2B3UA

Human spermine spermidine acetyltransferase k26r mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
162
Chain Sequence
AKFVIRPATAADCSDILRLIKELAQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 33
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3uA00
2G3TA 4R57A 1YGHA 5CNPA 2P6FA 1S3ZA 3H4QA 2OZHA 3F0AA 2R7HA 4QC6A 4X5KA 1B87A 4CAWA 4XNHC 3D2MA 2ZXVA 1P4NA 2B5GB 1M1DA 3DR6A 5I0CA 4XPLA 3EO4A 2B4DB 1I21A 2Q04A 2I79A 1M4IA 4I49A 4L8AA 2WPXA 3VWDA 2Z10A 2CNTA 3P2FA 2KCWA 3NE7A 1MJAA 1NE9A 4JJXA 4UA3A 2REEA 5C88A 4YFJA 4QVTA 2JDCA 2QIRA 2O28A 4CRZB 2PR1A 5F47A 3QB8A 1BOBA 2CNSA 3S6GA 1S5KA 5KTAA 1Y9KA 2FIWA 4MY3A 3BJ8A 3WR7A 4R9MA 1WWZA 4UWJA 2PQ8A 3LODA 3D8PA 2VBQA 3D3SA 2B58A 3IWGA 1IICA 2P0WA 1NMTA 4NCZA 3TTHA 2B3UA 3LD2A 3W91A 4YGOA 4PSWA 2AJ6A 2GANA 1CM0A 1QSMA 4YRHA 4AB7A 1N71A 4JXRA 2FXFA 3FBUA 1YK3A 1BO4A 1YX0A 1L0CA 4AVBA 4JD6A 4ZBGA 4JWPA 4OAEA 2VZYA 5IX3A 5F49A 4U9YA 5EC4A 1FY7A 2I00A 5F46A 2BL1A 1YVKA 1IYLA 2ZW5A 4BMHA 5JPHA 2RC4A 2P6GA 4M85A 4JLYA 1RXTA 4RI1A 3BJ7A 2Z0ZA 4PSXA 3W6SA 3ZZIA 4FD7A 4E8OA 2OZGA 1YVOA 1NSLA 2B3VA 4CAVA 5EBVA 2VZZA 3KKWA 2D4OA 5GCNA 2DXQA 4CRYB 2OH1A 1VHSA 2ARHA 1MJ9A 3TO9A 2BSWA 4R87A 2R1IA 2HV2A 3CXSA 4QB9A 4KVME 4MBUA 2FS5A 3E0KA 4LX9A 1IYKA 3JVNA 1I1DA 4E2AA 4MY0A 4KOSA 3DR8A 3R9FA 2OZUA 1QSTA 1PU9A 4IUSA 5C82A 2OU2A 3S6HA 1U6MA 1IB1E 3R95A 1R57A 3TO6A 2BEIA 1Z9UA 1B6BA 3TO7A 3PGPA 1XIXA 4M3SA 3TOBA 4CAXA 1S7KA 2H5MA 3FXTA 4KOXA 4XPKA 2FIAA 1YREA 3QAHA 1P0HA 4MJ8A 4KLVA 3RYOA 4OLLA 2AE6A 4DNCA 3FNCA 1KZFA 1UFHA 4AG7A 4AVAA 4II9A 3FRMA 4KUBA 4PK3A 2K5TA 3DSBA 5IB0A 4QUSA 3TT2A 2D4PA 2G0BA 4E0AA 3EFAA 2JLMA 2X7BA 2JEVA 3VWEA 1XMTA 4MI4A 3S6KA 2EVNA 2FCKA 5DWMA 3JUWA 3DNSA 1WK4A 2CY2A 1I12A 1SQHA 2GE3A 4GS4A 4KOYA 3G8WA 1S7NA 1RO5A 4J3GA 4UBRA 2Q4VA 1YR0A 5FVJA 3SHPA 3W6XA 3C26A 3T9YA 2Y0MA 4AG9A 3R1KA 4FD5A 4UWIA 4OADA 1KUXA 4LUAA 1Q2CA 2J8MA 3GKRA 1ON0A 5IV0A 1M44A 4PV6A 3G3SA 3R9GA 4ORFA 4KLWA 4KZTA 3K9UA 4NEXA 3MGDA 2HUZA 4H89A 4KVXA 3N7ZA 4L89A 2WPWA 1YLEA 5HH1A 1PUAA 3PZJA 4K30A 2A4NA 4F6AA 5KTCA 5H86A 2Z11A 3D2PA 4QBJA 3ZJ0A 4IF5A 1CJWA 5ISVA 4NF1A 2QMLA 2OB0A 1TIQA 1XF8A 2GIVA 4H6UA 3CXPA 5J8FA 2PRBA 3FYNA 3SXOA 4B5PB 4KOWA 3TOAA 2Q4YA 4XPDC 4Y49B 4EVYA 1KUYA 4HNXB 1OZPA 1IIDA 2ATRA 1S7FA 3EY5A 1Y7RA 2FE7A 4KOVA 2VI7A 1Z4RA 3OWCA 4FD6A 4MHDA 5F48A 1QSNA 1XEBA 3EXNA 2VXKA 2VQYA 4F0YA 4RS2A 2R98A 2ZW6A 2Q0YA 2R8VA 4U5YA 3PP9A 4R3LA 2PDOA 1GHEA 4B5PA 2B4BA 3TE4A 3FB3A 2QECA 5JQ4A 4U9ZA 3R9EA 1Z4EA 4HKFA 5E96A 5J8CA 2G3AA 2PR8A 3IGRA 4KOTA 4NXYA 2PC1A 2CNMA 2REFA 2ZW4A 3CXQA 1MK4A 5KTDA 4B5OA 2JDDA 1M4DA 3SXNA 1QSRA 1Q2DA 4XPDB 2P6EA 3I9SA 3R96A 4JXQA 2BUEA 3F5BA 3GY9A 2ZPAA 4KUAA 2Q7BA 3GYAA 2Q44A 4CS0B 3P2HA 2FSRA 1Q2YA 1XE4A 3V8IA 3I3GA 2VEZA 4HNWB 1K4JA 4ONUA 4R3KA 4NSQA 4PK2A 2B5GA 4KORA 3TCVA 4KOUA 5H84A 4FD4A 1QSOA 4KVOE 1VKCA 3B8GA 3EC4A 2IL4A 5DWNA 3TFYA 1J4JA 1M4GA 2B4DA 3FIXA 4H6ZA 1KUVA 3UY5A 3F8KA 1S60A 2J8RA 1LRZA 4HNYB 3BLNA 1MJBA 2EUIA 5HMNA 4Y49C 4AVCA 3DDDA 2NMTA 2FL4A 2J8NA 3T90A 1V0CA 2PSWA 1S7LA 2FT0A 3S6FA 2ZW7A 2HQYA 2F5IA 4XNHB 2C27A 1Y9WA
chains in the Genus database with same CATH superfamily
1A2ZA 2G3TA 2AFXA 4R57A 2JBKA 1YGHA 4MHYA 4Q38A 2ZEPA 1LAPA 2P6FA 5CNPA 3RAMA 2ZEEA 2PCUA 1S3ZA 4JZ0A 3H4QA 4B6ZA 2OZHA 2ANPA 3F0AA 2R7HA 4NFRA 4QC6A 4A32A 1YMEA 3PB4X 4X5KA 1B87A 2EWBA 3RNZA 3K9TA 4CAWA 4A38A 4XNHC 4R76A 2ZEHA 4CYQA 1KWMA 3D2MA 2AFMA 4NGMA 2ZXVA 1P4NA 2B5GB 1M1DA 3DR6A 5I0CA 2YNEA 4XPLA 2RB7A 4IHMA 1Z5RA 2B4DB 1I21A 3EO4A 4RN7A 2Q04A 4F8ZA 2EBJA 1M4IA 2I79A 5DS0A 4I49A 4L8AA 2WPXA 3IU2A 3H5ZA 2Z10A 1HEEA 1CPXA 2CNTA 4UCPA 3P2FA 2KCWA 1ARMA 1TF8A 2GFQA 3IWEA 3NE7A 3KGQA 1MJAA 1NE9A 4JJXA 4UA3A 7CPAA 1AYEA 4DJLA 3S9LA 2REEA 1IOFA 5C88A 4YFJA 3IU1A 4QVTA 2JDCA 2QIRA 2F7VA 4AXVA 2O28A 1FT7A 4CRZB 4ZY1A 4B11A 2PJAA 3FX6A 4C2YA 2PR1A 3KQXA 4MFLA 1ZLIA 5F47A 1LCPA 3FJUA 3QB8A 1BOBA 2CNSA 1YSJA 3PBEA 3S6GA 1S5KA 3VWDA 5KTAA 1Y9KA 2FIWA 3IJ3A 4P4FA 4MY3A 2WUUA 2PE3A 