2B4LA

Crystal structure of the binding protein opuac in complex with glycine betaine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
268
Chain Sequence
DENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine-binding protein
publication title Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 98
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2b4lA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2b4lA01
4OEVA 1OLAA 4GF8A 4ZEDA 4QFKA 4ZEKA 2GRVA 4GFRA 4QFOA 3E3KA 1B4ZA 1B32A 1JEVA 4I9DA 3TPAA 1B5HA 3MW0A 2B4MA 1JETA 3MVYA 1ZLQA 3I5OA 1UIUA 1B3LA 4FAJA 1B7HA 4PFYA 1B3FA 3DRHA 4JSOA 4ZE9A 5KZTA 3MVWA 3TCFA 2WOPA 1QKAA 4XKRA 1B51A 3RQTA 1JEUA 4DCXA 1B2HA 3TCGA 1B40A 3O6PA 3O9PA 1B05A 2NOOA 3MVXA 3DRJA 4XKPA 3LVUA 1B3HA 3DRIA 4PFWA 3M8UA 4I8CA 4RA1A 4ONYA 2D5WA 4ZEBA 1QKBA 1B9JA 5L8DA 3RYAA 2WOKA 3MZBA 1VR5A 1UIVA 4PFUA 4OFOA 1DPEA 1B1HA 3RYBA 1DPPA 2RKMA 4ZEIA 4OESA 4QFPA 3TCHA 4GL8A 3PAMA 5F1QA 4XKNA 3MVZA 1ZU0A 2WOLA 2Z23A 3QIMA 1RKMA 1B3GA 4OFJA 4OEUA 3RY3A 1OLCA 4TOZA 1B5IA 3DRGA 2OLBA 4QFNA 3CHGA 4QFLA 1B46A 3DP8A 5ICQA 1UQWA 1B52A 4OFLA 3T66A 3FTOA 4OERA 4PFTA 5HM4B 3DRFA 2O7IA 3DRKA 4WEDA 1B6HA 1ZTYA 4ZECA 1B5JA 3ZS6A 4DCYA 1B0HA 4OETA 4JSDA 2B4LA 5ISUA 1B4HA 4ZE8A 4XKQA 1B58A 1XOCA 3MZ9A
chains in the Genus database with same CATH superfamily
1MQIA 4NF6B 5H8HA 2Q88A 1FPKA 4O3AA 2XX9A 3AXFA 5DTBA 2HFBA 2Z22A 1FPJA 2X7QA 2ZZWA 3N6UA 1FBCA 2Y7KA 4AQ4A 2P3NA 4OVQA 3I5OA 2VGQA 4PF6A 2QS1A 4QBAA 4KHZE 2GQ1A 1FTJA 3D1RA 1HSEA 1URGA 5H8QB 5TPAA 2VT5A 4HXVA 4R2FA 3UK4A 1QW0A 3I3VA 2X26A 2O1LA 1EYIA 3IAZA 5L8DA 1FW0A 4F39A 2PT2A 1A40A 1N84A 3K6UA 4PFUA 3RNNA 3PU5A 4E0XA 5F1QA 2XWKA 4GWXA 3EHTA 5JTYA 3W9WA 1LB8A 1SYHA 4XF5A 3UP9A 2OJTA 2FYIA 3S9MC 2HAVA 3PGFA 4N13A 1FPEA 1MM6A 4U22A 3U72A 1D3KA 1MXZA 5H8FA 4U4XA 4AB6A 2PFYA 3G3FA 3KOSA 1B5JA 2CZIA 5DYHA 4I3YA 