R96 A;  4FUU A;  1BO4 A;  3EC4 A;  1XBU A;  5GCN A;  4OC3 A;  2PJ9 A;  4H2K A;  1LOK A;  2ZEM A;  4L89 A;  4MFJ A;  4ZX9 A;  4E0A A;  4MFQ A;  4UCP A;  5IV0 A;  2F7V A;  2Z3L A;  3D8P A;  3GKR A;  4M85 A;  2IMO A;  2Z11 A;  3OWC A;  3PB9 X;  3NFZ A;  3T8W A;  2PJ4 A;  4Q36 A;  4A38 A;  1F57 A;  4C2X A;  4CAW A;  1S7L A;  2FS5 A;  3IWG A;  1Y9K A;  2GLF A;  4GXH A;  2D4P A;  3KHZ A;  4XPD C;  2VXK A;  2ANP A;  1R43 A;  3CXS A;  4Q38 A;  1ZG9 A;  2OB0 A;  3RO0 A;  3ZZI A;  1BPN A;  2PDO A;  2VI7 A;  3RBU A;  1AYE A;  1PCA A;  1VGY A;  2ZW5 A;  3T90 A;  4F9V A;  3S6H A;  1Q2C A;  1AMP A;  2VZZ A;  4P4I A;  4R6T A;  5DWM A;  4IUS A;  1QMU A;  2J8R A;  1NMT A;  1UFH A;  2GLJ A;  4YRH A;  2B4B A;  2RC4 A;  6CPA A;  4OAD A;  3PB7 X;  2KCW A;  2PVW A;  2PJ6 A;  3NE8 A;  4WWV A;  2CTC A;  2RB7 A;  4J3G A;  2OZH A;  1Y9W A;  1Z8X A;  2FVG A;  4MHN A;  3SJX A;  4MY0 A;  3VH9 A;  3D3S A;  3TOB A;  2CTB A;  1M4L A;  1ZO0 A;  2O53 A;  2V77 A;  2OR4 A;  3WC7 A;  4PXB A;  2JDD A;  3B35 A;  4B14 A;  2A4N A;  1VHS A;  1XRY A;  4NSQ A;  3D2P A;  1FT7 A;  4KOV A;  5C82 A;  1IYL A;  3KQZ A;  1Z8T A;  3CZX A;  3RAM A;  4JXR A;  4MRI A;  5D29 A;  1WK4 A;  2FIA A;  4XNH C;  2DPS A;  2QEC A;  3FF3 A;  2VEZ A;  2IQ6 A;  4KSF A;  1KUY A;  4C2Z A;  4FD7 A;  1AUG A;  2HUZ A;  1Z2L A;  1DTD A;  1GYT A;  3LOD A;  4B10 A;  1M1D A;  4P4E A;  2ZEN A;  3W91 A;  1PU9 A;  2P6G A;  2NSM A;  4CRZ B;  3B3T A;  2PJ0 A;  4G1P A;  4QVT A;  3V8I A;  4MHZ A;  4A32 A;  2I79 A;  1XFO A;  4MCQ A;  3I3G A;  4KUA A;  2G3A A;  4C7I A;  3SJE A;  4R3L A;  4P4D A;  4XPD B;  4H89 A;  2FSR A;  3IFE A;  1TKH A;  1GHE A;  2Z3O A;  1Q2Y A;  2PJ8 A;  1L0C A;  3IWE A;  3NH8 A;  3DR6 A;  4F6A A;  3GLJ A;  1UWY A;  2ZXV A;  4U9Z A;  4FAI A;  2P6E A;  2OZU A;  4CAX A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 4MFK A;  4UWI A;  3H5Z A;  2ZW7 A;  4JWP A;  4KSA A;  5ISV A;  2B5G B;  2QIR A;  4X5K A;  2BSW A;  3TTH A;  3UY5 A;  1S7F A;  1YR0 A;  2ZPA A;  4R3K A;  4XPL A;  4CAE A;  1Z4R A;  1NSL A;  1S7N A;  5KTA A;  4KOT A;  2B4D A;  4CAF A;  4DNC A;  3DR8 A;  1B6B A;  4YFJ A;  5CNP A;  1YGH A;  2YGW A;  4RS2 A;  4KOU A;  4C7H A;  4L8A A;  2JLM A;  3I9S A;  2CY2 A;  1M4I A;  4NCZ A;  5F49 A;  3E0K A;  3SXN A;  3W6X A;  2GE3 A;  5J8C