3BJ8A 3WR7A 4R9MA 1ELMP 1WWZA 4UWJA 2PQ8A 2PVVA 4OC3A 3LODA 3D8PA 2VBQA 3D3SA 1CPSA 2B58A 3IO1A 3IWGA 3PFOA 2WZNA 4LQGA 1IICA 5LRJA 2CIJA 2V8HA 3SJGA 2C6GA 1NMTA 2C1CA 2P0WA 4NCZA 2B3UA 3LD2A 1Z8TA 4ZY2A 3TTHA 1ZO0A 4YGOA 3W91A 4OMEA 4PSWA 2PJ5A 4UEZA 3IIBA 2AJ6A 4CAEA 1IOIA 2GANA 1CM0A 2PJ7A 1QSMA 1Y0RA 2YNCA 2Z3MA 4MCRA 2ZOGA 4YRHA 4AB7A 5JGFA 1N71A 4JXRA 2FXFA 3FBUA 4MFQA 1YK3A 2YNDA 1NSAA 3DLJA 2PJ2A 3WT4A 5I4MA 1BO4A 1YX0A 2GREA 1L0CA 4AVBA 5LYLA 3FVLA 4C7IA 3ISXA 5JM6A 4JD6A 4M6GA 4ZBGA 4CGPA 4JWPA 4NGQA 4OAEA 2VZYA 4UEEA 5IX3A 2C6CA 2PRQA 5F49A 4FAIA 4U9YA 4UIBA 4K3NA 5EC4A 1FY7A 2HC9A 2I00A 4F9VA 4UFWA 2BL1A 1VGYA 3LMSA 3VH9A 5F46A 1YVKA 2JBJA 1IYLA 1ARLA 4JYWA 2ZW5A 4NGRA 4BMHA 5JPHA 1ZG7A 2RC4A 2P6GA 2POKA 4ZGYB 2I3CA 3V38A 4M85A 1VHEA 5IB9A 4JLYA 4IK2A 1RXTA 3H8FA 4RI1A 3BJ7A 2Z0ZA 4PSXA 3D7DA 3W6SA 3ZZIA 1BPNA 4FD7A 3FECA 3MN8A 2ZEOA 3SI1A 3HLPA 2BCOA 4MFJA 2OZGA 1YVOA 2NYQA 1NSLA 1XRYA 3WABA 3KZWA 2O4HA 2B3VA 2CXAA 3SI2A 1CP7A 4CAVA 5EBVA 1M4LA 2ZEDA 2VZZA 1R43A 1LANA 2D4OA 3KKWA 4A30A 3CT9A 3BHXA 1FNOA 4NGSA 8CPAA 5D29A 5GCNA 4MHNA 2DXQA 4CRYB 2O53A 2PJ3A 4MHZA 2V8GA 2G9DA 1VHSA 2OH1A 2ARHA 1MJ9A 3TO9A 1YQEA 2EK8A 2BSWA 3B3VA 4R87A 2R1IA 4CGOA 4MCSA 1EE3P 2HV2A 3CXSA 4QB9A 4A94A 4FBEA 4KVME 4MBUA 2FS5A 3E0KA 4LX9A 1IYKA 4X3RA 3JVNA 1I1DA 5HVFA 1BAVA 4E2AA 4MY0A 4KOSA 3FMCA 3DR8A 1HDQA 2FVGA 3R9FA 2IMOA 2HB6A 2OZUA 1QSTA 4CYNA 3JTKA 1PU9A 4MXUA 4ZYQA 4IUSA 5C82A 2OU2A 3KHZA 3S6HA 1U6MA 4Q36A 1IB1E 2OR4A 3R95A 3WC6A 4B14A 1R57A 3TO6A 3PFEA 4PXBA 1YW4A 4MFZA 2BEIA 1Z9UA 1B6BA 1X10A 3TO7A 5D8NA 3PGPA 3B7IA 1XIXA 4M3SA 4DUKA 2DEAA 3TOBA 4CAXA 3QAYA 3TX8A 2ZEFA 3SJFA 1S7KA 3KR4A 5CBMA 3RZAA 2H5MA 3FXTA 4ONWA 4IAVA 1CX8A 4KOXA 3K2KA 4WJBA 4XPKA 2FIAA 4UFXA 1YREA 3QAHA 2GLJA 4KSFA 1P0HA 4MJ8A 3NH5A 2AFUA 2F8HA 1ZG8A 2DPSA 4MFPA 4KLVA 3RYOA 1CP6A 4OLLA 2AE6A 4DNCA 1IU8A 1ELLP 3FNCA 4NGPA 1DTDA 2GU2A 1KZFA 1UFHA 3NA6A 3FEEA 4AG7A 4AVAA 4MMOA 4II9A 3FRMA 4OIWA 3JRUA 4KUBA 4PK3A 4ZY0A 1Q7LA 5G1ZA 2K5TA 2PJ6A 4OIDA 3DSBA 1XFOA 3S9MA 5IB0A 4QUSA 3TT2A 2XEJA 4F9UA 5JH9A 2D4PA 2G0BA 3CPAA 4PQAA 4ZI6A 4E0AA 2PJBA 3EFAA 4G1PA 2JLMA 5LRKA 4E8OA 1Z8LA 5K8OA 2X7BA 5LYDA 4A31A 2JEVA 2C6PA 3VWEA 1BPMA 2Z3LA 1XMTA 4P44A 2NSMA 4MI4A 4B12A 4C68A 3S6KA 4P4IA 2EVNA 2FCKA 4C7HA 5DWMA 3D7FA 3JUWA 1Y7EA 2PJ0A 2Q43A 2Q7SA 3DNSA 1VIXA 3KASA 3LWUA 3NH4A 4X2TA 6CPAA 1WK4A 4UIAA 3SJEA 2CY2A 2QJ8A 3L2NA 4M6IA 2ABZA 2BOAA 1LAMA 3B3TA 4LQ6A 1I12A 1SQHA 2GE3A 5EMIA 4OC4A 4GS4A 3FF3A 5CPAA 4R8FA 3SJXA 1GYTA 1TXRA 4C2ZA 4KOYA 1HDUA 3G8WA 1S7NA 3KQZA 1RO5A 3A9LA 4J3GA 2DF5A 4UBRA 4WWVA 2Q4VA 4MCPA 1YR0A 3GLJA 5FVJA 3SHPA 3W6XA 3QNVA 3C26A 3HUVA 3WC5A 3T9YA 2YNCC 5A28A 5HVHA 2DPTA 2Y0MA 3D67A 2AFZA 3D4UA 4P45A 3R1KA 4AG9A 4FD5A 4EWTA 4UWIA 3IEHA 2ZEGA 3BXMA 4OADA 1KUXA 4LUAA 4PXEA 1Q2CA 2J8MA 5AG7A 3GKRA 4OC0A 1ON0A 5IV0A 1M44A 4TNUA 1F2PA 3B2YA 5J1QA 3KL9A 3ISZA 4B10A 4PV6A 3G3SA 3R9GA 1F57A 5BWAB 4A37A 4ORFA 1XJOA 3NE8A 4KLWA 1PCAA 2Z3NA 4KZTA 3K9UA 4OC5A 4P4BA 4NEXA 2IJZA 3MGDA 1YLOA 2HUZA 4ZX8A 4H89A 5G21A 4KVXA 3V7ZA 3N7ZA 1QQ9A 4L89A 2WPWA 1XMBA 1Z8WA 1YLEA 5HH1A 4PXCA 4FUUA 1PUAA 3PZJA 5ELYA 2Z3PA 4HPSA 4K30A 4BINA 2A4NA 3RO0A 4F6AA 5KTCA 2CTCA 5H86A 4EMEA 2RFHA 1F2OA 2Z11A 2QYVA 3PB9X 4P4DA 3D2PA 4OKOA 4QBJA 2CTBA 3ZJ0A 5K8PA 3D68A 2AFWA 4IF5A 2CF4A 1CJWA 5ISVA 4MCQA 5LYIA 4NF1A 2QMLA 3CZXA 2OB0A 4NJRA 3NFZA 4MHPA 1OBRA 4MFKA 1TIQA 1XF8A 1ZG9A 2V77A 5HXDA 3D7HA 3WC7A 2GIVA 4H6UA 2Z3OA 3CXPA 1LFWA 2Z3KA 5J8FA 2PRBA 3FYNA 4YU9A 3SXOA 4Z65A 1YW6A 4KOWA 4B5PB 1ZLHA 3TOAA 2Q4YA 4XPDC 4Y49B 4EVYA 4B13A 1KUYA 4HNXB 4Q7AA 1AMPA 1OZPA 4P4JA 3IC1A 2ODFA 1IIDA 2ATRA 1XBUA 1S7FA 3EY5A 1VHOA 1Y7RA 2V8VA 2FE7A 4FWUA 4KOVA 4P4EA 2VI7A 1Z4RA 3TC8A 2GLFA 3OWCA 4FD6A 4MHDA 1QSNA 5F48A 1XEBA 3EXNA 3FEDA 5AG4A 3PB8X 2VXKA 2VQYA 4PXDA 4UEFA 3I1UA 4RS2A 4F0YA 2R98A 3IFEA 4KS9A 2ZW6A 2Q0YA 5HVGA 1H8LA 2R8VA 4U5YA 3PP9A 4R3LA 5AG5A 2PDOA 1GHEA 3CPXA 4GXHA 4B5PA 4RUHA 2B4BA 5K8NA 1TKJA 2PIYA 3TE4A 