2B3WA

Nmr structure of the e.coli protein ybia, northeast structural genomics target et24.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
168
structure length
168
Chain Sequence
MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the E.coli protein YbiA, Northeast Structural Genomics target ET24.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ybiA
total genus 48
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08719 DUF1768 Domain of unknown function (DUF1768)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.40 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2b3wA00
2B3WA
chains in the Genus database with same CATH superfamily
2DTZA 3LOCA 4YZEA 4AF5A 2VKVA 3SDGA 3RD3A 5CXGA 2WV1A 2XPUA 3VW1A 2R7TA 2IEKA 2QKOA 2V57A 2W53A 1JT6A 2QTQA 4X1EA 1UI6A 5IPAA 2R7OA 5F08A 3BTIA 5CQGA 1ORKA 2UXOA 3KKCA 5HAWA 3T6NA 2PZ9A 3HTAA 3MNLA 5K7FA 3VVZA 3V6GA 2HYTA 4AC6A 3DCFA 3VOXA 2FJI1 5CXIA 2UXIA 2HXOA 3CJDA 2A2FX 3BRUA 3BTCA 3HE0A 4M3BA 3RH2A 1JUSA 2JJ7A 2JK3A 1JUMA 1BJZA 2HQ5A 5J1YA 5D18A 2OERA 3NS4A 3WHBA 3NNRA 4V2FA 2R7UA 1ZK8A 3PPBA 3F0CA 3QKXA 4M3GA 3DEWA 4NELA 2RASA 4D5FA 3VW2A 4KWAA 2XPVA 4JYKA 2NP5A 2DG7A 3C07A 2FX0A 3BR3A 2XGCA 5FKMA 2NS7A 5F0HA 3MVPA 2R7SA 3B81A 3IH4A 3G7RA 3SFIA 2IAIA 2YVXA 2ZY9A 2ID3A 3KNWA 2TCTA 3BNIA 4HKUA 5FKKA 2YVHA 4MK6A 3Q0VA 2X9DA 4XK4A 3ON2A 3O8GA 3BTJA 2R7RA 2UXUA 2GBYA 1SGMA 2HKUA 4NN1A 2O7TA 3FHNA 3QPLA 4M3DA 3JSJA 3BR0A 2Y31A 2EH3A 2ZB9A 5K7HA 5F0CA 3LSJA 3HGGA 4M3FA 5EZGA 5D19A 4DW6A 4B3AA 4GFLA 2QWTA 2F07A 5IP6A 3HTJA 2GFNA 3FK6A 2IU5A 1RPWA 2G7LA 3ZQIA 2XGEA 1UI5A 3VIBA 3HTHA 3IH2A 3VVXA 3BR1A 3PM1A 2G7GA 2WUIA 3VUQA 2OPTA 3KYLA 5H9TA 2FD5A 2G0EA 1QVTA 4IRVA 3TP0A 2R7VA 4WIBA 3FIWA 4JNNA 4D7MA 2R7QA 2O7OA 3B6CA 2X6OA 5IOZA 5J1UA 1RKWA 3DU6A 5FHPA 5HBUA 1ZKGA 2REKA 2Y30A 3BJBA 3IUVA 4ICHA 3LSRA 1RKTA 4GCTA 3GEUA 2WGBA 3LWJA 2ID6A 4PXIA 1A6IA 4ABZA 3IH3A 3SWHA 3VTIA 4MO7A 2Q24A 1VI0A 3ZQGA 4B1RA 5IOYA 4OD4A 2OI8A 3NI7A 2XPWA 2I10A 3WHCA 2RAEA 2PBXA 2QIBA 1JTXA 3KZ9A 5FGLA 5F04A 3G1OA 3Q0UA 3LJLA 2ZOZA 5GPCA 1QPIA 3LSPA 3P9TA 2UXPA 1U9NA 1JT0A 3CCYA 2G7SA 4DVYP 1T33A 5F0FA 5K7ZA 2XB5A 3NPIA 2VPRA 1QVUA 1T56A 2QCOA 1Z0XA 2PFVA 4C2MA 3DU5A 2ZCNA 5AQCA 3GZIA 2QOPA 4D7NA 2ZOYA 5FKOA 3BR2A 5HSZA 3QBMA 5FKNA 3NRGA 3BTLA 3QQAA 3KKDA 4GFKA 3Q3SA 1JUPA 3NXCA 3AQTA 3HGYA 4JL3A 3VW0A 3F1BA 4AUXA 3ON4A 3EUPA 5C4YA 2FBQA 2B1EA 3CWRA 3QPSA 5FMPA 4L62A 3VVYA 5GPAA 3CRJA 5EZHA 5J3LA 3O60A 3BQYA 