2B4DB

Ssat+coa+sp- sp disordered
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
170
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 34
structure length 169
sequence length 170
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4dB00
4YRHA 2X7BA 2ZW4A 2PDOA 2Z11A 4U9ZA 4QC6A 2AE6A 1XMTA 4KOTA 2WPWA 3K9UA 3RYOA 2Q7BA 4YGOA 4CAWA 4KOWA 1NMTA 3F5BA 2AJ6A 2NMTA 3LODA 2FT0A 3PZJA 3PP9A 3BJ8A 1R57A 4R57A 1V0CA 5IX3A 2ATRA 4MJ8A 3TO9A 4FD6A 4KZTA 1FY7A 2DXQA 1L0CA 4J3GA 1M44A 3P2FA 4NEXA 3F8KA 1Q2YA 1MJAA 1TIQA 4KORA 2ZW7A 4KVOE 5F46A 1J4JA 4HNWB 4ZBGA 2OZGA 3EC4A 4RS2A 3TCVA 2BUEA 2FE7A 4AVCA 4I49A 2P0WA 4OAEA 1IYKA 3W6SA 1NSLA 1M1DA 4JD6A 1YREA 2G3AA 3I3GA 4KUBA 2J8NA 5F49A 4MY0A 5KTDA 4PK3A 1Z4EA 3H4QA 5I0CA 4KOXA 2CY2A 1QSRA 5JPHA 2ZXVA 4B5PA 1YLEA 2Q4YA 3DSBA 1YVKA 1YR0A 5JQ4A 4FD5A 1K4JA 4HNXB 1XE4A 1XF8A 5EBVA 4EVYA 2B58A 2R98A 5IB0A 1Z9UA 3OWCA 1XEBA 4JWPA 4PK2A 4MBUA 4NSQA 3SHPA 1QSTA 4XNHB 2PSWA 1LRZA 3LD2A 3T90A 2R8VA 4M3SA 2I79A 1MJBA 1P4NA 2C27A 3TO7A 4QVTA 4AVBA 4CRYB 1B6BA 1M4DA 2VBQA 4II9A 2A4NA 3EXNA 2D4PA 4M85A 3CXSA 4KVXA 4H6UA 4XNHC 1KUVA 2QMLA 4HKFA 4B5PB 4E0AA 2Q4VA 2Q04A 3FB3A 2IL4A 3BLNA 5C88A 4KOUA 3S6HA 4XPKA 4KOYA 2Y0MA 2Z0ZA 2JDDA 4CAXA 4PSXA 4JJXA 2ZPAA 4R9MA 2PC1A 3N7ZA 3EO4A 2VI7A 4B5OA 1OZPA 4FD4A 2FCKA 3C26A 2D4OA 5HMNA 3TO6A 4Y49B 2P6EA 1S5KA 2CNSA 5DWMA 2GANA 3B8GA 1VKCA 3UY5A 4UBRA 1YX0A 3R96A 3D2PA 3R1KA 3WR7A 4AG7A 3E0KA 2RC4A 5FVJA 3DNSA 4MHDA 1QSOA 5F47A 1UFHA 1IIDA 2B5GA 1I21A 1BO4A 1I1DA 2G0BA 2Z10A 4Y49C 3FYNA 1M4GA 1S60A 3TOAA 1Z4RA 3CXPA 4AG9A 4K30A 1Q2DA 3F0AA 2PR8A 1CM0A 1YGHA 3MGDA 1Q2CA 3IGRA 2FL4A 3DDDA 5HH1A 1KUYA 2OH1A 4OADA 2PRBA 2EVNA 3KKWA 2CNTA 4KLWA 4UA3A 1M4IA 1I12A 2PQ8A 2VXKA 2VEZA 5J8CA 1S7FA 1GHEA 1Y9WA 3BJ7A 3QAHA 5J8FA 1Y9KA 3S6FA 4PV6A 3R9EA 3GY9A 4NXYA 1KUXA 2WPXA 3V8IA 3SXOA 2B5GB 3FNCA 3G8WA 1YK3A 2K5TA 3T9YA 4AB7A 1BOBA 4JXQA 3W6XA 4XPLA 1IYLA 1N71A 4E8OA 4RI1A 1WWZA 2P6GA 4KUAA 3PGPA 3VWDA 2QECA 4R3KA 2GE3A 4CRZB 3EFAA 4R3LA 5F48A 1NE9A 3I9SA 4IUSA 5C82A 2F5IA 2G3TA 1B87A 4QBJA 5H84A 5KTAA 4AVAA 4MI4A 1MK4A 1MJ9A 1VHSA 2ZW5A 2CNMA 4KLVA 4ONUA 1IB1E 1WK4A 3R9FA 4JLYA 2B4BA 2VZZA 2B4DA 2HV2A 4NF1A 2JDCA 4IF5A 4KOSA 1S3ZA 1YVOA 4KOVA 4JXRA 3R9GA 2J8RA 4PSWA 3JUWA 2BEIA 4KVME 5DWNA 1S7NA 4R87A 2REFA 4XPDB 3DR6A 4CAVA 2B3VA 3D8PA 4UWJA 3S6KA 3EY5A 4H89A 2ARHA 4DNCA 1QSNA 2FIAA 2ZW6A 2Q44A 4CS0B 3FIXA 2VQYA 2HUZA 4XPDC 1KZFA 3JVNA 2I00A 3D2MA 1P0HA 3FRMA 3W91A 2B4DB 3GYAA 2KCWA 4E2AA 5IV0A 3CXQA 3GKRA 4LX9A 2REEA 3D3SA 5E96A 2HQYA 1RXTA 2P6FA 3G3SA 3TE4A 4QB9A 1PUAA 3SXNA 3ZZIA 3R95A 4BMHA 1SQHA 4L8AA 2OB0A 4L89A 2FIWA 4X5KA 1CJWA 5EC4A 2FS5A 2BL1A 2JEVA 1RO5A 2J8MA 3TT2A 3IWGA 2R7HA 4LUAA 2OZUA 1QSMA 2EUIA 3QB8A 3S6GA 2VZYA 4FD7A 3DR8A 2H5MA 3FBUA 4U5YA 1PU9A 3VWEA 4GS4A 2JLMA 4F0YA 4UWIA 5GCNA 2PR1A 2O28A 3NE7A 5KTCA 4QUSA 2FSRA 1S7LA 2QIRA 5CNPA 2R1IA 3TTHA 4ORFA 4YFJA 5ISVA 5H86A 4MY3A 2BSWA 2OU2A 4HNYB 1XIXA 4U9YA 3TFYA 2OZHA 2Q0YA 4H6ZA 1S7KA 3P2HA 2FXFA 1IICA 3ZJ0A 4F6AA 4NCZA 2GIVA 3TOBA 1Y7RA 2B3UA 3FXTA 1ON0A 4OLLA 1U6MA
chains in the Genus database with same CATH superfamily
1KWMA 4YRHA 2X7BA 2ZW4A 2PDOA 1XFOA 2Z11A 2HC9A 2V8GA 3B3TA 2PVVA 4U9ZA 3D7FA 4QC6A 3QNVA 3WABA 2AE6A 1XMTA 4KOTA 2F7VA 3WC7A 1YLOA 2WPWA 3K9UA 3D7DA 3RYOA 4UCPA 2Q7BA 4YGOA 4CAWA 2AFOA 4KOWA 1NMTA 3F5BA 4OC2A 2AJ6A 4KSAA 2Z3KA 2NMTA 5LYIA 5K8MA 2XEJA 5LRGA 3LODA 4X2TA 1QMUA 2FT0A 3PZJA 4M6IA 3PP9A 1JWQA 3BJ8A 1R57A 4R57A 1V0CA 4TNUA 2ATRA 2ZEHA 5IX3A 3BHXA 3HLPA 4UCNA 4MJ8A 3TO9A 4A32A 2ZEOA 3KHZA 4UFVA 4FD6A 4KZTA 1Y0YA 5G1ZA 1FY7A 2DXQA 3H8EA 1L0CA 2PCUA 3KQXA 4P44A 4NGRA 3IU2A 3BXMA 4J3GA 1VIXA 3GB0A 3JRUA 2JEWA 4B14A 3IIBA 1M44A 1ZG7A 3MN8A 2YNCC 4MFJA 3P2FA 4NEXA 2DPTA 3SI0A 1F2OA 4ZY1A 3F8KA 3S9NA 3FF3A 1Q2YA 1MJAA 1TIQA 4KORA 4CAFA 2BOAA 2DF5A 2ZW7A 4KVOE 4UIBA 5F46A 1J4JA 1XMBA 4G1PA 4OIDA 4B13A 4MRIA 1DTDA 1TKHA 2V77A 4HNWB 4P4JA 2WUUA 4ZBGA 2C6CA 2OZGA 3EC4A 3GLJA 4RS2A 2ZEPA 3TX8A 