4OC2A 3GB0A 2WYRA 4X8IA 3FB3A 2QECA 5JQ4A 2AFSA 2IQ6A 4U9ZA 3R9EA 4CGLA 5AG6A 2XEIA 3RBUA 1AUGA 3KR5A 1Z4EA 4HKFA 5E96A 5LRGA 5J8CA 3BI1A 4MRIA 2G3AA 1Z8XA 4A39A 2PR8A 2QVPA 3N5FA 2OOTA 4CPAA 3IGRA 3H8GA 2Q51A 1IY7A 3PEIA 4KOTA 3BI0A 2YGWA 4NXYA 3IWWA 1UWYA 2PC1A 2CNMA 1X12A 2REFA 2ZW4A 1MK4A 1TF9A 3CXQA 3H8EA 4B5OA 5KTDA 3DGVA 3D7GA 2JEWA 2JDDA 1M4DA 2PIZA 4OC1A 3SXNA 1QSRA 4GM5A 1Q2DA 4XPDB 1PYTB 2P6EA 4UF4A 3I9SA 3R96A 4JXQA 2ZEMA 2BUEA 1TKFA 3PRTA 3F5BA 3GY9A 4CYPA 2ZPAA 1CBXA 3SI0A 3PB7X 4KUAA 2Q7BA 3GYAA 2Q44A 2WSAA 3P2HA 2FSRA 4CS0B 1Q2YA 5F09A 1RTQA 1XE4A 4PPZA 4OP4A 2PJ1A 1JWQA 3B3WA 1Z2LA 3V8IA 4A95A 3PBBA 1CG2A 4O23A 3I3GA 2ZOFA 1IGBA 4NGNA 3FH4A 2PVWA 1DE4C 3VARA 4ZX9A 2VEZA 1JQGA 4H2KA 4CGNA 2Q4ZA 4HNWB 3NH8A 1K4JA 4R7MA 4ONUA 4R3KA 2XEGA 4TWEA 4NSQA 4PK2A 2B5GA 4KORA 3TCVA 1QMUA 2PJ8A 4KOUA 3S9NA 2PJ4A 5H84A 4NJQA 4A2ZA 4FD4A 1QSOA 5K8MA 4C2XA 2VL1A 4KVOE 1VKCA 4YWYA 4BBHA 3B3CA 3PB6X 5G22A 2BO9A 3B8GA 3EC4A 2IL4A 1TKHA 2EK9A 4W9YA 4CGMA 5DWNA 4UCNA 3TFYA 4P10A 3VATA 1J4JA 1M4GA 1LOKA 2B4DA 2XEFA 3D66A 3FIXA 4P6YA 4H6ZA 5G20A 4EFDA 4NGTA 1KUVA 1Y0YA 3MRUA 3UY5A 5THWA 3B3SA 4KSAA 3B35A 3KHXA 3F8KA 1S60A 3GIUA 2J8RA 1LRZA 2PJCA 4DYOA 4HNYB 1BLLE 2ZENA 2EO8A 3BLNA 4KSIA 3GUXA 1MJBA 4R6TA 2EUIA 5LYFA 4BD9A 5A27A 5HMNA 4Y49C 2V8DA 3T8WA 3DDDA 4AVCA 2J9AA 4M6HA 2NMTA 2FL4A 1XOVA 2J8NA 3T90A 1V0CA 4UFVA 4F0XA 1R3NA 2PSWA 4CYOA 1S7LA 2PJ9A 2FT0A 3CDXA 4UCMA 4A33A 2AFOA 3S6FA 5AGEA 2ZW7A 2HQYA 2F5IA 3LACA 4XNHB 3KI9A 2ZELA 2C27A 1Y9WA 4CAFA
chains in the Genus database with same CATH topology
2G3TA 4R57A 1YGHA 4Q38A 5CNPA 2P6FA 1S3ZA 3H4QA 2OZHA 3F0AA 2R7HA 4QC6A 4A32A 4X5KA 1B87A 4CAWA 4XNHC 4CYQA 3D2MA 2ZXVA 1P4NA 2B5GB 1M1DA 3DR6A 5I0CA 2YNEA 4XPLA 3EO4A 2B4DB 1I21A 2Q04A 2I79A 1M4IA 4I49A 4L8AA 2WPXA 3IU2A 3H5ZA 2Z10A 3VWDA 4UCPA 2CNTA 3P2FA 2KCWA 3IWEA 3NE7A 1MJAA 1NE9A 4JJXA 4UA3A 2REEA 5C88A 4YFJA 3IU1A 4QVTA 2JDCA 2QIRA 2O28A 4CRZB 4B11A 4C2YA 2PR1A 4MFLA 5F47A 3QB8A 1BOBA 2CNSA 3S6GA 1S5KA 5KTAA 1Y9KA 2FIWA 4MY3A 2WUUA 3BJ8A 3WR7A 4R9MA 1WWZA 4UWJA 2PQ8A 3LODA 3D8PA 2VBQA 3D3SA 2B58A 3IWGA 1IICA 2P0WA 1NMTA 4NCZA 3TTHA 4A95A 2B3UA 3LD2A 3W91A 1ZO0A 4YGOA 4PSWA 4CAEA 2AJ6A 2GANA 1CM0A 1QSMA 2YNCA 2Z3MA 4YRHA 4AB7A 1N71A 4JXRA 2FXFA 3FBUA 4MFQA 1YK3A 2YNDA 1BO4A 1YX0A 1L0CA 4AVBA 4C7IA 4JD6A 4ZBGA 4CGPA 4JWPA 4OAEA 2VZYA 5IX3A 5F49A 4U9YA 5EC4A 1FY7A 2I00A 5F46A 4UFWA 2BL1A 1YVKA 1IYLA 2ZW5A 4BMHA 5JPHA 2RC4A 2P6GA 4ZGYB 4M85A 4JLYA 1RXTA 4RI1A 3BJ7A 2Z0ZA 4PSXA 3W6SA 3ZZIA 4FD7A 4E8OA 4MFJA 2OZGA 1YVOA 1NSLA 2B3VA 2CXAA 4CAVA 5EBVA 2VZZA 3KKWA 2D4OA 4A30A 5GCNA 2DXQA 4CRYB 2OH1A 1VHSA 2ARHA 1MJ9A 3TO9A 2BSWA 4R87A 2R1IA 4CGOA 2HV2A 3CXSA 4QB9A 4KVME 4MBUA 2FS5A 3E0KA 4LX9A 1IYKA 3JVNA 1I1DA 4E2AA 4MY0A 4KOSA 3DR8A 3R9FA 2OZUA 1QSTA 4CYNA 3JTKA 1PU9A 4IUSA 5C82A 2OU2A 3S6HA 1U6MA 4Q36A 1IB1E 3R95A 4B14A 1R57A 3TO6A 4MFZA 2BEIA 1Z9UA 1B6BA 3TO7A 3PGPA 1XIXA 4M3SA 3TOBA 4CAXA 1S7KA 2H5MA 3FXTA 4KOXA 4XPKA 2FIAA 4UFXA 4KSFA 1YREA 3QAHA 1P0HA 4MJ8A 2DPSA 4MFPA 4KLVA 3RYOA 4OLLA 2AE6A 4DNCA 3FNCA 1KZFA 1UFHA 4AG7A 4AVAA 4II9A 3FRMA 4KUBA 4PK3A 5G1ZA 2K5TA 3DSBA 5IB0A 4QUSA 3TT2A 2D4PA 2G0BA 4E0AA 3EFAA 2JLMA 2X7BA 4A31A 2JEVA 3VWEA 2Z3LA 1XMTA 4MI4A 4B12A 4C68A 3S6KA 2EVNA 2FCKA 4C7HA 5DWMA 3JUWA 3DNSA 1WK4A 2CY2A 1I12A 1SQHA 2GE3A 4GS4A 4C2ZA 4KOYA 3G8WA 1S7NA 1RO5A 3A9LA 4J3GA 4UBRA 2Q4VA 1YR0A 5FVJA 3SHPA 3W6XA 3C26A 3T9YA 2YNCC 5A28A 2DPTA 2Y0MA 4AG9A 3R1KA 4FD5A 4UWIA 4OADA 1KUXA 4LUAA 1Q2CA 2J8MA 5AG7A 3GKRA 1ON0A 5IV0A 1M44A 4B10A 4PV6A 3G3SA 3R9GA 5BWAB 4ORFA 4KLWA 4KZTA 2Z3NA 3K9UA 4NEXA 3MGDA 2HUZA 4H89A 5G21A 4KVXA 3N7ZA 4L89A 2WPWA 1YLEA 5HH1A 1PUAA 3PZJA 2Z3PA 4K30A 2A4NA 4F6AA 5KTCA 5H86A 2Z11A 3D2PA 4QBJA 3ZJ0A 4IF5A 1CJWA 5ISVA 4NF1A 2QMLA 2OB0A 4MFKA 1TIQA 1XF8A 2GIVA 4H6UA 2Z3OA 3CXPA 5J8FA 2Z3KA 2PRBA 3FYNA 3SXOA 4B5PB 4KOWA 3TOAA 2Q4YA 4XPDC 4Y49B 4EVYA 4B13A 1KUYA 4HNXB 1OZPA 1IIDA 2ATRA 1S7FA 3EY5A 1Y7RA 2FE7A 4KOVA 2VI7A 