2B3WA

Nmr structure of the e.coli protein ybia, northeast structural genomics target et24.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
168
structure length
168
Chain Sequence
b'MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ybiA
publication title NMR structure of the E.coli protein YbiA, Northeast Structural Genomics target ET24.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 48
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08719 DUF1768 Domain of unknown function (DUF1768)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.40 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2b3wA00
2B3WA
chains in the Genus database with same CATH superfamily
5FHPA 3G1OA 4M3FA 3RD3A 2YVXA 2OF7A 2Y2ZA 5F1JA 3O8HA 2XDNA 1QVUA 3LSJA 2TRTA 2R7VA 2HQ5A 2GFNA 3KKDA 3ON4A 4MK6A 3FHNA 3VIBA 2JK3A 4B3AA 2RHAA 5K7ZA 2GBYA 4IRVA 3FIWA 3GZIA 3CCYA 4M3GA 2UXHA 4GFLA 3VTIA 5C4YA 3VVXA 2R7XA 1U9NA 1JTXA 3BQZA 4M3BA 3DU5A 3CRJA 2OERA 3C2BA 3IH3A 1T56A 2NP5A 2RASA 3AQTA 4OD5A 2GENA 2XB5A 3SDGA 4WIBA 2WV1A 5FKNA 4JNNA 2R7WA 3LSRA 4M3DA 2JJ7A 2ZB9A 5H9TA 3BTJA 3ZQLA 1Z77A 3K8PC 3G7RA 2UXOA 5D18A 1U9OA 3SWHA 3LHQA 3QBMA 3B81A 3QPLA 4OD4A 3Q0VA 4D5CA 3NRGA 3F1BA 4JKZA 2Y31A 2IBDA 1ZKGA 3IH2A 5J1UA 4V2FA 3BR1A 5IOZA 4NN1A 3HTHA 3ZQFA 4HKUA 5HAWA 3VOXA 3F0CA 4ACIA 2DG8A 3KZ9A 2NS7A 4KWAA 5K7FA 3BR0A 4V2GA 4ME9A 5HBUA 3T6NA 3NS4A 4L62A 1ZK8A 3DCFA 3DPJA 4PXIA 2REKA 3QQAA 5EFYA 1JTYA 5CXIA 3C07A 1RPWA 3WHCA 3NXCA 3E7QA 3P9TA 4UDSA 2ID6A 4W1UA 5FKMA 2HYJA 5IPAA 1UI5A 2FBQA 2X6OA 2UXUA 3TP0A 2FX0A 2XPVA 3KNWA 3G56A 1SGMA 3VW1A 3TP3A 5GP9A 3V6GA 2F07A 2FD5A 3DU6A 2QTQA 2Y30A 3BQYA 1ORKA 5CW8A 1BJZA 3HTJA 5F04A 4MXMA 2G7SA 2VKEA 2ZCMA 5IP6A 4U9LA 2XRLA 3MNLA 4AUXA 2ZCNA 2WGBA 2OPTA 3B6AA 5FGLA 2XGCA 3RH2A 2RAEA 3HTAA 5D1RA 5FKLA 2HXIA 3GEUA 3QKXA 5AQCA 2HKUA 3EGQA 4U9NA 3Q0WA 2R7UA 4DVYP 2QCOA 3HGYA 3KKCA 2Q24A 3BTLA 3WHBA 5F08A 4G12A 2G7GA 2ZCXA 3BTCA 3FK7A 2R7TA 2QKOA 5F0FA 2OI8A 3BHQA 5F0HA 5D19A 2UXIA 4D5FA 2PBXA 2YVHA 4C2MA 3VVZA 3G1MA 2R7RA 2O7TA 4ICHA 5J1RA 3HE0A 3BR5A 3Q3SA 3BR2A 5CQGA 2UXPA 3HIMA 1A6IA 5EZHA 3HTIA 1RKTA 1QPIA 4AF5A 1RKWA 3BT9A 4M3EA 3O60A 2VKVA 4GCLA 2G0EA 2R7SA 5IOYA 3VP5A 3O8GA 4DW6A 2XPWA 3BNIA 3AQSA 3LWJA 1JT6A 2FQ4A 2ZY9A 3B6CA 3FK6A 2X9DA 3CDLA 2VPRA 2QOPA 2TCTA 3BCGA 1JUPA 2XGEA 3ANGA 2NS8A 1T33A 5CXGA 3PASA 3BRUA 2ID3A 3HGGA 3JSJA 5F27A 3ON2A 2G3BA 5F0CA 2FJ1A 3EUPA 2B3WA 4JL3A 3VUQA 3CJDA 4W97A 5EZGA 2FJI1 2EH3A 