5HXDA 3TCVA 2BUEA 2FE7A 4AVCA 3D7HA 4I49A 2P0WA 4OAEA 4F9UA 1IYKA 5CBMA 3FVLA 3PB4X 4CGMA 2JBKA 3HUVA 2XEIA 1NSLA 1M1DA 3W6SA 4JD6A 3CT9A 1YREA 2G3AA 3I3GA 4KUBA 2J8NA 3K9TA 4MY0A 5F49A 5KTDA 4PK3A 3KR5A 2AFZA 3PBEA 1LCPA 3IWEA 1Z4EA 2QJ8A 3H4QA 4PPZA 1X12A 2CY2A 4KOXA 4Z65A 4OC4A 5I0CA 1QSRA 3PEIA 2ZXVA 4B5PA 5IB9A 5JPHA 1YLEA 2Q4YA 2WSAA 2CIJA 4UCMA 4NGSA 1ZG8A 3DSBA 1YVKA 1YR0A 2PJ4A 2ZEGA 3PB6X 1CG2A 4FD5A 4H2KA 1K4JA 5JQ4A 4HNXB 1XE4A 2Q7SA 3PFEA 1LANA 1XF8A 2IJZA 5EBVA 4UFXA 3D67A 3N5FA 4EVYA 3B3VA 2B58A 4RUHA 1LAMA 4ZX8A 1ZO0A 2R98A 5IB0A 2EWBA 3K2KA 1BLLE 1Z9UA 1Z5RA 1ZG9A 1XEBA 3OWCA 4JWPA 5AG7A 4MFLA 4PK2A 4P10A 4MBUA 2DEAA 4EWTA 2YNCA 1LOKA 4FAIA 4NSQA 3SHPA 1QSTA 4XNHB 4B12A 2PSWA 4BD9A 4MHYA 1LRZA 3LD2A 3T90A 8CPAA 3KI9A 2R8VA 1Z2LA 2AFMA 1RTQA 4M3SA 3RNZA 2PJ1A 2I79A 3B2YA 1MJBA 4PXDA 1P4NA 5JGFA 4CGLA 2C27A 1OBRA 3WC5A 3TO7A 4QVTA 4AVBA 2CTBA 1TKJA 4ONWA 4WJBA 3SJXA 3V7ZA 4CRYB 2F8HA 1B6BA 1FNOA 1M4DA 2VBQA 4II9A 2A4NA 1Z8WA 5LRKA 2PE3A 3EXNA 4NGNA 4IHMA 2D4PA 4M85A 4DYOA 3CXSA 2VL1A 4KVXA 1A2ZA 4H6UA 1KUVA 4PQAA 4XNHC 2QMLA 4HKFA 4B5PB 4BBHA 4E0AA 1JQGA 5DS0A 3NA6A 4MHNA 4ZYQA 2Q4VA 2PJ2A 1HDQA 4P6YA 2Q04A 1Q7LA 3FB3A 2PJ6A 2IL4A 3BLNA 5C88A 3TC8A 2Z3MA 4KOUA 4WWVA 3S6HA 5EMIA 4UEFA 2I3CA 3LACA 4XPKA 4KOYA 3B3SA 2Y0MA 5LYFA 1BPMA 2JDDA 2O53A 2Z0ZA 4CAXA 4PSXA 1IOIA 4JJXA 4FUUA 4P45A 2PJ5A 2ZPAA 4KS9A 4R9MA 2PC1A 2PJ0A 4CPAA 4EFDA 1DE4C 2XEFA 3N7ZA 3EO4A 4K3NA 2VI7A 4MXUA 4B5OA 4KSIA 1ARLA 1XRYA 3IJ3A 2QYVA 1OZPA 1GYTA 2AFXA 4OP4A 4NGMA 4FD4A 4TWEA 2FCKA 3C26A 3NE8A 2D4OA 2Z3PA 3FEDA 4P4BA 5HMNA 3TO6A 4Y49B 1AUGA 1H8LA 3B7IA 1ZLHA 2P6EA 1S5KA 4A95A 2CNSA 5DWMA 1HEEA 4C7IA 2GANA 3B8GA 3FECA 4NGPA 1VKCA 3UY5A 4UBRA 1YX0A 5G21A 3R96A 3D2PA 4A94A 3R1KA 3WR7A 2WZNA 4UEEA 4A37A 4AG7A 3E0KA 2RC4A 5FVJA 2RFHA 3DNSA 4W9YA 4MHDA 1QSOA 3T8WA 5F47A 4R8FA 4A30A 5LRJA 1UFHA 1IIDA 2B5GA 1I21A 1BO4A 1BAVA 3FJUA 1I1DA 2G0BA 2O4HA 2YGWA 2Z10A 4Y49C 4MCPA 3FYNA 1IGBA 3BI1A 1M4GA 5D8NA 5A27A 1Z8LA 3D66A 1S60A 3NH8A 3TOAA 4A33A 1Z4RA 3CXPA 5F09A 4AG9A 2V8HA 4K30A 2PRQA 1Q2DA 3F0AA 2PR8A 3D68A 2ZELA 3FH4A 3H8FA 6CPAA 2GREA 3GUXA 1CM0A 4RN7A 4NJQA 1YQEA 4MFPA 1YGHA 3MGDA 5THWA 3VATA 2XEGA 4F8ZA 1Q2CA 3IGRA 4MMOA 2FL4A 4OC0A 2QVPA 3DDDA 2V8VA 5K8OA 4NGQA 5HH1A 1KUYA 2OH1A 4MFQA 1IU8A 4OADA 2PRBA 2RB7A 2EVNA 4F0XA 4B6ZA 2ABZA 3KKWA 2CNTA 3LMSA 3NH4A 4OC1A 4KLWA 4Q36A 4P4IA 4UA3A 5LYDA 2CXAA 3SJGA 4IK2A 1M4IA 2POKA 1I12A 2PQ8A 4MFKA 1QQ9A 2VXKA 2VEZA 3FMCA 4PXCA 5J8CA 1S7FA 3JTKA 1GHEA 4MHPA 1XOVA 1Y9WA 1CPSA 1CP6A 3BJ7A 3QAHA 3CPAA 4LQ6A 1YW6A 5J8FA 1Y9KA 3S6FA 4CYPA 4PV6A 3R9EA 3GY9A 4NXYA 4PXEA 1KUXA 2WPXA 3V8IA 3IU1A 4AXVA 3SXOA 2B5GB 3FNCA 3G8WA 1YK3A 2BCOA 2K5TA 3T9YA 4AB7A 1Z8XA 1BOBA 4JXQA 4X8IA 3W6XA 4XPLA 3GIUA 2OR4A 1IYLA 1N71A 4OMEA 4RI1A 4E8OA 1WWZA 3B3WA 3KL9A 2P6GA 3PBBA 4KUAA 3PGPA 1ZLIA 2QECA 3VWDA 5ELYA 2HB6A 4R3KA 2GE3A 3PB7X 2GLJA 3EFAA 3PB8X 4R3LA 3S9MA 3VH9A 5F48A 4NFRA 1NE9A 4CRZB 1Y0RA 3I9SA 4IUSA 5C82A 3H5ZA 1AYEA 4R76A 4BINA 2PVWA 3NH5A 2F5IA 2G3TA 1B87A 4P4DA 4QBJA 3PB9X 2C6PA 4NGTA 4GM5A 5H84A 4A2ZA 4OC5A 5KTAA 2CTCA 4AVAA 1CX8A 1M4LA 3IWWA 1Y7EA 1PCAA 4MI4A 1Z8TA 2ZENA 4OC3A 1MK4A 3VARA 1YW4A 4C2YA 4ZY2A 1MJ9A 3CDXA 1VHSA 1ARMA 5A28A 2AFWA 2Z3OA 2Q43A 2ZW5A 3KGQA 2CNMA 4KLVA 2PJBA 4ONUA 1IB1E 2YNEA 4JZ0A 3RAMA 1WK4A 4YWYA 4M6GA 3R9FA 4KSFA 2PJ9A 1TF8A 5JM6A 1LAPA 1PYTB 1XJOA 4LQGA 3RZAA 1AMPA 4JLYA 2B4BA 2PJ3A 2VZZA 5LYLA 2B4DA 2NYQA 4MCSA 2GFQA 2HV2A 5BWAB 2C1CA 4ZGYB 5J1QA 2PIZA 4NF1A 4PXBA 1FT7A 2JDCA 4IF5A 4KOSA 2DPSA 1VHOA 1S3ZA 2PJ7A 1YVOA 3IFEA 1UWYA 2V8DA 4KOVA 3FEEA 3LWUA 2AFSA 4UIAA 4JXRA 3R9GA 3IEHA 2J8RA 1YMEA 4PSWA 2ANPA 3JUWA 2BEIA 4KVME 4UEZA 5DWNA 1TKFA 3RBUA 4CYOA 2GLFA 3D4UA 4IAVA 1S7NA 4R87A 2Z3NA 4CGNA 2REFA 4XPDB 5I4MA 3DR6A 2Q4ZA 2B3VA 4CAVA 1ELMP 2PJ8A 3D8PA 3MRUA 4X3RA 4A38A 4UWJA 3KR4A 3ISXA 3S6KA 3EY5A 5G20A 3PRTA 4H89A 2ARHA 3IO1A 4DNCA 2Z3LA 1QSNA 1VHEA 2FIAA 2PJAA 1NSAA 1BPNA 2ZW6A 2BO9A 1ELLP 5K8PA 