2B3UA

Human spermine spermidine acetyltransferase k26r mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
162
Chain Sequence
AKFVIRPATAADCSDILRLIKELAQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 33
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3uA00
1IB1E 2PRBA 4CS0B 1QSOA 4BMHA 3FIXA 2Q4VA 5I0CA 3H4QA 1KUXA 2BEIA 4M85A 1RO5A 1QSNA 2ATRA 2OZHA 1Y9WA 4KVME 4EVYA 4JJXA 3KKWA 4E8OA 4R87A 2Q04A 1P4NA 2VEZA 4XPDB 3K9UA 1YK3A 4AVBA 4E2AA 2JDDA 2J8MA 1CM0A 4KLWA 5FVJA 4ORFA 2OU2A 5JQ4A 4CAVA 3LODA 2CY2A 4J3GA 4M3SA 4KOYA 4H89A 3S6FA 3TOBA 4NEXA 1M1DA 4F6AA 4XNHB 3T9YA 4FD7A 4KUBA 2HV2A 2VI7A 3DR8A 3R95A 5HMNA 3TO6A 4UWIA 1M4IA 1B87A 3EFAA 3R9EA 1SQHA 2A4NA 2P6FA 1I1DA 4KUAA 4DNCA 2Z0ZA 1Q2DA 1Y9KA 4KVXA 5F46A 4GS4A 4QUSA 1LRZA 1Z4RA 3PZJA 3FRMA 1I21A 1YGHA 2VZZA 3CXSA 2Y0MA 4AG9A 4JLYA 3R9FA 1L0CA 1Y7RA 5F47A 1IYKA 2Z10A 4L8AA 5F49A 4NF1A 1S7LA 3TT2A 3TOAA 3G8WA 2G3TA 5H86A 4XPDC 1M4DA 4KZTA 3SHPA 1XF8A 2CNTA 4Y49B 2RC4A 3TO7A 2H5MA 3MGDA 1IICA 1Z4EA 3P2FA 5GCNA 1MJAA 1XMTA 3TE4A 4NSQA 3N7ZA 4KOVA 2AJ6A 4PSWA 2GIVA 1VHSA 4B5PB 3DNSA 2Q44A 2R7HA 1RXTA 3GKRA 4CAWA 1R57A 1QSTA 2Q0YA 3GYAA 3RYOA 1MJBA 2D4PA 4B5PA 5CNPA 2EVNA 4AVAA 3DDDA 4XNHC 2D4OA 4FD6A 2VBQA 1Z9UA 2JDCA 1U6MA 2J8RA 1PUAA 2OZUA 2EUIA 3TCVA 4I49A 2WPWA 2FXFA 1ON0A 3P2HA 4L89A 4IUSA 2FE7A 1B6BA 1S3ZA 3GY9A 3JUWA 4UA3A 2OB0A 3T90A 4R3LA 4XPLA 3TTHA 2OH1A 4HNWB 2B3VA 3ZZIA 4FD4A 2PC1A 1IYLA 5J8CA 2HQYA 2Q7BA 1K4JA 3R1KA 3D2MA 4Y49C 3EO4A 3S6KA 4KOSA 5ISVA 4MI4A 1CJWA 4B5OA 3TO9A 2P6EA 4R3KA 4AG7A 4PK3A 2BL1A 3PGPA 2JEVA 2O28A 2Q4YA 2Z11A 2FSRA 1YVOA 3FB3A 4RS2A 3SXNA 1BOBA 2J8NA 4KORA 2ZXVA 3BJ8A 4QC6A 2QIRA 4CRYB 3E0KA 1QSMA 4R9MA 4X5KA 3R96A 2PSWA 5EC4A 2C27A 4AVCA 4U9YA 4HKFA 1NE9A 4JWPA 1KUYA 3CXPA 2REFA 3D8PA 2PQ8A 1S7NA 4K30A 1OZPA 4NCZA 2R1IA 2ZW7A 1GHEA 4LUAA 3WR7A 2IL4A 4MBUA 2X7BA 4H6ZA 2HUZA 4KOWA 2ARHA 5H84A 3W6SA 2B5GA 1S60A 1XEBA 4PV6A 1V0CA 2QECA 4MJ8A 3EXNA 2BUEA 5KTCA 1J4JA 4R57A 3DR6A 3VWEA 2KCWA 4XPKA 1MJ9A 3S6GA 4H6UA 4KOUA 5KTAA 3PP9A 3LD2A 5F48A 2FT0A 3CXQA 1MK4A 1NSLA 2F5IA 1I12A 2FIAA 1YR0A 1YX0A 2CNMA 4UBRA 2P0WA 3V8IA 5IX3A 3EC4A 3R9GA 3SXOA 3VWDA 4OAEA 4U9ZA 4PSXA 2PR8A 2VZYA 2FCKA 2PR1A 4FD5A 3TFYA 4CAXA 2JLMA 1Q2YA 3F5BA 2G3AA 1BO4A 2R98A 4F0YA 2VXKA 2FIWA 2GE3A 5IB0A 1P0HA 4PK2A 3ZJ0A 1M44A 1XIXA 2OZGA 2WPXA 2K5TA 5E96A 4U5YA 3S6HA 4AB7A 4JD6A 4JXQA 2FL4A 1FY7A 4YFJA 4QBJA 4MY0A 3JVNA 1N71A 4NXYA 4YRHA 2P6GA 2CNSA 3G3SA 2ZPAA 2DXQA 4CRZB 4KLVA 3D2PA 3I3GA 3I9SA 1VKCA 1S5KA 4KOXA 1YVKA 1S7KA 3NE7A 3OWCA 5C82A 3F0AA 5HH1A 5IV0A 3W91A 4QB9A 1M4GA 3IWGA 1WK4A 2B58A 1YLEA 3FBUA 1UFHA 2ZW4A 2I00A 5EBVA 4MHDA 3C26A 1QSRA 1NMTA 3FNCA 4KOTA 1KZFA 1XE4A 2B5GB 2ZW6A 2BSWA 1PU9A 2G0BA 5KTDA 4QVTA 2ZW5A 3FXTA 3QB8A 4LX9A 2R8VA 4OLLA 3IGRA 3EY5A 4II9A 1IIDA 2FS5A 4IF5A 2B4DB 4UWJA 3B8GA 4JXRA 5JPHA 5J8FA 2GANA 2B4BA 4ONUA 4HNYB 3FYNA 1WWZA 2QMLA 3BLNA 2REEA 3BJ7A 4YGOA 3DSBA 1YREA 1TIQA 2AE6A 4RI1A 1KUVA 2PDOA 2I79A 2B4DA 2B3UA 4MY3A 4KVOE 4HNXB 2NMTA 4OADA 3UY5A 5DWNA 3QAHA 5C88A 1Q2CA 3F8KA 5DWMA 4E0AA 1S7FA 3D3SA 4ZBGA 2VQYA 3W6XA
chains in the Genus database with same CATH superfamily
1IB1E 2PRBA 4CS0B 4UFXA 2CXAA 1QSOA 3IU1A 4BMHA 1H8LA 3FIXA 3BI0A 3CDXA 1Z8LA 3FEEA 2Q4VA 5I0CA 1IY7A 1Z2LA 2Z3LA 3WABA 3H4QA 4NGPA 5G22A 4FWUA 1KUXA 3MRUA 2BEIA 4M85A 1RO5A 4M6IA 3PB9X 1QSNA 2ATRA 1TXRA 2OZHA 1Y9WA 5AG5A 4CGOA 4FBEA 4DUKA 4KVME 4PXCA 4ZGYB 2PJ9A 4EVYA 4JJXA 3SI1A 3MN8A 4UF4A 4CGMA 3KKWA 4ZI6A 1CP6A 4MFZA 3KZWA 5BWAB 3T8WA 4R87A 4E8OA 1ELMP 3N5FA 2Q04A 1P4NA 2VEZA 4IAVA 4XPDB 1Z8XA 3K9UA 4Z65A 1YK3A 4AVBA 4G1PA 2JDDA 4E2AA 2J8MA 4CPAA 4W9YA 3SJGA 1CM0A 4KLWA 5FVJA 4CYPA 4ORFA 2IQ6A 1R43A 2OU2A 2WSAA 3IWWA 5JQ4A 3PBEA 4CAVA 3LODA 2CY2A 4J3GA 4M3SA 4KOYA 2DPTA 4H89A 4NGRA 3S6FA 3TOBA 3RNZA 3LWUA 4NEXA 1M1DA 3KQXA 2DF5A 4F6AA 4PXBA 2ZEGA 4UEZA 4XNHB 4B10A 4GM5A 3T9YA 4FD7A 2YNCC 4KUBA 5AG7A 2HV2A 5THWA 4EWTA 2VI7A 2PJ5A 4C7HA 3D7HA 5K8OA 3DR8A 3R95A 5HMNA 2ZENA 