3BTIA 4D7NA 3COLA 1JUMA 2GUHA 2D6YA 1QVTA 5DAJA 2IAIA 4XK4A 3G1LA 5GPAA 1Z0XA 2HYTA 3S5RA 2W53A 4B1RA 4GFKA 3VW2A 3ZQIA 2NX4A 4I6ZA 5J1YA 4JYKA 2PZ9A 5FKOA 3LSPA 3VVYA 4NELA 2R7QA 2HXOA 4I76A 5GPCA 2ZOZA 3BR6A 4AC0A 3BR3A 3NI7A 5EYRA 5K58A 1JT0A 2O7OA 2IEKA 3VW0A 2QWTA 1UI6A 2DG7A 3DEWA 2R7OA 3V78A 4YZEA 2A2FX 3MVPA 2NP3A 3ANPA 3Q0UA 2V57A 2DTZA 4CGRA 2I10A 3IUVA 5HSZA 2XPUA 4AC6A 4X1EA 3LJLA 3NNRA 2ZOYA 5J3LA 1JUSA 3IH4A 3PPBA 4GCTA 4D7MA 3KYLA 2IU5A 3SFIA 2PFVA 1VI0A 3FRQA 2YVEA 3ZQHA 5FMPA 3VOKA 2XGDA 2B1EA 3CWRA 3VPRA 3ZQGA 2WUIA 3NPIA 3QPSA 2G7LA 5FKKA 4ABZA 3BJBA 4MO7A 3LOCA 5K7HA 4GCKA 3PM1A 2QIBA
chains in the Genus database with same CATH topology
3NS4A 5CQGA 2PFVA 4IRVA 2R7TA 2B3WA 2R7WA 2B1EA 3VTIA 2R7XA 2FJI1 3K8PC 2R7VA 2R7SA 4C2MA 3SWHA 3DU5A 3DU6A 2R7RA 2R7OA 2R7UA 4DVYP 4OD4A 2R7QA 3FHNA 3KYLA 4OD5A 2A2FX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3W A; 
#chains in the Genus database with same CATH topology
 5FHP A;  3G1O A;  4M3F A;  3RD3 A;  2YVX A;  2OF7 A;  2Y2Z A;  5F1J A;  3O8H A;  2XDN A;  1QVU A;  3LSJ A;  2TRT A;  2R7V A;  2HQ5 A;  2GFN A;  3KKD A;  3ON4 A;  4MK6 A;  3FHN A;  3VIB A;  2JK3 A;  4B3A A;  2RHA A;  5K7Z A;  2GBY A;  4IRV A;  3FIW A;  3GZI A;  3CCY A;  4M3G A;  2UXH A;  4GFL A;  3VTI A;  5C4Y A;  3VVX A;  2R7X A;  1U9N A;  1JTX A;  3BQZ A;  4M3B A;  3DU5 A;  3CRJ A;  2OER A;  3C2B A;  3IH3 A;  1T56 A;  2NP5 A;  2RAS A;  3AQT A;  4OD5 A;  2GEN A;  2XB5 A;  3SDG A;  4WIB A;  2WV1 A;  5FKN A;  4JNN A;  2R7W A;  3LSR A;  4M3D A;  2JJ7 A;  2ZB9 A;  5H9T A;  3BTJ A;  3ZQL A;  1Z77 A;  3K8P C;  3G7R A;  2UXO A;  5D18 A;  1U9O A;  3SWH A;  3LHQ A;  3QBM A;  3B81 A;  3QPL A;  4OD4 A;  3Q0V A;  4D5C A;  3NRG A;  3F1B A;  4JKZ A;  2Y31 A;  2IBD A;  1ZKG A;  3IH2 A;  5J1U A;  4V2F A;  3BR1 A;  5IOZ A;  4NN1 A;  3HTH A;  3ZQF A;  4HKU A;  5HAW A;  3VOX A;  3F0C A;  4ACI A;  2DG8 A;  3KZ9 A;  2NS7 A;  4KWA A;  5K7F A;  3BR0 A;  4V2G A;  4ME9 A;  5HBU A;  3T6N A;  3NS4 A;  4L62 A;  1ZK8 A;  3DCF A;  3DPJ A;  4PXI A;  2REK A;  3QQA A;  5EFY A;  1JTY A;  5CXI A;  3C07 A;  1RPW A;  3WHC A;  3NXC A;  3E7Q A;  3P9T A;  4UDS A;  2ID6 A;  4W1U A;  5FKM A;  2HYJ A;  5IPA A;  1UI5 A;  2FBQ A;  2X6O A;  2UXU A;  3TP0 A;  2FX0 A;  2XPV A;  3KNW A;  3G56 A;  1SGM A;  3VW1 A;  3TP3 A;  5GP9 A;  3V6G A;  2F07 A;  2FD5 A;  3DU6 A;  2QTQ A;  2Y30 A;  3BQY A;  1ORK A;  5CW8 A;  1BJZ A;  3HTJ A;  5F04 A;  4MXM A;  2G7S A;  2VKE