2OOTA 3KASA 4C68A 2Q44A 4CS0B 3FIXA 2VQYA 2HUZA 4XPDC 2ZEFA 1R3NA 2WYRA 1KZFA 5K8NA 3JVNA 4R7MA 4EMEA 2Q51A 2I00A 3D2MA 4ZX9A 3SI2A 2FVGA 4GXHA 1P0HA 3FRMA 2EK8A 4O23A 5AGEA 1X10A 4UF4A 3W91A 2B4DB 4F9VA 3GYAA 1XBUA 4P4EA 2KCWA 3ISZA 4E2AA 5IV0A 3CXQA 4A39A 3V38A 3GKRA 4LX9A 1IOFA 2REEA 3D3SA 3RO0A 5E96A 2HQYA 1RXTA 2IMOA 2CF4A 2P6FA 3G3SA 1VGYA 2ZEDA 4QB9A 4C7HA 3TE4A 3CZXA 1PUAA 3KZWA 3SXNA 3R95A 3ZZIA 1SQHA 2ZEEA 3BI0A 2OB0A 4L8AA 4BMHA 4L89A 4MCQA 1CBXA 2FIWA 3DGVA 1CJWA 4FWUA 4X5KA 2FS5A 5D29A 5EC4A 4NJRA 5HVFA 1F57A 2BL1A 4CGOA 1TF9A 4YU9A 2JEVA 1RO5A 4C2XA 4A31A 2J8MA 3SJFA 3TT2A 5JH9A 3IWGA 4ZY0A 3NFZA 4C2ZA 4OKOA 2R7HA 4Q38A 2GU2A 3H8GA 4LUAA 1HDUA 2OZUA 1QSMA 2EUIA 1F2PA 3QB8A 4R6TA 4CYQA 3S6GA 2VZYA 2JBJA 4FD7A 5HVGA 3DR8A 2H5MA 3FBUA 5AG6A 2ZEMA 1CP7A 4DJLA 4U5YA 1PU9A 4CYNA 4MHZA 3VWEA 4GS4A 5HVHA 2JLMA 4F0YA 3CPXA 3SJEA 2C6GA 4UWIA 4FBEA 4MFZA 3L2NA 5GCNA 2PR1A 2O28A 4MCRA 4B11A 2G9DA 7CPAA 5AG4A 3NE7A 4CAEA 5KTCA 4QUSA 3WC6A 1LFWA 2FSRA 1S7LA 2IQ6A 4JYWA 2QIRA 4OIWA 2PIYA 5CNPA 3KHXA 3KQZA 2R1IA 3TTHA 4ORFA 3I1UA 2EK9A 4YFJA 5H86A 4MY3A 5ISVA 3IC1A 2BSWA 2OU2A 4HNYB 3SI1A 4M6HA 4Q7AA 1XIXA 2ZOGA 3B35A 4U9YA 4CGPA 3TFYA 3A9LA 3DLJA 2NSMA 2OZHA 2Q0YA 3D7GA 5CPAA 4H6ZA 1S7KA 3P2HA 1CPXA 2ZOFA 2FXFA 1IICA 3ZJ0A 1EE3P 4HPSA 4F6AA 3B3CA 5G22A 1IY7A 2AFUA 4NCZA 2GIVA 2PJCA 4UFWA 5AG5A 2EO8A 3TOBA 1Y7RA 3QAYA 3WT4A 4ZI6A 1YSJA 1TXRA 4P4FA 3PFOA 2B3UA 3S9LA 3FX6A 4DUKA 4B10A 3FXTA 1ON0A 2YNDA 4OLLA 1U6MA 2J9AA 1R43A 2EBJA 2ODFA
chains in the Genus database with same CATH topology
4YRHA 2X7BA 2ZW4A 2PDOA 2Z11A 4U9ZA 4QC6A 2AE6A 1XMTA 4KOTA 2WPWA 3K9UA 3RYOA 4UCPA 2Q7BA 4YGOA 4CAWA 4KOWA 1NMTA 3F5BA 2AJ6A 4KSAA 2Z3KA 2NMTA 3LODA 2FT0A 3PZJA 3PP9A 3BJ8A 1R57A 4R57A 1V0CA 5IX3A 2ATRA 4UCNA 4MJ8A 3TO9A 4A32A 4UFVA 4FD6A 4KZTA 5G1ZA 1FY7A 2DXQA 1L0CA 3IU2A 4J3GA 4B14A 1M44A 2YNCC 4MFJA 3P2FA 4NEXA 2DPTA 3F8KA 1Q2YA 1MJAA 1TIQA 4KORA 4CAFA 2ZW7A 4KVOE 5F46A 1J4JA 4B13A 4HNWB 2WUUA 4ZBGA 2OZGA 3EC4A 4RS2A 3TCVA 2BUEA 2FE7A 4AVCA 4I49A 2P0WA 4OAEA 1IYKA 4CGMA 3W6SA 1NSLA 1M1DA 4JD6A 1YREA 2G3AA 3I3GA 4KUBA 2J8NA 5F49A 4MY0A 5KTDA 4PK3A 3IWEA 1Z4EA 3H4QA 5I0CA 4KOXA 2CY2A 1QSRA 5JPHA 2ZXVA 4B5PA 1YLEA 2Q4YA 2WSAA 4UCMA 3DSBA 1YVKA 1YR0A 5JQ4A 4FD5A 1K4JA 4HNXB 1XE4A 1XF8A 5EBVA 4UFXA 4EVYA 2B58A 1ZO0A 2R98A 5IB0A 1Z9UA 3OWCA 1XEBA 4JWPA 5AG7A 4MFLA 4PK2A 4MBUA 2YNCA 4NSQA 3SHPA 1QSTA 4XNHB 4B12A 2PSWA 1LRZA 3LD2A 3T90A 2R8VA 4M3SA 2I79A 1MJBA 1P4NA 4CGLA 2C27A 3TO7A 4QVTA 4AVBA 4CRYB 1B6BA 1M4DA 2VBQA 4II9A 2A4NA 3EXNA 2D4PA 4M85A 3CXSA 4KVXA 4H6UA 4XNHC 1KUVA 2QMLA 4HKFA 4B5PB 4BBHA 4E0AA 2Q4VA 2Q04A 3FB3A 2IL4A 3BLNA 5C88A 2Z3MA 4KOUA 3S6HA 4XPKA 4KOYA 2Y0MA 2Z0ZA 2JDDA 4CAXA 4PSXA 4JJXA 2ZPAA 4KS9A 4R9MA 2PC1A 3N7ZA 3EO4A 2VI7A 4B5OA 1OZPA 4FD4A 2FCKA 3C26A 2D4OA 2Z3PA 5HMNA 3TO6A 4Y49B 2P6EA 1S5KA 4A95A 2CNSA 5DWMA 4C7IA 2GANA 3B8GA 1VKCA 3UY5A 4UBRA 1YX0A 5G21A 3R96A 3D2PA 3R1KA 3WR7A 4AG7A 3E0KA 2RC4A 5FVJA 3DNSA 4MHDA 1QSOA 5F47A 4A30A 1UFHA 1IIDA 2B5GA 1I21A 1BO4A 1I1DA 2G0BA 2Z10A 2YGWA 4Y49C 3FYNA 1M4GA 5A27A 4A33A 1S60A 3TOAA 1Z4RA 3CXPA 4AG9A 4K30A 1Q2DA 3F0AA 2PR8A 1CM0A 4MFPA 1YGHA 3MGDA 1Q2CA 3IGRA 2FL4A 3DDDA 5HH1A 1KUYA 2OH1A 4MFQA 4OADA 2PRBA 2EVNA 4F0XA 3KKWA 2CNTA 4KLWA 4Q36A 4UA3A 2CXAA 1M4IA 1I12A 2PQ8A 4MFKA 2VXKA 2VEZA 5J8CA 1S7FA 3JTKA 1GHEA 1Y9WA 3BJ7A 3QAHA 5J8FA 1Y9KA 3S6FA 4CYPA 4PV6A 3R9EA 3GY9A 4NXYA 1KUXA 2WPXA 3V8IA 3IU1A 3SXOA 2B5GB 3FNCA 3G8WA 1YK3A 2K5TA 3T9YA 4AB7A 1BOBA 4JXQA 3W6XA 4XPLA 1IYLA 1N71A 4E8OA 4RI1A 1WWZA 2P6GA 4KUAA 3PGPA 3VWDA 2QECA 4R3KA 2GE3A 4CRZB 3EFAA 4R3LA 5F48A 1NE9A 3I9SA 4IUSA 5C82A 3H5ZA 2F5IA 2G3TA 1B87A 4QBJA 5H84A 4A2ZA 5KTAA 4AVAA 4MI4A 4C2YA 1MK4A 1MJ9A 1VHSA 5A28A 2Z3OA 2ZW5A 2CNMA 4KLVA 4ONUA 1IB1E 2YNEA 1WK4A 3R9FA 4KSFA 4JLYA 2B4BA 2VZZA 2B4DA 2HV2A 5BWAB 4ZGYB 4NF1A 2JDCA 4IF5A 4KOSA 2DPSA 1S3ZA 1YVOA 4KOVA 4JXRA 3R9GA 2J8RA 4PSWA 3JUWA 2BEIA 4KVME 5DWNA 4CYOA 1S7NA 4R87A 2Z3NA 4CGNA 