2Z3OA 3TO6A 4UCNA 4UWIA 1XMBA 1M4IA 1B87A 2PJ4A 3EFAA 4FAIA 3NH4A 1Y0YA 3R9EA 4PXDA 1SQHA 2A4NA 4ONWA 4UFVA 2P6FA 1Z8WA 4MFLA 1I1DA 5EMIA 4ZY2A 5G20A 4KUAA 2BOAA 4DNCA 2Z0ZA 4R8FA 1Q2DA 1Y9KA 4CAFA 4UIAA 4KVXA 2WYRA 5F46A 2BO9A 4GS4A 4QUSA 3SI2A 1LRZA 1Z4RA 3PZJA 1IU8A 1LAMA 4P4BA 5ELYA 2AFWA 1ZO0A 4P6YA 4A95A 3PBBA 4MHYA 1A2ZA 3FRMA 1F2OA 1I21A 1YGHA 2PJ0A 4F8ZA 2VZZA 3CXSA 4CYQA 5CBMA 3IC1A 2QYVA 4A37A 2WZNA 2Y0MA 4A94A 3QNVA 4AG9A 4JLYA 3R9FA 4F9UA 1L0CA 1F2PA 1Y7RA 5F47A 4M6HA 1IYKA 2Z10A 2OOTA 3D67A 2EK8A 3FMCA 3K2KA 4L8AA 2ZELA 5F49A 4F0XA 4UCMA 4NF1A 3IJ3A 3S9MA 4KSIA 4F9VA 2AFSA 1S7LA 3TT2A 3B7IA 3G8WA 1IGBA 2G3TA 3TOAA 2YNCA 4MMOA 5H86A 3KL9A 4OMEA 4JYWA 4JZ0A 4XPDC 3QAYA 1M4DA 4KZTA 3SHPA 2RB7A 1XF8A 3FF3A 1LAPA 3GIUA 1ZLHA 2CNTA 4WJBA 2JBJA 4PXEA 4Y49B 2RC4A 3TO7A 2GLJA 1BPNA 2H5MA 3MGDA 2QVPA 3WT4A 1IICA 3FH4A 5LYDA 1Z4EA 4B11A 3CT9A 3P2FA 3CPAA 3B35A 3PB6X 5GCNA 2ZEPA 1MJAA 6CPAA 1XMTA 4IK2A 3TE4A 3BHXA 2ZEFA 3N7ZA 3PRTA 2V8GA 4KS9A 4NSQA 4NGMA 4NGSA 4KOVA 5G21A 3S9LA 4AXVA 2PIZA 1ZG7A 2AJ6A 4PSWA 2ZOFA 3B3CA 2GIVA 2YGWA 2ZEHA 3LACA 1VHSA 4R76A 4UEFA 4B5PB 3DNSA 2Q44A 2R7HA 1RXTA 1JWQA 2AFMA 1TKHA 4RN7A 3GKRA 4CAWA 1NSAA 1R57A 3H8FA 1QSTA 3KHZA 5IB9A 2PJAA 2Q0YA 3GYAA 3RYOA 1MJBA 2XEGA 3VARA 2D4PA 1ELLP 4B5PA 8CPAA 3D68A 5K8PA 5HVFA 3FX6A 3KR5A 4MHNA 3FEDA 4MFKA 5CNPA 3CZXA 4OC1A 2EVNA 4AVAA 3DDDA 2PE3A 4XNHC 2V77A 3NFZA 2D4OA 5AGEA 4B6ZA 4FD6A 4Q38A 2VBQA 1Z9UA 4ZY0A 3RAMA 2Q43A 2JDCA 1U6MA 3VATA 4CGPA 4MRIA 2J8RA 3ISZA 1PUAA 1HDQA 2Z3KA 1BLLE 4A33A 2OZUA 4B13A 2EUIA 5G1ZA 2IJZA 2ZOGA 5JH9A 3TCVA 1IOIA 2AFZA 4I49A 4LQGA 4ZX8A 4O23A 4OP4A 4CYOA 2WPWA 2FXFA 1ON0A 3P2HA 5LYIA 4L89A 3TC8A 4IUSA 2FE7A 1B6BA 1S3ZA 3GY9A 3DGVA 3JUWA 3JTKA 4UA3A 3PFOA 2OB0A 3T90A 4ZX9A 5HVHA 1ARMA 4R3LA 2C6GA 4XPLA 3TTHA 2OH1A 4P4EA 4HNWB 2B3VA 3ZZIA 4FD4A 3H8EA 1LFWA 4MHPA 4C2ZA 2HC9A 2PC1A 2PVVA 1IYLA 3WC5A 3PFEA 5J8CA 3PB4X 4OC5A 2HQYA 2Q7BA 1K4JA 3NE8A 4NJRA 5JM6A 3R1KA 2NYQA 3D2MA 1VHEA 3EO4A 4Y49C 4KOSA 3S6KA 2Q4ZA 5ISVA 4R6TA 1IOFA 4MI4A 1CJWA 2YNDA 1ZLIA 4MHZA 2F7VA 2RFHA 4B5OA 3IWEA 2Q51A 3H8GA 3IEHA 3B2YA 3TO9A 4CYNA 1BPMA 3S9NA 3B3TA 2GFQA 2P6EA 2XEIA 4YWYA 4R3KA 4AG7A 4PK3A 4OC4A 3SJFA 1TKJA 3FVLA 1CBXA 1Y7EA 2ZEDA 2BL1A 4GXHA 2JEVA 2O28A 3PGPA 4OC2A 4BD9A 1XOVA 2Q4YA 4A31A 1YMEA 2FSRA 2XEJA 2Z11A 2Q7SA 1YVOA 2AFUA 3FB3A 4RS2A 3SXNA 2PJ2A 1CP7A 5LYLA 1FNOA 4A38A 1BOBA 2J8NA 3L2NA 1YQEA 3IO1A 2ZXVA 4KORA 3BJ8A 2O53A 4QC6A 1XFOA 2QIRA 2AFXA 3V7ZA 4CRYB 3E0KA 2F8HA 1QSMA 2PRQA 3PB8X 3RBUA 2GU2A 2PJBA 1UWYA 4R9MA 4X5KA 2C1CA 4P45A 2POKA 3R96A 3KQZA 7CPAA 4BINA 3LMSA 2ABZA 2PSWA 4KSFA 5EC4A 2C27A 2QJ8A 4AVCA 4B14A 2WUUA 4U9YA 5LRKA 4HKFA 1NE9A 4DYOA 2CTBA 3K9TA 3TX8A 3D7GA 2AFOA 4JWPA 1XRYA 1KUYA 3CXPA 2REFA 4MFPA 3D8PA 2BCOA 2PQ8A 1S7NA 3WC7A 1VGYA 4TNUA 3SI0A 5DS0A 3KGQA 4B12A 4K30A 3DLJA 1AMPA 1OZPA 4NCZA 4P4IA 4C2XA 2R1IA 3BXMA 1TF8A 2ZW7A 3D4UA 1GHEA 4LUAA 2PCUA 3WR7A 5A27A 2NSMA 2IL4A 4MBUA 1CG2A 3A9LA 2X7BA 3FECA 4H6ZA 5AG4A 4M6GA 2HUZA 4KOWA 1RTQA 2ARHA 5H84A 4X3RA 2I3CA 3B3SA 2EBJA 4X8IA 4PPZA 2ZEMA 5CPAA 4OC0A 3W6SA 2O4HA 2B5GA 3HUVA 1S60A 1XEBA 1HEEA 4PV6A 3RZAA 1V0CA 5A28A 2QECA 2PJ3A 4MJ8A 3EXNA 2BUEA 4P4JA 5KTCA 4DJLA 2Z3MA 1J4JA 3NH5A 3JRUA 4R57A 3DR6A 4NGNA 3VWEA 2KCWA 4TWEA 3I1UA 4XPKA 5HVGA 5LYFA 1MJ9A 3S6GA 4H6UA 4KOUA 4P4FA 5KTAA 3PP9A 4IHMA 4UIBA 5I4MA 3LD2A 5F48A 4C7IA 2FT0A 4ZYQA 1R3NA 3CXQA 1MK4A 1NSLA 4MCSA 1EE3P 2DPSA 4R7MA 2JEWA 2PJ8A 1Z5RA 3CPXA 3VH9A 4BBHA 4LQ6A 1JQGA 2FIAA 2F5IA 1DE4C 1I12A 1Q7LA 1YR0A 1YX0A 2DEAA 2CNMA 4UBRA 2P0WA 4MCPA 3V8IA 3PB7X 4CAEA 5IX3A 1HDUA 3EC4A 3IU2A 4P4DA 4YU9A 5JGFA 5AG6A 1XBUA 3R9GA 3SXOA 3VWDA 2CF4A 4OAEA 1ZG8A 4U9ZA 4PSXA 1X12A 1LANA 1XJOA 2PR8A 4Q7AA 2VZYA 3GUXA 4Q36A 4C68A 2FCKA 2PR1A 5K8NA 1QQ9A 4H2KA 2ANPA 2C6PA 4FD5A 2GREA 3TFYA 4UFWA 4CAXA 2JLMA 1Q2YA 2JBKA 1Z8TA 3F5BA 2G3AA 1BO4A 2R98A 4A32A 4NGTA 4F0YA 3WC6A 2VXKA 2FIWA 2GE3A 5IB0A 1P0HA 5J1QA 4PK2A 2GLFA 3ZJ0A 1M44A 2V8HA 1XIXA 2OZGA 