1NNFA 2DE3A 2B4LA 1MH3A 4YB6A 2Y5LA 3VXBA 3NOHA 3HN0A 2DWAA 4GFRA 4JVCA 3G3IA 4R74A 1H43A 1Q9DA 1MXWA 5K2YA 4F1YA 4C0RA 2OK2A 5I84A 5KZTA 1A55A 2F3DA 4XKRA 4ZS9A 4F29A 4JXIA 1B2HA 2NOOA 4POXA 4NN3A 4IO2A 3P7IA 1B3HA 4EQBA 1ATGA 1FSAA 4GXSB 3M8UA 4EXKA 4IO7A 4OVTA 3RYAA 1VR5A 1LAXA 3U93A 3N94A 2R6GE 4MCOA 2QRYA 4RXLA 3BFUA 3H06B 4R9FA 1IEJA 4RJZA 4RPNA 4HS7A 3KOTA 1NFTA 2F78A 1GR2A 2Y7PA 1MQHA 3H6VA 2QS4A 3IB0A 2XWOA 3PUVE 5L9MA 4AB5A 3K01A 3TUSA 4H46A 1AIVA 5IM2A 4MIJA 4F2OA 4GIZA 2QL3A 3KC1A 5ET6A 3TQWA 3C34A 4LA9A 4NE4A 3KN8A 4OMBA 1SBPA 4C1UA 4FATA 5TP9A 3E3KA 4KFQA 5F24A 1FTOA 4X9TA 5CMBA 3W9VA 1VFDA 4MH5A 1TXFA 3MVYA 4JDFA 4HW8A 1M5DA 4WKMA 3KJ7A 1B7HA 4N07A 4OZ9A 4F3PA 4ZE9A 5TU0A 4DCXA 3PV0E 4JBZA 5CBSA 3CSGA 4FIMA 1Y4CA 4XKPA 2O69A 3K0VA 1DMBA 4IY5A 4Z7EA 4KCDA 3E9XA 2B3FA 1LFGA 3SEWA 4RA1A 1WVJA 1EH3A 4P47A 5ET8A 5EQ8A 4N8YA 4JWYA 3TODA 2V84A 2WYPA 1DPPA 2F34A 4G8HA 4FECA 3EHUA 2I0BA 3JYRA 3PPNA 2XD2A 2OWSA 4THIA 1GGGA 5AE4A 1RDZA 3EN3A 1B7UA 1A8EA 3GYYA 1B5IA 3O6HA 3DRGA 3N5LA 5EYHA 1MS7A 1LAHE 1ZJLA 1XS5A 3DP8A 4P1LA 4OA4A 3IR1A 3RPLA 5DVJA 5H8SA 3RPWA 5A5LA 5I58B 2VPOA 3T0JA 3CRBA 4XFEA 3DRKA 2HEUA 4Q5TA 4YZZA 1B4HA 4MMPA 1NNTA 1FRPA 4F3SA 4OEVA 1OLAA 4ZEDA 3RTWB 1AH5A 2E0SA 2B65A 5IZ3A 2XXRA 3FBPA 1JEVA 4O7MA 1PBQA 5KDTA 1SD3A 1JETA 4PFRA 3PTYA 2ESNA 3A09A 5H8NB 2FIEA 4U23A 2M8CA 2AL4A 1YXIA 1Y20A 2ZZVA 4OANA 1VSOA 2O6AA 3IO4A 2R71A 5M2VA 1MRPA 2P0SA 2DVCA 1NH8A 3LVUA 3UGWA 5K2XA 5IAIA 1LLSA 4NTLA 3FXRA 4R73A 2OZZA 5EYFA 4NF5B 2HAUA 4FE8A 3HO7A 4QXDA 2PT1A 4YMBA 3IK6B 1JQFA 3IJOB 2HZKA 3VV5A 4Q0CA 5FHNA 1URSA 4G61A 1DOTA 4QSDA 2RCBA 3U1OA 1SYIA 4G4PA 5J16A 2X7PA 3OOAA 4F3GA 2FBPA 5CRYA 4IY6A 1A99A 3KSXA 4OERA 3G3GA 3G7WA 4F1UA 1YAEA 2H5YA 4PDDA 3MYUA 2GH9A 2QMWA 3VLVA 1NUZA 4PF8A 1LAFE 1K9ZA 4MLQA 3EF7A 1AOVA 3L6GA 5IZZA 2DP8A 2NWJA 1EZPA 3CIJA 4UACA 5HBCA 5L9OA 