1Z4RA 3OWCA 4FD6A 4MHDA 5F48A 1QSNA 5AG4A 1XEBA 3EXNA 2VXKA 2VQYA 4F0YA 4RS2A 2R98A 4KS9A 2ZW6A 2Q0YA 2R8VA 4U5YA 3PP9A 4R3LA 5AG5A 2PDOA 1GHEA 4B5PA 2B4BA 3TE4A 3FB3A 2QECA 5JQ4A 4U9ZA 3R9EA 4CGLA 5AG6A 1Z4EA 4HKFA 5E96A 5J8CA 2G3AA 2PR8A 3IGRA 4KOTA 4NXYA 2YGWA 2PC1A 2CNMA 2REFA 3CXQA 2ZW4A 1MK4A 5KTDA 4B5OA 2JDDA 1M4DA 3SXNA 1QSRA 1Q2DA 4XPDB 2P6EA 3I9SA 3R96A 4JXQA 2BUEA 3F5BA 3GY9A 4CYPA 2ZPAA 4KUAA 2Q7BA 3GYAA 2Q44A 2WSAA 3P2HA 2FSRA 4CS0B 1Q2YA 1XE4A 3V8IA 3I3GA 2VEZA 4CGNA 4HNWB 1K4JA 4ONUA 4R3KA 4NSQA 4PK2A 2B5GA 4KORA 3TCVA 4KOUA 5H84A 4A2ZA 4FD4A 1QSOA 4C2XA 4KVOE 1VKCA 4BBHA 5G22A 3B8GA 3EC4A 2IL4A 4CGMA 5DWNA 4UCNA 3TFYA 1J4JA 1M4GA 2B4DA 3FIXA 5G20A 4H6ZA 1KUVA 3UY5A 4KSAA 3F8KA 1S60A 2J8RA 1LRZA 4HNYB 3BLNA 1MJBA 2EUIA 5A27A 5HMNA 4Y49C 4AVCA 3DDDA 2NMTA 2FL4A 2J8NA 3T90A 1V0CA 4UFVA 4F0XA 2PSWA 4CYOA 1S7LA 2FT0A 4UCMA 4A33A 3S6FA 5AGEA 2ZW7A 2HQYA 2F5IA 4XNHB 2C27A 1Y9WA 4CAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3T A;  4R57 A;  1YGH A;  5CNP A;  2P6F A;  1S3Z A;  3H4Q A;  2OZH A;  3F0A A;  2R7H A;  4QC6 A;  4X5K A;  1B87 A;  4CAW A;  4XNH C;  3D2M A;  2ZXV A;  1P4N A;  2B5G B;  1M1D A;  3DR6 A;  5I0C A;  4XPL A;  3EO4 A;  2B4D B;  1I21 A;  2Q04 A;  2I79 A;  1M4I A;  4I49 A;  4L8A A;  2WPX A;  3VWD A;  2Z10 A;  2CNT A;  3P2F A;  2KCW A;  3NE7 A;  1MJA A;  1NE9 A;  4JJX A;  4UA3 A;  2REE A;  5C88 A;  4YFJ A;  4QVT A;  2JDC A;  2QIR A;  2O28 A;  4CRZ B;  2PR1 A;  5F47 A;  3QB8 A;  1BOB A;  2CNS A;  3S6G A;  1S5K A;  5KTA A;  1Y9K A;  2FIW A;  4MY3 A;  3BJ8 A;  3WR7 A;  4R9M A;  1WWZ A;  4UWJ A;  2PQ8 A;  3LOD A;  3D8P A;  2VBQ A;  3D3S A;  2B58 A;  3IWG A;  1IIC A;  2P0W A;  1NMT A;  4NCZ A;  3TTH A;  2B3U A;  3LD2 A;  3W91 A;  4YGO A;  4PSW A;  2AJ6 A;  2GAN A;  1CM0 A;  1QSM A;  4YRH A;  4AB7 A;  1N71 A;  4JXR A;  2FXF A;  3FBU A;  1YK3 A;  1BO4 A;  1YX0 A;  1L0C A;  4AVB A;  4JD6 A;  4ZBG A;  4JWP A;  4OAE A;  2VZY A;  5IX3 A;  5F49 A;  4U9Y A;  5EC4 A;  1FY7 A;  2I00 A;  5F46 A;  2BL1 A;  1YVK A;  1IYL A;  2ZW5 A;  4BMH A;  5JPH A;  2RC4 A;  2P6G A;  4M85 A;  4JLY A;  1RXT A;  4RI1 A;  3BJ7 A;  2Z0Z A;  4PSX A;  3W6S A;  3ZZI A;  4FD7 A;  4E8O A;  2OZG A;  1YVO A;  1NSL A;  2B3V A;  4CAV A;  5EBV A;  2VZZ A;  3KKW A;  2D4O A;  5GCN A;  2DXQ A;  4CRY B;  2OH1 A;  1VHS A;  2ARH A;  1MJ9 A;  3TO9 A;  2BSW A;  4R87 A;  2R1I A;  2HV2 A;  3CXS A;  4QB9 A;  4KVM E;  4MBU A;  2FS5 A;  3E0K A;  4LX9 A;  1IYK A;  3JVN A;  1I1D A;  4E2A A;  4MY0 A;  4KOS A;  3DR8 A;  3R9F A;  2OZU A;  1QST A;  1PU9 A;  4IUS A;  5C82 A;  2OU2 A;  3S6H A;  1U6M A;  1IB1 E;  3R95 A;  1R57 A;  3TO6 A;  2BEI A;  1Z9U A;  1B6B A;  3TO7 A;  3PGP A;  1XIX A;  4M3S A;  3TOB A;  4CAX A;  1S7K A;  2H5M A;  3FXT A;  4KOX A;  4XPK A;  2FIA A;  1YRE A;  3QAH A;  1P0H A;  4MJ8 A;  4KLV A;  3RYO A;  4OLL A;  2AE6 A;  4DNC A;  3FNC A;  1KZF A;  1UFH A;  4AG7 A;  4AVA A;  4II9 A;  3FRM A;  4KUB A;  4PK3 A;  2K5T A;  3DSB A;  5IB0 A;  4QUS A;  3TT2 A;  2D4P A;  2G0B A;  4E0A A;  3EFA A;  2JLM A;  2X7B A;  2JEV A;  3VWE A;  1XMT A;  4MI4 A;  3S6K A;  2EVN A;  2FCK A;  5DWM A;  3JUW A;  3DNS A;  1WK4 A;  2CY2 A;  1I12 A;  1SQH A;  2GE3 A;  4GS4 A;  4KOY A;  3G8W A;  1S7N A;  1RO5 A;  4J3G A;  4UBR A;  2Q4V A;  1YR0 A;  5FVJ A;  3SHP A;  3W6X A;  3C26 A;  3T9Y A;  2Y0M A;  4AG9 A;  3R1K A;  4FD5 A;  4UWI A;  4OAD A;  1KUX A;  4LUA A;  1Q2C A;  2J8M A;  3GKR A;  1ON0 A;  5IV0 A;  1M44 A;  4PV6 A;  3G3S A;  3R9G A;  4ORF A;  4KLW A;  4KZT A;  3K9U A;  4NEX A;  3MGD A;  2HUZ A;  4H89 A;  4KVX A;  3N7Z A;  4L89 A;  2WPW A;  1YLE A;  5HH1 A;  1PUA A;  3PZJ A;  4K30 A;  2A4N A;  4F6A A;  5KTC A;  5H86 A;  2Z11 A;  3D2P A;  4QBJ A;  3ZJ0 A;  4IF5 A;  1CJW A;  5ISV A;  4NF1 A;  2QML A;  2OB0 A;  1TIQ A;  1XF8 A;  2GIV A;  4H6U A;  3CXP A;  5J8F A;  2PRB A;  3FYN A;  3SXO A;  4B5P B;  4KOW A;  3TOA A;  2Q4Y A;  4XPD C;  4Y49 B;  4EVY A;  1KUY A;  4HNX B;  1OZP A;  1IID A;  