2PJ1A 2PJ7A 2HB6A 2IMOA 2WPXA 2K5TA 5D29A 5E96A 2EO8A 3BI1A 1Y0RA 4U5YA 2PIYA 5F09A 3S6HA 4AB7A 4JD6A 1KWMA 2FL4A 3GLJA 4JXQA 1FY7A 4YFJA 1LCPA 1TF9A 4QBJA 3D7FA 1DTDA 4MY0A 4P44A 3JVNA 4EMEA 1N71A 4NXYA 3H5ZA 3NA6A 4YRHA 3IIBA 2P6GA 1AYEA 2CNSA 2PVWA 3D66A 3G3SA 4KSAA 4PQAA 2ZPAA 3IFEA 2DXQA 1VIXA 4FUUA 1QMUA 4WWVA 4CRZB 4KLVA 2V8VA 3D2PA 1CX8A 2OR4A 4NGQA 4UCPA 3I3GA 3I9SA 1YLOA 4P10A 1CPXA 1VKCA 4RUHA 3HLPA 1S5KA 4KOXA 1YVKA 3V38A 4UEEA 1S7KA 4NFRA 3NE7A 1LOKA 2G9DA 1X10A 3OWCA 5C82A 2PJ6A 3F0AA 5HH1A 2YNEA 4MFJA 1M4LA 1TKFA 5HXDA 2FVGA 2CTCA 5IV0A 3W91A 2ZEOA 3GB0A 4QB9A 1F57A 1GYTA 4EFDA 1M4GA 1BAVA 1OBRA 3IWGA 2VL1A 1WK4A 3KASA 4C2YA 1FT7A 4OIWA 2B58A 1YLEA 3FBUA 1UFHA 2ZW4A 2C6CA 2I00A 2J9AA 2EK9A 2Z3PA 2ZEEA 3D7DA 4MHDA 5EBVA 5LRJA 3C26A 1QSRA 2ODFA 4X2TA 4OC3A 1NMTA 1YSJA 1ZG9A 3FNCA 4OIDA 4KOTA 1AUGA 1KZFA 1XE4A 1PCAA 2B5GB 2PJCA 2ZW6A 2BSWA 1PU9A 2G0BA 5KTDA 3PEIA 4A39A 4QVTA 1YW4A 2ZW5A 3FJUA 3FXTA 3QB8A 2EWBA 4LX9A 4MCQA 4HPSA 2R8VA 5D8NA 4OLLA 1YW6A 4MCRA 4MXUA 4ZY1A 5K8MA 3IGRA 3EY5A 4II9A 1IIDA 2FS5A 4IF5A 2B4DB 2V8DA 4OKOA 4UWJA 4A30A 3B8GA 4JXRA 1VHOA 3SJEA 5JPHA 5J8FA 2GANA 2B4BA 4ONUA 3KHXA 4HNYB 3FYNA 1ARLA 1WWZA 2XEFA 2QMLA 3BLNA 3B3WA 2REEA 3BJ7A 4YGOA 3NH8A 3DSBA 1YREA 4MFQA 1TIQA 5LRGA 2AE6A 2Z3NA 4RI1A 1KUVA 3RO0A 2PDOA 2I79A 2B4DA 1CPSA 2B3UA 1PYTB 4A2ZA 4MY3A 4CGNA 4KVOE 4HNXB 2NMTA 3KI9A 2CIJA 4OADA 3SJXA 5DWNA 3UY5A 3B3VA 3QAHA 5C88A 1Q2CA 3F8KA 5DWMA 4E0AA 1S7FA 3KR4A 3D3SA 4ZBGA 2VQYA 4CGLA 3ISXA 4K3NA 3W6XA 4NJQA
chains in the Genus database with same CATH topology
1IB1E 2PRBA 4CS0B 4UFXA 2CXAA 1QSOA 3IU1A 4BMHA 3FIXA 2Q4VA 5I0CA 2Z3LA 3H4QA 5G22A 1KUXA 2BEIA 4M85A 1RO5A 5AG5A 1QSNA 2ATRA 2OZHA 4CGOA 1Y9WA 4KVME 4ZGYB 4EVYA 4JJXA 4CGMA 3KKWA 4MFZA 5BWAB 4E8OA 4R87A 2Q04A 1P4NA 2VEZA 4XPDB 3K9UA 1YK3A 4AVBA 4E2AA 2JDDA 2J8MA 1CM0A 4KLWA 5FVJA 4CYPA 4ORFA 2OU2A 2WSAA 5JQ4A 4CAVA 3LODA 2CY2A 4J3GA 4M3SA 4KOYA 2DPTA 4H89A 3S6FA 3TOBA 4NEXA 1M1DA 4F6AA 4XNHB 4B10A 3T9YA 4FD7A 2YNCC 4KUBA 5AG7A 2HV2A 2VI7A 4C7HA 3DR8A 3R95A 5HMNA 2Z3OA 3TO6A 4UCNA 4UWIA 1M4IA 1B87A 3EFAA 3R9EA 1SQHA 2A4NA 4UFVA 2P6FA 4MFLA 1I1DA 5G20A 4KUAA 4DNCA 2Z0ZA 1Q2DA 1Y9KA 4CAFA 4KVXA 5F46A 4GS4A 4QUSA 1LRZA 1Z4RA 3PZJA 1ZO0A 4A95A 3FRMA 1I21A 1YGHA 2VZZA 3CXSA 4CYQA 2Y0MA 4AG9A 4JLYA 3R9FA 1L0CA 1Y7RA 5F47A 1IYKA 2Z10A 4L8AA 5F49A 4F0XA 4UCMA 4NF1A 1S7LA 3TT2A 3TOAA 3G8WA 2G3TA 2YNCA 5H86A 4XPDC 1M4DA 4KZTA 3SHPA 1XF8A 2CNTA 4Y49B 2RC4A 3TO7A 2H5MA 3MGDA 1IICA 1Z4EA 4B11A 3P2FA 5GCNA 1MJAA 1XMTA 3TE4A 4NSQA 3N7ZA 4KS9A 5G21A 4KOVA 2AJ6A 4PSWA 2GIVA 2YGWA 1VHSA 4B5PB 3DNSA 2Q44A 2R7HA 1RXTA 3GKRA 4CAWA 1R57A 1QSTA 2Q0YA 3GYAA 3RYOA 1MJBA 2D4PA 4B5PA 4MFKA 5CNPA 2EVNA 4AVAA 3DDDA 5AGEA 4XNHC 2D4OA 4FD6A 4Q38A 2VBQA 1Z9UA 2JDCA 1U6MA 4CGPA 2J8RA 1PUAA 2Z3KA 4A33A 2OZUA 4B13A 2EUIA 5G1ZA 3TCVA 4I49A 4CYOA 2WPWA 2FXFA 1ON0A 3P2HA 4L89A 4IUSA 2FE7A 1B6BA 1S3ZA 3GY9A 3JUWA 3JTKA 4UA3A 2OB0A 3T90A 4R3LA 4XPLA 3TTHA 2OH1A 4HNWB 2B3VA 3ZZIA 4FD4A 4C2ZA 2PC1A 1IYLA 5J8CA 2HQYA 2Q7BA 1K4JA 3R1KA 3D2MA 4Y49C 3EO4A 3S6KA 4KOSA 5ISVA 4MI4A 1CJWA 2YNDA 4B5OA 3IWEA 3TO9A 4CYNA 2P6EA 4R3KA 4AG7A 4PK3A 2BL1A 3PGPA 2JEVA 2O28A 4A31A 2Q4YA 2Z11A 2FSRA 1YVOA 3FB3A 4RS2A 3SXNA 1BOBA 2J8NA 4KORA 2ZXVA 3BJ8A 4QC6A 2QIRA 4CRYB 3E0KA 1QSMA 4R9MA 4X5KA 3R96A 2PSWA 4KSFA 5EC4A 2C27A 4AVCA 4B14A 2WUUA 4U9YA 4HKFA 1NE9A 4JWPA 1KUYA 3CXPA 2REFA 4MFPA 3D8PA 2PQ8A 1S7NA 4B12A 4K30A 1OZPA 4NCZA 4C2XA 2R1IA 2ZW7A 1GHEA 4LUAA 3WR7A 5A27A 2IL4A 4MBUA 3A9LA 2X7BA 4H6ZA 5AG4A 2HUZA 4KOWA 2ARHA 5H84A 3W6SA 2B5GA 1S60A 1XEBA 4PV6A 1V0CA 5A28A 2QECA 4MJ8A 3EXNA 2BUEA 5KTCA 2Z3MA 1J4JA 4R57A 3DR6A 3VWEA 2KCWA 4XPKA 1MJ9A 3S6GA 4H6UA 4KOUA 5KTAA 3PP9A 3LD2A 5F48A 4C7IA 2FT0A 3CXQA 1MK4A 1NSLA 2DPSA 4BBHA 2F5IA 1I12A 2FIAA 1YR0A 1YX0A 2CNMA 4UBRA 2P0WA 3V8IA 4CAEA 5IX3A 3EC4A 3IU2A 5AG6A 3R9GA 3SXOA 3VWDA 4OAEA 4U9ZA 4PSXA 2PR8A 2VZYA 4Q36A 4C68A 2FCKA 2PR1A 4FD5A 3TFYA 4UFWA 4CAXA 2JLMA 1Q2YA 