2REFA 4XPDB 3DR6A 4CAVA 2B3VA 3D8PA 4UWJA 3S6KA 3EY5A 5G20A 4H89A 2ARHA 4DNCA 2Z3LA 1QSNA 2FIAA 2ZW6A 4C68A 2Q44A 4CS0B 3FIXA 2VQYA 2HUZA 4XPDC 1KZFA 3JVNA 2I00A 3D2MA 1P0HA 3FRMA 5AGEA 3W91A 2B4DB 3GYAA 2KCWA 4E2AA 5IV0A 3CXQA 3GKRA 4LX9A 2REEA 3D3SA 5E96A 2HQYA 1RXTA 2P6FA 3G3SA 4C7HA 3TE4A 4QB9A 1PUAA 3SXNA 3ZZIA 3R95A 4BMHA 1SQHA 4L8AA 2OB0A 4L89A 2FIWA 4X5KA 1CJWA 5EC4A 2FS5A 2BL1A 4CGOA 4C2XA 2JEVA 1RO5A 4A31A 2J8MA 3TT2A 3IWGA 4C2ZA 2R7HA 4Q38A 4LUAA 2OZUA 1QSMA 2EUIA 3QB8A 4CYQA 3S6GA 2VZYA 4FD7A 3DR8A 2H5MA 3FBUA 5AG6A 4U5YA 1PU9A 4CYNA 3VWEA 4GS4A 2JLMA 4F0YA 4UWIA 4MFZA 5GCNA 2PR1A 2O28A 4B11A 5AG4A 3NE7A 4CAEA 5KTCA 4QUSA 2FSRA 1S7LA 2QIRA 5CNPA 2R1IA 3TTHA 4ORFA 4YFJA 5ISVA 5H86A 4MY3A 2BSWA 2OU2A 4HNYB 1XIXA 4U9YA 4CGPA 3TFYA 3A9LA 2OZHA 2Q0YA 4H6ZA 1S7KA 3P2HA 2FXFA 1IICA 3ZJ0A 4F6AA 5G22A 4NCZA 2GIVA 4UFWA 5AG5A 3TOBA 1Y7RA 2B3UA 4B10A 3FXTA 1ON0A 2YNDA 4OLLA 1U6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRH A;  2X7B A;  2ZW4 A;  2PDO A;  2Z11 A;  4U9Z A;  4QC6 A;  2AE6 A;  1XMT A;  4KOT A;  2WPW A;  3K9U A;  3RYO A;  2Q7B A;  4YGO A;  4CAW A;  4KOW A;  1NMT A;  3F5B A;  2AJ6 A;  2NMT A;  3LOD A;  2FT0 A;  3PZJ A;  3PP9 A;  3BJ8 A;  1R57 A;  4R57 A;  1V0C A;  5IX3 A;  2ATR A;  4MJ8 A;  3TO9 A;  4FD6 A;  4KZT A;  1FY7 A;  2DXQ A;  1L0C A;  4J3G A;  1M44 A;  3P2F A;  4NEX A;  3F8K A;  1Q2Y A;  1MJA A;  1TIQ A;  4KOR A;  2ZW7 A;  4KVO E;  5F46 A;  1J4J A;  4HNW B;  4ZBG A;  2OZG A;  3EC4 A;  4RS2 A;  3TCV A;  2BUE A;  2FE7 A;  4AVC A;  4I49 A;  2P0W A;  4OAE A;  1IYK A;  3W6S A;  1NSL A;  1M1D A;  4JD6 A;  1YRE A;  2G3A A;  3I3G A;  4KUB A;  2J8N A;  5F49 A;  4MY0 A;  5KTD A;  4PK3 A;  1Z4E A;  3H4Q A;  5I0C A;  4KOX A;  2CY2 A;  1QSR A;  5JPH A;  2ZXV A;  4B5P A;  1YLE A;  2Q4Y A;  3DSB A;  1YVK A;  1YR0 A;  5JQ4 A;  4FD5 A;  1K4J A;  4HNX B;  1XE4 A;  1XF8 A;  5EBV A;  4EVY A;  2B58 A;  2R98 A;  5IB0 A;  1Z9U A;  3OWC A;  1XEB A;  4JWP A;  4PK2 A;  4MBU A;  4NSQ A;  3SHP A;  1QST A;  4XNH B;  2PSW A;  1LRZ A;  3LD2 A;  3T90 A;  2R8V A;  4M3S A;  2I79 A;  1MJB A;  1P4N A;  2C27 A;  3TO7 A;  4QVT A;  4AVB A;  4CRY B;  1B6B A;  1M4D A;  2VBQ A;  4II9 A;  2A4N A;  3EXN A;  2D4P A;  4M85 A;  3CXS A;  4KVX A;  4H6U A;  4XNH C;  1KUV A;  2QML A;  4HKF A;  4B5P B;  4E0A A;  2Q4V A;  2Q04 A;  3FB3 A;  2IL4 A;  3BLN A;  5C88 A;  4KOU A;  3S6H A;  4XPK A;  4KOY A;  2Y0M A;  2Z0Z A;  2JDD A;  4CAX A;  4PSX A;  4JJX A;  2ZPA A;  4R9M A;  2PC1 A;  3N7Z A;  3EO4 A;  2VI7 A;  4B5O A;  1OZP A;  4FD4 A;  2FCK A;  3C26 A;  2D4O A;  5HMN A;  3TO6 A;  4Y49 B;  2P6E A;  1S5K A;  2CNS A;  5DWM A;  2GAN A;  3B8G A;  1VKC A;  3UY5 A;  4UBR A;  1YX0 A;  3R96 A;  3D2P A;  3R1K A;  3WR7 A;  4AG7 A;  3E0K A;  2RC4 A;  5FVJ A;  3DNS A;  4MHD A;  1QSO A;  5F47 A;  1UFH A;  1IID A;  2B5G A;  1I21 A;  1BO4 A;  1I1D A;  2G0B A;  2Z10 A;  4Y49 C;  3FYN A;  1M4G A;  1S60 A;  3TOA A;  1Z4R A;  3CXP A;  4AG9 A;  4K30 A;  1Q2D A;  3F0A A;  2PR8 A;  1CM0 A;  1YGH A;  3MGD A;  1Q2C A;  3IGR A;  2FL4 A;  3DDD A;  5HH1 A;  1KUY A;  2OH1 A;  4OAD A;  2PRB A;  2EVN A;  3KKW A;  2CNT A;  4KLW A;  4UA3 A;  1M4I A;  1I12 A;  2PQ8 A;  2VXK A;  2VEZ A;  5J8C A;  1S7F A;  1GHE A;  1Y9W A;  3BJ7 A;  3QAH A;  5J8F A;  1Y9K A;  3S6F A;  4PV6 A;  3R9E A;  3GY9 A;  4NXY A;  1KUX A;  2WPX A;  3V8I A;  3SXO A;  2B5G B;  3FNC A;  3G8W A;  1YK3 A;  2K5T A;  3T9Y A;  4AB7 A;  1BOB A;  4JXQ A;  3W6X A;  4XPL A;  1IYL A;  1N71 A;  4E8O A;  4RI1 A;  1WWZ A;  2P6G A;  4KUA A;  3PGP A;  3VWD A;  2QEC A;  4R3K A;  2GE3 A;  4CRZ B;  3EFA A;  4R3L A;  5F48 A;  1NE9 A;  3I9S A;  4IUS A;  5C82 A;  2F5I A;  2G3T A;  1B87 A;  4QBJ A;  5H84 A;  5KTA A;  4AVA A;  4MI4 A;  1MK4 A;  1MJ9 A;  1VHS A;  2ZW5 A;  2CNM A;  4KLV A;  4ONU A;  1IB1 E;  1WK4 A;  3R9F A;  4JLY A;  2B4B A;  2VZZ A;  2B4D A;  2HV2 A;  4NF1 A;  2JDC A;  4IF5 A;  4KOS A;  1S3Z A;  1YVO A;  4KOV A;  4JXR A;  3R9G A;  2J8R A;  4PSW