A;  4XNH B;  5H84 A;  3NE7 A;  2G0B A;  2CNS A;  1QSO A;  3FRM A;  3CXQ A;  2VZY A;  4UFW A;  5G21 A;  2FIW A;  5EBV A;  4E2A A;  4YGO A;  4QUS A;  2FCK A;  3S6K A;  2BUE A;  5G1Z A;  3P2H A;  2Q44 A;  3R9E A;  4A30 A;  3W6S A;  1IB1 E;  4KLW A;  1R57 A;  4NEX A;  2AE6 A;  1QSM A;  2VQY A;  3QB8 A;  5G22 A;  4OLL A;  4EVY A;  3LD2 A;  2EVN A;  1I21 A;  4A33 A;  2ATR A;  4KOR A;  1ON0 A;  4MY3 A;  3TO6 A;  2REF A;  3WR7 A;  5BWA B;  1YK3 A;  3P2F A;  1YVK A;  1RO5 A;  3FNC A;  4I49 A;  2HV2 A;  2DPT A;  3QAH A;  4CYQ A;  3C26 A;  3CXP A;  2JEV A;  4QB9 A;  2BL1 A;  4ZGY B;  3JVN A;  4HNY B;  3TFY A;  4KOX A;  4GS4 A;  5I0C A;  2PR8 A;  5A27 A;  5J8F A;  4AG9 A;  3A9L A;  4NXY A;  3EXN A;  2Z3K A;  3BLN A;  4F0Y A;  4B13 A;  2YNE A;  3DSB A;  3FXT A;  5AG5 A;  4A2Z A;  1LRZ A;  3DDD A;  3TT2 A;  2Q04 A;  4CGN A;  2Z3M A;  2REE A;  3FBU A;  1QST A;  3IU2 A;  4JXQ A;  4XPK A;  2Q7B A;  5IB0 A;  4HNW B;  2H5M A;  5AG6 A;  3RYO A;  4UWJ A;  2YNC C;  2B3U A;  4HKF A;  4KOY A;  2Z3P A;  1VKC A;  1RXT A;  2OZG A;  4MJ8 A;  1S7K A;  1TIQ A;  3F5B A;  5E96 A;  2FT0 A;  4UBR A;  1M44 A;  3MGD A;  4FD6 A;  5HH1 A;  4CRY B;  5C88 A;  2G3T A;  2WPW A;  1P0H A;  4KS9 A;  4RI1 A;  4BMH A;  1S3Z A;  2B5G A;  5JQ4 A;  1WWZ A;  5H86 A;  4AG7 A;  4PSX A;  1XF8 A;  1KZF A;  4NF1 A;  5KTD A;  4LUA A;  1B87 A;  1N71 A;  4FD4 A;  4MFL A;  3T9Y A;  4B5P A;  4UCM A;  3R9G A;  1I1D A;  4ORF A;  2Q4V A;  1CM0 A;  3EO4 A;  3FYN A;  2EUI A;  1YVO A;  4CYN A;  3GYA A;  1Q2D A;  5F47 A;  2YNC A;  1MJA A;  3ZJ0 A;  4B5P B;  2J8N A;  1PUA A;  3GY9 A;  4K30 A;  4UA3 A;  4KUB A;  1MK4 A;  4H6U A;  2C27 A;  4KOW A;  1Z4E A;  3VWE A;  3B8G A;  2F5I A;  5KTC A;  4BBH A;  2YND A;  4KLV A;  1XIX A;  5AG7 A;  4MHD A;  2Q4Y A;  1CJW A;  1YRE A;  4MFP A;  4JD6 A;  3KKW A;  4CAV A;  2JDC A;  5F48 A;  3BJ7 A;  4U5Y A;  1V0C A;  2CNT A;  2K5T A;  3F0A A;  3G3S A;  4UFV A;  1KUX A;  1S5K A;  4IF5 A;  5A28 A;  4PK2 A;  4ZBG A;  2R8V A;  3PZJ A;  4A95 A;  4R9M A;  4B5O A;  1BOB A;  2HQY A;  1S60 A;  4MI4 A;  2O28 A;  1XEB A;  1J4J A;  2ZW4 A;  5G20 A;  2NMT A;  2CXA A;  2WPX A;  2PSW A;  4KVX A;  4B11 A;  3PGP A;  1QSR A;  4B12 A;  5HMN A;  4CGP A;  4R87 A;  4CYP A;  4UFX A;  4ONU A;  1NE9 A;  3FB3 A;  5FVJ A;  3S6F A;  4AVC