2B4DB

Ssat+coa+sp- sp disordered
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
170
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 34
structure length 169
sequence length 170
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4dB00
1QSRA 1VHSA 4AVBA 3R95A 2CNTA 2FT0A 4PK2A 4BMHA 1V0CA 4IF5A 5GCNA 2PQ8A 4L89A 2QECA 2BL1A 3H4QA 2OH1A 3R9FA 4MY0A 2VI7A 4UA3A 3S6HA 2BUEA 4JLYA 3CXPA 2B5GB 1KUXA 2QIRA 4FD6A 3T9YA 2OZGA 4KUBA 1U6MA 3W91A 2QMLA 4JD6A 1B6BA 3S6GA 1S7FA 1OZPA 2FCKA 2J8MA 4M3SA 2P0WA 1QSOA 3TE4A 1Z4EA 4XPLA 2G3TA 5H84A 2Q0YA 3I9SA 4M85A 2CY2A 4AVAA 5ISVA 4MHDA 2X7BA 1TIQA 1UFHA 5H86A 4FD5A 3PZJA 5DWNA 2JLMA 4F6AA 1S7KA 4XPKA 5KTDA 3F0AA 2B4DA 2FL4A 4ZBGA 1IB1E 2B4DB 2ZXVA 5HH1A 2OU2A 1MJBA 5DWMA 1I1DA 4H6ZA 3QB8A 2ZW5A 2BEIA 2EVNA 1IICA 3S6FA 3TO9A 1L0CA 4AG9A 2Q4VA 3T90A 2OZHA 4YRHA 4RI1A 1NSLA 1S3ZA 3TOAA 2ZW4A 3GKRA 3NE7A 1RXTA 2CNMA 4KOXA 1Y7RA 1QSMA 2Q44A 5J8CA 5E96A 3EC4A 4J3GA 4QC6A 3FBUA 1B87A 1N71A 4E0AA 5HMNA 4CAXA 4JXRA 3B8GA 3RYOA 3EO4A 1CJWA 3N7ZA 4Y49C 2WPWA 1S7LA 3D2PA 4PSXA 4QUSA 3UY5A 4AVCA 2FS5A 4I49A 3IWGA 4U9YA 2ARHA 3QAHA 1IIDA 3VWEA 2PRBA 2G0BA 3EY5A 3BLNA 3R9EA 1YVKA 4B5PB 4FD4A 4RS2A 3DR8A 4KZTA 4IUSA 4MJ8A 5EC4A 2GE3A 2IL4A 4E8OA 5F48A 3VWDA 4KOVA 4XNHB 4HNXB 2J8NA 3FIXA 1P0HA 1Y9WA 4CS0B 2ZPAA 4R9MA 4E2AA 2PDOA 3C26A 2D4PA 3G8WA 2F5IA 2ZW7A 4FD7A 2GANA 4KUAA 4AB7A 4CAWA 3W6SA 3D8PA 3FNCA 2KCWA 4H6UA 4NEXA 2VZZA 1M4DA 4YFJA 1CM0A 2HV2A 2Z11A 2Y0MA 2VQYA 3D3SA 1KZFA 3FRMA 1Z9UA 2K5TA 2HUZA 4QBJA 5JPHA 1QSTA 1P4NA 2C27A 4KOUA 3PP9A 4NF1A 5IV0A 1KUYA 4XPDB 2B3UA 3I3GA 4NXYA 2CNSA 4EVYA 3E0KA 3P2HA 1M1DA 4HNWB 4JJXA 5F47A 4QB9A 3MGDA 4KOSA 2WPXA 2FSRA 4OADA 3KKWA 3ZJ0A 3JVNA 4AG7A 4F0YA 1BOBA 3FB3A 2REEA 1YX0A 2GIVA 1M44A 3R9GA 5C82A 2R98A 1YK3A 4PK3A 4R57A 2AE6A 2G3AA 2JEVA 5I0CA 3TT2A 4ONUA 4R3KA 2REFA 5KTCA 2R8VA 2Q4YA 1FY7A 1S60A 4JXQA 1NE9A 3FYNA 2R7HA 1I12A 1R57A 1YLEA 4KVXA 2EUIA 2ZW6A 2P6FA 3TOBA 4OAEA 3LD2A 1MJAA 1J4JA 4UWJA 1VKCA 4H89A 2ATRA 3CXSA 5J8FA 1BO4A 4NSQA 2PR8A 4UWIA 4PSWA 3SHPA 4U9ZA 1IYKA 1K4JA 3S6KA 4NCZA 3TTHA 1Y9KA 2R1IA 4II9A 4KOYA 4L8AA 3G3SA 2OZUA 4X5KA 1SQHA 3FXTA 4HNYB 1RO5A 4R87A 1Q2YA 4YGOA 1GHEA 2FIAA 2VZYA 4KVOE 1XEBA 1S7NA 3SXNA 2PR1A 1YREA 2B4BA 5CNPA 3D2MA 1Q2DA 1KUVA 3DNSA 2JDCA 2P6EA 3BJ8A 5C88A 1MK4A 3PGPA 4CRYB 2HQYA 3TO7A 1Q2CA 3F8KA 4QVTA 1PUAA 2D4OA 4MI4A 4K30A 1NMTA 2FE7A 4CRZB 2B3VA 3W6XA 4KLVA 1PU9A 3LODA 4KLWA 3BJ7A 3DR6A 3IGRA 1M4GA 5IX3A 2VEZA 2PSWA 4KVME 1LRZA 3TCVA 2VXKA 2Z10A 3TFYA 2A4NA 2FIWA 2I00A 2AJ6A 2P6GA 3R96A 2NMTA 2VBQA 4HKFA 2FXFA 4OLLA 2JDDA 1YGHA 2RC4A 5FVJA 3WR7A 1XE4A 1XIXA 3TO6A 1S5KA 1XF8A 4JWPA 4ORFA 4UBRA 2B58A 1YR0A 1Z4RA 1YVOA 4Y49B 4KORA 3ZZIA 5KTAA 1IYLA 1M4IA 3V8IA 2BSWA 4XPDC 4DNCA 3OWCA 2I79A 2PC1A 2O28A 3K9UA 3SXOA 2J8RA 3DDDA 5F46A 4CAVA 3JUWA 1WWZA 3DSBA 4LX9A 4R3LA 3CXQA 1ON0A 2H5MA 2Q04A 2Z0ZA 4PV6A 1MJ9A 5F49A 5JQ4A 4B5PA 3F5BA 4GS4A 3R1KA 4KOWA 5IB0A 2B5GA 4LUAA 1I21A 4MY3A 1QSNA 4XNHC 2Q7BA 3GY9A 4MBUA 3GYAA 5EBVA 4KOTA 4U5YA 1XMTA 3EFAA 2OB0A 3P2FA 4B5OA 1WK4A 2DXQA 3EXNA
chains in the Genus database with same CATH superfamily
1QSRA 1VHSA 4AVBA 2C6GA 1CX8A 3R95A 2CNTA 3S9MA 2FT0A 4PK2A 5AG5A 2GLJA 3D7FA 5AG6A 4BMHA 4BBHA 1V0CA 3TC8A 4IF5A 2V8GA 5GCNA 5ELYA 1HEEA 2PQ8A 4L89A 2QECA 3PB6X 3PB4X 2BL1A 3H4QA 2OH1A 4CYOA 3R9FA 2J9AA 4MY0A 2VI7A 4UA3A 3S6HA 4FUUA 2BUEA 4DJLA 4JLYA 2PJ3A 3CXPA 3HUVA 4O23A 2ZEHA 1ZG8A 3IO1A 1PYTB 2B5GB 3LACA 1KUXA 2QIRA 4IK2A 4FD6A 3T9YA 2OZGA 1GYTA 1U6MA 3K2KA 2XEIA 4KUBA 3W91A 2QMLA 5THWA 5JGFA 4JD6A 2EO8A 3NFZA 1B6BA 3S6GA 1S7FA 4F8ZA 1Y0RA 3IEHA 1OZPA 2AFZA 2FCKA 2J8MA 4HPSA 5D8NA 4ZX9A 3IIBA 3PBEA 4UIBA 4M3SA 1Y7EA 1Z8XA 1R43A 2P0WA 1QSOA 3B2YA 3QAYA 3MRUA 3TE4A 2AFOA 1Z4EA 2O53A 4XPLA 2G3TA 2GFQA 5H84A 4ZY0A 4B11A 4C2YA 2Q0YA 3VARA 3I9SA 4AXVA 2O4HA 4M85A 4YWYA 1TF9A 2PE3A 2Q4ZA 5BWAB 2CY2A 4AVAA 5ISVA 5G20A 7CPAA 4MHDA 3HLPA 2X7BA 4OC5A 4NJQA 1TIQA 3CZXA 4MHYA 5HVFA 1X10A 1UFHA 2GU2A 