2B3WA

Nmr structure of the e.coli protein ybia, northeast structural genomics target et24.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
168
structure length
168
Chain Sequence
MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ybiA
publication title NMR structure of the E.coli protein YbiA, Northeast Structural Genomics target ET24.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 48
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08719 DUF1768 Domain of unknown function (DUF1768)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.40 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2b3wA00
2B3WA
chains in the Genus database with same CATH superfamily
3BRUA 1ZK8A 5D18A 3IUVA 3B6AA 3KKCA 5D1RA 4ICHA 3QQAA 4UDSA 4GCTA 5C4YA 3VVYA 2GENA 3NS4A 2IEKA 2RASA 5CXIA 5J1YA 3G1OA 3HTIA 2GUHA 3VUQA 2R7RA 2HKUA 2DTZA 2Y31A 3ZQHA 5HAWA 5FKOA 1Z77A 3BTLA 3GZIA 4D7MA 1VI0A 2HYTA 3F1BA 3G1LA 2G7LA 2VKVA 3COLA 2QKOA 4V2GA 5CQGA 5IOZA 1JUPA 2G7GA 3NXCA 2OI8A 4JKZA 2G3BA 1RKWA 3V78A 3HTAA 2ZY9A 2HXIA 2ZOYA 3EGQA 1JUMA 3IH2A 3BTIA 3S5RA 4M3EA 3T6NA 3C2BA 1ORKA 2R7UA 3LSRA 3FRQA 3C07A 3RH2A 2Y2ZA 5GPAA 2O7TA 3O8HA 2DG7A 3FHNA 2PZ9A 3VIBA 3KKDA 5CW8A 3SDGA 1U9OA 5EZHA 2QTQA 2I10A 4OD4A 3WHCA 5K7ZA 2B1EA 3IH4A 4X1EA 4D5FA 3Q0UA 3HE0A 2DG8A 4GFKA 2R7VA 3WHBA 3BT9A 4C2MA 5FKKA 3VOKA 2G7SA 2XDNA 4GCKA 2NS7A 5FHPA 1SGMA 4AC0A 2XGDA 4W97A 5K7HA 2UXUA 3GEUA 2NS8A 1BJZA 2FJI1 5CXGA 1JTXA 3BTJA 2HXOA 2X6OA 3BR1A 4G12A 2FD5A 2RHAA 2OERA 2YVHA 3LHQA 5J1RA 5GP9A 5FGLA 2UXPA 3VW0A 4I76A 2XPVA 3BR3A 1RKTA 3VW1A 1UI5A 2G0EA 1QVUA 3KNWA 3Q0VA 3LOCA 5AQCA 2IAIA 3TP0A 5IPAA 5IOYA 1ZKGA 4B1RA 3LWJA 2OPTA 5GPCA 3LJLA 3BR5A 3NI7A 3PM1A 2Q24A 4DW6A 2TRTA 2R7WA 3FIWA 2WGBA 5DAJA 5F1JA 5HSZA 2NP5A 3AQSA 1QVTA 3G1MA 3BQYA 2XGCA 3LSJA 2HYJA 4MK6A 5F04A 3VTIA 4OD5A 1JTYA 2PBXA 2PFVA 2JJ7A 4M3GA 5J1UA 4D7NA 3E7QA 2QIBA 3FK7A 2IU5A 2X9DA 2O7OA 5HBUA 3TP3A 3G7RA 5H9TA 1UI6A 2WUIA 4DVYP 2XPWA 2WV1A 4YZEA 2B3WA 2ZCMA 3IH3A 3CWRA 3ON4A 2VKEA 3BR0A 1QPIA 3HGGA 4IRVA 3NRGA 3ANGA 3JSJA 4CGRA 3EUPA 5F0CA 5FKMA 3AQTA 4ABZA 2D6YA 2ID3A 5FMPA 2GBYA 3B81A 4M3DA 3NNRA 5D19A 3CRJA 2R7QA 3QKXA 3RD3A 2FJ1A 3QBMA 2EH3A 2ZB9A 4AUXA 2XGEA 5FKNA 2A2FX 3P9TA 5F08A 2JK3A 4KWAA 2IBDA 3ZQFA 2XRLA 4GCLA 3ZQIA 3LSPA 1JUSA 3ZQLA 4W1UA 2ZOZA 3VOXA 4AC6A 3CCYA 3F0CA 3VW2A 1T56A 3V6GA 2QWTA 3BNIA 3FK6A 1T33A 4ACIA 2XB5A 3G56A 3CDLA 1JT0A 2XPUA 2FX0A 1RPWA 2RAEA 2UXIA 3O8GA 2REKA 2OF7A 3BHQA 