1A7LA 1G0HA 2G29A 1IMDA 1K9YA 4NHBA 4NMYA 4GWWA 3GLBA 3PUYE 1LAGE 5TPAB 3WAFA 4PFYA 4H8IA 4MBPA 1JNFA 4FORA 2ONSA 1R1NA 1B51A 2F36A 3KJTA 5EHMA 1B40A 4P8BA 3G3HA 1B05A 1T0KA 4DDDA 1I6AA 4NWDA 4GBWA 2YLNA 2V93A 1M5FA 4BLAA 1O7TA 1QKBA 1B9JA 3H4ZA 4N81A 3Q28A 3FJ7A 5KCJA 3FJGA 1QVSA 3MJNA 4LQ5A 4GXAA 1SQYA 1BKAA 3TCHA 2NUVA 2YPNA 5I5PA 3CR9A 2I0CA 1Y1ZA 3LUYA 2HXWA 3FD3A 1RKMA 3I6VA 4X48A 2DQVA 4LZ7A 2DYXA 2XXWA 1MQGA 2FIXA 3FXQA 4QFLA 1VFEA 2Y5KA 4U21A 4DXCA 2Q8MA 1Y9UA 1B52A 4OFLA 4EXLA 3QXMA 4WXJA 1EYKA 1SW5A 3OSQA 4JSDA 5ISUA 4GD5A 5CC2A 3IOVA 1SI0A 4XIGQ 3ZSFA 1UTBB 3U8QA 4NX1A 1MG1A 4P0GA 1LEVA 4X1BA 4H5GA 4N8GA 3PMWA 2DXYA 4N15A 4G68A 4IGRA 1LBZA 3TDJA 2WBBA 1B3FA 3E4RA 4NF4A 1N7XA 1FCKA 2H9BA 3ZKLA 2Q8JA 4F18A 1FPGA 2DOJA 3CG1A 2WYKA 4PTKA 2I48A 3B6QA 1LBCA 4F22A 4PE5B 1FTMA 1FBEA 1ANFA 3FJMA 4R72A 1O63A 1R9LA 5B70A 1N04A 1OQGA 4UABA 4GWOA 3ZKKA 1B1HA 4R6HA 5DEXA 4E0WA 4N6DA 3JZJA 1TWYA 3VLWA 1AMFA 2F6PA 4L17A 4MX6A 1AWBA 5EYGA 4N17A 2ONKE 5AA1A 3HCQA 4JWXA 3R6UA 1WODA 3EQ1A 5CMMA 5HPQA 2F5XA 2ABHA 3A29A 2A5TA 4PGPA 2PX1A 2O7UA 3TELA 4IO3A 4HE2A 2XX8A 3FATA 3KZGA 3OEKA 1B1XA 4OTEA 2GFEA 2I3VA 5CI5A 5AA2A 4LP2B 4XKQA 1FBGA 1MQJA 2HXRA 2ZYOA 5FBPA 3MUQA 5AA4B 3S2VA 3A3UA 1N3XA 1FJ9A 4F31B 3O6GA 1IQ7A 4PE3A 4BDLA 4KXPA 1H44A 1MXVA 4LZ5A 2Z8EA 5AA2D 4KR5A 4BDRA 3PD9A 2I3WA 2XXPA 3VE1B 3JV9A 2IA4A 4GL0A 5DVFA 3KSJA 5I57A 1RYOA 3H7MA 3FGSA 1FTLA 1Z7NE 1GV8A 2R9JA 5I56A 4AS4A 3FASA 2H25A 2Q9TA 3VLUA 3OXNA 4GWUA 1UIVA 4Z0IA 3N6TA 3R26A 1SDXA 4GL8A 4OVRA 4WEPA 3FZVA 3SEVA 1LB9A 1CB6A 2XXVA 2I58A 5CM6A 4Q30B 1JP4A 5J1DA 1MQDA 5ET5A 4QFNA 4YB5A 4R2BA 3TMGA 2XA5A 4EQ7A 2PMSA 2WBDA 3KBRA 1YCJA 3CFXA 5JEIA 2Y7WA 4NF6A 1ZIUA 1XI6A 3VVDA 4M4GA 2WKYA 3THIA 4LZ8A 3EKIA 4IGTA 4OENA 5IZ3B 2QVVA 1EZ9A 1IMCA 1QUKA 3MP6A 4PBHA 1MXUA 1OVTA 4H6DA 5KDTB 4GOTA 3IOWA 2QS2A 4ZZAA 2GRVA 4ESXA 