3F5BA 2G3AA 1BO4A 2R98A 4A32A 4F0YA 2VXKA 2FIWA 2GE3A 5IB0A 1P0HA 4PK2A 3ZJ0A 1M44A 1XIXA 2OZGA 2WPXA 2K5TA 5E96A 4U5YA 3S6HA 4AB7A 4JD6A 4JXQA 2FL4A 1FY7A 4YFJA 4QBJA 4MY0A 3JVNA 1N71A 4NXYA 3H5ZA 4YRHA 2P6GA 2CNSA 3G3SA 4KSAA 2ZPAA 2DXQA 4CRZB 4KLVA 3D2PA 4UCPA 3I3GA 3I9SA 1VKCA 1S5KA 4KOXA 1YVKA 1S7KA 3NE7A 3OWCA 5C82A 3F0AA 5HH1A 2YNEA 4MFJA 5IV0A 3W91A 4QB9A 1M4GA 3IWGA 4C2YA 1WK4A 2B58A 1YLEA 3FBUA 1UFHA 2ZW4A 2I00A 5EBVA 2Z3PA 4MHDA 3C26A 1QSRA 1NMTA 3FNCA 4KOTA 1KZFA 1XE4A 2B5GB 2ZW6A 2BSWA 1PU9A 2G0BA 5KTDA 4QVTA 2ZW5A 3FXTA 3QB8A 4LX9A 2R8VA 4OLLA 3IGRA 3EY5A 4II9A 1IIDA 2FS5A 4IF5A 2B4DB 4UWJA 4A30A 3B8GA 4JXRA 5JPHA 5J8FA 2GANA 2B4BA 4ONUA 4HNYB 3FYNA 1WWZA 2QMLA 3BLNA 2REEA 3BJ7A 4YGOA 3DSBA 1YREA 4MFQA 1TIQA 2AE6A 2Z3NA 4RI1A 1KUVA 2PDOA 2I79A 2B4DA 2B3UA 4A2ZA 4MY3A 4CGNA 4KVOE 4HNXB 2NMTA 4OADA 3UY5A 5DWNA 3QAHA 5C88A 1Q2CA 3F8KA 5DWMA 4E0AA 1S7FA 3D3SA 4ZBGA 2VQYA 4CGLA 3W6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IB1 E;  2PRB A;  4CS0 B;  1QSO A;  4BMH A;  3FIX A;  2Q4V A;  5I0C A;  3H4Q A;  1KUX A;  2BEI A;  4M85 A;  1RO5 A;  1QSN A;  2ATR A;  2OZH A;  1Y9W A;  4KVM E;  4EVY A;  4JJX A;  3KKW A;  4E8O A;  4R87 A;  2Q04 A;  1P4N A;  2VEZ A;  4XPD B;  3K9U A;  1YK3 A;  4AVB A;  4E2A A;  2JDD A;  2J8M A;  1CM0 A;  4KLW A;  5FVJ A;  4ORF A;  2OU2 A;  5JQ4 A;  4CAV A;  3LOD A;  2CY2 A;  4J3G A;  4M3S A;  4KOY A;  4H89 A;  3S6F A;  3TOB A;  4NEX A;  1M1D A;  4F6A A;  4XNH B;  3T9Y A;  4FD7 A;  4KUB A;  2HV2 A;  2VI7 A;  3DR8 A;  3R95 A;  5HMN A;  3TO6 A;  4UWI A;  1M4I A;  1B87 A;  3EFA A;  3R9E A;  1SQH A;  2A4N A;  2P6F A;  1I1D A;  4KUA A;  4DNC A;  2Z0Z A;  1Q2D A;  1Y9K A;  4KVX A;  5F46 A;  4GS4 A;  4QUS A;  1LRZ A;  1Z4R A;  3PZJ A;  3FRM A;  1I21 A;  1YGH A;  2VZZ A;  3CXS A;  2Y0M A;  4AG9 A;  4JLY A;  3R9F A;  1L0C A;  1Y7R A;  5F47 A;  1IYK A;  2Z10 A;  4L8A A;  5F49 A;  4NF1 A;  1S7L A;  3TT2 A;  3TOA A;  3G8W A;  2G3T A;  5H86 A;  4XPD C;  1M4D A;  4KZT A;  3SHP A;  1XF8 A;  2CNT A;  4Y49 B;  2RC4 A;  3TO7 A;  2H5M A;  3MGD A;  1IIC A;  1Z4E A;  3P2F A;  5GCN A;  1MJA A;  1XMT A;  3TE4 A;  4NSQ A;  3N7Z A;  4KOV A;  2AJ6 A;  4PSW A;  2GIV A;  1VHS A;  4B5P B;  3DNS A;  2Q44 A;  2R7H A;  1RXT A;  3GKR A;  4CAW A;  1R57 A;  1QST A;  2Q0Y A;  3GYA A;  3RYO A;  1MJB A;  2D4P A;  4B5P A;  5CNP A;  2EVN A;  4AVA A;  3DDD A;  4XNH C;  2D4O A;  4FD6 A;  2VBQ A;  1Z9U A;  2JDC A;  1U6M A;  2J8R A;  1PUA A;  2OZU A;  2EUI A;  3TCV A;  4I49 A;  2WPW A;  2FXF A;  1ON0 A;  3P2H A;  4L89 A;  4IUS A;  2FE7 A;  1B6B A;  1S3Z A;  3GY9 A;  3JUW A;  4UA3 A;  2OB0 A;  3T90 A;  4R3L A;  4XPL A;  3TTH A;  2OH1 A;  4HNW B;  2B3V A;  3ZZI A;  4FD4 A;  2PC1 A;  1IYL A;  5J8C A;  2HQY A;  2Q7B A;  1K4J A;  3R1K A;  3D2M A;  4Y49 C;  3EO4 A;  3S6K A;  4KOS A;  5ISV A;  4MI4 A;  1CJW A;  4B5O A;  3TO9 A;  2P6E A;  4R3K A;  4AG7 A;  4PK3 A;  2BL1 A;  3PGP A;  2JEV A;  2O28 A;  2Q4Y A;  2Z11 A;  2FSR A;  1YVO A;  3FB3 A;  4RS2 A;  3SXN A;  1BOB A;  2J8N A;  4KOR A;  2ZXV A;  3BJ8 A;  4QC6 A;  2QIR A;  4CRY B;  3E0K A;  1QSM A;  4R9M A;  4X5K A;  3R96 A;  2PSW A;  5EC4 A;  2C27 A;  4AVC A;  4U9Y A;  4HKF A;  1NE9 A;  4JWP A;  1KUY A;  3CXP A;  2REF A;  3D8P A;  2PQ8 A;  1S7N A;  4K30 A;  1OZP A;  4NCZ A;  2R1I A;  2ZW7 A;  1GHE A;  4LUA A;  3WR7 A;  2IL4 A;  4MBU A;  2X7B A;  4H6Z A;  2HUZ A;  4KOW A;  2ARH A;  5H84 A;  3W6S A;  2B5G A;  1S60 A;  1XEB A;  4PV6 A;  1V0C A;  2QEC A;  4MJ8 A;  3EXN A;  2BUE A;  5KTC A;  1J4J A;  4R57 A;  3DR6 A;  3VWE A;  2KCW A;  4XPK A;  1MJ9 A;  3S6G A;  4H6U A;  4KOU A;  5KTA A;  3PP9 A;  3LD2 A;  5F48 A;  2FT0 A;  3CXQ A;  1MK4 A;  1NSL A;  2F5I A;  1I12 A;  2FIA A;  1YR0 A;  1YX0 A;  2CNM A;  4UBR A;  2P0W A;  3V8I A;  5IX3 A;  3EC4 A;  3R9G A;  3SXO A;  3VWD A;  4OAE A;  4U9Z A;  4PSX A;  2PR8 A;  2VZY A;  2FCK A;  2PR1 A;  4FD5 A;  3TFY A;  4CAX A;  2JLM A;  1Q2Y A;  3F5B A;  2G3A A;  1BO4 A;  2R98 A;  