A;  3JUW A;  2BEI A;  4KVM E;  5DWN A;  1S7N A;  4R87 A;  2REF A;  4XPD B;  3DR6 A;  4CAV A;  2B3V A;  3D8P A;  4UWJ A;  3S6K A;  3EY5 A;  4H89 A;  2ARH A;  4DNC A;  1QSN A;  2FIA A;  2ZW6 A;  2Q44 A;  4CS0 B;  3FIX A;  2VQY A;  2HUZ A;  4XPD C;  1KZF A;  3JVN A;  2I00 A;  3D2M A;  1P0H A;  3FRM A;  3W91 A;  2B4D B;  3GYA A;  2KCW A;  4E2A A;  5IV0 A;  3CXQ A;  3GKR A;  4LX9 A;  2REE A;  3D3S A;  5E96 A;  2HQY A;  1RXT A;  2P6F A;  3G3S A;  3TE4 A;  4QB9 A;  1PUA A;  3SXN A;  3ZZI A;  3R95 A;  4BMH A;  1SQH A;  4L8A A;  2OB0 A;  4L89 A;  2FIW A;  4X5K A;  1CJW A;  5EC4 A;  2FS5 A;  2BL1 A;  2JEV A;  1RO5 A;  2J8M A;  3TT2 A;  3IWG A;  2R7H A;  4LUA A;  2OZU A;  1QSM A;  2EUI A;  3QB8 A;  3S6G A;  2VZY A;  4FD7 A;  3DR8 A;  2H5M A;  3FBU A;  4U5Y A;  1PU9 A;  3VWE A;  4GS4 A;  2JLM A;  4F0Y A;  4UWI A;  5GCN A;  2PR1 A;  2O28 A;  3NE7 A;  5KTC A;  4QUS A;  2FSR A;  1S7L A;  2QIR A;  5CNP A;  2R1I A;  3TTH A;  4ORF A;  4YFJ A;  5ISV A;  5H86 A;  4MY3 A;  2BSW A;  2OU2 A;  4HNY B;  1XIX A;  4U9Y A;  3TFY A;  2OZH A;  2Q0Y A;  4H6Z A;  1S7K A;  3P2H A;  2FXF A;  1IIC A;  3ZJ0 A;  4F6A A;  4NCZ A;  2GIV A;  3TOB A;  1Y7R A;  2B3U A;  3FXT A;  1ON0 A;  4OLL A;  1U6M A; 
#chains in the Genus database with same CATH topology
 1KWM A;  4YRH A;  2X7B A;  2ZW4 A;  2PDO A;  1XFO A;  2Z11 A;  2HC9 A;  2V8G A;  3B3T A;  2PVV A;  4U9Z A;  3D7F A;  4QC6 A;  3QNV A;  3WAB A;  2AE6 A;  1XMT A;  4KOT A;  2F7V A;  3WC7 A;  1YLO A;  2WPW A;  3K9U A;  3D7D A;  3RYO A;  4UCP A;  2Q7B A;  4YGO A;  4CAW A;  2AFO A;  4KOW A;  1NMT A;  3F5B A;  4OC2 A;  2AJ6 A;  4KSA A;  2Z3K A;  2NMT A;  5LYI A;  5K8M A;  2XEJ A;  5LRG A;  3LOD A;  4X2T A;  1QMU A;  2FT0 A;  3PZJ A;  4M6I A;  3PP9 A;  1JWQ A;  3BJ8 A;  1R57 A;  4R57 A;  1V0C A;  4TNU A;  2ATR A;  2ZEH A;  5IX3 A;  3BHX A;  3HLP A;  4UCN A;  4MJ8 A;  3TO9 A;  4A32 A;  2ZEO A;  3KHZ A;  4UFV A;  4FD6 A;  4KZT A;  1Y0Y A;  5G1Z A;  1FY7 A;  2DXQ A;  3H8E A;  1L0C A;  2PCU A;  3KQX A;  4P44 A;  4NGR A;  3IU2 A;  3BXM A;  4J3G A;  1VIX A;  3GB0 A;  3JRU A;  2JEW A;  4B14 A;  3IIB A;  1M44 A;  1ZG7 A;  3MN8 A;  2YNC C;  4MFJ A;  3P2F A;  4NEX A;  2DPT A;  3SI0 A;  1F2O A;  4ZY1 A;  3F8K A;  3S9N A;  3FF3 A;  1Q2Y A;  1MJA A;  1TIQ A;  4KOR A;  4CAF A;  2BOA A;  2DF5 A;  2ZW7 A;  4KVO E;  4UIB A;  5F46 A;  1J4J A;  1XMB A;  4G1P A;  4OID A;  4B13 A;  4MRI A;  1DTD A;  1TKH A;  2V77 A;  4HNW B;  4P4J A;  2WUU A;  4ZBG A;  2C6C A;  2OZG A;  3EC4 A;  3GLJ A;  4RS2 A;  2ZEP A;  3TX8 A;  5HXD A;  3TCV A;  2BUE A;  2FE7 A;  4AVC A;  3D7H A;  4I49 A;  2P0W A;  4OAE A;  4F9U A;  1IYK A;  5CBM A;  3FVL A;  3PB4 X;  4CGM A;  2JBK A;  3HUV A;  2XEI A;  1NSL A;  1M1D A;  3W6S A;  4JD6 A;  3CT9 A;  1YRE A;  2G3A A;  3I3G A;  4KUB A;  2J8N A;  3K9T A;  4MY0 A;  5F49 A;  5KTD A;  4PK3 A;  3KR5 A;  2AFZ A;  3PBE A;  1LCP A;  3IWE A;  1Z4E A;  2QJ8 A;  3H4Q A;  4PPZ A;  1X12 A;  2CY2 A;  4KOX A;  4Z65 A;  4OC4 A;  5I0C A;  1QSR A;  3PEI A;  2ZXV A;  4B5P A;  5IB9 A;  5JPH A;  1YLE A;  2Q4Y A;  2WSA A;  2CIJ A;  4UCM A;  4NGS A;  1ZG8 A;  3DSB A;  1YVK A;  1YR0 A;  2PJ4 A;  2ZEG A;  3PB6 X;  1CG2 A;  4FD5 A;  4H2K A;  1K4J A;  5JQ4 A;  4HNX B;  1XE4 A;  2Q7S A;  3PFE A;  1LAN A;  1XF8 A;  2IJZ A;  5EBV A;  4UFX A;  3D67 A;  3N5F A;  4EVY A;  3B3V A;  2B58 A;  4RUH A;  1LAM A;  4ZX8 A;  1ZO0 A;  2R98 A;  5IB0 A;  2EWB A;  3K2K A;  1BLL E;  1Z9U A;  1Z5R A;  1ZG9 A;  1XEB A;  3OWC A;  4JWP A;  5AG7 A;  4MFL A;  4PK2 A;  4P10 A;  4MBU A;  2DEA A;  4EWT A;  2YNC A;  1LOK A;  4FAI A;  4NSQ A;  3SHP A;  1QST A;  4XNH B;  4B12 A;  2PSW A;  4BD9 A;  4MHY A;  1LRZ A;  3LD2 A;  3T90 A;  8CPA A;  3KI9 A;  2R8V A;  1Z2L A;  2AFM A;  1RTQ A;  4M3S A;  3RNZ A;  2PJ1 A;  2I79 A;  3B2Y A;  1MJB A;  4PXD A;  1P4N A;  5JGF A;  4CGL A;  2C27 A;  1OBR A;  3WC5 A;  3TO7 A;  4QVT A;  4AVB A;  2CTB A;  1TKJ A;  4ONW A;  4WJB A;  3SJX A;  3V7Z A;  4CRY B;  2F8H A;  1B6B