2ATR A;  1S7F A;  3EY5 A;  1Y7R A;  2FE7 A;  4KOV A;  2VI7 A;  1Z4R A;  3OWC A;  4FD6 A;  4MHD A;  5F48 A;  1QSN A;  1XEB A;  3EXN A;  2VXK A;  2VQY A;  4F0Y A;  4RS2 A;  2R98 A;  2ZW6 A;  2Q0Y A;  2R8V A;  4U5Y A;  3PP9 A;  4R3L A;  2PDO A;  1GHE A;  4B5P A;  2B4B A;  3TE4 A;  3FB3 A;  2QEC A;  5JQ4 A;  4U9Z A;  3R9E A;  1Z4E A;  4HKF A;  5E96 A;  5J8C A;  2G3A A;  2PR8 A;  3IGR A;  4KOT A;  4NXY A;  2PC1 A;  2CNM A;  2REF A;  2ZW4 A;  3CXQ A;  1MK4 A;  5KTD A;  4B5O A;  2JDD A;  1M4D A;  3SXN A;  1QSR A;  1Q2D A;  4XPD B;  2P6E A;  3I9S A;  3R96 A;  4JXQ A;  2BUE A;  3F5B A;  3GY9 A;  2ZPA A;  4KUA A;  2Q7B A;  3GYA A;  2Q44 A;  4CS0 B;  3P2H A;  2FSR A;  1Q2Y A;  1XE4 A;  3V8I A;  3I3G A;  2VEZ A;  4HNW B;  1K4J A;  4ONU A;  4R3K A;  4NSQ A;  4PK2 A;  2B5G A;  4KOR A;  3TCV A;  4KOU A;  5H84 A;  4FD4 A;  1QSO A;  4KVO E;  1VKC A;  3B8G A;  3EC4 A;  2IL4 A;  5DWN A;  3TFY A;  1J4J A;  1M4G A;  2B4D A;  3FIX A;  4H6Z A;  1KUV A;  3UY5 A;  3F8K A;  1S60 A;  2J8R A;  1LRZ A;  4HNY B;  3BLN A;  1MJB A;  2EUI A;  5HMN A;  4Y49 C;  4AVC A;  3DDD A;  2NMT A;  2FL4 A;  2J8N A;  3T90 A;  1V0C A;  2PSW A;  1S7L A;  2FT0 A;  3S6F A;  2ZW7 A;  2HQY A;  2F5I A;  4XNH B;  2C27 A;  1Y9W A; 
#chains in the Genus database with same CATH topology
 1A2Z A;  2G3T A;  2AFX A;  4R57 A;  2JBK A;  1YGH A;  4MHY A;  4Q38 A;  2ZEP A;  1LAP A;  2P6F A;  5CNP A;  3RAM A;  2ZEE A;  2PCU A;  1S3Z A;  4JZ0 A;  3H4Q A;  4B6Z A;  2OZH A;  2ANP A;  3F0A A;  2R7H A;  4NFR A;  4QC6 A;  4A32 A;  1YME A;  3PB4 X;  4X5K A;  1B87 A;  2EWB A;  3RNZ A;  3K9T A;  4CAW A;  4A38 A;  4XNH C;  4R76 A;  2ZEH A;  4CYQ A;  1KWM A;  3D2M A;  2AFM A;  4NGM A;  2ZXV A;  1P4N A;  2B5G B;  1M1D A;  3DR6 A;  5I0C A;  2YNE A;  4XPL A;  2RB7 A;  4IHM A;  1Z5R A;  2B4D B;  1I21 A;  3EO4 A;  4RN7 A;  2Q04 A;  4F8Z A;  2EBJ A;  1M4I A;  2I79 A;  5DS0 A;  4I49 A;  4L8A A;  2WPX A;  3IU2 A;  3H5Z A;  2Z10 A;  1HEE A;  1CPX A;  2CNT A;  4UCP A;  3P2F A;  2KCW A;  1ARM A;  1TF8 A;  2GFQ A;  3IWE A;  3NE7 A;  3KGQ A;  1MJA A;  1NE9 A;  4JJX A;  4UA3 A;  7CPA A;  1AYE A;  4DJL A;  3S9L A;  2REE A;  1IOF A;  5C88 A;  4YFJ A;  3IU1 A;  4QVT A;  2JDC A;  2QIR A;  2F7V A;  4AXV A;  2O28 A;  1FT7 A;  4CRZ B;  4ZY1 A;  4B11 A;  2PJA A;  3FX6 A;  4C2Y A;  2PR1 A;  3KQX A;  4MFL A;  1ZLI A;  5F47 A;  1LCP A;  3FJU A;  3QB8 A;  1BOB A;  2CNS A;  1YSJ A;  3PBE A;  3S6G A;  1S5K A;  3VWD A;  5KTA A;  1Y9K A;  2FIW A;  3IJ3 A;  4P4F A;  4MY3 A;  2WUU A;  2PE3 A;  3BJ8 A;  3WR7 A;  4R9M A;  1ELM P;  1WWZ A;  4UWJ A;  2PQ8 A;  2PVV A;  4OC3 A;  3LOD A;  3D8P A;  2VBQ A;  3D3S A;  1CPS A;  2B58 A;  3IO1 A;  3IWG A;  3PFO A;  2WZN A;  4LQG A;  1IIC A;  5LRJ A;  2CIJ A;  2V8H A;  3SJG A;  2C6G A;  1NMT A;  2C1C A;  2P0W A;  4NCZ A;  2B3U A;  3LD2 A;  1Z8T A;  4ZY2 A;  3TTH A;  1ZO0 A;  4YGO A;  3W91 A;  4OME A;  4PSW A;  2PJ5 A;  4UEZ A;  3IIB A;  2AJ6 A;  4CAE A;  1IOI A;  2GAN A;  1CM0 A;  2PJ7 A;  1QSM A;  1Y0R A;  2YNC A;  2Z3M A;  4MCR A;  2ZOG A;  4YRH A;  4AB7 A;  5JGF A;  1N71 A;  4JXR A;  2FXF A;  3FBU A;  4MFQ A;  1YK3 A;  2YND A;  1NSA A;  3DLJ A;  2PJ2 A;  3WT4 A;  5I4M A;  1BO4 A;  1YX0 A;  2GRE A;  1L0C A;  4AVB A;  5LYL A;  3FVL A;  4C7I A;  3ISX A;  5JM6 A;  4JD6 A;  4M6G A;  4ZBG A;  4CGP A;  4JWP A;  4NGQ A;  4OAE A;  2VZY A;  4UEE A;  5IX3 A;  2C6C A;  2PRQ A;  5F49 A;  4FAI A;  4U9Y A;  4UIB A;  4K3N A;  5EC4 A;  1FY7 A;  2HC9 A;  2I00 A;  4F9V A;  4UFW A;  2BL1 A;  1VGY A;  3LMS A;  3VH9 A;  5F46 A;  1YVK A;  2JBJ A;  1IYL A;  1ARL A;  4JYW A;  2ZW5 A;  4NGR A;  4BMH A;  5JPH A;  1ZG7 A;  2RC4 A;  2P6G A;  2POK A;  4ZGY B;  2I3C A;  3V38 A;  4M85 A;  1VHE A;  5IB9 A;  4JLY A;  4IK2 A;  1RXT A;  3H8F A;  4RI1 A;  3BJ7 A;  2Z0Z A;  4PSX A;  3D7D A;  3W6S A;  3ZZI A;  1BPN A;  4FD7 A;  3FEC A;  3MN8 A;  2ZEO A;  3SI1 A;  3HLP A;  2BCO A;  4MFJ A;  2OZG A;  1YVO A;  2NYQ A;  1NSL A;  1XRY A;  3WAB A;  3KZW A;  2O4H