4F0Y A;  2VXK A;  2FIW A;  2GE3 A;  5IB0 A;  1P0H A;  4PK2 A;  3ZJ0 A;  1M44 A;  1XIX A;  2OZG A;  2WPX A;  2K5T A;  5E96 A;  4U5Y A;  3S6H A;  4AB7 A;  4JD6 A;  4JXQ A;  2FL4 A;  1FY7 A;  4YFJ A;  4QBJ A;  4MY0 A;  3JVN A;  1N71 A;  4NXY A;  4YRH A;  2P6G A;  2CNS A;  3G3S A;  2ZPA A;  2DXQ A;  4CRZ B;  4KLV A;  3D2P A;  3I3G A;  3I9S A;  1VKC A;  1S5K A;  4KOX A;  1YVK A;  1S7K A;  3NE7 A;  3OWC A;  5C82 A;  3F0A A;  5HH1 A;  5IV0 A;  3W91 A;  4QB9 A;  1M4G A;  3IWG A;  1WK4 A;  2B58 A;  1YLE A;  3FBU A;  1UFH A;  2ZW4 A;  2I00 A;  5EBV A;  4MHD A;  3C26 A;  1QSR A;  1NMT A;  3FNC A;  4KOT A;  1KZF A;  1XE4 A;  2B5G B;  2ZW6 A;  2BSW A;  1PU9 A;  2G0B A;  5KTD A;  4QVT A;  2ZW5 A;  3FXT A;  3QB8 A;  4LX9 A;  2R8V A;  4OLL A;  3IGR A;  3EY5 A;  4II9 A;  1IID A;  2FS5 A;  4IF5 A;  2B4D B;  4UWJ A;  3B8G A;  4JXR A;  5JPH A;  5J8F A;  2GAN A;  2B4B A;  4ONU A;  4HNY B;  3FYN A;  1WWZ A;  2QML A;  3BLN A;  2REE A;  3BJ7 A;  4YGO A;  3DSB A;  1YRE A;  1TIQ A;  2AE6 A;  4RI1 A;  1KUV A;  2PDO A;  2I79 A;  2B4D A;  2B3U A;  4MY3 A;  4KVO E;  4HNX B;  2NMT A;  4OAD A;  3UY5 A;  5DWN A;  3QAH A;  5C88 A;  1Q2C A;  3F8K A;  5DWM A;  4E0A A;  1S7F A;  3D3S A;  4ZBG A;  2VQY A;  3W6X A; 
#chains in the Genus database with same CATH topology
 1IB1 E;  2PRB A;  4CS0 B;  4UFX A;  2CXA A;  1QSO A;  3IU1 A;  4BMH A;  1H8L A;  3FIX A;  3BI0 A;  3CDX A;  1Z8L A;  3FEE A;  2Q4V A;  5I0C A;  1IY7 A;  1Z2L A;  2Z3L A;  3WAB A;  3H4Q A;  4NGP A;  5G22 A;  4FWU A;  1KUX A;  3MRU A;  2BEI A;  4M85 A;  1RO5 A;  4M6I A;  3PB9 X;  1QSN A;  2ATR A;  1TXR A;  2OZH A;  1Y9W A;  5AG5 A;  4CGO A;  4FBE A;  4DUK A;  4KVM E;  4PXC A;  4ZGY B;  2PJ9 A;  4EVY A;  4JJX A;  3SI1 A;  3MN8 A;  4UF4 A;  4CGM A;  3KKW A;  4ZI6 A;  1CP6 A;  4MFZ A;  3KZW A;  5BWA B;  3T8W A;  4R87 A;  4E8O A;  1ELM P;  3N5F A;  2Q04 A;  1P4N A;  2VEZ A;  4IAV A;  4XPD B;  1Z8X A;  3K9U A;  4Z65 A;  1YK3 A;  4AVB A;  4G1P A;  2JDD A;  4E2A A;  2J8M A;  4CPA A;  4W9Y A;  3SJG A;  1CM0 A;  4KLW A;  5FVJ A;  4CYP A;  4ORF A;  2IQ6 A;  1R43 A;  2OU2 A;  2WSA A;  3IWW A;  5JQ4 A;  3PBE A;  4CAV A;  3LOD A;  2CY2 A;  4J3G A;  4M3S A;  4KOY A;  2DPT A;  4H89 A;  4NGR A;  3S6F A;  3TOB A;  3RNZ A;  3LWU A;  4NEX A;  1M1D A;  3KQX A;  2DF5 A;  4F6A A;  4PXB A;  2ZEG A;  4UEZ A;  4XNH B;  4B10 A;  4GM5 A;  3T9Y A;  4FD7 A;  2YNC C;  4KUB A;  5AG7 A;  2HV2 A;  5THW A;  4EWT A;  2VI7 A;  2PJ5 A;  4C7H A;  3D7H A;  5K8O A;  3DR8 A;  3R95 A;  5HMN A;  2ZEN A;  2Z3O A;  3TO6 A;  4UCN A;  4UWI A;  1XMB A;  1M4I A;  1B87 A;  2PJ4 A;  3EFA A;  4FAI A;  3NH4 A;  1Y0Y A;  3R9E A;  4PXD A;  1SQH A;  2A4N A;  4ONW A;  4UFV A;  2P6F A;  1Z8W A;  4MFL A;  1I1D A;  5EMI A;  4ZY2 A;  5G20 A;  4KUA A;  2BOA A;  4DNC A;  2Z0Z A;  4R8F A;  1Q2D A;  1Y9K A;  4CAF A;  4UIA A;  4KVX A;  2WYR A;  5F46 A;  2BO9 A;  4GS4 A;  4QUS A;  3SI2 A;  1LRZ A;  1Z4R A;  3PZJ A;  1IU8 A;  1LAM A;  4P4B A;  5ELY A;  2AFW A;  1ZO0 A;  4P6Y A;  4A95 A;  3PBB A;  4MHY A;  1A2Z A;  3FRM A;  1F2O A;  1I21 A;  1YGH A;  2PJ0 A;  4F8Z A;  2VZZ A;  3CXS A;  4CYQ A;  5CBM A;  3IC1 A;  2QYV A;  4A37 A;  2WZN A;  2Y0M A;  4A94 A;  3QNV A;  4AG9 A;  4JLY A;  3R9F A;  4F9U A;  1L0C A;  1F2P A;  1Y7R A;  5F47 A;  4M6H A;  1IYK A;  2Z10 A;  2OOT A;  3D67 A;  2EK8 A;  3FMC A;  3K2K A;  4L8A A;  2ZEL A;  5F49 A;  4F0X A;  4UCM A;  4NF1 A;  3IJ3 A;  3S9M A;  4KSI A;  4F9V A;  2AFS A;  1S7L A;  3TT2 A;  3B7I A;  3G8W A;  1IGB A;  2G3T A;  3TOA A;  2YNC A;  4MMO A;  5H86 A;  3KL9 A;  4OME A;  4JYW A;  4JZ0 A;  4XPD C;  3QAY A;  1M4D A;  4KZT A;  3SHP A;  2RB7 A;  1XF8 A;  3FF3 A;  1LAP A;  3GIU A;  1ZLH A;  2CNT A;  4WJB A;  2JBJ A;  4PXE A;  4Y49 B;  2RC4 A;  3TO7 A;  2GLJ A;  1BPN A;  2H5M A;  3MGD A;  2QVP A;  3WT4 A;  1IIC A;  3FH4 A;  5LYD A;  1Z4E A;  4B11 A;  3CT9 A;  3P2F A;  3CPA A;  3B35 A;  3PB6 X;  5GCN A;  2ZEP A;  1MJA A;  6CPA A;  1XMT A;  4IK2 A;  3TE4 A;  3BHX