3SI0A 1TKFA 5H86A 5J1QA 2G9DA 4FD5A 3PZJA 3PBBA 5DWNA 2JLMA 4F6AA 1S7KA 2AFMA 4XPKA 3IU2A 3WC6A 1AUGA 2CXAA 4P4EA 5KTDA 4CYPA 3S9LA 2PJ6A 3F0AA 3FMCA 4WWVA 2B4DA 2FL4A 4ZBGA 3B3SA 1IB1E 4MFKA 2VL1A 3WT4A 2B4DB 2ZXVA 1YSJA 5HH1A 5LRGA 2PCUA 3H8GA 4MFPA 1ZG9A 2OU2A 1MJBA 3IWWA 4PXCA 5DWMA 1I1DA 1YW4A 1F2PA 4PXBA 3FVLA 4H6ZA 4RN7A 2PJ9A 4MFQA 3PFEA 2JBKA 3PRTA 2PJCA 2ZEPA 3QB8A 4IHMA 2ZW5A 2ZEMA 2BEIA 2PRQA 2EVNA 3KR5A 3BI1A 3H8FA 4R76A 4A30A 4C2ZA 1IICA 3S6FA 3TO9A 3V38A 5HVGA 2BCOA 1L0CA 4MCSA 4AG9A 2Q4VA 3T90A 4OC2A 2OZHA 1X12A 4YRHA 2Z3LA 4RI1A 4H2KA 2ZEGA 3FECA 2POKA 1S3ZA 1NSLA 3SJXA 1JWQA 3TOAA 2ZW4A 3GKRA 2QJ8A 3NE7A 1RXTA 2CNMA 3KZWA 2EK8A 4MHNA 2PJBA 4KOXA 4Q7AA 1QSMA 1Y7RA 4CPAA 3FEDA 2Q44A 2ZEOA 2ZOGA 3IWEA 4OIWA 5J8CA 5E96A 3EC4A 4J3GA 4QC6A 3FBUA 1B87A 1N71A 4E0AA 5HMNA 2NSMA 4GM5A 2WZNA 5LYFA 4CAXA 4NGMA 1XRYA 4JXRA 3B8GA 3RYOA 3EO4A 2ZOFA 1CJWA 3N7ZA 1IY7A 4UIAA 4Y49C 1YMEA 3NH5A 2EWBA 2WPWA 1S7LA 2XEFA 4MFLA 3SJGA 3D2PA 4PSXA 3LMSA 3SJEA 4QUSA 1Z2LA 4UFVA 3D7GA 3UY5A 2ZEFA 4AVCA 1VHOA 1BPMA 1Z8WA 2RFHA 2FS5A 4I49A 4Z65A 4UFXA 4NGPA 3IWGA 4U9YA 2ARHA 3QAHA 4OIDA 2ABZA 1IIDA 3IFEA 3VWEA 2PRBA 4C68A 5JH9A 2G0BA 3B7IA 3PFOA 3EY5A 4CGPA 4EFDA 3BLNA 1LFWA 3B3VA 3R9EA 4A38A 2IMOA 1Z5RA 4CAEA 1YVKA 3NH8A 4KSAA 3B3TA 4B5PB 1M4LA 4FD4A 2Z3KA 1VGYA 4RS2A 1ZLHA 3DR8A 4A37A 4KZTA 4NFRA 2YNEA 2DPSA 4MFZA 4IUSA 4MJ8A 4B13A 1AMPA 2DPTA 3BXMA 4UF4A 4P4DA 3RAMA 1VIXA 4C2XA 4X3RA 5EC4A 2Z3OA 4LQ6A 3RBUA 2GLFA 4MCPA 2GE3A 2IL4A 4E8OA 2PVWA 1VHEA 5F48A 3VWDA 4FAIA 4NGNA 5LRKA 4KOVA 4XNHB 2RB7A 5HXDA 4HNXB 3KHZA 4OC3A 4B6ZA 2J8NA 3FIXA 1P0HA 3DLJA 1Y9WA 1BAVA 4JZ0A 2ZPAA 2BO9A 4R9MA 4CS0B 2PDOA 4E2AA 3C26A 2D4PA 3ISZA 4UCNA 5JM6A 4UEEA 1IU8A 3G8WA 2F5IA 2ZW7A 4A31A 4FD7A 2GANA 4KUAA 3FH4A 2OR4A 4AB7A 4OC4A 4PQAA 4CAWA 2Z3NA 4P10A 3W6SA 2EBJA 4A33A 1XBUA 3D8PA 2QVPA 2WUUA 3FNCA 2KCWA 4H6UA 4NEXA 4MHZA 5LRJA 3WC5A 4FBEA 5K8PA 2VZZA 1M4DA 4YFJA 1CM0A 4G1PA 2JEWA 4OC0A 2HV2A 1ELLP 2Z11A 4ZY1A 1TKHA 2PJ2A 1IOFA 2Y0MA 1UWYA 2VQYA 1KZFA 1LOKA 2CTCA 2ODFA 2WYRA 2YNCC 3D3SA 1Z9UA 3FRMA 2K5TA 2HUZA 2I3CA 4FWUA 4IAVA 5G1ZA 4QBJA 3L2NA 5JPHA 2CF4A 4BINA 4F0XA 2NYQA 3KR4A 3T8WA 4JYWA 1NSAA 5HVHA 5F09A 2YNCA 3N5FA 3FX6A 1QSTA 1P4NA 1BPNA 2C27A 2Q7SA 3PP9A 4KOUA 4NF1A 5IV0A 2AFWA 4C7IA 3QNVA 3SJFA 1KUYA 4CAFA 1LAMA 3ISXA 1CP7A 4XPDB 2B3UA 3BHXA 3I3GA 4NXYA 2CNSA 4TNUA 3RNZA 4EVYA 3E0KA 3B3WA 3NH4A 1M1DA 3P2HA 4HNWB 4JJXA 3MN8A 5F47A 5LYLA 2WSAA 2QYVA 4QB9A 3MGDA 4C7HA 4KOSA 2YGWA 2WPXA 3KASA 2FSRA 4OADA 3KKWA 3KI9A 3JVNA 3ZJ0A 4AG7A 4BD9A 4F0YA 3GIUA 1BOBA 3FF3A 2C6PA 5K8OA 3FB3A 2REEA 1YX0A 2GIVA 1M44A 3R9GA 5K8MA 5C82A 2R98A 1QQ9A 1YK3A 4PK3A 1EE3P 1Z8TA 4M6GA 4R57A 2AE6A 2G3AA 2JEVA 5I0CA 3KL9A 1YW6A 3TT2A 4ONUA 4R3KA 2REFA 3KQZA 2R8VA 2Q4YA 2PJAA 1FY7A 1S60A 3B35A 5I4MA 5KTCA 4JXQA 4CYNA 3FEEA 1XMBA 5CBMA 1NE9A 2FVGA 8CPAA 3K9TA 5CPAA 2PJ4A 1Z8LA 3CPXA 4UEFA 4OP4A 3FYNA 2R7HA 3B3CA 1I12A 3IC1A 1R57A 1YLEA 4KVXA 4CGMA 2EUIA 2ZW6A 1HDUA 2P6FA 3TOBA 3VH9A 4PXDA 2V8VA 3GLJA 1YQEA 4OAEA 3DGVA 4CGOA 4NGSA 1OBRA 4UCPA 3LD2A 3IU1A 1MJAA 1XJOA 4UCMA 2PJ7A 4OMEA 3RO0A 2HC9A 4F9UA 3D4UA 3D7HA 2ZEDA 5K8NA 4MFJA 1J4JA 4UWJA 1VKCA 4H89A 1TXRA 2ATRA 1FT7A 3CXSA 3D68A 5J8FA 1BO4A 4NSQA 2PR8A 4UWIA 3D7DA 2JBJA 4PSWA 4ZX8A 3SHPA 4P4IA 4U9ZA 1XOVA 1IYKA 3TX8A 1K4JA 4UFWA 3S6KA 3CPAA 2Z3MA 4NCZA 4P4FA 2C1CA 2Q43A 4CGLA 4ZGYB 3TTHA 1Y9KA 2R1IA 2CIJA 2V77A 3KHXA 4A94A 4EMEA 4II9A 3LWUA 4P45A 4KOYA 1Q7LA 4F9VA 4L8AA 1QMUA 1KWMA 3G3SA 2OZUA 2XEJA 4X5KA 2AFUA 1R3NA 1SQHA 1A2ZA 1FNOA 3FXTA 3D67A 4HNYB 4MXUA 1IOIA 1RO5A 4R87A 1Q2YA 4YGOA 2BOAA 1GHEA 2FIAA 2VZYA 4KVOE 5EMIA 1CP6A 4YU9A 2PIYA 1XEBA 3SI2A 1S7NA 3SXNA 3PB8X 4KSFA 2PR1A 4CYQA 1YREA 2B4BA 5CNPA 1F2OA 3D2MA 5A28A 1Q2DA 1KUVA 2PJ8A 1LANA 1ZLIA 2JDCA 2P6EA 1PCAA 3BJ8A 3DNSA 5C88A 5LYIA 1MK4A 4P6YA 3PGPA 2IJZA 2HQYA 4A95A 4CRYB 3S9NA 3TO7A 5A27A 1Q2CA 4DUKA 3F8KA 4MRIA 4GXHA 4QVTA 1LAPA 1DE4C 1PUAA 2D4OA 2DF5A 4MI4A 1ZO0A 4A2ZA 2AFSA 