3VP5A 3G1LA 4I76A 5F27A 4GCLA 2HYJA 2IBDA 4G12A 4OD5A 3O8HA 4V2GA 2R7WA 3BQZA 3ANPA 3HIMA 2D6YA 4U9LA 4UDSA 3ANGA 3FRQA 5DAJA 5CW8A 3BT9A 2FQ4A 4CGRA 3TP3A 3HTIA 3G56A 2NX4A 2GENA 3FK7A 2R7XA 2XDNA 4AC0A 3BR6A 4D5CA 2RHAA 2XGDA 3COLA 2DG8A 3BHQA 2TRTA 3K8PC 5J1RA 4M3EA 3EGQA 4I6ZA 3CDLA 2UXHA 3VPRA 5F1JA 4ME9A 3ZQLA 2ZCXA 4GCKA 4JKZA 2Y2ZA 5GP9A 5K58A 2HXIA 3DPJA 2ZCMA 2FJ1A 5FKLA 3S5RA 3VOKA 2GUHA 3E7QA 1U9OA 3C2BA 2XRLA 2VKEA 3BCGA 3BR5A 2G3BA 3PASA 1Z77A 2OF7A 5EYRA 3ZQHA 5EFYA 3V78A 4ACIA 3AQSA 4W97A 3ZQFA 2YVEA 1JTYA 2B3WA 2NP3A 4W1UA 3Q0WA 4MXMA 5D1RA 3LHQA 3G1MA 4U9NA 2NS8A 3B6AA
chains in the Genus database with same CATH topology
3VTIA 4C2MA 3DU5A 3DU6A 3NS4A 2B1EA 3KYLA 4OD4A 2B3WA 2FJI1 2R7RA 4IRVA 2R7TA 4DVYP 2R7VA 3FHNA 2R7SA 3K8PC 2A2FX 4OD5A 2R7QA 2R7OA 2R7WA 5CQGA 2PFVA 2R7XA 3SWHA 2R7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3W A; 
#chains in the Genus database with same CATH topology
 2DTZ A;  3LOC A;  4YZE A;  4AF5 A;  2VKV A;  3SDG A;  3RD3 A;  5CXG A;  2WV1 A;  2XPU A;  3VW1 A;  2R7T A;  2IEK A;  2QKO A;  2V57 A;  2W53 A;  1JT6 A;  2QTQ A;  4X1E A;  1UI6 A;  5IPA A;  2R7O A;  5F08 A;  3BTI A;  5CQG A;  1ORK A;  2UXO A;  3KKC A;  5HAW A;  3T6N A;  2PZ9 A;  3HTA A;  3MNL A;  5K7F A;  3VVZ A;  3V6G A;  2HYT A;  4AC6 A;  3DCF A;  3VOX A;  2FJI 1;  5CXI A;  2UXI A;  2HXO A;  3CJD A;  2A2F X;  3BRU A;  3BTC A;  3HE0 A;  4M3B A;  3RH2 A;  1JUS A;  2JJ7 A;  2JK3 A;  1JUM A;  1BJZ A;  2HQ5 A;  5J1Y A;  5D18 A;  2OER A;  3NS4 A;  3WHB A;  3NNR A;  4V2F A;  2R7U A;  1ZK8 A;  3PPB A;  3F0C A;  3QKX A;  4M3G A;  3DEW A;  4NEL A;  2RAS A;  4D5F A;  3VW2 A;  4KWA A;  2XPV A;  4JYK A;  2NP5 A;  2DG7 A;  3C07 A;  2FX0 A;  3BR3 A;  2XGC A;  5FKM A;  2NS7 A;  5F0H A;  3MVP A;  2R7S A;  3B81 A;  3IH4 A;  3G7R A;  3SFI A;  2IAI A;  2YVX A;  2ZY9 A;  2ID3 A;  3KNW A;  2TCT A;  3BNI A;  4HKU A;  5FKK A;  2YVH A;  4MK6 A;  3Q0V A;  2X9D A;  4XK4 A;  3ON2 A;  3O8G A;  3BTJ A;  2R7R A;  2UXU A;  2GBY A;  1SGM A;  2HKU A;  4NN1 A;  2O7T A;  3FHN A;  3QPL A;  4M3D A;  3JSJ A;  3BR0 A;  2Y31 A;  2EH3 A;  2ZB9 A;  5K7H A;  5F0C A;  3LSJ A;  3HGG A;  4M3F A;  5EZG A;  5D19 A;  4DW6 A;  4B3A A;  4GFL A;  2QWT A;  2F07 A;  5IP6 A;  3HTJ A;  2GFN A;  3FK6 A;  2IU5 A;  1RPW A;  2G7L A;  3ZQI A;  2XGE A;  1UI5 A;  3VIB A;  3HTH A;  3IH2 A;  3VVX A;  3BR1 A;  3PM1 A;  2G7G A;  2WUI A;  3VUQ A;  2OPT A;  3KYL A;  5H9T A;  2FD5 A;  