A;  2ZEF A;  3N7Z A;  3PRT A;  2V8G A;  4KS9 A;  4NSQ A;  4NGM A;  4NGS A;  4KOV A;  5G21 A;  3S9L A;  4AXV A;  2PIZ A;  1ZG7 A;  2AJ6 A;  4PSW A;  2ZOF A;  3B3C A;  2GIV A;  2YGW A;  2ZEH A;  3LAC A;  1VHS A;  4R76 A;  4UEF A;  4B5P B;  3DNS A;  2Q44 A;  2R7H A;  1RXT A;  1JWQ A;  2AFM A;  1TKH A;  4RN7 A;  3GKR A;  4CAW A;  1NSA A;  1R57 A;  3H8F A;  1QST A;  3KHZ A;  5IB9 A;  2PJA A;  2Q0Y A;  3GYA A;  3RYO A;  1MJB A;  2XEG A;  3VAR A;  2D4P A;  1ELL P;  4B5P A;  8CPA A;  3D68 A;  5K8P A;  5HVF A;  3FX6 A;  3KR5 A;  4MHN A;  3FED A;  4MFK A;  5CNP A;  3CZX A;  4OC1 A;  2EVN A;  4AVA A;  3DDD A;  2PE3 A;  4XNH C;  2V77 A;  3NFZ A;  2D4O A;  5AGE A;  4B6Z A;  4FD6 A;  4Q38 A;  2VBQ A;  1Z9U A;  4ZY0 A;  3RAM A;  2Q43 A;  2JDC A;  1U6M A;  3VAT A;  4CGP A;  4MRI A;  2J8R A;  3ISZ A;  1PUA A;  1HDQ A;  2Z3K A;  1BLL E;  4A33 A;  2OZU A;  4B13 A;  2EUI A;  5G1Z A;  2IJZ A;  2ZOG A;  5JH9 A;  3TCV A;  1IOI A;  2AFZ A;  4I49 A;  4LQG A;  4ZX8 A;  4O23 A;  4OP4 A;  4CYO A;  2WPW A;  2FXF A;  1ON0 A;  3P2H A;  5LYI A;  4L89 A;  3TC8 A;  4IUS A;  2FE7 A;  1B6B A;  1S3Z A;  3GY9 A;  3DGV A;  3JUW A;  3JTK A;  4UA3 A;  3PFO A;  2OB0 A;  3T90 A;  4ZX9 A;  5HVH A;  1ARM A;  4R3L A;  2C6G A;  4XPL A;  3TTH A;  2OH1 A;  4P4E A;  4HNW B;  2B3V A;  3ZZI A;  4FD4 A;  3H8E A;  1LFW A;  4MHP A;  4C2Z A;  2HC9 A;  2PC1 A;  2PVV A;  1IYL A;  3WC5 A;  3PFE A;  5J8C A;  3PB4 X;  4OC5 A;  2HQY A;  2Q7B A;  1K4J A;  3NE8 A;  4NJR A;  5JM6 A;  3R1K A;  2NYQ A;  3D2M A;  1VHE A;  3EO4 A;  4Y49 C;  4KOS A;  3S6K A;  2Q4Z A;  5ISV A;  4R6T A;  1IOF A;  4MI4 A;  1CJW A;  2YND A;  1ZLI A;  4MHZ A;  2F7V A;  2RFH A;  4B5O A;  3IWE A;  2Q51 A;  3H8G A;  3IEH A;  3B2Y A;  3TO9 A;  4CYN A;  1BPM A;  3S9N A;  3B3T A;  2GFQ A;  2P6E A;  2XEI A;  4YWY A;  4R3K A;  4AG7 A;  4PK3 A;  4OC4 A;  3SJF A;  1TKJ A;  3FVL A;  1CBX A;  1Y7E A;  2ZED A;  2BL1 A;  4GXH A;  2JEV A;  2O28 A;  3PGP A;  4OC2 A;  4BD9 A;  1XOV A;  2Q4Y A;  4A31 A;  1YME A;  2FSR A;  2XEJ A;  2Z11 A;  2Q7S A;  1YVO A;  2AFU A;  3FB3 A;  4RS2 A;  3SXN A;  2PJ2 A;  1CP7 A;  5LYL A;  1FNO A;  4A38 A;  1BOB A;  2J8N A;  3L2N A;  1YQE A;  3IO1 A;  2ZXV A;  4KOR A;  3BJ8 A;  2O53 A;  4QC6 A;  1XFO A;  2QIR A;  2AFX A;  3V7Z A;  4CRY B;  3E0K A;  2F8H A;  1QSM A;  2PRQ A;  3PB8 X;  3RBU A;  2GU2 A;  2PJB A;  1UWY A;  4R9M A;  4X5K A;  2C1C A;  4P45 A;  2POK A;  3R96 A;  3KQZ A;  7CPA A;  4BIN A;  3LMS A;  2ABZ A;  2PSW A;  4KSF A;  5EC4 A;  2C27 A;  2QJ8 A;  4AVC A;  4B14 A;  2WUU A;  4U9Y A;  5LRK A;  4HKF A;  1NE9 A;  4DYO A;  2CTB A;  3K9T A;  3TX8 A;  3D7G A;  2AFO A;  4JWP A;  1XRY A;  1KUY A;  3CXP A;  2REF A;  4MFP A;  3D8P A;  2BCO A;  2PQ8 A;  1S7N A;  3WC7 A;  1VGY A;  4TNU A;  3SI0 A;  5DS0 A;  3KGQ A;  4B12 A;  4K30 A;  3DLJ A;  1AMP A;  1OZP A;  4NCZ A;  4P4I A;  4C2X A;  2R1I A;  3BXM A;  1TF8 A;  2ZW7 A;  3D4U A;  1GHE A;  4LUA A;  2PCU A;  3WR7 A;  5A27 A;  2NSM A;  2IL4 A;  4MBU A;  1CG2 A;  3A9L A;  2X7B A;  3FEC A;  4H6Z A;  5AG4 A;  4M6G A;  2HUZ A;  4KOW A;  1RTQ A;  2ARH A;  5H84 A;  4X3R A;  2I3C A;  3B3S A;  2EBJ A;  4X8I A;  4PPZ A;  2ZEM A;  5CPA A;  4OC0 A;  3W6S A;  2O4H A;  2B5G A;  3HUV A;  1S60 A;  1XEB A;  1HEE A;  4PV6 A;  3RZA A;  1V0C A;  5A28 A;  2QEC A;  2PJ3 A;  4MJ8 A;  3EXN A;  2BUE A;  4P4J A;  5KTC A;  4DJL A;  2Z3M A;  1J4J A;  3NH5 A;  3JRU A;  4R57 A;  3DR6 A;  4NGN A;  3VWE A;  2KCW A;  4TWE A;  3I1U A;  4XPK A;  5HVG A;  5LYF A;  1MJ9 A;  3S6G A;  4H6U A;  4KOU A;  4P4F A;  5KTA A;  3PP9 A;  4IHM A;  4UIB A;  5I4M A;  3LD2 A;  5F48 A;  4C7I A;  2FT0 A;  4ZYQ A;  1R3N A;  3CXQ A;  1MK4 A;  1NSL A;  4MCS A;  1EE3 P;  2DPS A;  4R7M A;  2JEW A;  2PJ8 A;  1Z5R A;  3CPX A;  3VH9 A;  4BBH A;  4LQ6 A;  1JQG A;  2FIA A;  2F5I A;  1DE4 C;  1I12 A;  1Q7L A;  1YR0 A;  1YX0 A;  2DEA A;  2CNM A;  4UBR A;  2P0W A;  4MCP A;  3V8I A;  3PB7 X;  4CAE A;  5IX3 A;  1HDU A;  3EC4 A;  3IU2 A;  4P4D A;  