2B3WA

Nmr structure of the e.coli protein ybia, northeast structural genomics target et24.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
168
structure length
168
Chain Sequence
MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ybiA
publication title NMR structure of the E.coli protein YbiA, Northeast Structural Genomics target ET24.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 48
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08719 DUF1768 Domain of unknown function (DUF1768)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.40 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2b3wA00
2B3WA
chains in the Genus database with same CATH superfamily
3E7QA 3AQSA 2QIBA 2ZCMA 4IRVA 4D5FA 4WIBA 2R7RA 3G56A 4V2FA 2XGCA 3SWHA 3QKXA 3LSJA 2XPWA 5F0CA 2Q24A 3CRJA 5D1RA 3BTLA 4JNNA 2R7WA 1BJZA 1RPWA 2O7OA 5IOYA 5F0HA 4AUXA 4ME9A 2PFVA 1U9OA 5K7FA 2GFNA 5F1JA 5F27A 2R7SA 5K7HA 2V57A 4HKUA 2NS7A 1JUMA 3IH4A 4V2GA 4JKZA 3BQZA 4M3BA 3ZQFA 4M3DA 1JUSA 2HXOA 5AQCA 4MXMA 5C4YA 3HTIA 2OERA 3VVZA 2FQ4A 3IH2A 5HSZA 4GFLA 3VW0A 4W1UA 3HIMA 3NNRA 4B1RA 3BR5A 2VPRA 2XGEA 3GEUA 4AF5A 5H9TA 3T6NA 3NRGA 4XK4A 4I76A 4JYKA 4ICHA 1SGMA 5DAJA 3G1MA 2GBYA 5GP9A 3BR1A 3ZQHA 4U9NA 5K7ZA 2Y2ZA 4D5CA 2HYJA 5CW8A 3G1LA 5K58A 1T33A 3PASA 4DW6A 4W97A 2XPUA 3BCGA 2TCTA 5J1UA 3EGQA 2IEKA 5F08A 5CXGA 4D7MA 2G7SA 3CCYA 3FRQA 1ZK8A 2G0EA 5D18A 2FJI1 4ACIA 3S5RA 4M3EA 2QOPA 3Q0UA 3FK6A 3BNIA 3O8HA 1UI5A 2WGBA 2ZCNA 3VW2A 2ZOZA 2XB5A 3F0CA 3Q0VA 4UDSA 3LSPA 1UI6A 3K8PC 2HYTA 3G1OA 4PXIA 3RH2A 2FX0A 2GENA 3Q3SA 1Z77A 3C07A 2WUIA 3HE0A 5EFYA 2D6YA 3HTAA 1U9NA 5FGLA 4L62A 3IH3A 3PPBA 1Z0XA 3COLA 2A2FX 2UXOA 4C2MA 3B6CA 3NXCA 2HQ5A 2NP3A 4AC0A 3VOXA 3VW1A 3WHCA 3LOCA 2TRTA 3FK7A 3SDGA 2YVXA 2Y31A 3ANGA 2EH3A 2XGDA 3BTJA 3BTCA 3F1BA 1ZKGA 3VTIA 2R7XA 2I10A 2B1EA 3VVYA 3LSRA 3KZ9A 3LWJA 2XPVA 4GCKA 5HBUA 3ON4A 3LHQA 2G3BA 1VI0A 2O7TA 3KKDA 3SFIA 4MK6A 2ZB9A 4JL3A 3AQTA 2YVHA 2REKA 3BR2A 2IBDA 3BR0A 3FHNA 3NPIA 3BJBA 1QVUA 3RD3A 3CJDA 5FKMA 3CDLA 3V6GA 2ID3A 2NS8A 2B3WA 2YVEA 5J3LA 3KNWA 3PM1A 2NP5A 3O60A 2UXUA 2QCOA 2W53A 1ORKA 3QBMA 2QKOA 1JTXA 3TP3A 2IU5A 3DU5A 2R7TA 3ZQIA 2Y30A 3BTIA 5J1RA 4GCLA 3VP5A 1QPIA 2ZY9A 3DCFA 2IAIA 3JSJA 3VVXA 2PZ9A 3MNLA 3QPSA 5FKKA 3ANPA 3VIBA 2R7QA 4NELA 3VOKA 5CQGA 3NI7A 4B3AA 4NN1A 5IOZA 2OPTA 2JK3A 4GFKA 2X6OA 2DG7A 2DTZA 4X1EA 4ABZA 3BR3A 4DVYP 2QWTA 3WHBA 4GCTA 3HGGA 2F07A 4I6ZA 2RAEA 3DU6A 1QVTA 5EYRA 3V78A 1JT6A 2R7OA 