2G0E A;  1QVT A;  4IRV A;  3TP0 A;  2R7V A;  4WIB A;  3FIW A;  4JNN A;  4D7M A;  2R7Q A;  2O7O A;  3B6C A;  2X6O A;  5IOZ A;  5J1U A;  1RKW A;  3DU6 A;  5FHP A;  5HBU A;  1ZKG A;  2REK A;  2Y30 A;  3BJB A;  3IUV A;  4ICH A;  3LSR A;  1RKT A;  4GCT A;  3GEU A;  2WGB A;  3LWJ A;  2ID6 A;  4PXI A;  1A6I A;  4ABZ A;  3IH3 A;  3SWH A;  3VTI A;  4MO7 A;  2Q24 A;  1VI0 A;  3ZQG A;  4B1R A;  5IOY A;  4OD4 A;  2OI8 A;  3NI7 A;  2XPW A;  2I10 A;  3WHC A;  2RAE A;  2PBX A;  2QIB A;  1JTX A;  3KZ9 A;  5FGL A;  5F04 A;  3G1O A;  3Q0U A;  3LJL A;  2ZOZ A;  5GPC A;  1QPI A;  3LSP A;  3P9T A;  2UXP A;  1U9N A;  1JT0 A;  3CCY A;  2G7S A;  4DVY P;  1T33 A;  5F0F A;  5K7Z A;  2XB5 A;  3NPI A;  2VPR A;  1QVU A;  1T56 A;  2QCO A;  1Z0X A;  2PFV A;  4C2M A;  3DU5 A;  2ZCN A;  5AQC A;  3GZI A;  2QOP A;  4D7N A;  2ZOY A;  5FKO A;  3BR2 A;  5HSZ A;  3QBM A;  5FKN A;  3NRG A;  3BTL A;  3QQA A;  3KKD A;  4GFK A;  3Q3S A;  1JUP A;  3NXC A;  3AQT A;  3HGY A;  4JL3 A;  3VW0 A;  3F1B A;  4AUX A;  3ON4 A;  3EUP A;  5C4Y A;  2FBQ A;  2B1E A;  3CWR A;  3QPS A;  5FMP A;  4L62 A;  3VVY A;  5GPA A;  3CRJ A;  5EZH A;  5J3L A;  3O60 A;  3BQY A;  3VP5 A;  3G1L A;  4I76 A;  5F27 A;  4GCL A;  2HYJ A;  2IBD A;  4G12 A;  4OD5 A;  3O8H A;  4V2G A;  2R7W A;  3BQZ A;  3ANP A;  3HIM A;  2D6Y A;  4U9L A;  4UDS A;  3ANG A;  3FRQ A;  5DAJ A;  5CW8 A;  3BT9 A;  2FQ4 A;  4CGR A;  3TP3 A;  3HTI A;  3G56 A;  2NX4 A;  2GEN A;  3FK7 A;  2R7X A;  2XDN A;  4AC0 A;  3BR6 A;  4D5C A;  2RHA A;  2XGD A;  3COL A;  2DG8 A;  3BHQ A;  2TRT A;  3K8P C;  5J1R A;  4M3E A;  3EGQ A;  4I6Z A;  3CDL A;  2UXH A;  3VPR A;  5F1J A;  4ME9 A;  3ZQL A;  2ZCX A;  4GCK A;  4JKZ A;  2Y2Z A;  5GP9 A;  5K58 A;  2HXI A;  3DPJ A;  2ZCM A;  2FJ1 A;  5FKL A;  3S5R A;  3VOK A;  2GUH A;  3E7Q A;  1U9O A;  3C2B A;  2XRL A;  2VKE A;  3BCG A;  3BR5 A;  2G3B A;  3PAS A;  1Z77 A;  2OF7 A;  5EYR A;  3ZQH A;  5EFY A;  3V78 A;  4ACI A;  3AQS A;  4W97 A;  3ZQF A;  2YVE A;  1JTY A;  2B3W A;  2NP3 A;  4W1U A;  3Q0W A;  4MXM A;  5D1R A;  3LHQ A;  3G1M A;  4U9N A;  2NS8 A;  3B6A A; 
#chains in the Genus database with same CATH homology
 3VTI A;  4C2M A;  3DU5 A;  3DU6 A;  3NS4 A;  2B1E A;  3KYL A;  4OD4 A;  2B3W A;  2FJI 1;  2R7R A;  4IRV A;  2R7T A;  4DVY P;  2R7V A;  3FHN A;  2R7S A;  3K8P C;  2A2F X;  4OD5 A;  2R7Q A;  2R7O A;  2R7W A;  5CQG A;  2PFV A;  2R7X A;  3SWH A;  2R7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...