3KGQA 5LYDA 4K30A 3D66A 1NMTA 2FE7A 4ONWA 4CRZB 4NGQA 2B3VA 4PPZA 3PB9X 3W6XA 4LQGA 4KLVA 4ZY2A 4WJBA 1PU9A 3LODA 4KLWA 1Y0YA 5AG4A 2V8HA 3BJ7A 3BI0A 4K3NA 2OOTA 3DR6A 3GUXA 3H8EA 3V7ZA 3IGRA 1M4GA 5IX3A 4NGTA 4B12A 2VEZA 2PSWA 2Q51A 1XFOA 2F8HA 4KVME 3VATA 1LRZA 1YLOA 3TCVA 2VXKA 2Z10A 3TFYA 2A4NA 2FIWA 2I00A 3CT9A 3I1UA 4ZI6A 2AJ6A 2ANPA 2PJ0A 1AYEA 2P6GA 3R96A 2PVVA 2NMTA 2VBQA 4P44A 4P4BA 4HKFA 2FXFA 5AGEA 4OLLA 3NE8A 4R6TA 2JDDA 3SI1A 1YGHA 4OC1A 1HDQA 2RC4A 4M6HA 5FVJA 1DTDA 3WR7A 1XE4A 4MMOA 1XIXA 4W9YA 3TO6A 1S5KA 2CTBA 1XF8A 4JWPA 4ORFA 4UBRA 2B58A 2DEAA 1YR0A 1Z4RA 1CG2A 1YVOA 4X2TA 2IQ6A 4KORA 3JRUA 3GB0A 4NGRA 2Z3PA 4Y49B 3ZZIA 5KTAA 1LCPA 4A39A 1IYLA 2PIZA 2XEGA 3JTKA 4MCRA 1M4IA 3H5ZA 4Q36A 1ARLA 4A32A 3V8IA 2F7VA 4OKOA 1IGBA 1F57A 2BSWA 3A9LA 4TWEA 4XPDC 4DNCA 3FJUA 1CPXA 1BLLE 3OWCA 2HB6A 2I79A 1ARMA 1JQGA 2PC1A 2YNDA 1TF8A 2O28A 4PXEA 4MHPA 1RTQA 3K9UA 4M6IA 3RZAA 2J8RA 3KQXA 4R8FA 3SXOA 4EWTA 3DDDA 2EK9A 3WABA 5F46A 4CAVA 4KSIA 3JUWA 4DYOA 1WWZA 3DSBA 4LX9A 4UEZA 4RUHA 4R3LA 2PJ1A 4KS9A 1ELMP 3CXQA 1ON0A 2H5MA 2Q04A 2Z0ZA 4P4JA 4PV6A 3IJ3A 4Q38A 3CDXA 1MJ9A 5G21A 5F49A 2AFXA 1CPSA 5JQ4A 4B5PA 4CGNA 3F5BA 4GS4A 3R1KA 4KOWA 5IB0A 2B5GA 4LUAA 3NA6A 1I21A 5D29A 4NJRA 4X8IA 4B10A 2ZEEA 5IB9A 1CBXA 2ZENA 2C6CA 3PB7X 3PEIA 4MY3A 1TKJA 4B14A 1QSNA 4XNHC 6CPAA 4MCQA 2PJ5A 5G22A 2Q7BA 3GY9A 1H8LA 4MBUA 3GYAA 2ZELA 3WC7A 5EBVA 4R7MA 4KOTA 1XMTA 3EFAA 3P2FA 2OB0A 4U5YA 5AG7A 4B5OA 5DS0A 1WK4A 2GREA 1ZG7A 2DXQA 3EXNA 4ZYQA 2V8DA
chains in the Genus database with same CATH topology
1QSRA 1VHSA 4AVBA 3R95A 2CNTA 2FT0A 4PK2A 5AG5A 4BMHA 5AG6A 4BBHA 1V0CA 4IF5A 5GCNA 2PQ8A 4L89A 2QECA 2BL1A 3H4QA 2OH1A 4CYOA 3R9FA 4MY0A 2VI7A 4UA3A 3S6HA 2BUEA 4JLYA 3CXPA 2B5GB 1KUXA 2QIRA 4FD6A 3T9YA 2OZGA 4KUBA 1U6MA 3W91A 2QMLA 4JD6A 1B6BA 3S6GA 1S7FA 1OZPA 2FCKA 2J8MA 4M3SA 2P0WA 1QSOA 3TE4A 1Z4EA 4XPLA 2G3TA 5H84A 4B11A 4C2YA 2Q0YA 3I9SA 4M85A 5BWAB 2CY2A 4AVAA 5ISVA 5G20A 4MHDA 2X7BA 1TIQA 1UFHA 5H86A 4FD5A 3PZJA 5DWNA 2JLMA 4F6AA 1S7KA 4XPKA 2CXAA 5KTDA 4CYPA 3F0AA 2B4DA 2FL4A 4ZBGA 1IB1E 4MFKA 2B4DB 2ZXVA 5HH1A 4MFPA 2OU2A 1MJBA 5DWMA 1I1DA 4H6ZA 4MFQA 3QB8A 2ZW5A 2BEIA 2EVNA 4A30A 4C2ZA 1IICA 3S6FA 3TO9A 1L0CA 4AG9A 2Q4VA 3T90A 2OZHA 4YRHA 2Z3LA 4RI1A 1NSLA 1S3ZA 3TOAA 2ZW4A 3GKRA 3NE7A 1RXTA 2CNMA 4KOXA 1Y7RA 1QSMA 2Q44A 3IWEA 5J8CA 5E96A 3EC4A 4J3GA 4QC6A 3FBUA 1B87A 1N71A 4E0AA 5HMNA 4CAXA 4JXRA 3B8GA 3RYOA 3EO4A 1CJWA 3N7ZA 4Y49C 2WPWA 1S7LA 4MFLA 3D2PA 4PSXA 4QUSA 4UFVA 3UY5A 4AVCA 2FS5A 4I49A 4UFXA 3IWGA 4U9YA 2ARHA 3QAHA 1IIDA 3VWEA 2PRBA 4C68A 2G0BA 3EY5A 3BLNA 3R9EA 4CAEA 1YVKA 4KSAA 4B5PB 4FD4A 2Z3KA 4RS2A 3DR8A 4KZTA 2YNEA 2DPSA 4MFZA 4IUSA 4MJ8A 4B13A 2DPTA 4C2XA 5EC4A 2Z3OA 2GE3A 2IL4A 4E8OA 5F48A 3VWDA 4KOVA 4XNHB 4HNXB 2J8NA 3FIXA 1P0HA 1Y9WA 4CS0B 2ZPAA 4R9MA 4E2AA 2PDOA 3C26A 2D4PA 4UCNA 3G8WA 2F5IA 2ZW7A 4A31A 4FD7A 2GANA 4KUAA 4AB7A 4CAWA 2Z3NA 3W6SA 4A33A 3D8PA 2WUUA 3FNCA 2KCWA 4H6UA 4NEXA 2VZZA 1M4DA 4YFJA 1CM0A 2HV2A 2Z11A 2YNCC 2Y0MA 2VQYA 3D3SA 1KZFA 3FRMA 1Z9UA 2K5TA 2HUZA 5G1ZA 4QBJA 5JPHA 4F0XA 2YNCA 1QSTA 1P4NA 2C27A 4KOUA 3PP9A 4NF1A 5IV0A 4C7IA 1KUYA 4CAFA 4XPDB 2B3UA 3I3GA 4NXYA 2CNSA 4EVYA 3E0KA 4HNWB 3P2HA 1M1DA 4JJXA 5F47A 2WSAA 4QB9A 3MGDA 4C7HA 4KOSA 2YGWA 2WPXA 2FSRA 4OADA 3KKWA 3ZJ0A 3JVNA 4AG7A 4F0YA 1BOBA 3FB3A 2REEA 1YX0A 2GIVA 1M44A 3R9GA 5C82A 2R98A 1YK3A 4PK3A 4R57A 2AE6A 2G3AA 2JEVA 5I0CA 3TT2A 4ONUA 4R3KA 2REFA 5KTCA 2R8VA 2Q4YA 1FY7A 1S60A 4JXQA 4CYNA 1NE9A 3FYNA 2R7HA 1I12A 1R57A 1YLEA 4KVXA 4CGMA 2EUIA 2ZW6A 2P6FA 3TOBA 4OAEA 4CGOA 4UCPA 3LD2A 3IU1A 1MJAA 4UCMA 4MFJA 1J4JA 4UWJA 1VKCA 4H89A 2ATRA 3CXSA 5J8FA 1BO4A 4NSQA 2PR8A 4UWIA 4PSWA 3SHPA 4U9ZA 1IYKA 1K4JA 4UFWA 3S6KA 2Z3MA 4NCZA 4CGLA 4ZGYB 3TTHA 1Y9KA 2R1IA 4II9A 4KOYA 4L8AA 3G3SA 2OZUA 4X5KA 1SQHA 3FXTA 4HNYB 1RO5A 4R87A 1Q2YA 4YGOA 4KVOE 1GHEA 2FIAA 2VZYA 1XEBA 1S7NA 3SXNA 4KSFA 2PR1A 4CYQA 1YREA 2B4BA 5CNPA 3D2MA 5A28A 1Q2DA 1KUVA 3DNSA 2JDCA 2P6EA 