3HTHA 3HTJA 2NX4A 2XDNA 5GPAA 5EZHA 2FD5A 1T56A 4AC6A 5FKOA 5FKNA 2FJ1A 5F0FA 2HKUA 2RHAA 5FHPA 5IPAA 1RKWA 3B6AA 2QTQA 2UXPA 3O8GA 4YZEA 5HAWA 2HXIA 3NS4A 3BRUA 3IUVA 3BR6A 3DEWA 4OD4A 3VUQA 2G7LA 3MVPA 3BHQA 2R7VA 5GPCA 2GUHA 3ZQLA 3TP0A 4OD5A 3FIWA 2UXHA 2FBQA 3B81A 3HGYA 3P9TA 5D19A 2JJ7A 1JTYA 2VKVA 1RKTA 4MO7A 3C2BA 4M3FA 5EZGA 5FKLA 3LJLA 4G12A 2ZOYA 3CWRA 3ON2A 5CXIA 3KKCA 3QPLA 2RASA 3KYLA 2OI8A 3VPRA 3EUPA 2DG8A 2G7GA 2ZCXA 3DPJA 2WV1A 3QQAA 3Q0WA 4M3GA 2VKEA 5F04A 2X9DA 3GZIA 4KWAA 4U9LA 5IP6A 2UXIA 1A6IA 2XRLA 5FMPA 2R7UA 4CGRA 3G7RA 1JUPA 2ID6A 3BT9A 2OF7A 2PBXA 1JT0A 3BQYA 5J1YA 3ZQGA 4D7NA
chains in the Genus database with same CATH topology
3DU5A 2PFVA 4OD4A 2R7TA 3KYLA 4IRVA 2R7VA 2A2FX 2R7RA 4C2MA 4OD5A 3K8PC 2FJI1 3SWHA 4DVYP 2B3WA 2R7SA 2R7UA 3VTIA 2R7QA 2R7XA 2B1EA 3DU6A 5CQGA 2R7WA 3FHNA 3NS4A 2R7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3W A; 
#chains in the Genus database with same CATH topology
 3E7Q A;  3AQS A;  2QIB A;  2ZCM A;  4IRV A;  4D5F A;  4WIB A;  2R7R A;  3G56 A;  4V2F A;  2XGC A;  3SWH A;  3QKX A;  3LSJ A;  2XPW A;  5F0C A;  2Q24 A;  3CRJ A;  5D1R A;  3BTL A;  4JNN A;  2R7W A;  1BJZ A;  1RPW A;  2O7O A;  5IOY A;  5F0H A;  4AUX A;  4ME9 A;  2PFV A;  1U9O A;  5K7F A;  2GFN A;  5F1J A;  5F27 A;  2R7S A;  5K7H A;  2V57 A;  4HKU A;  2NS7 A;  1JUM A;  3IH4 A;  4V2G A;  4JKZ A;  3BQZ A;  4M3B A;  3ZQF A;  4M3D A;  1JUS A;  2HXO A;  5AQC A;  4MXM A;  5C4Y A;  3HTI A;  2OER A;  3VVZ A;  2FQ4 A;  3IH2 A;  5HSZ A;  4GFL A;  3VW0 A;  4W1U A;  3HIM A;  3NNR A;  4B1R A;  3BR5 A;  2VPR A;  2XGE A;  3GEU A;  4AF5 A;  5H9T A;  3T6N A;  3NRG A;  4XK4 A;  4I76 A;  4JYK A;  4ICH A;  1SGM A;  5DAJ A;  3G1M A;  2GBY A;  5GP9 A;  3BR1 A;  3ZQH A;  4U9N A;  5K7Z A;  2Y2Z A;  4D5C A;  2HYJ A;  5CW8 A;  3G1L A;  5K58 A;  1T33 A;  3PAS A;  4DW6 A;  4W97 A;  2XPU A;  3BCG A;  2TCT A;  5J1U A;  3EGQ A;  2IEK A;  5F08 A;  5CXG A;  4D7M A;  2G7S A;  3CCY A;  3FRQ A;  1ZK8 A;  2G0E A;  5D18 A;  2FJI 1;  4ACI A;  3S5R A;  4M3E A;  2QOP A;  3Q0U A;  3FK6 A;  3BNI A;  3O8H A;  1UI5 A;  2WGB A;  2ZCN A;  3VW2 A;  2ZOZ A;  2XB5 A;  3F0C A;  3Q0V A;  4UDS A;  3LSP A;  1UI6 A;  3K8P C;  2HYT A;  3G1O A;  4PXI A;  3RH2 A;  2FX0 A;  2GEN A;  3Q3S A;  1Z77 A;  3C07 A;  2WUI A;  3HE0 A;  5EFY A;  2D6Y A;  3HTA A;  1U9N A;  5FGL A;  4L62 A;  3IH3 A;  3PPB A;  1Z0X A;  3COL A;  2A2F X;  2UXO A;  4C2M A;  3B6C A;  3NXC A;  2HQ5 A;  2NP3 