4YU9 A;  5JGF A;  5AG6 A;  1XBU A;  3R9G A;  3SXO A;  3VWD A;  2CF4 A;  4OAE A;  1ZG8 A;  4U9Z A;  4PSX A;  1X12 A;  1LAN A;  1XJO A;  2PR8 A;  4Q7A A;  2VZY A;  3GUX A;  4Q36 A;  4C68 A;  2FCK A;  2PR1 A;  5K8N A;  1QQ9 A;  4H2K A;  2ANP A;  2C6P A;  4FD5 A;  2GRE A;  3TFY A;  4UFW A;  4CAX A;  2JLM A;  1Q2Y A;  2JBK A;  1Z8T A;  3F5B A;  2G3A A;  1BO4 A;  2R98 A;  4A32 A;  4NGT A;  4F0Y A;  3WC6 A;  2VXK A;  2FIW A;  2GE3 A;  5IB0 A;  1P0H A;  5J1Q A;  4PK2 A;  2GLF A;  3ZJ0 A;  1M44 A;  2V8H A;  1XIX A;  2OZG A;  2PJ1 A;  2PJ7 A;  2HB6 A;  2IMO A;  2WPX A;  2K5T A;  5D29 A;  5E96 A;  2EO8 A;  3BI1 A;  1Y0R A;  4U5Y A;  2PIY A;  5F09 A;  3S6H A;  4AB7 A;  4JD6 A;  1KWM A;  2FL4 A;  3GLJ A;  4JXQ A;  1FY7 A;  4YFJ A;  1LCP A;  1TF9 A;  4QBJ A;  3D7F A;  1DTD A;  4MY0 A;  4P44 A;  3JVN A;  4EME A;  1N71 A;  4NXY A;  3H5Z A;  3NA6 A;  4YRH A;  3IIB A;  2P6G A;  1AYE A;  2CNS A;  2PVW A;  3D66 A;  3G3S A;  4KSA A;  4PQA A;  2ZPA A;  3IFE A;  2DXQ A;  1VIX A;  4FUU A;  1QMU A;  4WWV A;  4CRZ B;  4KLV A;  2V8V A;  3D2P A;  1CX8 A;  2OR4 A;  4NGQ A;  4UCP A;  3I3G A;  3I9S A;  1YLO A;  4P10 A;  1CPX A;  1VKC A;  4RUH A;  3HLP A;  1S5K A;  4KOX A;  1YVK A;  3V38 A;  4UEE A;  1S7K A;  4NFR A;  3NE7 A;  1LOK A;  2G9D A;  1X10 A;  3OWC A;  5C82 A;  2PJ6 A;  3F0A A;  5HH1 A;  2YNE A;  4MFJ A;  1M4L A;  1TKF A;  5HXD A;  2FVG A;  2CTC A;  5IV0 A;  3W91 A;  2ZEO A;  3GB0 A;  4QB9 A;  1F57 A;  1GYT A;  4EFD A;  1M4G A;  1BAV A;  1OBR A;  3IWG A;  2VL1 A;  1WK4 A;  3KAS A;  4C2Y A;  1FT7 A;  4OIW A;  2B58 A;  1YLE A;  3FBU A;  1UFH A;  2ZW4 A;  2C6C A;  2I00 A;  2J9A A;  2EK9 A;  2Z3P A;  2ZEE A;  3D7D A;  4MHD A;  5EBV A;  5LRJ A;  3C26 A;  1QSR A;  2ODF A;  4X2T A;  4OC3 A;  1NMT A;  1YSJ A;  1ZG9 A;  3FNC A;  4OID A;  4KOT A;  1AUG A;  1KZF A;  1XE4 A;  1PCA A;  2B5G B;  2PJC A;  2ZW6 A;  2BSW A;  1PU9 A;  2G0B A;  5KTD A;  3PEI A;  4A39 A;  4QVT A;  1YW4 A;  2ZW5 A;  3FJU A;  3FXT A;  3QB8 A;  2EWB A;  4LX9 A;  4MCQ A;  4HPS A;  2R8V A;  5D8N A;  4OLL A;  1YW6 A;  4MCR A;  4MXU A;  4ZY1 A;  5K8M A;  3IGR A;  3EY5 A;  4II9 A;  1IID A;  2FS5 A;  4IF5 A;  2B4D B;  2V8D A;  4OKO A;  4UWJ A;  4A30 A;  3B8G A;  4JXR A;  1VHO A;  3SJE A;  5JPH A;  5J8F A;  2GAN A;  2B4B A;  4ONU A;  3KHX A;  4HNY B;  3FYN A;  1ARL A;  1WWZ A;  2XEF A;  2QML A;  3BLN A;  3B3W A;  2REE A;  3BJ7 A;  4YGO A;  3NH8 A;  3DSB A;  1YRE A;  4MFQ A;  1TIQ A;  5LRG A;  2AE6 A;  2Z3N A;  4RI1 A;  1KUV A;  3RO0 A;  2PDO A;  2I79 A;  2B4D A;  1CPS A;  2B3U A;  1PYT B;  4A2Z A;  4MY3 A;  4CGN A;  4KVO E;  4HNX B;  2NMT A;  3KI9 A;  2CIJ A;  4OAD A;  3SJX A;  5DWN A;  3UY5 A;  3B3V A;  3QAH A;  5C88 A;  1Q2C A;  3F8K A;  5DWM A;  4E0A A;  1S7F A;  3KR4 A;  3D3S A;  4ZBG A;  2VQY A;  4CGL A;  3ISX A;  4K3N A;  3W6X A;  4NJQ A; 
#chains in the Genus database with same CATH homology
 1IB1 E;  2PRB A;  4CS0 B;  4UFX A;  2CXA A;  1QSO A;  3IU1 A;  4BMH A;  3FIX A;  2Q4V A;  5I0C A;  2Z3L A;  3H4Q A;  5G22 A;  1KUX A;  2BEI A;  4M85 A;  1RO5 A;  5AG5 A;  1QSN A;  2ATR A;  2OZH A;  4CGO A;  1Y9W A;  4KVM E;  4ZGY B;  4EVY A;  4JJX A;  4CGM A;  3KKW A;  4MFZ A;  5BWA B;  4E8O A;  4R87 A;  2Q04 A;  1P4N A;  2VEZ A;  4XPD B;  3K9U A;  1YK3 A;  4AVB A;  4E2A A;  2JDD A;  2J8M A;  1CM0 A;  4KLW A;  5FVJ A;  4CYP A;  4ORF A;  2OU2 A;  2WSA A;  5JQ4 A;  4CAV A;  3LOD A;  2CY2 A;  4J3G A;  4M3S A;  4KOY A;  2DPT A;  4H89 A;  3S6F A;  3TOB A;  4NEX A;  1M1D A;  4F6A A;  4XNH B;  4B10 A;  3T9Y A;  4FD7 A;  2YNC C;  4KUB A;  5AG7 A;  2HV2 A;  2VI7 A;  4C7H A;  3DR8 A;  3R95 A;  5HMN A;  2Z3O A;  3TO6 A;  4UCN A;  4UWI A;  1M4I A;  1B87 A;  3EFA A;  3R9E A;  1SQH A;  2A4N A;  4UFV A;  2P6F A;  4MFL A;  1I1D A;  5G20 A;  4KUA A;  4DNC A;  2Z0Z A;  1Q2D A;  1Y9K A;  4CAF A;  4KVX A;  5F46 A;  4GS4 A;  4QUS A;  1LRZ A;  1Z4R A;  3PZJ A;  1ZO0 A;  4A95 A;  3FRM A;  1I21 A;  1YGH A;  2VZZ A;  3CXS A;  4CYQ A;  2Y0M A;  