3BJ8A 5C88A 1MK4A 3PGPA 4CRYB 2HQYA 4A95A 3TO7A 5A27A 1Q2CA 3F8KA 4QVTA 1PUAA 2D4OA 4A2ZA 4MI4A 1ZO0A 4K30A 1NMTA 2FE7A 4CRZB 2B3VA 3W6XA 4KLVA 1PU9A 3LODA 4KLWA 5AG4A 3BJ7A 3DR6A 3IGRA 1M4GA 5IX3A 4B12A 2VEZA 2PSWA 4KVME 1LRZA 3TCVA 2VXKA 2Z10A 3TFYA 2A4NA 2FIWA 2I00A 2AJ6A 2P6GA 3R96A 2NMTA 2VBQA 4HKFA 2FXFA 5AGEA 4OLLA 2JDDA 1YGHA 2RC4A 5FVJA 3WR7A 1XE4A 1XIXA 3TO6A 1S5KA 1XF8A 4JWPA 4ORFA 4UBRA 2B58A 1YR0A 1Z4RA 1YVOA 4Y49B 4KORA 3ZZIA 2Z3PA 5KTAA 1IYLA 3JTKA 1M4IA 3H5ZA 4Q36A 4A32A 3V8IA 2BSWA 3A9LA 4XPDC 4DNCA 3OWCA 2I79A 2PC1A 2YNDA 2O28A 3K9UA 3SXOA 2J8RA 3DDDA 5F46A 4CAVA 3JUWA 1WWZA 3DSBA 4LX9A 4R3LA 4KS9A 3CXQA 1ON0A 2H5MA 2Q04A 2Z0ZA 4Q38A 4PV6A 1MJ9A 5G21A 5F49A 5JQ4A 4B5PA 4CGNA 3F5BA 4GS4A 3R1KA 4KOWA 5IB0A 2B5GA 4LUAA 1I21A 4B10A 4B14A 4MY3A 1QSNA 4XNHC 5G22A 2Q7BA 3GY9A 4MBUA 3GYAA 5EBVA 4KOTA 1XMTA 3EFAA 3P2FA 2OB0A 4U5YA 5AG7A 4B5OA 1WK4A 3IU2A 2DXQA 3EXNA 4CGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSR A;  1VHS A;  4AVB A;  3R95 A;  2CNT A;  2FT0 A;  4PK2 A;  4BMH A;  1V0C A;  4IF5 A;  5GCN A;  2PQ8 A;  4L89 A;  2QEC A;  2BL1 A;  3H4Q A;  2OH1 A;  3R9F A;  4MY0 A;  2VI7 A;  4UA3 A;  3S6H A;  2BUE A;  4JLY A;  3CXP A;  2B5G B;  1KUX A;  2QIR A;  4FD6 A;  3T9Y A;  2OZG A;  4KUB A;  1U6M A;  3W91 A;  2QML A;  4JD6 A;  1B6B A;  3S6G A;  1S7F A;  1OZP A;  2FCK A;  2J8M A;  4M3S A;  2P0W A;  1QSO A;  3TE4 A;  1Z4E A;  4XPL A;  2G3T A;  5H84 A;  2Q0Y A;  3I9S A;  4M85 A;  2CY2 A;  4AVA A;  5ISV A;  4MHD A;  2X7B A;  1TIQ A;  1UFH A;  5H86 A;  4FD5 A;  3PZJ A;  5DWN A;  2JLM A;  4F6A A;  1S7K A;  4XPK A;  5KTD A;  3F0A A;  2B4D A;  2FL4 A;  4ZBG A;  1IB1 E;  2B4D B;  2ZXV A;  5HH1 A;  2OU2 A;  1MJB A;  5DWM A;  1I1D A;  4H6Z A;  3QB8 A;  2ZW5 A;  2BEI A;  2EVN A;  1IIC A;  3S6F A;  3TO9 A;  1L0C A;  4AG9 A;  2Q4V A;  3T90 A;  2OZH A;  4YRH A;  4RI1 A;  1NSL A;  1S3Z A;  3TOA A;  2ZW4 A;  3GKR A;  3NE7 A;  1RXT A;  2CNM A;  4KOX A;  1Y7R A;  1QSM A;  2Q44 A;  5J8C A;  5E96 A;  3EC4 A;  4J3G A;  4QC6 A;  3FBU A;  1B87 A;  1N71 A;  4E0A A;  5HMN A;  4CAX A;  4JXR A;  3B8G A;  3RYO A;  3EO4 A;  1CJW A;  3N7Z A;  4Y49 C;  2WPW A;  1S7L A;  3D2P A;  4PSX A;  4QUS A;  3UY5 A;  4AVC A;  2FS5 A;  4I49 A;  3IWG A;  4U9Y A;  2ARH A;  3QAH A;  1IID A;  3VWE A;  2PRB A;  2G0B A;  3EY5 A;  3BLN A;  3R9E A;  1YVK A;  4B5P B;  4FD4 A;  4RS2 A;  3DR8 A;  4KZT A;  4IUS A;  4MJ8 A;  5EC4 A;  2GE3 A;  2IL4 A;  4E8O A;  5F48 A;  3VWD A;  4KOV A;  4XNH B;  4HNX B;  2J8N A;  3FIX A;  1P0H A;  1Y9W A;  4CS0 B;  2ZPA A;  4R9M A;  4E2A A;  2PDO A;  3C26 A;  2D4P A;  3G8W A;  2F5I A;  2ZW7 A;  4FD7 A;  2GAN A;  4KUA A;  4AB7 A;  4CAW A;  3W6S A;  3D8P A;  3FNC A;  2KCW A;  4H6U A;  4NEX A;  2VZZ A;  1M4D A;  4YFJ A;  1CM0 A;  2HV2 A;  2Z11 A;  2Y0M A;  2VQY A;  3D3S A;  1KZF A;  3FRM A;  1Z9U A;  2K5T A;  2HUZ A;  4QBJ A;  5JPH A;  1QST A;  1P4N A;  2C27 A;  4KOU A;  3PP9 A;  4NF1 A;  5IV0 A;  1KUY A;  4XPD B;  2B3U A;  3I3G A;  4NXY A;  2CNS A;  4EVY A;  3E0K A;  3P2H A;  1M1D A;  4HNW B;  4JJX A;  5F47 A;  4QB9 A;  3MGD A;  4KOS A;  2WPX A;  2FSR A;  4OAD A;  3KKW A;  3ZJ0 A;  3JVN A;  4AG7 A;  4F0Y A;  1BOB A;  3FB3 A;  2REE A;  1YX0 A;  2GIV A;  1M44 A;  3R9G A;  5C82 A;  2R98 A;  1YK3 A;  4PK3 A;  4R57 A;  2AE6 A;  2G3A A;  2JEV A;  5I0C A;  3TT2 A;  4ONU A;  4R3K A;  2REF A;  5KTC A;  2R8V A;  2Q4Y A;  1FY7 A;  1S60 A;  4JXQ A;  1NE9 A;  3FYN A;  2R7H A;  1I12 A;  1R57 A;  1YLE A;  4KVX A;  2EUI A;  2ZW6 A;  2P6F A;  3TOB A;  4OAE A;  3LD2 A;  1MJA A;  1J4J A;  4UWJ A;  1VKC A;  4H89 A;  2ATR A;  3CXS A;  5J8F A;  1BO4 A;  4NSQ A;  2PR8 A;  4UWI A;  4PSW A;  3SHP A;  4U9Z A;  1IYK A;  1K4J A;  3S6K A;  4NCZ A;  3TTH A;  1Y9K A;  2R1I A;  4II9 A;  4KOY A;  4L8A A;  3G3S A;  2OZU A;  4X5K A;  1SQH A;  3FXT A;  4HNY B;  1RO5 A;  4R87 A;  1Q2Y A;  4YGO A;  1GHE A;  2FIA A;  2VZY A;  4KVO E;  1XEB A;  1S7N A;  3SXN A;  2PR1 A;  1YRE A;  2B4B A;  5CNP