A;  1FNO A;  1M4D A;  2VBQ A;  4II9 A;  2A4N A;  1Z8W A;  5LRK A;  2PE3 A;  3EXN A;  4NGN A;  4IHM A;  2D4P A;  4M85 A;  4DYO A;  3CXS A;  2VL1 A;  4KVX A;  1A2Z A;  4H6U A;  1KUV A;  4PQA A;  4XNH C;  2QML A;  4HKF A;  4B5P B;  4BBH A;  4E0A A;  1JQG A;  5DS0 A;  3NA6 A;  4MHN A;  4ZYQ A;  2Q4V A;  2PJ2 A;  1HDQ A;  4P6Y A;  2Q04 A;  1Q7L A;  3FB3 A;  2PJ6 A;  2IL4 A;  3BLN A;  5C88 A;  3TC8 A;  2Z3M A;  4KOU A;  4WWV A;  3S6H A;  5EMI A;  4UEF A;  2I3C A;  3LAC A;  4XPK A;  4KOY A;  3B3S A;  2Y0M A;  5LYF A;  1BPM A;  2JDD A;  2O53 A;  2Z0Z A;  4CAX A;  4PSX A;  1IOI A;  4JJX A;  4FUU A;  4P45 A;  2PJ5 A;  2ZPA A;  4KS9 A;  4R9M A;  2PC1 A;  2PJ0 A;  4CPA A;  4EFD A;  1DE4 C;  2XEF A;  3N7Z A;  3EO4 A;  4K3N A;  2VI7 A;  4MXU A;  4B5O A;  4KSI A;  1ARL A;  1XRY A;  3IJ3 A;  2QYV A;  1OZP A;  1GYT A;  2AFX A;  4OP4 A;  4NGM A;  4FD4 A;  4TWE A;  2FCK A;  3C26 A;  3NE8 A;  2D4O A;  2Z3P A;  3FED A;  4P4B A;  5HMN A;  3TO6 A;  4Y49 B;  1AUG A;  1H8L A;  3B7I A;  1ZLH A;  2P6E A;  1S5K A;  4A95 A;  2CNS A;  5DWM A;  1HEE A;  4C7I A;  2GAN A;  3B8G A;  3FEC A;  4NGP A;  1VKC A;  3UY5 A;  4UBR A;  1YX0 A;  5G21 A;  3R96 A;  3D2P A;  4A94 A;  3R1K A;  3WR7 A;  2WZN A;  4UEE A;  4A37 A;  4AG7 A;  3E0K A;  2RC4 A;  5FVJ A;  2RFH A;  3DNS A;  4W9Y A;  4MHD A;  1QSO A;  3T8W A;  5F47 A;  4R8F A;  4A30 A;  5LRJ A;  1UFH A;  1IID A;  2B5G A;  1I21 A;  1BO4 A;  1BAV A;  3FJU A;  1I1D A;  2G0B A;  2O4H A;  2YGW A;  2Z10 A;  4Y49 C;  4MCP A;  3FYN A;  1IGB A;  3BI1 A;  1M4G A;  5D8N A;  5A27 A;  1Z8L A;  3D66 A;  1S60 A;  3NH8 A;  3TOA A;  4A33 A;  1Z4R A;  3CXP A;  5F09 A;  4AG9 A;  2V8H A;  4K30 A;  2PRQ A;  1Q2D A;  3F0A A;  2PR8 A;  3D68 A;  2ZEL A;  3FH4 A;  3H8F A;  6CPA A;  2GRE A;  3GUX A;  1CM0 A;  4RN7 A;  4NJQ A;  1YQE A;  4MFP A;  1YGH A;  3MGD A;  5THW A;  3VAT A;  2XEG A;  4F8Z A;  1Q2C A;  3IGR A;  4MMO A;  2FL4 A;  4OC0 A;  2QVP A;  3DDD A;  2V8V A;  5K8O A;  4NGQ A;  5HH1 A;  1KUY A;  2OH1 A;  4MFQ A;  1IU8 A;  4OAD A;  2PRB A;  2RB7 A;  2EVN A;  4F0X A;  4B6Z A;  2ABZ A;  3KKW A;  2CNT A;  3LMS A;  3NH4 A;  4OC1 A;  4KLW A;  4Q36 A;  4P4I A;  4UA3 A;  5LYD A;  2CXA A;  3SJG A;  4IK2 A;  1M4I A;  2POK A;  1I12 A;  2PQ8 A;  4MFK A;  1QQ9 A;  2VXK A;  2VEZ A;  3FMC A;  4PXC A;  5J8C A;  1S7F A;  3JTK A;  1GHE A;  4MHP A;  1XOV A;  1Y9W A;  1CPS A;  1CP6 A;  3BJ7 A;  3QAH A;  3CPA A;  4LQ6 A;  1YW6 A;  5J8F A;  1Y9K A;  3S6F A;  4CYP A;  4PV6 A;  3R9E A;  3GY9 A;  4NXY A;  4PXE A;  1KUX A;  2WPX A;  3V8I A;  3IU1 A;  4AXV A;  3SXO A;  2B5G B;  3FNC A;  3G8W A;  1YK3 A;  2BCO A;  2K5T A;  3T9Y A;  4AB7 A;  1Z8X A;  1BOB A;  4JXQ A;  4X8I A;  3W6X A;  4XPL A;  3GIU A;  2OR4 A;  1IYL A;  1N71 A;  4OME A;  4RI1 A;  4E8O A;  1WWZ A;  3B3W A;  3KL9 A;  2P6G A;  3PBB A;  4KUA A;  3PGP A;  1ZLI A;  2QEC A;  3VWD A;  5ELY A;  2HB6 A;  4R3K A;  2GE3 A;  3PB7 X;  2GLJ A;  3EFA A;  3PB8 X;  4R3L A;  3S9M A;  3VH9 A;  5F48 A;  4NFR A;  1NE9 A;  4CRZ B;  1Y0R A;  3I9S A;  4IUS A;  5C82 A;  3H5Z A;  1AYE A;  4R76 A;  4BIN A;  2PVW A;  3NH5 A;  2F5I A;  2G3T A;  1B87 A;  4P4D A;  4QBJ A;  3PB9 X;  2C6P A;  4NGT A;  4GM5 A;  5H84 A;  4A2Z A;  4OC5 A;  5KTA A;  2CTC A;  4AVA A;  1CX8 A;  1M4L A;  3IWW A;  1Y7E A;  1PCA A;  4MI4 A;  1Z8T A;  2ZEN A;  4OC3 A;  1MK4 A;  3VAR A;  1YW4 A;  4C2Y A;  4ZY2 A;  1MJ9 A;  3CDX A;  1VHS A;  1ARM A;  5A28 A;  2AFW A;  2Z3O A;  2Q43 A;  2ZW5 A;  3KGQ A;  2CNM A;  4KLV A;  2PJB A;  4ONU A;  1IB1 E;  2YNE A;  4JZ0 A;  3RAM A;  1WK4 A;  4YWY A;  4M6G A;  3R9F A;  4KSF A;  2PJ9 A;  1TF8 A;  5JM6 A;  1LAP A;  1PYT B;  1XJO A;  4LQG A;  3RZA A;  1AMP A;  4JLY A;  2B4B A;  2PJ3 A;  2VZZ A;  5LYL A;  2B4D A;  2NYQ A;  4MCS A;  2GFQ A;  2HV2 A;  5BWA B;  2C1C A;  4ZGY B;  5J1Q A;  2PIZ A;  4NF1 A;  4PXB A;  1FT7 A;  2JDC A;  4IF5 A;  4KOS A;  2DPS A;  1VHO A;  1S3Z A;  2PJ7 A;  1YVO A;  3IFE A;  1UWY A;  2V8D A;  4KOV A;  3FEE A;  3LWU