5BUUA 2B3BA 1UTHB 5AA3A 2QFLA 2Q2AA 4GWYA 5H8QA 4KYSA 4KQPA 1UIUA 2HHMA 2Q74A 1J1NA 4P56A 3UA8A 3Q29A 3VFJA 2I6EA 4HE0A 3O6PA 3O9PA 1FBDA 1POTA 2QVRA 4PGNA 2O68A 4N6PA 5CMKA 3S4UA 1MPDA 3OELA 2ZNTA 3FV2A 1BK4A 4OYVA 1NV4A 2KQZA 4H5FA 3RUMA 2V3UA 1MXYA 1MY4A 4TQUQ 2JJKA 2YJPA 3DM0A 1PB7A 2XWIA 4LONB 4JVIA 3VXCA 3B50A 4DIGA 4OEUA 2H98A 4ZDMA 3H6UA 1OQHA 2DDKA 3IO6A 2ALUA 3BFTA 1MDQA 2WX9A 4H65A 3Q25A 4QF9A 1LGBC 3HHFA 4NF0A 1GTKA 3RT6B 1MPCA 3H03A 4H8JA 3UIFA 1DBZA 4NG7A 3G3KA 1ZKBA 3PMXA 3KG2A 3C36A 1NL5A 4YAHX 3GBBA 4EDPA 4ECFA 2RF1A 4ZEKA 2BJIA 1VE4A 1B4ZA 4JVDA 1FQDA 1S50A 3SDFA 1DCUA 4I9DA 3TTLA 1B5HA 3MSTA 1INPA 4XXUA 3IL1B 4MNIA 2VOZA 3M3LA 1MPBA 1B3LA 4OVJA 5FHMA 4I1DA 3MVWA 3KGCA 1MY1A 2F7BA 3QAXA 3B8BA 3MPLA 4LATA 4ND9A 5KCJB 3TFLA 4AS5A 3OSRA 4IO6A 1BP5A 1URDA 2P2AA 3UN6A 1FTAA 3LC8A 4MAGA 3T93B 3BIHA 2PYYA 1SPIA 2OBGA 3MZBA 1ZBMA 4PCDA 1DPEA 4EF1A 2RKMA 3MC2A 1GVCA 3B6WA 5IKBA 4JB7A 3SEYA 3MBPA 1SI1A 1P1WA 1MH4A 1SW2A 4ISUA 1IMEA 2VPNA 5I2NB 5LOMA 3PD8A 3U94A 2XXUA 3T9UA 3S9LC 1FPDA 1B46A 5T3JA 5FHOA 2FA7A 1YTVA 4NF8B 1FPBA 2CZLA 2ZYKA 4DI4B 3K1PA 1I69A 3ODBA 3QYTA 4PFIA 2XWVA 3GZGA 3LSLA 4FJPA 4ZE8A 4O94A 3RYDA 5BWJA 4YKPA 4G68B 1FPFA 1MM7A 2DE2A 1TT1A 1D9YA 4QFOA 2AL5A 5CMCA 2CEXA 2KLFA 3K1MA 3IFAA 2F97A 3USDA 4MEVA 3ILTB 5H8HB 4ELQA 2REJA 4NQ8A 1PDAA 1OIBA 2RINA 2HPGA 4X04A 1US5A 1YPNA 3PUXE 1JEUA 2DVZA 3TTRA 1NV6A 1HSLA 4O3CA 3V5AA 3MVXA 3DRJA 2VP1A 3EPEA 5ICTA 1RDXA 4GQOA 3MAMA 5DEXB 4ZEBA 3D4CA 1JW4A 3RTFB 2Y84A 2AIXA 3R7XA 3RT8A 4RK9A 1LBBA 4PAIA 1MXXA 1IMBA 4PAKA 4O8MA 2P1SA 4R75A 4XTCQ 2V4CA 4IB2A 1PB9A 1B3GA 2I4BA 5CBRA 1USYE 3UORA 4TOZA 5I58A 2CZHA 1NV7A 3N26A 1TFAA 4X8RA 5JTYB 3PPRA 1KA1A 1UQWA 5A5XA 4FEDA 3T66A 3FTOA 3A3CA 3QK6A 4PFTA 1FJ6A 1QUJA 2QPQA 2QMXA 3O28A 3QUJA 2DE4A 3HHGA 1ZTYA 3QMFA 1QUIA 1R9QA 4HE1A 5H8FB 2RCAA 1Q1KA 1PBPA 4GX3A 5LDZA 5ITOA 