A;  3D2M A;  1Q2D A;  1KUV A;  3DNS A;  2JDC A;  2P6E A;  3BJ8 A;  5C88 A;  1MK4 A;  3PGP A;  4CRY B;  2HQY A;  3TO7 A;  1Q2C A;  3F8K A;  4QVT A;  1PUA A;  2D4O A;  4MI4 A;  4K30 A;  1NMT A;  2FE7 A;  4CRZ B;  2B3V A;  3W6X A;  4KLV A;  1PU9 A;  3LOD A;  4KLW A;  3BJ7 A;  3DR6 A;  3IGR A;  1M4G A;  5IX3 A;  2VEZ A;  2PSW A;  4KVM E;  1LRZ A;  3TCV A;  2VXK A;  2Z10 A;  3TFY A;  2A4N A;  2FIW A;  2I00 A;  2AJ6 A;  2P6G A;  3R96 A;  2NMT A;  2VBQ A;  4HKF A;  2FXF A;  4OLL A;  2JDD A;  1YGH A;  2RC4 A;  5FVJ A;  3WR7 A;  1XE4 A;  1XIX A;  3TO6 A;  1S5K A;  1XF8 A;  4JWP A;  4ORF A;  4UBR A;  2B58 A;  1YR0 A;  1Z4R A;  1YVO A;  4Y49 B;  4KOR A;  3ZZI A;  5KTA A;  1IYL A;  1M4I A;  3V8I A;  2BSW A;  4XPD C;  4DNC A;  3OWC A;  2I79 A;  2PC1 A;  2O28 A;  3K9U A;  3SXO A;  2J8R A;  3DDD A;  5F46 A;  4CAV A;  3JUW A;  1WWZ A;  3DSB A;  4LX9 A;  4R3L A;  3CXQ A;  1ON0 A;  2H5M A;  2Q04 A;  2Z0Z A;  4PV6 A;  1MJ9 A;  5F49 A;  5JQ4 A;  4B5P A;  3F5B A;  4GS4 A;  3R1K A;  4KOW A;  5IB0 A;  2B5G A;  4LUA A;  1I21 A;  4MY3 A;  1QSN A;  4XNH C;  2Q7B A;  3GY9 A;  4MBU A;  3GYA A;  5EBV A;  4KOT A;  4U5Y A;  1XMT A;  3EFA A;  2OB0 A;  3P2F A;  4B5O A;  1WK4 A;  2DXQ A;  3EXN A; 
#chains in the Genus database with same CATH topology
 1QSR A;  1VHS A;  4AVB A;  2C6G A;  1CX8 A;  3R95 A;  2CNT A;  3S9M A;  2FT0 A;  4PK2 A;  5AG5 A;  2GLJ A;  3D7F A;  5AG6 A;  4BMH A;  4BBH A;  1V0C A;  3TC8 A;  4IF5 A;  2V8G A;  5GCN A;  5ELY A;  1HEE A;  2PQ8 A;  4L89 A;  2QEC A;  3PB6 X;  3PB4 X;  2BL1 A;  3H4Q A;  2OH1 A;  4CYO A;  3R9F A;  2J9A A;  4MY0 A;  2VI7 A;  4UA3 A;  3S6H A;  4FUU A;  2BUE A;  4DJL A;  4JLY A;  2PJ3 A;  3CXP A;  3HUV A;  4O23 A;  2ZEH A;  1ZG8 A;  3IO1 A;  1PYT B;  2B5G B;  3LAC A;  1KUX A;  2QIR A;  4IK2 A;  4FD6 A;  3T9Y A;  2OZG A;  1GYT A;  1U6M A;  3K2K A;  2XEI A;  4KUB A;  3W91 A;  2QML A;  5THW A;  5JGF A;  4JD6 A;  2EO8 A;  3NFZ A;  1B6B A;  3S6G A;  1S7F A;  4F8Z A;  1Y0R A;  3IEH A;  1OZP A;  2AFZ A;  2FCK A;  2J8M A;  4HPS A;  5D8N A;  4ZX9 A;  3IIB A;  3PBE A;  4UIB A;  4M3S A;  1Y7E A;  1Z8X A;  1R43 A;  2P0W A;  1QSO A;  3B2Y A;  3QAY A;  3MRU A;  3TE4 A;  2AFO A;  1Z4E A;  2O53 A;  4XPL A;  2G3T A;  2GFQ A;  5H84 A;  4ZY0 A;  4B11 A;  4C2Y A;  2Q0Y A;  3VAR A;  3I9S A;  4AXV A;  2O4H A;  4M85 A;  4YWY A;  1TF9 A;  2PE3 A;  2Q4Z A;  5BWA B;  2CY2 A;  4AVA A;  5ISV A;  5G20 A;  7CPA A;  4MHD A;  3HLP A;  2X7B A;  4OC5 A;  4NJQ A;  1TIQ A;  3CZX A;  4MHY A;  5HVF A;  1X10 A;  1UFH A;  2GU2 A;  3SI0 A;  1TKF A;  5H86 A;  5J1Q A;  2G9D A;  4FD5 A;  3PZJ A;  3PBB A;  5DWN A;  2JLM A;  4F6A A;  1S7K A;  2AFM A;  4XPK A;  3IU2 A;  3WC6 A;  1AUG A;  2CXA A;  4P4E A;  5KTD A;  4CYP A;  3S9L A;  2PJ6 A;  3F0A A;  3FMC A;  4WWV A;  2B4D A;  2FL4 A;  4ZBG A;  3B3S A;  1IB1 E;  4MFK A;  2VL1 A;  3WT4 A;  2B4D B;  2ZXV A;  1YSJ A;  5HH1 A;  5LRG A;  2PCU A;  3H8G A;  4MFP A;  1ZG9 A;  2OU2 A;  1MJB A;  3IWW A;  4PXC A;  5DWM A;  1I1D A;  1YW4 A;  1F2P A;  4PXB A;  3FVL A;  4H6Z A;  4RN7 A;  2PJ9 A;  4MFQ A;  3PFE A;  2JBK A;  3PRT A;  2PJC A;  2ZEP A;  3QB8 A;  4IHM A;  2ZW5 A;  2ZEM A;  2BEI A;  2PRQ A;  2EVN A;  3KR5 A;  3BI1 A;  3H8F A;  4R76 A;  4A30 A;  4C2Z A;  1IIC A;  3S6F A;  3TO9 A;  3V38 A;  5HVG A;  2BCO A;  1L0C A;  4MCS A;  4AG9 A;  2Q4V A;  3T90 A;  4OC2 A;  2OZH A;  1X12 A;  4YRH A;  2Z3L A;  4RI1 A;  4H2K A;  2ZEG A;  3FEC A;  2POK A;  1S3Z A;  1NSL A;  3SJX A;  1JWQ A;  3TOA A;  2ZW4 A;  3GKR A;  2QJ8 A;  3NE7 A;  1RXT A;  2CNM A;  3KZW A;  2EK8 A;  4MHN A;  2PJB A;  4KOX A;  4Q7A A;  1QSM A;  1Y7R A;  4CPA A;  3FED A;  2Q44 A;  2ZEO A;  2ZOG A;  3IWE A;  4OIW A;  5J8C A;  5E96 A;  3EC4 A;  4J3G A;  4QC6 A;  3FBU A;  1B87 A;  1N71 A;  4E0A A;  5HMN A;  2NSM A;  4GM5 A;  2WZN A;  5LYF A;  4CAX A;  4NGM A;  1XRY A;  4JXR A;  3B8G A;  3RYO A;  3EO4 A;  2ZOF A;  1CJW A;  3N7Z A;  1IY7 A;  4UIA A;  4Y49 C;  1YME A;  3NH5 A;  2EWB A;  2WPW