A;  4AVB A;  4JJX A;  2GAN A;  3FIX A;  1P4N A;  2DXQ A;  2R98 A;  4AVA A;  4C68 A;  4Y49 B;  2X7B A;  3JUW A;  3H4Q A;  2QML A;  5AGE A;  1SQH A;  1XE4 A;  1YLE A;  3TE4 A;  4PK3 A;  1M4G A;  3SHP A;  3EY5 A;  2CNM A;  3IGR A;  2Q0Y A;  4A31 A;  5DWN A;  2PC1 A;  2OU2 A;  3D2M A;  2WSA A;  2P0W A;  1M4D A;  2BEI A;  4FD5 A;  4E8O A;  1MJB A;  2GIV A;  2PQ8 A;  4AB7 A;  5EC4 A;  3TOA A;  3S6G A;  3TO7 A;  2VBQ A;  4KVO E;  2FL4 A;  2OH1 A;  1XMT A;  1FY7 A;  4KOS A;  1K4J A;  4UCN A;  1QSN A;  4CGM A;  2P6F A;  2WUU A;  2PRB A;  2J8M A;  3R9F A;  3SXO A;  4HNX B;  3DNS A;  2D4O A;  4KZT A;  4OAE A;  3TO9 A;  5JPH A;  3PP9 A;  2ARH A;  4JLY A;  4M3S A;  1OZP A;  1IYK A;  4H6Z A;  4QBJ A;  1KUV A;  3VWD A;  4CYO A;  4KVM E;  4PV6 A;  2R1I A;  3R95 A;  2PR1 A;  4LX9 A;  2ZW6 A;  4Y49 C;  2FXF A;  2AJ6 A;  3N7Z A;  1Y7R A;  2R7H A;  2Y0M A;  3BJ8 A;  4CS0 B;  3IU1 A;  4CGL A;  5IX3 A;  4II9 A;  2B58 A;  4C2Y A;  4U9Y A;  3TCV A;  1I12 A;  1IIC A;  2B4D B;  1IID A;  3EFA A;  4QC6 A;  3K9U A;  2Z0Z A;  3R1K A;  4PSW A;  3JTK A;  2IL4 A;  2I00 A;  3G8W A;  1U6M A;  1YX0 A;  4R57 A;  4MFZ A;  2B3V A;  4CGO A;  2Z3N A;  5AG4 A;  2FE7 A;  2Z10 A;  4F0X A;  4MBU A;  1Z9U A;  5F46 A;  3F8K A;  3R96 A;  1BO4 A;  3EC4 A;  5GCN A;  4L89 A;  4MFJ A;  4E0A A;  4MFQ A;  4UCP A;  5IV0 A;  2Z3L A;  3D8P A;  3GKR A;  4M85 A;  2Z11 A;  3OWC A;  4Q36 A;  4CAW A;  4C2X A;  1S7L A;  2FS5 A;  3IWG A;  1Y9K A;  2D4P A;  4XPD C;  2VXK A;  3CXS A;  4Q38 A;  2OB0 A;  3ZZI A;  2VI7 A;  2PDO A;  2ZW5 A;  3T90 A;  3S6H A;  1Q2C A;  2VZZ A;  5DWM A;  4IUS A;  2J8R A;  1NMT A;  1UFH A;  4YRH A;  2B4B A;  2RC4 A;  4OAD A;  2KCW A;  4J3G A;  2OZH A;  1Y9W A;  4MY0 A;  3D3S A;  3TOB A;  1ZO0 A;  2JDD A;  4B14 A;  2A4N A;  1VHS A;  4NSQ A;  3D2P A;  4KOV A;  5C82 A;  1IYL A;  4JXR A;  1WK4 A;  2FIA A;  4XNH C;  2DPS A;  2QEC A;  2VEZ A;  4KSF A;  1KUY A;  4C2Z A;  4FD7 A;  2HUZ A;  4B10 A;  3LOD A;  1M1D A;  3W91 A;  1PU9 A;  2P6G A;  4CRZ B;  4QVT A;  3V8I A;  4A32 A;  2I79 A;  3I3G A;  4KUA A;  2G3A A;  4C7I A;  4R3L A;  4XPD B;  4H89 A;  2FSR A;  1GHE A;  2Z3O A;  1Q2Y A;  3IWE A;  1L0C A;  3DR6 A;  4F6A A;  4U9Z A;  2ZXV A;  2P6E A;  2OZU A;  4CAX A;  1MJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...