A;  2B3V A;  2CXA A;  3SI2 A;  1CP7 A;  4CAV A;  5EBV A;  1M4L A;  2ZED A;  2VZZ A;  1R43 A;  1LAN A;  2D4O A;  3KKW A;  4A30 A;  3CT9 A;  3BHX A;  1FNO A;  4NGS A;  8CPA A;  5D29 A;  5GCN A;  4MHN A;  2DXQ A;  4CRY B;  2O53 A;  2PJ3 A;  4MHZ A;  2V8G A;  2G9D A;  1VHS A;  2OH1 A;  2ARH A;  1MJ9 A;  3TO9 A;  1YQE A;  2EK8 A;  2BSW A;  3B3V A;  4R87 A;  2R1I A;  4CGO A;  4MCS A;  1EE3 P;  2HV2 A;  3CXS A;  4QB9 A;  4A94 A;  4FBE A;  4KVM E;  4MBU A;  2FS5 A;  3E0K A;  4LX9 A;  1IYK A;  4X3R A;  3JVN A;  1I1D A;  5HVF A;  1BAV A;  4E2A A;  4MY0 A;  4KOS A;  3FMC A;  3DR8 A;  1HDQ A;  2FVG A;  3R9F A;  2IMO A;  2HB6 A;  2OZU A;  1QST A;  4CYN A;  3JTK A;  1PU9 A;  4MXU A;  4ZYQ A;  4IUS A;  5C82 A;  2OU2 A;  3KHZ A;  3S6H A;  1U6M A;  4Q36 A;  1IB1 E;  2OR4 A;  3R95 A;  3WC6 A;  4B14 A;  1R57 A;  3TO6 A;  3PFE A;  4PXB A;  1YW4 A;  4MFZ A;  2BEI A;  1Z9U A;  1B6B A;  1X10 A;  3TO7 A;  5D8N A;  3PGP A;  3B7I A;  1XIX A;  4M3S A;  4DUK A;  2DEA A;  3TOB A;  4CAX A;  3QAY A;  3TX8 A;  2ZEF A;  3SJF A;  1S7K A;  3KR4 A;  5CBM A;  3RZA A;  2H5M A;  3FXT A;  4ONW A;  4IAV A;  1CX8 A;  4KOX A;  3K2K A;  4WJB A;  4XPK A;  2FIA A;  4UFX A;  1YRE A;  3QAH A;  2GLJ A;  4KSF A;  1P0H A;  4MJ8 A;  3NH5 A;  2AFU A;  2F8H A;  1ZG8 A;  2DPS A;  4MFP A;  4KLV A;  3RYO A;  1CP6 A;  4OLL A;  2AE6 A;  4DNC A;  1IU8 A;  1ELL P;  3FNC A;  4NGP A;  1DTD A;  2GU2 A;  1KZF A;  1UFH A;  3NA6 A;  3FEE A;  4AG7 A;  4AVA A;  4MMO A;  4II9 A;  3FRM A;  4OIW A;  3JRU A;  4KUB A;  4PK3 A;  4ZY0 A;  1Q7L A;  5G1Z A;  2K5T A;  2PJ6 A;  4OID A;  3DSB A;  1XFO A;  3S9M A;  5IB0 A;  4QUS A;  3TT2 A;  2XEJ A;  4F9U A;  5JH9 A;  2D4P A;  2G0B A;  3CPA A;  4PQA A;  4ZI6 A;  4E0A A;  2PJB A;  3EFA A;  4G1P A;  2JLM A;  5LRK A;  4E8O A;  1Z8L A;  5K8O A;  2X7B A;  5LYD A;  4A31 A;  2JEV A;  2C6P A;  3VWE A;  1BPM A;  2Z3L A;  1XMT A;  4P44 A;  2NSM A;  4MI4 A;  4B12 A;  4C68 A;  3S6K A;  4P4I A;  2EVN A;  2FCK A;  4C7H A;  5DWM A;  3D7F A;  3JUW A;  1Y7E A;  2PJ0 A;  2Q43 A;  2Q7S A;  3DNS A;  1VIX A;  3KAS A;  3LWU A;  3NH4 A;  4X2T A;  6CPA A;  1WK4 A;  4UIA A;  3SJE A;  2CY2 A;  2QJ8 A;  3L2N A;  4M6I A;  2ABZ A;  2BOA A;  1LAM A;  3B3T A;  4LQ6 A;  1I12 A;  1SQH A;  2GE3 A;  5EMI A;  4OC4 A;  4GS4 A;  3FF3 A;  5CPA A;  4R8F A;  3SJX A;  1GYT A;  1TXR A;  4C2Z A;  4KOY A;  1HDU A;  3G8W A;  1S7N A;  3KQZ A;  1RO5 A;  3A9L A;  4J3G A;  2DF5 A;  4UBR A;  4WWV A;  2Q4V A;  4MCP A;  1YR0 A;  3GLJ A;  5FVJ A;  3SHP A;  3W6X A;  3QNV A;  3C26 A;  3HUV A;  3WC5 A;  3T9Y A;  2YNC C;  5A28 A;  5HVH A;  2DPT A;  2Y0M A;  3D67 A;  2AFZ A;  3D4U A;  4P45 A;  3R1K A;  4AG9 A;  4FD5 A;  4EWT A;  4UWI A;  3IEH A;  2ZEG A;  3BXM A;  4OAD A;  1KUX A;  4LUA A;  4PXE A;  1Q2C A;  2J8M A;  5AG7 A;  3GKR A;  4OC0 A;  1ON0 A;  5IV0 A;  1M44 A;  4TNU A;  1F2P A;  3B2Y A;  5J1Q A;  3KL9 A;  3ISZ A;  4B10 A;  4PV6 A;  3G3S A;  3R9G A;  1F57 A;  5BWA B;  4A37 A;  4ORF A;  1XJO A;  3NE8 A;  4KLW A;  1PCA A;  2Z3N A;  4KZT A;  3K9U A;  4OC5 A;  4P4B A;  4NEX A;  2IJZ A;  3MGD A;  1YLO A;  2HUZ A;  4ZX8 A;  4H89 A;  5G21 A;  4KVX A;  3V7Z A;  3N7Z A;  1QQ9 A;  4L89 A;  2WPW A;  1XMB A;  1Z8W A;  1YLE A;  5HH1 A;  4PXC A;  4FUU A;  1PUA A;  3PZJ A;  5ELY A;  2Z3P A;  4HPS A;  4K30 A;  4BIN A;  2A4N A;  3RO0 A;  4F6A A;  5KTC A;  2CTC A;  5H86 A;  4EME A;  2RFH A;  1F2O A;  2Z11 A;  2QYV A;  3PB9 X;  4P4D A;  3D2P A;  4OKO A;  4QBJ A;  2CTB A;  3ZJ0 A;  5K8P A;  3D68 A;  2AFW A;  4IF5 A;  2CF4 A;  1CJW A;  5ISV A;  4MCQ A;  5LYI A;  4NF1 A;  2QML A;  3CZX A;  2OB0 A;  4NJR A;  3NFZ A;  4MHP A;  1OBR A;  4MFK A;  1TIQ A;  1XF8 A;  1ZG9 A;  2V77 A;  5HXD A;  3D7H A;  3WC7 A;  2GIV A;  4H6U A;  2Z3O A;  3CXP A;  1LFW A;  2Z3K A;  5J8F A;  2PRB A;  3FYN A;  4YU9 A;  3SXO A;  4Z65 A;  1YW6 A;  4KOW A;  4B5P B;  1ZLH A;  3TOA A;  2Q4Y A;  4XPD C;  4Y49 B;  4EVY A;  4B13 A;  1KUY A;  4HNX B;  4Q7A A;  1AMP A;  1OZP A;  4P4J A;  