A;  2AFS A;  4UIA A;  4JXR A;  3R9G A;  3IEH A;  2J8R A;  1YME A;  4PSW A;  2ANP A;  3JUW A;  2BEI A;  4KVM E;  4UEZ A;  5DWN A;  1TKF A;  3RBU A;  4CYO A;  2GLF A;  3D4U A;  4IAV A;  1S7N A;  4R87 A;  2Z3N A;  4CGN A;  2REF A;  4XPD B;  5I4M A;  3DR6 A;  2Q4Z A;  2B3V A;  4CAV A;  1ELM P;  2PJ8 A;  3D8P A;  3MRU A;  4X3R A;  4A38 A;  4UWJ A;  3KR4 A;  3ISX A;  3S6K A;  3EY5 A;  5G20 A;  3PRT A;  4H89 A;  2ARH A;  3IO1 A;  4DNC A;  2Z3L A;  1QSN A;  1VHE A;  2FIA A;  2PJA A;  1NSA A;  1BPN A;  2ZW6 A;  2BO9 A;  1ELL P;  5K8P A;  2OOT A;  3KAS A;  4C68 A;  2Q44 A;  4CS0 B;  3FIX A;  2VQY A;  2HUZ A;  4XPD C;  2ZEF A;  1R3N A;  2WYR A;  1KZF A;  5K8N A;  3JVN A;  4R7M A;  4EME A;  2Q51 A;  2I00 A;  3D2M A;  4ZX9 A;  3SI2 A;  2FVG A;  4GXH A;  1P0H A;  3FRM A;  2EK8 A;  4O23 A;  5AGE A;  1X10 A;  4UF4 A;  3W91 A;  2B4D B;  4F9V A;  3GYA A;  1XBU A;  4P4E A;  2KCW A;  3ISZ A;  4E2A A;  5IV0 A;  3CXQ A;  4A39 A;  3V38 A;  3GKR A;  4LX9 A;  1IOF A;  2REE A;  3D3S A;  3RO0 A;  5E96 A;  2HQY A;  1RXT A;  2IMO A;  2CF4 A;  2P6F A;  3G3S A;  1VGY A;  2ZED A;  4QB9 A;  4C7H A;  3TE4 A;  3CZX A;  1PUA A;  3KZW A;  3SXN A;  3R95 A;  3ZZI A;  1SQH A;  2ZEE A;  3BI0 A;  2OB0 A;  4L8A A;  4BMH A;  4L89 A;  4MCQ A;  1CBX A;  2FIW A;  3DGV A;  1CJW A;  4FWU A;  4X5K A;  2FS5 A;  5D29 A;  5EC4 A;  4NJR A;  5HVF A;  1F57 A;  2BL1 A;  4CGO A;  1TF9 A;  4YU9 A;  2JEV A;  1RO5 A;  4C2X A;  4A31 A;  2J8M A;  3SJF A;  3TT2 A;  5JH9 A;  3IWG A;  4ZY0 A;  3NFZ A;  4C2Z A;  4OKO A;  2R7H A;  4Q38 A;  2GU2 A;  3H8G A;  4LUA A;  1HDU A;  2OZU A;  1QSM A;  2EUI A;  1F2P A;  3QB8 A;  4R6T A;  4CYQ A;  3S6G A;  2VZY A;  2JBJ A;  4FD7 A;  5HVG A;  3DR8 A;  2H5M A;  3FBU A;  5AG6 A;  2ZEM A;  1CP7 A;  4DJL A;  4U5Y A;  1PU9 A;  4CYN A;  4MHZ A;  3VWE A;  4GS4 A;  5HVH A;  2JLM A;  4F0Y A;  3CPX A;  3SJE A;  2C6G A;  4UWI A;  4FBE A;  4MFZ A;  3L2N A;  5GCN A;  2PR1 A;  2O28 A;  4MCR A;  4B11 A;  2G9D A;  7CPA A;  5AG4 A;  3NE7 A;  4CAE A;  5KTC A;  4QUS A;  3WC6 A;  1LFW A;  2FSR A;  1S7L A;  2IQ6 A;  4JYW A;  2QIR A;  4OIW A;  2PIY A;  5CNP A;  3KHX A;  3KQZ A;  2R1I A;  3TTH A;  4ORF A;  3I1U A;  2EK9 A;  4YFJ A;  5H86 A;  4MY3 A;  5ISV A;  3IC1 A;  2BSW A;  2OU2 A;  4HNY B;  3SI1 A;  4M6H A;  4Q7A A;  1XIX A;  2ZOG A;  3B35 A;  4U9Y A;  4CGP A;  3TFY A;  3A9L A;  3DLJ A;  2NSM A;  2OZH A;  2Q0Y A;  3D7G A;  5CPA A;  4H6Z A;  1S7K A;  3P2H A;  1CPX A;  2ZOF A;  2FXF A;  1IIC A;  3ZJ0 A;  1EE3 P;  4HPS A;  4F6A A;  3B3C A;  5G22 A;  1IY7 A;  2AFU A;  4NCZ A;  2GIV A;  2PJC A;  4UFW A;  5AG5 A;  2EO8 A;  3TOB A;  1Y7R A;  3QAY A;  3WT4 A;  4ZI6 A;  1YSJ A;  1TXR A;  4P4F A;  3PFO A;  2B3U A;  3S9L A;  3FX6 A;  4DUK A;  4B10 A;  3FXT A;  1ON0 A;  2YND A;  4OLL A;  1U6M A;  2J9A A;  1R43 A;  2EBJ A;  2ODF A; 
#chains in the Genus database with same CATH homology
 4YRH A;  2X7B A;  2ZW4 A;  2PDO A;  2Z11 A;  4U9Z A;  4QC6 A;  2AE6 A;  1XMT A;  4KOT A;  2WPW A;  3K9U A;  3RYO A;  4UCP A;  2Q7B A;  4YGO A;  4CAW A;  4KOW A;  1NMT A;  3F5B A;  2AJ6 A;  4KSA A;  2Z3K A;  2NMT A;  3LOD A;  2FT0 A;  3PZJ A;  3PP9 A;  3BJ8 A;  1R57 A;  4R57 A;  1V0C A;  5IX3 A;  2ATR A;  4UCN A;  4MJ8 A;  3TO9 A;  4A32 A;  4UFV A;  4FD6 A;  4KZT A;  5G1Z A;  1FY7 A;  2DXQ A;  1L0C A;  3IU2 A;  4J3G A;  4B14 A;  1M44 A;  2YNC C;  4MFJ A;  3P2F A;  4NEX A;  2DPT A;  3F8K A;  1Q2Y A;  1MJA A;  1TIQ A;  4KOR A;  4CAF A;  2ZW7 A;  4KVO E;  5F46 A;  1J4J A;  4B13 A;  4HNW B;  2WUU A;  4ZBG A;  2OZG A;  3EC4 A;  4RS2 A;  3TCV A;  2BUE A;  2FE7 A;  4AVC A;  4I49 A;  2P0W A;  4OAE A;  1IYK A;  4CGM A;  3W6S A;  1NSL A;  1M1D A;  4JD6 A;  1YRE A;  2G3A A;  3I3G A;  4KUB A;  2J8N A;  5F49 A;  4MY0 A;  5KTD A;  4PK3 A;  3IWE A;  1Z4E A;  3H4Q A;  5I0C A;  4KOX A;  2CY2 A;  1QSR A;  5JPH A;  2ZXV A;  4B5P A;  1YLE A;  2Q4Y A;  2WSA A;  4UCM A;  3DSB A;  1YVK A;  1YR0 A;  5JQ4 A;  4FD5 A;  1K4J A;  4HNX B;  1XE4 A;  1XF8 