A;  1S7L A;  2XEF A;  4MFL A;  3SJG A;  3D2P A;  4PSX A;  3LMS A;  3SJE A;  4QUS A;  1Z2L A;  4UFV A;  3D7G A;  3UY5 A;  2ZEF A;  4AVC A;  1VHO A;  1BPM A;  1Z8W A;  2RFH A;  2FS5 A;  4I49 A;  4Z65 A;  4UFX A;  4NGP A;  3IWG A;  4U9Y A;  2ARH A;  3QAH A;  4OID A;  2ABZ A;  1IID A;  3IFE A;  3VWE A;  2PRB A;  4C68 A;  5JH9 A;  2G0B A;  3B7I A;  3PFO A;  3EY5 A;  4CGP A;  4EFD A;  3BLN A;  1LFW A;  3B3V A;  3R9E A;  4A38 A;  2IMO A;  1Z5R A;  4CAE A;  1YVK A;  3NH8 A;  4KSA A;  3B3T A;  4B5P B;  1M4L A;  4FD4 A;  2Z3K A;  1VGY A;  4RS2 A;  1ZLH A;  3DR8 A;  4A37 A;  4KZT A;  4NFR A;  2YNE A;  2DPS A;  4MFZ A;  4IUS A;  4MJ8 A;  4B13 A;  1AMP A;  2DPT A;  3BXM A;  4UF4 A;  4P4D A;  3RAM A;  1VIX A;  4C2X A;  4X3R A;  5EC4 A;  2Z3O A;  4LQ6 A;  3RBU A;  2GLF A;  4MCP A;  2GE3 A;  2IL4 A;  4E8O A;  2PVW A;  1VHE A;  5F48 A;  3VWD A;  4FAI A;  4NGN A;  5LRK A;  4KOV A;  4XNH B;  2RB7 A;  5HXD A;  4HNX B;  3KHZ A;  4OC3 A;  4B6Z A;  2J8N A;  3FIX A;  1P0H A;  3DLJ A;  1Y9W A;  1BAV A;  4JZ0 A;  2ZPA A;  2BO9 A;  4R9M A;  4CS0 B;  2PDO A;  4E2A A;  3C26 A;  2D4P A;  3ISZ A;  4UCN A;  5JM6 A;  4UEE A;  1IU8 A;  3G8W A;  2F5I A;  2ZW7 A;  4A31 A;  4FD7 A;  2GAN A;  4KUA A;  3FH4 A;  2OR4 A;  4AB7 A;  4OC4 A;  4PQA A;  4CAW A;  2Z3N A;  4P10 A;  3W6S A;  2EBJ A;  4A33 A;  1XBU A;  3D8P A;  2QVP A;  2WUU A;  3FNC A;  2KCW A;  4H6U A;  4NEX A;  4MHZ A;  5LRJ A;  3WC5 A;  4FBE A;  5K8P A;  2VZZ A;  1M4D A;  4YFJ A;  1CM0 A;  4G1P A;  2JEW A;  4OC0 A;  2HV2 A;  1ELL P;  2Z11 A;  4ZY1 A;  1TKH A;  2PJ2 A;  1IOF A;  2Y0M A;  1UWY A;  2VQY A;  1KZF A;  1LOK A;  2CTC A;  2ODF A;  2WYR A;  2YNC C;  3D3S A;  1Z9U A;  3FRM A;  2K5T A;  2HUZ A;  2I3C A;  4FWU A;  4IAV A;  5G1Z A;  4QBJ A;  3L2N A;  5JPH A;  2CF4 A;  4BIN A;  4F0X A;  2NYQ A;  3KR4 A;  3T8W A;  4JYW A;  1NSA A;  5HVH A;  5F09 A;  2YNC A;  3N5F A;  3FX6 A;  1QST A;  1P4N A;  1BPN A;  2C27 A;  2Q7S A;  3PP9 A;  4KOU A;  4NF1 A;  5IV0 A;  2AFW A;  4C7I A;  3QNV A;  3SJF A;  1KUY A;  4CAF A;  1LAM A;  3ISX A;  1CP7 A;  4XPD B;  2B3U A;  3BHX A;  3I3G A;  4NXY A;  2CNS A;  4TNU A;  3RNZ A;  4EVY A;  3E0K A;  3B3W A;  3NH4 A;  1M1D A;  3P2H A;  4HNW B;  4JJX A;  3MN8 A;  5F47 A;  5LYL A;  2WSA A;  2QYV A;  4QB9 A;  3MGD A;  4C7H A;  4KOS A;  2YGW A;  2WPX A;  3KAS A;  2FSR A;  4OAD A;  3KKW A;  3KI9 A;  3JVN A;  3ZJ0 A;  4AG7 A;  4BD9 A;  4F0Y A;  3GIU A;  1BOB A;  3FF3 A;  2C6P A;  5K8O A;  3FB3 A;  2REE A;  1YX0 A;  2GIV A;  1M44 A;  3R9G A;  5K8M A;  5C82 A;  2R98 A;  1QQ9 A;  1YK3 A;  4PK3 A;  1EE3 P;  1Z8T A;  4M6G A;  4R57 A;  2AE6 A;  2G3A A;  2JEV A;  5I0C A;  3KL9 A;  1YW6 A;  3TT2 A;  4ONU A;  4R3K A;  2REF A;  3KQZ A;  2R8V A;  2Q4Y A;  2PJA A;  1FY7 A;  1S60 A;  3B35 A;  5I4M A;  5KTC A;  4JXQ A;  4CYN A;  3FEE A;  1XMB A;  5CBM A;  1NE9 A;  2FVG A;  8CPA A;  3K9T A;  5CPA A;  2PJ4 A;  1Z8L A;  3CPX A;  4UEF A;  4OP4 A;  3FYN A;  2R7H A;  3B3C A;  1I12 A;  3IC1 A;  1R57 A;  1YLE A;  4KVX A;  4CGM A;  2EUI A;  2ZW6 A;  1HDU A;  2P6F A;  3TOB A;  3VH9 A;  4PXD A;  2V8V A;  3GLJ A;  1YQE A;  4OAE A;  3DGV A;  4CGO A;  4NGS A;  1OBR A;  4UCP A;  3LD2 A;  3IU1 A;  1MJA A;  1XJO A;  4UCM A;  2PJ7 A;  4OME A;  3RO0 A;  2HC9 A;  4F9U A;  3D4U A;  3D7H A;  2ZED A;  5K8N A;  4MFJ A;  1J4J A;  4UWJ A;  1VKC A;  4H89 A;  1TXR A;  2ATR A;  1FT7 A;  3CXS A;  3D68 A;  5J8F A;  1BO4 A;  4NSQ A;  2PR8 A;  4UWI A;  3D7D A;  2JBJ A;  4PSW A;  4ZX8 A;  3SHP A;  4P4I A;  4U9Z A;  1XOV A;  1IYK A;  3TX8 A;  1K4J A;  4UFW A;  3S6K A;  3CPA A;  2Z3M A;  4NCZ A;  4P4F A;  2C1C A;  2Q43 A;  4CGL A;  4ZGY B;  3TTH A;  1Y9K A;  2R1I A;  2CIJ A;  2V77 A;  3KHX A;  4A94 A;  4EME A;  4II9 A;  3LWU A;  4P45 A;  4KOY A;  1Q7L A;  4F9V A;  4L8A A;  1QMU A;  1KWM A;  3G3S A;  2OZU A;  2XEJ A;  4X5K A;  2AFU A;  1R3N A;  1SQH A;  1A2Z A;  1FNO A;  3FXT A;  3D67 A;  4HNY B;  4MXU A;  1IOI A;  1RO5 A;  4R87 A;  1Q2Y A;  4YGO A;  2BOA