3HTJA 5F0FA 3VVZA 3K8PC 5K7FA 3VPRA 3BJBA 4JL3A 3DPJA 1Z0XA 4U9LA 3MNLA 3ON2A 5F27A 4XK4A 3VP5A 3DEWA 3NPIA 2ZCNA 3QPLA 3DU6A 2UXOA 2R7XA 1U9NA 2F07A 3MVPA 3SFIA 2V57A 2NX4A 4D5CA 3SWHA 3CJDA 3VVXA 4NN1A 4ME9A 5EFYA 5F0HA 5EZGA 4JNNA 3Q0WA 4B3AA 2YVEA 2HQ5A 2ZCXA 3BTCA 5FKLA 2TCTA 4PXIA 4M3BA 2R7SA 2YVXA 3Q3SA 4WIBA 4JYKA 4MO7A 3KZ9A 3ZQGA 5IP6A 3DU5A 5EYRA 2Y30A 2FBQA 3BQZA 2R7TA 4V2FA 4HKUA 3HTHA 4GFLA 5K58A 2QOPA 2GFNA 3B6CA 3KYLA 3QPSA 4AF5A 4U9NA 3DCFA 4NELA 4M3FA 3PASA 2ID6A 2NP3A 4MXMA 3O60A 1JT6A 2UXHA 2QCOA 2FQ4A 2VPRA 3BR6A 3BR2A 3ANPA 3HGYA 3PPBA 2R7OA 5J3LA 1A6IA 4L62A 4I6ZA 2W53A 3HIMA 3BCGA
chains in the Genus database with same CATH topology
2R7TA 3FHNA 2R7QA 2B3WA 3VTIA 2R7SA 2R7WA 4OD4A 3DU6A 2R7XA 4OD5A 2B1EA 3KYLA 2R7UA 2PFVA 4IRVA 2FJI1 3DU5A 2R7OA 5CQGA 3NS4A 3SWHA 2R7VA 2A2FX 3K8PC 4C2MA 4DVYP 2R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3W A; 
#chains in the Genus database with same CATH topology
 3BRU A;  1ZK8 A;  5D18 A;  3IUV A;  3B6A A;  3KKC A;  5D1R A;  4ICH A;  3QQA A;  4UDS A;  4GCT A;  5C4Y A;  3VVY A;  2GEN A;  3NS4 A;  2IEK A;  2RAS A;  5CXI A;  5J1Y A;  3G1O A;  3HTI A;  2GUH A;  3VUQ A;  2R7R A;  2HKU A;  2DTZ A;  2Y31 A;  3ZQH A;  5HAW A;  5FKO A;  1Z77 A;  3BTL A;  3GZI A;  4D7M A;  1VI0 A;  2HYT A;  3F1B A;  3G1L A;  2G7L A;  2VKV A;  3COL A;  2QKO A;  4V2G A;  5CQG A;  5IOZ A;  1JUP A;  2G7G A;  3NXC A;  2OI8 A;  4JKZ A;  2G3B A;  1RKW A;  3V78 A;  3HTA A;  2ZY9 A;  2HXI A;  2ZOY A;  3EGQ A;  1JUM A;  3IH2 A;  3BTI A;  3S5R A;  4M3E A;  3T6N A;  3C2B A;  1ORK A;  2R7U A;  3LSR A;  3FRQ A;  3C07 A;  3RH2 A;  2Y2Z A;  5GPA A;  2O7T A;  3O8H A;  2DG7 A;  3FHN A;  2PZ9 A;  3VIB A;  3KKD A;  5CW8 A;  3SDG A;  1U9O A;  5EZH A;  2QTQ A;  2I10 A;  4OD4 A;  3WHC A;  5K7Z A;  2B1E A;  3IH4 A;  4X1E A;  4D5F A;  3Q0U A;  3HE0 A;  2DG8 A;  4GFK A;  2R7V A;  3WHB A;  3BT9 A;  4C2M A;  5FKK A;  3VOK A;  2G7S A;  2XDN A;  4GCK A;  2NS7 A;  5FHP A;  1SGM A;  4AC0 A;  2XGD A;  4W97 A;  5K7H A;  2UXU A;  3GEU A;  2NS8 A;  1BJZ A;  2FJI 1;  5CXG A;  1JTX A;  3BTJ A;  2HXO A;  2X6O A;  3BR1 A;  4G12 A;  2FD5 A;  2RHA A;  2OER A;  2YVH A;  3LHQ A;  5J1R A;  5GP9 A;  5FGL A;  2UXP A;  3VW0 A;  4I76 A;  2XPV A;  3BR3 A;  1RKT A;  3VW1 A;  1UI5 A;  2G0E A;  1QVU A;  3KNW A;  3Q0V A;  3LOC A;  5AQC A;  2IAI A;  3TP0 A;  5IPA A;  5IOY A;  1ZKG A;  4B1R A;  3LWJ A;  2OPT A;  5GPC A;  3LJL A;  3BR5 A;  3NI7 A;  3PM1 