A;  4AC0 A;  3VOX A;  3VW1 A;  3WHC A;  3LOC A;  2TRT A;  3FK7 A;  3SDG A;  2YVX A;  2Y31 A;  3ANG A;  2EH3 A;  2XGD A;  3BTJ A;  3BTC A;  3F1B A;  1ZKG A;  3VTI A;  2R7X A;  2I10 A;  2B1E A;  3VVY A;  3LSR A;  3KZ9 A;  3LWJ A;  2XPV A;  4GCK A;  5HBU A;  3ON4 A;  3LHQ A;  2G3B A;  1VI0 A;  2O7T A;  3KKD A;  3SFI A;  4MK6 A;  2ZB9 A;  4JL3 A;  3AQT A;  2YVH A;  2REK A;  3BR2 A;  2IBD A;  3BR0 A;  3FHN A;  3NPI A;  3BJB A;  1QVU A;  3RD3 A;  3CJD A;  5FKM A;  3CDL A;  3V6G A;  2ID3 A;  2NS8 A;  2B3W A;  2YVE A;  5J3L A;  3KNW A;  3PM1 A;  2NP5 A;  3O60 A;  2UXU A;  2QCO A;  2W53 A;  1ORK A;  3QBM A;  2QKO A;  1JTX A;  3TP3 A;  2IU5 A;  3DU5 A;  2R7T A;  3ZQI A;  2Y30 A;  3BTI A;  5J1R A;  4GCL A;  3VP5 A;  1QPI A;  2ZY9 A;  3DCF A;  2IAI A;  3JSJ A;  3VVX A;  2PZ9 A;  3MNL A;  3QPS A;  5FKK A;  3ANP A;  3VIB A;  2R7Q A;  4NEL A;  3VOK A;  5CQG A;  3NI7 A;  4B3A A;  4NN1 A;  5IOZ A;  2OPT A;  2JK3 A;  4GFK A;  2X6O A;  2DG7 A;  2DTZ A;  4X1E A;  4ABZ A;  3BR3 A;  4DVY P;  2QWT A;  3WHB A;  4GCT A;  3HGG A;  2F07 A;  4I6Z A;  2RAE A;  3DU6 A;  1QVT A;  5EYR A;  3V78 A;  1JT6 A;  2R7O A;  3HTH A;  3HTJ A;  2NX4 A;  2XDN A;  5GPA A;  5EZH A;  2FD5 A;  1T56 A;  4AC6 A;  5FKO A;  5FKN A;  2FJ1 A;  5F0F A;  2HKU A;  2RHA A;  5FHP A;  5IPA A;  1RKW A;  3B6A A;  2QTQ A;  2UXP A;  3O8G A;  4YZE A;  5HAW A;  2HXI A;  3NS4 A;  3BRU A;  3IUV A;  3BR6 A;  3DEW A;  4OD4 A;  3VUQ A;  2G7L A;  3MVP A;  3BHQ A;  2R7V A;  5GPC A;  2GUH A;  3ZQL A;  3TP0 A;  4OD5 A;  3FIW A;  2UXH A;  2FBQ A;  3B81 A;  3HGY A;  3P9T A;  5D19 A;  2JJ7 A;  1JTY A;  2VKV A;  1RKT A;  4MO7 A;  3C2B A;  4M3F A;  5EZG A;  5FKL A;  3LJL A;  4G12 A;  2ZOY A;  3CWR A;  3ON2 A;  5CXI A;  3KKC A;  3QPL A;  2RAS A;  3KYL A;  2OI8 A;  3VPR A;  3EUP A;  2DG8 A;  2G7G A;  2ZCX A;  3DPJ A;  2WV1 A;  3QQA A;  3Q0W A;  4M3G A;  2VKE A;  5F04 A;  2X9D A;  3GZI A;  4KWA A;  4U9L A;  5IP6 A;  2UXI A;  1A6I A;  2XRL A;  5FMP A;  2R7U A;  4CGR A;  3G7R A;  1JUP A;  2ID6 A;  3BT9 A;  2OF7 A;  2PBX A;  1JT0 A;  3BQY A;  5J1Y A;  3ZQG A;  4D7N A; 
#chains in the Genus database with same CATH homology
 3DU5 A;  2PFV A;  4OD4 A;  2R7T A;  3KYL A;  4IRV A;  2R7V A;  2A2F X;  2R7R A;  4C2M A;  4OD5 A;  3K8P C;  2FJI 1;  3SWH A;  4DVY P;  2B3W A;  2R7S A;  2R7U A;  3VTI A;  2R7Q A;  2R7X A;  2B1E A;  3DU6 A;  5CQG A;  2R7W A;  3FHN A;  3NS4 A;  2R7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...