A;  1GHE A;  2FIA A;  2VZY A;  4KVO E;  5EMI A;  1CP6 A;  4YU9 A;  2PIY A;  1XEB A;  3SI2 A;  1S7N A;  3SXN A;  3PB8 X;  4KSF A;  2PR1 A;  4CYQ A;  1YRE A;  2B4B A;  5CNP A;  1F2O A;  3D2M A;  5A28 A;  1Q2D A;  1KUV A;  2PJ8 A;  1LAN A;  1ZLI A;  2JDC A;  2P6E A;  1PCA A;  3BJ8 A;  3DNS A;  5C88 A;  5LYI A;  1MK4 A;  4P6Y A;  3PGP A;  2IJZ A;  2HQY A;  4A95 A;  4CRY B;  3S9N A;  3TO7 A;  5A27 A;  1Q2C A;  4DUK A;  3F8K A;  4MRI A;  4GXH A;  4QVT A;  1LAP A;  1DE4 C;  1PUA A;  2D4O A;  2DF5 A;  4MI4 A;  1ZO0 A;  4A2Z A;  2AFS A;  3KGQ A;  5LYD A;  4K30 A;  3D66 A;  1NMT A;  2FE7 A;  4ONW A;  4CRZ B;  4NGQ A;  2B3V A;  4PPZ A;  3PB9 X;  3W6X A;  4LQG A;  4KLV A;  4ZY2 A;  4WJB A;  1PU9 A;  3LOD A;  4KLW A;  1Y0Y A;  5AG4 A;  2V8H A;  3BJ7 A;  3BI0 A;  4K3N A;  2OOT A;  3DR6 A;  3GUX A;  3H8E A;  3V7Z A;  3IGR A;  1M4G A;  5IX3 A;  4NGT A;  4B12 A;  2VEZ A;  2PSW A;  2Q51 A;  1XFO A;  2F8H A;  4KVM E;  3VAT A;  1LRZ A;  1YLO A;  3TCV A;  2VXK A;  2Z10 A;  3TFY A;  2A4N A;  2FIW A;  2I00 A;  3CT9 A;  3I1U A;  4ZI6 A;  2AJ6 A;  2ANP A;  2PJ0 A;  1AYE A;  2P6G A;  3R96 A;  2PVV A;  2NMT A;  2VBQ A;  4P44 A;  4P4B A;  4HKF A;  2FXF A;  5AGE A;  4OLL A;  3NE8 A;  4R6T A;  2JDD A;  3SI1 A;  1YGH A;  4OC1 A;  1HDQ A;  2RC4 A;  4M6H A;  5FVJ A;  1DTD A;  3WR7 A;  1XE4 A;  4MMO A;  1XIX A;  4W9Y A;  3TO6 A;  1S5K A;  2CTB A;  1XF8 A;  4JWP A;  4ORF A;  4UBR A;  2B58 A;  2DEA A;  1YR0 A;  1Z4R A;  1CG2 A;  1YVO A;  4X2T A;  2IQ6 A;  4KOR A;  3JRU A;  3GB0 A;  4NGR A;  2Z3P A;  4Y49 B;  3ZZI A;  5KTA A;  1LCP A;  4A39 A;  1IYL A;  2PIZ A;  2XEG A;  3JTK A;  4MCR A;  1M4I A;  3H5Z A;  4Q36 A;  1ARL A;  4A32 A;  3V8I A;  2F7V A;  4OKO A;  1IGB A;  1F57 A;  2BSW A;  3A9L A;  4TWE A;  4XPD C;  4DNC A;  3FJU A;  1CPX A;  1BLL E;  3OWC A;  2HB6 A;  2I79 A;  1ARM A;  1JQG A;  2PC1 A;  2YND A;  1TF8 A;  2O28 A;  4PXE A;  4MHP A;  1RTQ A;  3K9U A;  4M6I A;  3RZA A;  2J8R A;  3KQX A;  4R8F A;  3SXO A;  4EWT A;  3DDD A;  2EK9 A;  3WAB A;  5F46 A;  4CAV A;  4KSI A;  3JUW A;  4DYO A;  1WWZ A;  3DSB A;  4LX9 A;  4UEZ A;  4RUH A;  4R3L A;  2PJ1 A;  4KS9 A;  1ELM P;  3CXQ A;  1ON0 A;  2H5M A;  2Q04 A;  2Z0Z A;  4P4J A;  4PV6 A;  3IJ3 A;  4Q38 A;  3CDX A;  1MJ9 A;  5G21 A;  5F49 A;  2AFX A;  1CPS A;  5JQ4 A;  4B5P A;  4CGN A;  3F5B A;  4GS4 A;  3R1K A;  4KOW A;  5IB0 A;  2B5G A;  4LUA A;  3NA6 A;  1I21 A;  5D29 A;  4NJR A;  4X8I A;  4B10 A;  2ZEE A;  5IB9 A;  1CBX A;  2ZEN A;  2C6C A;  3PB7 X;  3PEI A;  4MY3 A;  1TKJ A;  4B14 A;  1QSN A;  4XNH C;  6CPA A;  4MCQ A;  2PJ5 A;  5G22 A;  2Q7B A;  3GY9 A;  1H8L A;  4MBU A;  3GYA A;  2ZEL A;  3WC7 A;  5EBV A;  4R7M A;  4KOT A;  1XMT A;  3EFA A;  3P2F A;  2OB0 A;  4U5Y A;  5AG7 A;  4B5O A;  5DS0 A;  1WK4 A;  2GRE A;  1ZG7 A;  2DXQ A;  3EXN A;  4ZYQ A;  2V8D A; 
#chains in the Genus database with same CATH homology
 1QSR A;  1VHS A;  4AVB A;  3R95 A;  2CNT A;  2FT0 A;  4PK2 A;  5AG5 A;  4BMH A;  5AG6 A;  4BBH A;  1V0C A;  4IF5 A;  5GCN A;  2PQ8 A;  4L89 A;  2QEC A;  2BL1 A;  3H4Q A;  2OH1 A;  4CYO A;  3R9F A;  4MY0 A;  2VI7 A;  4UA3 A;  3S6H A;  2BUE A;  4JLY A;  3CXP A;  2B5G B;  1KUX A;  2QIR A;  4FD6 A;  3T9Y A;  2OZG A;  4KUB A;  1U6M A;  3W91 A;  2QML A;  4JD6 A;  1B6B A;  3S6G A;  1S7F A;  1OZP A;  2FCK A;  2J8M A;  4M3S A;  2P0W A;  1QSO A;  3TE4 A;  1Z4E A;  4XPL A;  2G3T A;  5H84 A;  4B11 A;  4C2Y A;  2Q0Y A;  3I9S A;  4M85 A;  5BWA B;  2CY2 A;  4AVA A;  5ISV A;  5G20 A;  4MHD A;  2X7B A;  1TIQ A;  1UFH A;  5H86 A;  4FD5 A;  3PZJ A;  5DWN A;  2JLM A;  4F6A A;  1S7K A;  4XPK A;  2CXA A;  5KTD A;  4CYP A;  3F0A A;  2B4D A;  2FL4 A;  4ZBG A;  1IB1 E;  4MFK A;  2B4D B;  2ZXV A;  5HH1 A;  4MFP A;  2OU2 A;  1MJB A;  5DWM A;  1I1D A;  4H6Z A;  4MFQ A;  3QB8 A;  2ZW5 A;  2BEI A;  2EVN A;  4A30 A;  4C2Z A;  1IIC A;  3S6F A;  3TO9 A;  1L0C A;  4AG9 A;  2Q4V A;  3T90 A;  2OZH A;  4YRH A;  2Z3L A;  4RI1 A;  1NSL A;  1S3Z A;  3TOA A;  2ZW4 