4AG9 A;  4JLY A;  3R9F A;  1L0C A;  1Y7R A;  5F47 A;  1IYK A;  2Z10 A;  4L8A A;  5F49 A;  4F0X A;  4UCM A;  4NF1 A;  1S7L A;  3TT2 A;  3TOA A;  3G8W A;  2G3T A;  2YNC A;  5H86 A;  4XPD C;  1M4D A;  4KZT A;  3SHP A;  1XF8 A;  2CNT A;  4Y49 B;  2RC4 A;  3TO7 A;  2H5M A;  3MGD A;  1IIC A;  1Z4E A;  4B11 A;  3P2F A;  5GCN A;  1MJA A;  1XMT A;  3TE4 A;  4NSQ A;  3N7Z A;  4KS9 A;  5G21 A;  4KOV A;  2AJ6 A;  4PSW A;  2GIV A;  2YGW A;  1VHS A;  4B5P B;  3DNS A;  2Q44 A;  2R7H A;  1RXT A;  3GKR A;  4CAW A;  1R57 A;  1QST A;  2Q0Y A;  3GYA A;  3RYO A;  1MJB A;  2D4P A;  4B5P A;  4MFK A;  5CNP A;  2EVN A;  4AVA A;  3DDD A;  5AGE A;  4XNH C;  2D4O A;  4FD6 A;  4Q38 A;  2VBQ A;  1Z9U A;  2JDC A;  1U6M A;  4CGP A;  2J8R A;  1PUA A;  2Z3K A;  4A33 A;  2OZU A;  4B13 A;  2EUI A;  5G1Z A;  3TCV A;  4I49 A;  4CYO A;  2WPW A;  2FXF A;  1ON0 A;  3P2H A;  4L89 A;  4IUS A;  2FE7 A;  1B6B A;  1S3Z A;  3GY9 A;  3JUW A;  3JTK A;  4UA3 A;  2OB0 A;  3T90 A;  4R3L A;  4XPL A;  3TTH A;  2OH1 A;  4HNW B;  2B3V A;  3ZZI A;  4FD4 A;  4C2Z A;  2PC1 A;  1IYL A;  5J8C A;  2HQY A;  2Q7B A;  1K4J A;  3R1K A;  3D2M A;  4Y49 C;  3EO4 A;  3S6K A;  4KOS A;  5ISV A;  4MI4 A;  1CJW A;  2YND A;  4B5O A;  3IWE A;  3TO9 A;  4CYN A;  2P6E A;  4R3K A;  4AG7 A;  4PK3 A;  2BL1 A;  3PGP A;  2JEV A;  2O28 A;  4A31 A;  2Q4Y A;  2Z11 A;  2FSR A;  1YVO A;  3FB3 A;  4RS2 A;  3SXN A;  1BOB A;  2J8N A;  4KOR A;  2ZXV A;  3BJ8 A;  4QC6 A;  2QIR A;  4CRY B;  3E0K A;  1QSM A;  4R9M A;  4X5K A;  3R96 A;  2PSW A;  4KSF A;  5EC4 A;  2C27 A;  4AVC A;  4B14 A;  2WUU A;  4U9Y A;  4HKF A;  1NE9 A;  4JWP A;  1KUY A;  3CXP A;  2REF A;  4MFP A;  3D8P A;  2PQ8 A;  1S7N A;  4B12 A;  4K30 A;  1OZP A;  4NCZ A;  4C2X A;  2R1I A;  2ZW7 A;  1GHE A;  4LUA A;  3WR7 A;  5A27 A;  2IL4 A;  4MBU A;  3A9L A;  2X7B A;  4H6Z A;  5AG4 A;  2HUZ A;  4KOW A;  2ARH A;  5H84 A;  3W6S A;  2B5G A;  1S60 A;  1XEB A;  4PV6 A;  1V0C A;  5A28 A;  2QEC A;  4MJ8 A;  3EXN A;  2BUE A;  5KTC A;  2Z3M A;  1J4J A;  4R57 A;  3DR6 A;  3VWE A;  2KCW A;  4XPK A;  1MJ9 A;  3S6G A;  4H6U A;  4KOU A;  5KTA A;  3PP9 A;  3LD2 A;  5F48 A;  4C7I A;  2FT0 A;  3CXQ A;  1MK4 A;  1NSL A;  2DPS A;  4BBH A;  2F5I A;  1I12 A;  2FIA A;  1YR0 A;  1YX0 A;  2CNM A;  4UBR A;  2P0W A;  3V8I A;  4CAE A;  5IX3 A;  3EC4 A;  3IU2 A;  5AG6 A;  3R9G A;  3SXO A;  3VWD A;  4OAE A;  4U9Z A;  4PSX A;  2PR8 A;  2VZY A;  4Q36 A;  4C68 A;  2FCK A;  2PR1 A;  4FD5 A;  3TFY A;  4UFW A;  4CAX A;  2JLM A;  1Q2Y A;  3F5B A;  2G3A A;  1BO4 A;  2R98 A;  4A32 A;  4F0Y A;  2VXK A;  2FIW A;  2GE3 A;  5IB0 A;  1P0H A;  4PK2 A;  3ZJ0 A;  1M44 A;  1XIX A;  2OZG A;  2WPX A;  2K5T A;  5E96 A;  4U5Y A;  3S6H A;  4AB7 A;  4JD6 A;  4JXQ A;  2FL4 A;  1FY7 A;  4YFJ A;  4QBJ A;  4MY0 A;  3JVN A;  1N71 A;  4NXY A;  3H5Z A;  4YRH A;  2P6G A;  2CNS A;  3G3S A;  4KSA A;  2ZPA A;  2DXQ A;  4CRZ B;  4KLV A;  3D2P A;  4UCP A;  3I3G A;  3I9S A;  1VKC A;  1S5K A;  4KOX A;  1YVK A;  1S7K A;  3NE7 A;  3OWC A;  5C82 A;  3F0A A;  5HH1 A;  2YNE A;  4MFJ A;  5IV0 A;  3W91 A;  4QB9 A;  1M4G A;  3IWG A;  4C2Y A;  1WK4 A;  2B58 A;  1YLE A;  3FBU A;  1UFH A;  2ZW4 A;  2I00 A;  5EBV A;  2Z3P A;  4MHD A;  3C26 A;  1QSR A;  1NMT A;  3FNC A;  4KOT A;  1KZF A;  1XE4 A;  2B5G B;  2ZW6 A;  2BSW A;  1PU9 A;  2G0B A;  5KTD A;  4QVT A;  2ZW5 A;  3FXT A;  3QB8 A;  4LX9 A;  2R8V A;  4OLL A;  3IGR A;  3EY5 A;  4II9 A;  1IID A;  2FS5 A;  4IF5 A;  2B4D B;  4UWJ A;  4A30 A;  3B8G A;  4JXR A;  5JPH A;  5J8F A;  2GAN A;  2B4B A;  4ONU A;  4HNY B;  3FYN A;  1WWZ A;  2QML A;  3BLN A;  2REE A;  3BJ7 A;  4YGO A;  3DSB A;  1YRE A;  4MFQ A;  1TIQ A;  2AE6 A;  2Z3N A;  4RI1 A;  1KUV A;  2PDO A;  2I79 A;  2B4D A;  2B3U A;  4A2Z A;  4MY3 A;  4CGN A;  4KVO E;  4HNX B;  2NMT A;  4OAD A;  3UY5 A;  5DWN A;  3QAH A;  5C88 A;  1Q2C A;  3F8K A;  5DWM A;  4E0A A;  1S7F A;  3D3S A;  4ZBG A;  2VQY A;  4CGL A;  3W6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...