3OO6A 4DLDA 4QFKA 2BJJX 2DWHA 4G8MA 3CFLA 2UVJA 1EU8A 3C35A 2ZYMA 3MZ1A 4LN5A 2QS3A 2B4MA 4GX4A 4POWA 3LR1A 1XT8A 4YU0A 5I57B 2I49A 1P99A 2CMOA 2Y7IA 5EQ9A 3V83A 1IZ1A 1EYJA 1N7WA 1Y4TA 4F2QA 1QKAA 1IXGA 1IMAA 2D21A 3TZAA 1MY2A 2L5VA 4RYAA 1YYZA 4NF5A 1A54A 4JWOA 2XD3A 4H45A 1XVXA 1NKXA 4LUBA 1O64A 2O51A 1MY3A 5DVIA 4OFOA 1NV3A 3OO9A 2UVHA 5I2KA 3RN8A 2F3BA 3HSTA 4DXBA 4GLIA 1HSJA 4YKJA 1YZ0A 1H76A 1KZ8A 4O3BA 1Y1MA 3PPOA 1PEBA 4ZEFA 4N4UA 2AYSA 1FQBA 3CHGA 3TAJA 3W15C 4DZ1A 2THIA 3FIRA 5B7DA 2XXQA 3FXUA 4ELRA 4WEDA 2LAOA 4MHFA 1Y3QA 2DWIA 4MF3A 4PDHA 2D3IA 4PP0A 4G68C 2OX3A 3PPPA 4XEQA 3ILUB 5I59A 1BIYA 3TTNA 2HQ0A 3FUZA 3VVEA 2V3TA 3Q27A 4FAJA 1I6BA 5EHSA 5TP9B 2ZXTA 2UXAA 3E79A 2PFZA 5DW8A 3TKDA 3O97A 4KD5A 1I6QA 3ROJA 1NNPA 3F11A 2RC8A 3QUFA 3PUZE 3Q26A 4QHQA 1Y3NA 3K02A 4K3FA 2O1MA 3H3GA 1NV2A 3DLNA 3T9XB 4BDMA 3C31A 2DSFA 1MDP1 2WOKA 2F7AA 2ZNSA 2Z8FA 4X1DA 1WDNA 3C32A 4F19A 2ONRA 1Z7ME 4YMAA 3K1NA 3HV1A 4G2ZA 4OESA 3ECRA 3LUZA 4P3LA 3K6XA 3LSWA 1ZU0A 1NV5A 1FQAA 5EQAA 2REGA 4PAFA 1AL3A 2I4CA 5ELVA 1P1UA 3BBRA 4OFJA 2H4IA 2OWTA 3HFUA 4ELOA 2ZMBA 2O84X 2DXRA 1M5CA 3OO7A 1D9QA 2GHBA 2XHDA 3TTKA 2F7CA 3CG3A 3DRFA 3MWBA 1FPLA 5ESYA 2NVUB 4MFIA 1QJMA 3RPLB 1UTBA 1LCFA 3K6VA 1CNQA 1FQEA 4GBVA 1JW5A 4TLMB 2R8TA 4KCCA 3MZ9A 3DELB 4PC9A 4GF8A 2MKZA 4YKKA 4U1ZA 2Z8DA 4I62A 2NXOA 5DT6A 3O66A 5IGAA 4ESWA 4KI0E 1NUYA 4P11A 2V25A 3KBZA 2XXYA 3T9HB 2UYEA 1QGXA 3PPQA 1LSTA 3S9EA 3M3KA 4JSOA 1ELJA 4N91A 1M5EA 3TCFA 1KA0A 1XHYA 1Q35A 1LBVA 3ONMA 3CI8A 1FBHA 3TCGA 2QSXA 1FPIA 3IOTA 1DTGA 1IITA 3KFMA 1SW4A 2UVIA 4PQJA 2V3QA 4I8CA 1P1OA 2D5WA 4U4SA 3V8XB 3DP4A 3SKPA 4M1VA 4BDNA 4GX6A 3OD7A 2XXHA 4RK2A 4QFPA 4XKNA 1VDWA 4O7IA 2WOLA 3OO8A 4UA8A 4PETA 3RGYA 2VHAA 3GBAA 1OLCA 2RC7A 1N76A 4OXVA 1M5BA 1S7YA 2OLBA 2VD3A 5ICQA 2XXTA 3KC0A 3LBSA 1LFHA 4YKIA 4DE8A 5HM4B 1JVYA 3LV0A 5AA4A 3E78A 