3IC1 A;  2ODF A;  1IID A;  2ATR A;  1XBU A;  1S7F A;  3EY5 A;  1VHO A;  1Y7R A;  2V8V A;  2FE7 A;  4FWU A;  4KOV A;  4P4E A;  2VI7 A;  1Z4R A;  3TC8 A;  2GLF A;  3OWC A;  4FD6 A;  4MHD A;  1QSN A;  5F48 A;  1XEB A;  3EXN A;  3FED A;  5AG4 A;  3PB8 X;  2VXK A;  2VQY A;  4PXD A;  4UEF A;  3I1U A;  4RS2 A;  4F0Y A;  2R98 A;  3IFE A;  4KS9 A;  2ZW6 A;  2Q0Y A;  5HVG A;  1H8L A;  2R8V A;  4U5Y A;  3PP9 A;  4R3L A;  5AG5 A;  2PDO A;  1GHE A;  3CPX A;  4GXH A;  4B5P A;  4RUH A;  2B4B A;  5K8N A;  1TKJ A;  2PIY A;  3TE4 A;  4OC2 A;  3GB0 A;  2WYR A;  4X8I A;  3FB3 A;  2QEC A;  5JQ4 A;  2AFS A;  2IQ6 A;  4U9Z A;  3R9E A;  4CGL A;  5AG6 A;  2XEI A;  3RBU A;  1AUG A;  3KR5 A;  1Z4E A;  4HKF A;  5E96 A;  5LRG A;  5J8C A;  3BI1 A;  4MRI A;  2G3A A;  1Z8X A;  4A39 A;  2PR8 A;  2QVP A;  3N5F A;  2OOT A;  4CPA A;  3IGR A;  3H8G A;  2Q51 A;  1IY7 A;  3PEI A;  4KOT A;  3BI0 A;  2YGW A;  4NXY A;  3IWW A;  1UWY A;  2PC1 A;  2CNM A;  1X12 A;  2REF A;  2ZW4 A;  1MK4 A;  1TF9 A;  3CXQ A;  3H8E A;  4B5O A;  5KTD A;  3DGV A;  3D7G A;  2JEW A;  2JDD A;  1M4D A;  2PIZ A;  4OC1 A;  3SXN A;  1QSR A;  4GM5 A;  1Q2D A;  4XPD B;  1PYT B;  2P6E A;  4UF4 A;  3I9S A;  3R96 A;  4JXQ A;  2ZEM A;  2BUE A;  1TKF A;  3PRT A;  3F5B A;  3GY9 A;  4CYP A;  2ZPA A;  1CBX A;  3SI0 A;  3PB7 X;  4KUA A;  2Q7B A;  3GYA A;  2Q44 A;  2WSA A;  3P2H A;  2FSR A;  4CS0 B;  1Q2Y A;  5F09 A;  1RTQ A;  1XE4 A;  4PPZ A;  4OP4 A;  2PJ1 A;  1JWQ A;  3B3W A;  1Z2L A;  3V8I A;  4A95 A;  3PBB A;  1CG2 A;  4O23 A;  3I3G A;  2ZOF A;  1IGB A;  4NGN A;  3FH4 A;  2PVW A;  1DE4 C;  3VAR A;  4ZX9 A;  2VEZ A;  1JQG A;  4H2K A;  4CGN A;  2Q4Z A;  4HNW B;  3NH8 A;  1K4J A;  4R7M A;  4ONU A;  4R3K A;  2XEG A;  4TWE A;  4NSQ A;  4PK2 A;  2B5G A;  4KOR A;  3TCV A;  1QMU A;  2PJ8 A;  4KOU A;  3S9N A;  2PJ4 A;  5H84 A;  4NJQ A;  4A2Z A;  4FD4 A;  1QSO A;  5K8M A;  4C2X A;  2VL1 A;  4KVO E;  1VKC A;  4YWY A;  4BBH A;  3B3C A;  3PB6 X;  5G22 A;  2BO9 A;  3B8G A;  3EC4 A;  2IL4 A;  1TKH A;  2EK9 A;  4W9Y A;  4CGM A;  5DWN A;  4UCN A;  3TFY A;  4P10 A;  3VAT A;  1J4J A;  1M4G A;  1LOK A;  2B4D A;  2XEF A;  3D66 A;  3FIX A;  4P6Y A;  4H6Z A;  5G20 A;  4EFD A;  4NGT A;  1KUV A;  1Y0Y A;  3MRU A;  3UY5 A;  5THW A;  3B3S A;  4KSA A;  3B35 A;  3KHX A;  3F8K A;  1S60 A;  3GIU A;  2J8R A;  1LRZ A;  2PJC A;  4DYO A;  4HNY B;  1BLL E;  2ZEN A;  2EO8 A;  3BLN A;  4KSI A;  3GUX A;  1MJB A;  4R6T A;  2EUI A;  5LYF A;  4BD9 A;  5A27 A;  5HMN A;  4Y49 C;  2V8D A;  3T8W A;  3DDD A;  4AVC A;  2J9A A;  4M6H A;  2NMT A;  2FL4 A;  1XOV A;  2J8N A;  3T90 A;  1V0C A;  4UFV A;  4F0X A;  1R3N A;  2PSW A;  4CYO A;  1S7L A;  2PJ9 A;  2FT0 A;  3CDX A;  4UCM A;  4A33 A;  2AFO A;  3S6F A;  5AGE A;  2ZW7 A;  2HQY A;  2F5I A;  3LAC A;  4XNH B;  3KI9 A;  2ZEL A;  2C27 A;  1Y9W A;  4CAF A; 
#chains in the Genus database with same CATH homology
 2G3T A;  4R57 A;  1YGH A;  4Q38 A;  5CNP A;  2P6F A;  1S3Z A;  3H4Q A;  2OZH A;  3F0A A;  2R7H A;  4QC6 A;  4A32 A;  4X5K A;  1B87 A;  4CAW A;  4XNH C;  4CYQ A;  3D2M A;  2ZXV A;  1P4N A;  2B5G B;  1M1D A;  3DR6 A;  5I0C A;  2YNE A;  4XPL A;  3EO4 A;  2B4D B;  1I21 A;  2Q04 A;  2I79 A;  1M4I A;  4I49 A;  4L8A A;  2WPX A;  3IU2 A;  3H5Z A;  2Z10 A;  3VWD A;  4UCP A;  2CNT A;  3P2F A;  2KCW A;  3IWE A;  3NE7 A;  1MJA A;  1NE9 A;  4JJX A;  4UA3 A;  2REE A;  5C88 A;  4YFJ A;  3IU1 A;  4QVT A;  2JDC A;  2QIR A;  2O28 A;  4CRZ B;  4B11 A;  4C2Y A;  2PR1 A;  4MFL A;  5F47 A;  3QB8 A;  1BOB A;  2CNS A;  3S6G A;  1S5K A;  5KTA A;  1Y9K A;  2FIW A;  4MY3 A;  2WUU A;  3BJ8 A;  3WR7 A;  4R9M A;  1WWZ A;  4UWJ A;  2PQ8 A;  3LOD A;  3D8P A;  2VBQ A;  3D3S A;  2B58 A;  3IWG A;  1IIC A;  2P0W A;  1NMT A;  4NCZ A;  3TTH A;  4A95 A;  2B3U A;  3LD2 A;  3W91 A;  1ZO0 A;  4YGO A;  4PSW A;  4CAE A;  2AJ6 A;  2GAN A;  1CM0 A;  1QSM A;  2YNC A;  2Z3M A;  4YRH A;  4AB7 A;  1N71 A;  4JXR A;  2FXF A;  3FBU A;  4MFQ A;  1YK3 A;  2YND A;  1BO4 A;  