A;  5EBV A;  4UFX A;  4EVY A;  2B58 A;  1ZO0 A;  2R98 A;  5IB0 A;  1Z9U A;  3OWC A;  1XEB A;  4JWP A;  5AG7 A;  4MFL A;  4PK2 A;  4MBU A;  2YNC A;  4NSQ A;  3SHP A;  1QST A;  4XNH B;  4B12 A;  2PSW A;  1LRZ A;  3LD2 A;  3T90 A;  2R8V A;  4M3S A;  2I79 A;  1MJB A;  1P4N A;  4CGL A;  2C27 A;  3TO7 A;  4QVT A;  4AVB A;  4CRY B;  1B6B A;  1M4D A;  2VBQ A;  4II9 A;  2A4N A;  3EXN A;  2D4P A;  4M85 A;  3CXS A;  4KVX A;  4H6U A;  4XNH C;  1KUV A;  2QML A;  4HKF A;  4B5P B;  4BBH A;  4E0A A;  2Q4V A;  2Q04 A;  3FB3 A;  2IL4 A;  3BLN A;  5C88 A;  2Z3M A;  4KOU A;  3S6H A;  4XPK A;  4KOY A;  2Y0M A;  2Z0Z A;  2JDD A;  4CAX A;  4PSX A;  4JJX A;  2ZPA A;  4KS9 A;  4R9M A;  2PC1 A;  3N7Z A;  3EO4 A;  2VI7 A;  4B5O A;  1OZP A;  4FD4 A;  2FCK A;  3C26 A;  2D4O A;  2Z3P A;  5HMN A;  3TO6 A;  4Y49 B;  2P6E A;  1S5K A;  4A95 A;  2CNS A;  5DWM A;  4C7I A;  2GAN A;  3B8G A;  1VKC A;  3UY5 A;  4UBR A;  1YX0 A;  5G21 A;  3R96 A;  3D2P A;  3R1K A;  3WR7 A;  4AG7 A;  3E0K A;  2RC4 A;  5FVJ A;  3DNS A;  4MHD A;  1QSO A;  5F47 A;  4A30 A;  1UFH A;  1IID A;  2B5G A;  1I21 A;  1BO4 A;  1I1D A;  2G0B A;  2Z10 A;  2YGW A;  4Y49 C;  3FYN A;  1M4G A;  5A27 A;  4A33 A;  1S60 A;  3TOA A;  1Z4R A;  3CXP A;  4AG9 A;  4K30 A;  1Q2D A;  3F0A A;  2PR8 A;  1CM0 A;  4MFP A;  1YGH A;  3MGD A;  1Q2C A;  3IGR A;  2FL4 A;  3DDD A;  5HH1 A;  1KUY A;  2OH1 A;  4MFQ A;  4OAD A;  2PRB A;  2EVN A;  4F0X A;  3KKW A;  2CNT A;  4KLW A;  4Q36 A;  4UA3 A;  2CXA A;  1M4I A;  1I12 A;  2PQ8 A;  4MFK A;  2VXK A;  2VEZ A;  5J8C A;  1S7F A;  3JTK A;  1GHE A;  1Y9W A;  3BJ7 A;  3QAH A;  5J8F A;  1Y9K A;  3S6F A;  4CYP A;  4PV6 A;  3R9E A;  3GY9 A;  4NXY A;  1KUX A;  2WPX A;  3V8I A;  3IU1 A;  3SXO A;  2B5G B;  3FNC A;  3G8W A;  1YK3 A;  2K5T A;  3T9Y A;  4AB7 A;  1BOB A;  4JXQ A;  3W6X A;  4XPL A;  1IYL A;  1N71 A;  4E8O A;  4RI1 A;  1WWZ A;  2P6G A;  4KUA A;  3PGP A;  3VWD A;  2QEC A;  4R3K A;  2GE3 A;  4CRZ B;  3EFA A;  4R3L A;  5F48 A;  1NE9 A;  3I9S A;  4IUS A;  5C82 A;  3H5Z A;  2F5I A;  2G3T A;  1B87 A;  4QBJ A;  5H84 A;  4A2Z A;  5KTA A;  4AVA A;  4MI4 A;  4C2Y A;  1MK4 A;  1MJ9 A;  1VHS A;  5A28 A;  2Z3O A;  2ZW5 A;  2CNM A;  4KLV A;  4ONU A;  1IB1 E;  2YNE A;  1WK4 A;  3R9F A;  4KSF A;  4JLY A;  2B4B A;  2VZZ A;  2B4D A;  2HV2 A;  5BWA B;  4ZGY B;  4NF1 A;  2JDC A;  4IF5 A;  4KOS A;  2DPS A;  1S3Z A;  1YVO A;  4KOV A;  4JXR A;  3R9G A;  2J8R A;  4PSW A;  3JUW A;  2BEI A;  4KVM E;  5DWN A;  4CYO A;  1S7N A;  4R87 A;  2Z3N A;  4CGN A;  2REF A;  4XPD B;  3DR6 A;  4CAV A;  2B3V A;  3D8P A;  4UWJ A;  3S6K A;  3EY5 A;  5G20 A;  4H89 A;  2ARH A;  4DNC A;  2Z3L A;  1QSN A;  2FIA A;  2ZW6 A;  4C68 A;  2Q44 A;  4CS0 B;  3FIX A;  2VQY A;  2HUZ A;  4XPD C;  1KZF A;  3JVN A;  2I00 A;  3D2M A;  1P0H A;  3FRM A;  5AGE A;  3W91 A;  2B4D B;  3GYA A;  2KCW A;  4E2A A;  5IV0 A;  3CXQ A;  3GKR A;  4LX9 A;  2REE A;  3D3S A;  5E96 A;  2HQY A;  1RXT A;  2P6F A;  3G3S A;  4C7H A;  3TE4 A;  4QB9 A;  1PUA A;  3SXN A;  3ZZI A;  3R95 A;  4BMH A;  1SQH A;  4L8A A;  2OB0 A;  4L89 A;  2FIW A;  4X5K A;  1CJW A;  5EC4 A;  2FS5 A;  2BL1 A;  4CGO A;  4C2X A;  2JEV A;  1RO5 A;  4A31 A;  2J8M A;  3TT2 A;  3IWG A;  4C2Z A;  2R7H A;  4Q38 A;  4LUA A;  2OZU A;  1QSM A;  2EUI A;  3QB8 A;  4CYQ A;  3S6G A;  2VZY A;  4FD7 A;  3DR8 A;  2H5M A;  3FBU A;  5AG6 A;  4U5Y A;  1PU9 A;  4CYN A;  3VWE A;  4GS4 A;  2JLM A;  4F0Y A;  4UWI A;  4MFZ A;  5GCN A;  2PR1 A;  2O28 A;  4B11 A;  5AG4 A;  3NE7 A;  4CAE A;  5KTC A;  4QUS A;  2FSR A;  1S7L A;  2QIR A;  5CNP A;  2R1I A;  3TTH A;  4ORF A;  4YFJ A;  5ISV A;  5H86 A;  4MY3 A;  2BSW A;  2OU2 A;  4HNY B;  1XIX A;  4U9Y A;  4CGP A;  3TFY A;  3A9L A;  2OZH A;  2Q0Y A;  4H6Z A;  1S7K A;  3P2H A;  2FXF A;  1IIC A;  3ZJ0 A;  4F6A A;  5G22 A;  4NCZ A;  2GIV A;  4UFW A;  5AG5 A;  3TOB A;  1Y7R A;  2B3U A;  4B10 A;  3FXT A;  1ON0 A;  2YND A;  4OLL A;  1U6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...