4H67A 4TLLB 3OEMA 2H99A 4LVQA 2A5SA 1XVYA 4EF2A 1XOCA 1JVXA 3LSFB 1LFIA 2XXKA 2ZZXA 1OMPA 1IIWA 3SEUA 1B32A 3C9HA 1CE2A 3TPAA 3MW0A 3SEXA 3TTMA 4F1VA 4GWSA 2XXXA 2IEEA 3H6WA 4I40A 5FTIA 3HPIA 1PC3A 2ANJA 1FTKA 1SW1A 4EQ9A 3GXAA 3QSLA 2DS9A 4IO5A 2GHAA 3EHSA 4DXUA 3PMVA 3DRIA 3FXBA 4MNCA 2HCAA 3SZPA 4F3BA 2XXIA 3C33A 5I3SA 1TFDA 3MPKA 1R6ZA 1N0TA 4R9GA 3QIMA 1G0IA 1RDYA 3FVOA 3H6TA 3VVFA 2OWZA 2QVUA 5A5XB 2HZLA 3RY3A 4QRZA 3TQLA 4OHNA 3MQ9A 4MJOA 4Q8RA 1LCTA 3CVGA 1FQCA 4N6KA 4QSCA 5JK4A 3IX1A 1A8FA 1II5A 4KYEA 1XC1A 5L9SA 3U65A 4NEDA 1NUWA 1SVXB 4P0IA 5ET7A 4R6KA 4BDOA 4HCWA 1P1QA 3L6HA 3ISPA 4I3EA 4U2RA 1B58A 1UTHA 4PFWA 1US4A 1DSNA 3IJXB 3IORA 3TEPA 3MP1A 3FV1A 4P1EA 4QSEA 2Q2CA 1DTZA 2P3VA 1P1NA 1H45A 4H1XA 1FQFA 4LQ2A 4MNPA 4BDQA 2WOPA 2QJEA 4U1OA 4ZZEA 3RQTA 4NGUA 2F35A 1B3EA 4NF4B 2CEYA 4R6YA 4ONYA 3G3JA 3OENA 5I2KB 2F8DA 5IZ1A 1NV0A 1B0LA 3B7DA 5F7VA 2OCUA 3RYBA 1KWHA 1OVBA 4ZEIA 3O6IA 1POY1 1USYH 2PVUA 3IB2A 4OWDA 1LBWA 3E13X 4RNSA 3S9NC 4H0WA 1D4NA 4IR8A 1B7ZA 2G93A 3FVNA 4HCYA 3FVKA 4IO4A 4ELPA 4PFBA 3K6WA 3BKIB 3C4MA 4NWCA 3CSBA 3K2DA 1IMFA 1N3WA 2UVGA 4YICA 1FBFA 4GVOA 3T96B 2KR0A 1B6HA 2FHYA 4ZECA 4OETA 5I59B 4DI3D 2A5TB 3T1BA 2ZYNA 2WEFA 3KN7A 4MLVA 1Y3PA 3WAEA 2DWJA 3T9VA 1PB8A 2RC9A 2VD2A 3M3FA 3T22A 2W7YA 5AA2B 3CFZA 3BIGA 4RPOA 1LBXA 4YB7A 3D4GA 1ZMGA 3PUWE 2PCRA 2F6GA 1DK4A 1F9BA 5I7IA 1EZOA 1ZLQA 1NNKA 1D9VA 1NH7A 3DRHA 1BLFA 3O2AA 4FBPA 4NAPA 4P9KA 3VDFA 4GRKA 2UYFA 1FBPA 2Y7RA 4OVSA 2CZKA 1S9TA 2FNCA 4OQOA 5H8NA 1L5TA 3U92A 1MY0A 2Q89A 1H3DA 1IUDA 1LBYA 4FEBA 3K00A 1IXCA 1NI9A 4G8NA 4OVPA 4C1TA 4KPTA 2PBWA 1NMUA 3B6TA 4HTGA 4RY1A 5I56B 2FVZA 3PAMA 3O29A 3FVGA 1QULA 5I2NA 3MVZA 1NUXA 5LTCA 2Z23A 3SETA 3MP8A 3KEIA 3IFCA 3SERA 5ITPA 4NF8A 4PBQA 3IOUA 4G77A 3DP6A 3SESA 4GWZA 4EUOA 3IB1A 1IXIA 2XX7A 3KN3A 1NV1A 3RLFE 3TYHA 3K4UA 2O7IA 5EQ7A 3ZS6A 4DCYA 2ZNUA 3OMBA 1B0HA 2E1SA 1BTJA 1RYXA 3V89B 1JW1A 4KYDA 1IXHA 3LSXA 5FTHA