A;  3GKR A;  3NE7 A;  1RXT A;  2CNM A;  4KOX A;  1Y7R A;  1QSM A;  2Q44 A;  3IWE A;  5J8C A;  5E96 A;  3EC4 A;  4J3G A;  4QC6 A;  3FBU A;  1B87 A;  1N71 A;  4E0A A;  5HMN A;  4CAX A;  4JXR A;  3B8G A;  3RYO A;  3EO4 A;  1CJW A;  3N7Z A;  4Y49 C;  2WPW A;  1S7L A;  4MFL A;  3D2P A;  4PSX A;  4QUS A;  4UFV A;  3UY5 A;  4AVC A;  2FS5 A;  4I49 A;  4UFX A;  3IWG A;  4U9Y A;  2ARH A;  3QAH A;  1IID A;  3VWE A;  2PRB A;  4C68 A;  2G0B A;  3EY5 A;  3BLN A;  3R9E A;  4CAE A;  1YVK A;  4KSA A;  4B5P B;  4FD4 A;  2Z3K A;  4RS2 A;  3DR8 A;  4KZT A;  2YNE A;  2DPS A;  4MFZ A;  4IUS A;  4MJ8 A;  4B13 A;  2DPT A;  4C2X A;  5EC4 A;  2Z3O A;  2GE3 A;  2IL4 A;  4E8O A;  5F48 A;  3VWD A;  4KOV A;  4XNH B;  4HNX B;  2J8N A;  3FIX A;  1P0H A;  1Y9W A;  4CS0 B;  2ZPA A;  4R9M A;  4E2A A;  2PDO A;  3C26 A;  2D4P A;  4UCN A;  3G8W A;  2F5I A;  2ZW7 A;  4A31 A;  4FD7 A;  2GAN A;  4KUA A;  4AB7 A;  4CAW A;  2Z3N A;  3W6S A;  4A33 A;  3D8P A;  2WUU A;  3FNC A;  2KCW A;  4H6U A;  4NEX A;  2VZZ A;  1M4D A;  4YFJ A;  1CM0 A;  2HV2 A;  2Z11 A;  2YNC C;  2Y0M A;  2VQY A;  3D3S A;  1KZF A;  3FRM A;  1Z9U A;  2K5T A;  2HUZ A;  5G1Z A;  4QBJ A;  5JPH A;  4F0X A;  2YNC A;  1QST A;  1P4N A;  2C27 A;  4KOU A;  3PP9 A;  4NF1 A;  5IV0 A;  4C7I A;  1KUY A;  4CAF A;  4XPD B;  2B3U A;  3I3G A;  4NXY A;  2CNS A;  4EVY A;  3E0K A;  4HNW B;  3P2H A;  1M1D A;  4JJX A;  5F47 A;  2WSA A;  4QB9 A;  3MGD A;  4C7H A;  4KOS A;  2YGW A;  2WPX A;  2FSR A;  4OAD A;  3KKW A;  3ZJ0 A;  3JVN A;  4AG7 A;  4F0Y A;  1BOB A;  3FB3 A;  2REE A;  1YX0 A;  2GIV A;  1M44 A;  3R9G A;  5C82 A;  2R98 A;  1YK3 A;  4PK3 A;  4R57 A;  2AE6 A;  2G3A A;  2JEV A;  5I0C A;  3TT2 A;  4ONU A;  4R3K A;  2REF A;  5KTC A;  2R8V A;  2Q4Y A;  1FY7 A;  1S60 A;  4JXQ A;  4CYN A;  1NE9 A;  3FYN A;  2R7H A;  1I12 A;  1R57 A;  1YLE A;  4KVX A;  4CGM A;  2EUI A;  2ZW6 A;  2P6F A;  3TOB A;  4OAE A;  4CGO A;  4UCP A;  3LD2 A;  3IU1 A;  1MJA A;  4UCM A;  4MFJ A;  1J4J A;  4UWJ A;  1VKC A;  4H89 A;  2ATR A;  3CXS A;  5J8F A;  1BO4 A;  4NSQ A;  2PR8 A;  4UWI A;  4PSW A;  3SHP A;  4U9Z A;  1IYK A;  1K4J A;  4UFW A;  3S6K A;  2Z3M A;  4NCZ A;  4CGL A;  4ZGY B;  3TTH A;  1Y9K A;  2R1I A;  4II9 A;  4KOY A;  4L8A A;  3G3S A;  2OZU A;  4X5K A;  1SQH A;  3FXT A;  4HNY B;  1RO5 A;  4R87 A;  1Q2Y A;  4YGO A;  4KVO E;  1GHE A;  2FIA A;  2VZY A;  1XEB A;  1S7N A;  3SXN A;  4KSF A;  2PR1 A;  4CYQ A;  1YRE A;  2B4B A;  5CNP A;  3D2M A;  5A28 A;  1Q2D A;  1KUV A;  3DNS A;  2JDC A;  2P6E A;  3BJ8 A;  5C88 A;  1MK4 A;  3PGP A;  4CRY B;  2HQY A;  4A95 A;  3TO7 A;  5A27 A;  1Q2C A;  3F8K A;  4QVT A;  1PUA A;  2D4O A;  4A2Z A;  4MI4 A;  1ZO0 A;  4K30 A;  1NMT A;  2FE7 A;  4CRZ B;  2B3V A;  3W6X A;  4KLV A;  1PU9 A;  3LOD A;  4KLW A;  5AG4 A;  3BJ7 A;  3DR6 A;  3IGR A;  1M4G A;  5IX3 A;  4B12 A;  2VEZ A;  2PSW A;  4KVM E;  1LRZ A;  3TCV A;  2VXK A;  2Z10 A;  3TFY A;  2A4N A;  2FIW A;  2I00 A;  2AJ6 A;  2P6G A;  3R96 A;  2NMT A;  2VBQ A;  4HKF A;  2FXF A;  5AGE A;  4OLL A;  2JDD A;  1YGH A;  2RC4 A;  5FVJ A;  3WR7 A;  1XE4 A;  1XIX A;  3TO6 A;  1S5K A;  1XF8 A;  4JWP A;  4ORF A;  4UBR A;  2B58 A;  1YR0 A;  1Z4R A;  1YVO A;  4Y49 B;  4KOR A;  3ZZI A;  2Z3P A;  5KTA A;  1IYL A;  3JTK A;  1M4I A;  3H5Z A;  4Q36 A;  4A32 A;  3V8I A;  2BSW A;  3A9L A;  4XPD C;  4DNC A;  3OWC A;  2I79 A;  2PC1 A;  2YND A;  2O28 A;  3K9U A;  3SXO A;  2J8R A;  3DDD A;  5F46 A;  4CAV A;  3JUW A;  1WWZ A;  3DSB A;  4LX9 A;  4R3L A;  4KS9 A;  3CXQ A;  1ON0 A;  2H5M A;  2Q04 A;  2Z0Z A;  4Q38 A;  4PV6 A;  1MJ9 A;  5G21 A;  5F49 A;  5JQ4 A;  4B5P A;  4CGN A;  3F5B A;  4GS4 A;  3R1K A;  4KOW A;  5IB0 A;  2B5G A;  4LUA A;  1I21 A;  4B10 A;  4B14 A;  4MY3 A;  1QSN A;  4XNH C;  5G22 A;  2Q7B A;  3GY9 A;  4MBU A;  3GYA A;  5EBV A;  4KOT A;  1XMT A;  3EFA A;  3P2F A;  2OB0 A;  4U5Y A;  5AG7 A;  4B5O A;  1WK4 A;  3IU2 A;  2DXQ A;  3EXN A;  4CGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...