1YX0 A;  1L0C A;  4AVB A;  4C7I A;  4JD6 A;  4ZBG A;  4CGP A;  4JWP A;  4OAE A;  2VZY A;  5IX3 A;  5F49 A;  4U9Y A;  5EC4 A;  1FY7 A;  2I00 A;  5F46 A;  4UFW A;  2BL1 A;  1YVK A;  1IYL A;  2ZW5 A;  4BMH A;  5JPH A;  2RC4 A;  2P6G A;  4ZGY B;  4M85 A;  4JLY A;  1RXT A;  4RI1 A;  3BJ7 A;  2Z0Z A;  4PSX A;  3W6S A;  3ZZI A;  4FD7 A;  4E8O A;  4MFJ A;  2OZG A;  1YVO A;  1NSL A;  2B3V A;  2CXA A;  4CAV A;  5EBV A;  2VZZ A;  3KKW A;  2D4O A;  4A30 A;  5GCN A;  2DXQ A;  4CRY B;  2OH1 A;  1VHS A;  2ARH A;  1MJ9 A;  3TO9 A;  2BSW A;  4R87 A;  2R1I A;  4CGO A;  2HV2 A;  3CXS A;  4QB9 A;  4KVM E;  4MBU A;  2FS5 A;  3E0K A;  4LX9 A;  1IYK A;  3JVN A;  1I1D A;  4E2A A;  4MY0 A;  4KOS A;  3DR8 A;  3R9F A;  2OZU A;  1QST A;  4CYN A;  3JTK A;  1PU9 A;  4IUS A;  5C82 A;  2OU2 A;  3S6H A;  1U6M A;  4Q36 A;  1IB1 E;  3R95 A;  4B14 A;  1R57 A;  3TO6 A;  4MFZ A;  2BEI A;  1Z9U A;  1B6B A;  3TO7 A;  3PGP A;  1XIX A;  4M3S A;  3TOB A;  4CAX A;  1S7K A;  2H5M A;  3FXT A;  4KOX A;  4XPK A;  2FIA A;  4UFX A;  4KSF A;  1YRE A;  3QAH A;  1P0H A;  4MJ8 A;  2DPS A;  4MFP A;  4KLV A;  3RYO A;  4OLL A;  2AE6 A;  4DNC A;  3FNC A;  1KZF A;  1UFH A;  4AG7 A;  4AVA A;  4II9 A;  3FRM A;  4KUB A;  4PK3 A;  5G1Z A;  2K5T A;  3DSB A;  5IB0 A;  4QUS A;  3TT2 A;  2D4P A;  2G0B A;  4E0A A;  3EFA A;  2JLM A;  2X7B A;  4A31 A;  2JEV A;  3VWE A;  2Z3L A;  1XMT A;  4MI4 A;  4B12 A;  4C68 A;  3S6K A;  2EVN A;  2FCK A;  4C7H A;  5DWM A;  3JUW A;  3DNS A;  1WK4 A;  2CY2 A;  1I12 A;  1SQH A;  2GE3 A;  4GS4 A;  4C2Z A;  4KOY A;  3G8W A;  1S7N A;  1RO5 A;  3A9L A;  4J3G A;  4UBR A;  2Q4V A;  1YR0 A;  5FVJ A;  3SHP A;  3W6X A;  3C26 A;  3T9Y A;  2YNC C;  5A28 A;  2DPT A;  2Y0M A;  4AG9 A;  3R1K A;  4FD5 A;  4UWI A;  4OAD A;  1KUX A;  4LUA A;  1Q2C A;  2J8M A;  5AG7 A;  3GKR A;  1ON0 A;  5IV0 A;  1M44 A;  4B10 A;  4PV6 A;  3G3S A;  3R9G A;  5BWA B;  4ORF A;  4KLW A;  4KZT A;  2Z3N A;  3K9U A;  4NEX A;  3MGD A;  2HUZ A;  4H89 A;  5G21 A;  4KVX A;  3N7Z A;  4L89 A;  2WPW A;  1YLE A;  5HH1 A;  1PUA A;  3PZJ A;  2Z3P A;  4K30 A;  2A4N A;  4F6A A;  5KTC A;  5H86 A;  2Z11 A;  3D2P A;  4QBJ A;  3ZJ0 A;  4IF5 A;  1CJW A;  5ISV A;  4NF1 A;  2QML A;  2OB0 A;  4MFK A;  1TIQ A;  1XF8 A;  2GIV A;  4H6U A;  2Z3O A;  3CXP A;  5J8F A;  2Z3K A;  2PRB A;  3FYN A;  3SXO A;  4B5P B;  4KOW A;  3TOA A;  2Q4Y A;  4XPD C;  4Y49 B;  4EVY A;  4B13 A;  1KUY A;  4HNX B;  1OZP A;  1IID A;  2ATR A;  1S7F A;  3EY5 A;  1Y7R A;  2FE7 A;  4KOV A;  2VI7 A;  1Z4R A;  3OWC A;  4FD6 A;  4MHD A;  5F48 A;  1QSN A;  5AG4 A;  1XEB A;  3EXN A;  2VXK A;  2VQY A;  4F0Y A;  4RS2 A;  2R98 A;  4KS9 A;  2ZW6 A;  2Q0Y A;  2R8V A;  4U5Y A;  3PP9 A;  4R3L A;  5AG5 A;  2PDO A;  1GHE A;  4B5P A;  2B4B A;  3TE4 A;  3FB3 A;  2QEC A;  5JQ4 A;  4U9Z A;  3R9E A;  4CGL A;  5AG6 A;  1Z4E A;  4HKF A;  5E96 A;  5J8C A;  2G3A A;  2PR8 A;  3IGR A;  4KOT A;  4NXY A;  2YGW A;  2PC1 A;  2CNM A;  2REF A;  3CXQ A;  2ZW4 A;  1MK4 A;  5KTD A;  4B5O A;  2JDD A;  1M4D A;  3SXN A;  1QSR A;  1Q2D A;  4XPD B;  2P6E A;  3I9S A;  3R96 A;  4JXQ A;  2BUE A;  3F5B A;  3GY9 A;  4CYP A;  2ZPA A;  4KUA A;  2Q7B A;  3GYA A;  2Q44 A;  2WSA A;  3P2H A;  2FSR A;  4CS0 B;  1Q2Y A;  1XE4 A;  3V8I A;  3I3G A;  2VEZ A;  4CGN A;  4HNW B;  1K4J A;  4ONU A;  4R3K A;  4NSQ A;  4PK2 A;  2B5G A;  4KOR A;  3TCV A;  4KOU A;  5H84 A;  4A2Z A;  4FD4 A;  1QSO A;  4C2X A;  4KVO E;  1VKC A;  4BBH A;  5G22 A;  3B8G A;  3EC4 A;  2IL4 A;  4CGM A;  5DWN A;  4UCN A;  3TFY A;  1J4J A;  1M4G A;  2B4D A;  3FIX A;  5G20 A;  4H6Z A;  1KUV A;  3UY5 A;  4KSA A;  3F8K A;  1S60 A;  2J8R A;  1LRZ A;  4HNY B;  3BLN A;  1MJB A;  2EUI A;  5A27 A;  5HMN A;  4Y49 C;  4AVC A;  3DDD A;  2NMT A;  2FL4 A;  2J8N A;  3T90 A;  1V0C A;  4UFV A;  4F0X A;  2PSW A;  4CYO A;  1S7L A;  2FT0 A;  4UCM A;  4A33 A;  3S6F A;  5AGE A;  2ZW7 A;  2HQY A;  2F5I A;  4XNH B;  2C27 A;  1Y9W A;  4CAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...