chains in the Genus database with same CATH topology
4PC9A 4GF8A 2MKZA 1FPKA 4ZEKA 2BJIA 5IZZA 1FPJA 1B4ZA 2ZZWA 4JVDA 1FBCA 1DCUA 4I9DA 1G0HA 2P3NA 1IMDA 5IGAA 1K9YA 1B5HA 3MSTA 1NUYA 1INPA 4NHBA 3KBZA 4MNIA 4OVQA 4GWWA 3I5OA 1B3LA 1QGXA 4PF6A 4QBAA 4PFYA 4JSOA 2GQ1A 4N91A 3MVWA 3TCFA 1KA0A 3D1RA 1LBVA 3B8BA 1B51A 1FBHA 3TCGA 1B40A 2VT5A 4P8BA 1FPIA 4HXVA 1B05A 4AS5A 2V3QA 4GBWA 1FTAA 4I8CA 4MAGA 2D5WA 3BIHA 1EYIA 1QKBA 1B9JA 5L8DA 4N81A 1SPIA 3MZBA 4PFUA 4M1VA 4GX6A 4PCDA 1DPEA 2RKMA 4QFPA 3TCHA 5F1QA 5I5PA 4XKNA 1VDWA 2XWKA 4O7IA 2WOLA 4GWXA 1RKMA 4PETA 3W9WA 1OLCA 1IMEA 4XF5A 2VPNA 2FIXA 2OLBA 4QFLA 1FPDA 1FPEA 1B46A 2Y5KA 5T3JA 5ICQA 3KC0A 1B52A 4OFLA 2Q8MA 1FPBA 2PFYA 5HM4B 3LV0A 4DI4B 1B5JA 1EYKA 2CZIA 4PFIA 3E78A 2XWVA 4I3YA 4JSDA 2DE3A 2B4LA 5ISUA 4ZE8A 4O94A 3RYDA 1XOCA 2Y5LA 1FPFA 2XXKA 2ZZXA 3NOHA 2DE2A 4NX1A 4QFOA 4GFRA 4JVCA 2CEXA 1LEVA 3IFAA 1Q9DA 1B32A 4N8GA 3TPAA 4MEVA 3MW0A 4N15A 1LBZA 4NQ8A 4F1VA 4GWSA 2WBBA 1B3FA 5KZTA 2HPGA 4X04A 2F3DA 4I40A 4XKRA 1JEUA 4F18A 1B2HA 2DVZA 1FPGA 1NV6A 2WYKA 4PTKA 2NOOA 3MVXA 3DRJA 4NN3A 1RDXA 1B3HA 3DRIA 1FSAA 3FXBA 1FBEA 3M8UA 4ZEBA 4MNCA 4OVTA 3RYAA 3SZPA 4UABA 1VR5A 1B1HA 5I3SA 4MCOA 4PAIA 4N6DA 1IMBA 4PAKA 4O8MA 2V4CA 3QIMA 1G0IA 4MX6A 1RDYA 1AWBA 2OWZA 1B3GA 2QVUA 2HZLA 3RY3A 5EYGA 4TOZA 4N17A 4MJOA 2CZHA 1NV7A 4X8RA 2XWOA 1KA1A 4N6KA 1UQWA 2F5XA 3A29A 5JK4A 4PGPA 3T66A 3FTOA 3U65A 4PFTA 1FJ6A 1NUWA 5ET7A 2QPQA 4H46A 5IM2A 4MIJA 4HE2A 2DE4A 4HCWA 1ZTYA 3QMFA 3KC1A 5ET6A 4HE1A 3ISPA 4I3EA 4XKQA 1B58A 4GX3A 1FBGA 4PFWA 5LDZA 2HXRA 5FBPA 4QFKA 1FJ9A 4PE3A 3E3KA 5F24A 4X9TA 4KXPA 3W9VA 4P1EA 4LN5A 2B4MA 4GX4A 3MVYA 2P3VA 1B7HA 4MNPA 5EQ9A 4ZE9A 1EYJA 2WOPA 1QKAA 3RQTA 4DCXA 1IMAA 4NGUA 2L5VA 1YYZA 4XKPA 2CEYA 4RA1A 4ONYA 4P47A 5ET8A 4AS4A 4H45A 5EQ8A 