A;  2Q24 A;  4DW6 A;  2TRT A;  2R7W A;  3FIW A;  2WGB A;  5DAJ A;  5F1J A;  5HSZ A;  2NP5 A;  3AQS A;  1QVT A;  3G1M A;  3BQY A;  2XGC A;  3LSJ A;  2HYJ A;  4MK6 A;  5F04 A;  3VTI A;  4OD5 A;  1JTY A;  2PBX A;  2PFV A;  2JJ7 A;  4M3G A;  5J1U A;  4D7N A;  3E7Q A;  2QIB A;  3FK7 A;  2IU5 A;  2X9D A;  2O7O A;  5HBU A;  3TP3 A;  3G7R A;  5H9T A;  1UI6 A;  2WUI A;  4DVY P;  2XPW A;  2WV1 A;  4YZE A;  2B3W A;  2ZCM A;  3IH3 A;  3CWR A;  3ON4 A;  2VKE A;  3BR0 A;  1QPI A;  3HGG A;  4IRV A;  3NRG A;  3ANG A;  3JSJ A;  4CGR A;  3EUP A;  5F0C A;  5FKM A;  3AQT A;  4ABZ A;  2D6Y A;  2ID3 A;  5FMP A;  2GBY A;  3B81 A;  4M3D A;  3NNR A;  5D19 A;  3CRJ A;  2R7Q A;  3QKX A;  3RD3 A;  2FJ1 A;  3QBM A;  2EH3 A;  2ZB9 A;  4AUX A;  2XGE A;  5FKN A;  2A2F X;  3P9T A;  5F08 A;  2JK3 A;  4KWA A;  2IBD A;  3ZQF A;  2XRL A;  4GCL A;  3ZQI A;  3LSP A;  1JUS A;  3ZQL A;  4W1U A;  2ZOZ A;  3VOX A;  4AC6 A;  3CCY A;  3F0C A;  3VW2 A;  1T56 A;  3V6G A;  2QWT A;  3BNI A;  3FK6 A;  1T33 A;  4ACI A;  2XB5 A;  3G56 A;  3CDL A;  1JT0 A;  2XPU A;  2FX0 A;  1RPW A;  2RAE A;  2UXI A;  3O8G A;  2REK A;  2OF7 A;  3BHQ A;  3HTJ A;  5F0F A;  3VVZ A;  3K8P C;  5K7F A;  3VPR A;  3BJB A;  4JL3 A;  3DPJ A;  1Z0X A;  4U9L A;  3MNL A;  3ON2 A;  5F27 A;  4XK4 A;  3VP5 A;  3DEW A;  3NPI A;  2ZCN A;  3QPL A;  3DU6 A;  2UXO A;  2R7X A;  1U9N A;  2F07 A;  3MVP A;  3SFI A;  2V57 A;  2NX4 A;  4D5C A;  3SWH A;  3CJD A;  3VVX A;  4NN1 A;  4ME9 A;  5EFY A;  5F0H A;  5EZG A;  4JNN A;  3Q0W A;  4B3A A;  2YVE A;  2HQ5 A;  2ZCX A;  3BTC A;  5FKL A;  2TCT A;  4PXI A;  4M3B A;  2R7S A;  2YVX A;  3Q3S A;  4WIB A;  4JYK A;  4MO7 A;  3KZ9 A;  3ZQG A;  5IP6 A;  3DU5 A;  5EYR A;  2Y30 A;  2FBQ A;  3BQZ A;  2R7T A;  4V2F A;  4HKU A;  3HTH A;  4GFL A;  5K58 A;  2QOP A;  2GFN A;  3B6C A;  3KYL A;  3QPS A;  4AF5 A;  4U9N A;  3DCF A;  4NEL A;  4M3F A;  3PAS A;  2ID6 A;  2NP3 A;  4MXM A;  3O60 A;  1JT6 A;  2UXH A;  2QCO A;  2FQ4 A;  2VPR A;  3BR6 A;  3BR2 A;  3ANP A;  3HGY A;  3PPB A;  2R7O A;  5J3L A;  1A6I A;  4L62 A;  4I6Z A;  2W53 A;  3HIM A;  3BCG A; 
#chains in the Genus database with same CATH homology
 2R7T A;  3FHN A;  2R7Q A;  2B3W A;  3VTI A;  2R7S A;  2R7W A;  4OD4 A;  3DU6 A;  2R7X A;  4OD5 A;  2B1E A;  3KYL A;  2R7U A;  2PFV A;  4IRV A;  2FJI 1;  3DU5 A;  2R7O A;  5CQG A;  3NS4 A;  3SWH A;  2R7V A;  2A2F X;  3K8P C;  4C2M A;  4DVY P;  2R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...