A;  2ZCM A;  5IP6 A;  4U9L A;  2XRL A;  3MNL A;  4AUX A;  2ZCN A;  2WGB A;  2OPT A;  3B6A A;  5FGL A;  2XGC A;  3RH2 A;  2RAE A;  3HTA A;  5D1R A;  5FKL A;  2HXI A;  3GEU A;  3QKX A;  5AQC A;  2HKU A;  3EGQ A;  4U9N A;  3Q0W A;  2R7U A;  4DVY P;  2QCO A;  3HGY A;  3KKC A;  2Q24 A;  3BTL A;  3WHB A;  5F08 A;  4G12 A;  2G7G A;  2ZCX A;  3BTC A;  3FK7 A;  2R7T A;  2QKO A;  5F0F A;  2OI8 A;  3BHQ A;  5F0H A;  5D19 A;  2UXI A;  4D5F A;  2PBX A;  2YVH A;  4C2M A;  3VVZ A;  3G1M A;  2R7R A;  2O7T A;  4ICH A;  5J1R A;  3HE0 A;  3BR5 A;  3Q3S A;  3BR2 A;  5CQG A;  2UXP A;  3HIM A;  1A6I A;  5EZH A;  3HTI A;  1RKT A;  1QPI A;  4AF5 A;  1RKW A;  3BT9 A;  4M3E A;  3O60 A;  2VKV A;  4GCL A;  2G0E A;  2R7S A;  5IOY A;  3VP5 A;  3O8G A;  4DW6 A;  2XPW A;  3BNI A;  3AQS A;  3LWJ A;  1JT6 A;  2FQ4 A;  2ZY9 A;  3B6C A;  3FK6 A;  2X9D A;  3CDL A;  2VPR A;  2QOP A;  2TCT A;  3BCG A;  1JUP A;  2XGE A;  3ANG A;  2NS8 A;  1T33 A;  5CXG A;  3PAS A;  3BRU A;  2ID3 A;  3HGG A;  3JSJ A;  5F27 A;  3ON2 A;  2G3B A;  5F0C A;  2FJ1 A;  3EUP A;  2B3W A;  4JL3 A;  3VUQ A;  3CJD A;  4W97 A;  5EZG A;  2FJI 1;  2EH3 A;  3BTI A;  4D7N A;  3COL A;  1JUM A;  2GUH A;  2D6Y A;  1QVT A;  5DAJ A;  2IAI A;  4XK4 A;  3G1L A;  5GPA A;  1Z0X A;  2HYT A;  3S5R A;  2W53 A;  4B1R A;  4GFK A;  3VW2 A;  3ZQI A;  2NX4 A;  4I6Z A;  5J1Y A;  4JYK A;  2PZ9 A;  5FKO A;  3LSP A;  3VVY A;  4NEL A;  2R7Q A;  2HXO A;  4I76 A;  5GPC A;  2ZOZ A;  3BR6 A;  4AC0 A;  3BR3 A;  3NI7 A;  5EYR A;  5K58 A;  1JT0 A;  2O7O A;  2IEK A;  3VW0 A;  2QWT A;  1UI6 A;  2DG7 A;  3DEW A;  2R7O A;  3V78 A;  4YZE A;  2A2F X;  3MVP A;  2NP3 A;  3ANP A;  3Q0U A;  2V57 A;  2DTZ A;  4CGR A;  2I10 A;  3IUV A;  5HSZ A;  2XPU A;  4AC6 A;  4X1E A;  3LJL A;  3NNR A;  2ZOY A;  5J3L A;  1JUS A;  3IH4 A;  3PPB A;  4GCT A;  4D7M A;  3KYL A;  2IU5 A;  3SFI A;  2PFV A;  1VI0 A;  3FRQ A;  2YVE A;  3ZQH A;  5FMP A;  3VOK A;  2XGD A;  2B1E A;  3CWR A;  3VPR A;  3ZQG A;  2WUI A;  3NPI A;  3QPS A;  2G7L A;  5FKK A;  4ABZ A;  3BJB A;  4MO7 A;  3LOC A;  5K7H A;  4GCK A;  3PM1 A;  2QIB A; 
#chains in the Genus database with same CATH homology
 3NS4 A;  5CQG A;  2PFV A;  4IRV A;  2R7T A;  2B3W A;  2R7W A;  2B1E A;  3VTI A;  2R7X A;  2FJI 1;  3K8P C;  2R7V A;  2R7S A;  4C2M A;  3SWH A;  3DU5 A;  3DU6 A;  2R7R A;  2R7O A;  2R7U A;  4DVY P;  4OD4 A;  2R7Q A;  3FHN A;  3KYL A;  4OD5 A;  2A2F X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...