4N8YA 5IZ1A 2Q9TA 4GWUA 1UIVA 1NV0A 4OFOA 2WYPA 3RYBA 1NV3A 1DPPA 4ZEIA 4GL8A 4OVRA 2F3BA 1LBWA 1RDZA 1YZ0A 1KZ8A 5CM6A 4IR8A 1JP4A 4HCYA 5J1DA 3GYYA 1B5IA 3DRGA 5EYHA 4PFBA 4N4UA 5ET5A 4QFNA 3CHGA 3DP8A 1IMFA 4P1LA 4OA4A 3RPLA 4YICA 1FBFA 5A5LA 2XA5A 2VPOA 3T0JA 2KR0A 2WBDA 4XFEA 3DRKA 4WEDA 1B6HA 1XI6A 2FHYA 4ZECA 4MHFA 4OETA 3EKIA 4YZZA 5IZ3B 4DI3D 2QVVA 3T1BA 1B4HA 1IMCA 2WEFA 4PDHA 4MMPA 4PBHA 1FRPA 4OEVA 1OLAA 4ZEDA 2OX3A 4XEQA 5IZ3A 2GRVA 3BIGA 1LBXA 3FBPA 1JEVA 2PCRA 4O7MA 2QFLA 1DK4A 5I7IA 1JETA 4PFRA 1ZLQA 4GWYA 3PTYA 1UIUA 4FAJA 2HHMA 2Q74A 3DRHA 4P56A 3E79A 2PFZA 5DW8A 2FIEA 4FBPA 4NAPA 4P9KA 4HE0A 1YXIA 3O6PA 2ZZVA 4OANA 3O9PA 1FBDA 1FBPA 2QVRA 3ROJA 4PGNA 4OVSA 2CZKA 3LVUA 1BK4A 1NV2A 1LBYA 1NV4A 2KQZA 1NI9A 4OVPA 2WOKA 4F19A 2JJKA 4QXDA 4OESA 2FVZA 4P3LA 3PAMA 3LUZA 2XWIA 3MVZA 1NUXA 4JVIA 5LTCA 1ZU0A 1NV5A 2Z23A 3B50A 5EQAA 2HZKA 4PAFA 3IFCA 4OFJA 4OEUA 4PBQA 2DDKA 4G61A 3HFUA 2WX9A 4GWZA 5J16A 2FBPA 1D9QA 1NV1A 4OERA 3DRFA 4NF0A 2O7IA 4F1UA 1FPLA 5ESYA 5EQ7A 3ZS6A 4DCYA 3MYUA 1B0HA 1DBZA 4NG7A 4PDDA 3RPLB 1NUZA 4PF8A 1CNQA 4GBVA 1K9ZA 2R8TA 3MZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEV A;  1OLA A;  4GF8 A;  4ZED A;  4QFK A;  4ZEK A;  2GRV A;  4GFR A;  4QFO A;  3E3K A;  1B4Z A;  1B32 A;  1JEV A;  4I9D A;  3TPA A;  1B5H A;  3MW0 A;  2B4M A;  1JET A;  3MVY A;  1ZLQ A;  3I5O A;  1UIU A;  1B3L A;  4FAJ A;  1B7H A;  4PFY A;  1B3F A;  3DRH A;  4JSO A;  4ZE9 A;  5KZT A;  3MVW A;  3TCF A;  2WOP A;  1QKA A;  4XKR A;  1B51 A;  3RQT A;  1JEU A;  4DCX A;  1B2H A;  3TCG A;  1B40 A;  3O6P A;  3O9P A;  1B05 A;  2NOO A;  3MVX A;  3DRJ A;  4XKP A;  3LVU A;  1B3H A;  3DRI A;  4PFW A;  3M8U A;  4I8C A;  4RA1 A;  4ONY A;  2D5W A;  4ZEB A;  1QKB A;  1B9J A;  5L8D A;  3RYA A;  2WOK A;  3MZB A;  1VR5 A;  1UIV A;  4PFU A;  4OFO A;  1DPE A;  1B1H A;  3RYB A;  1DPP A;  2RKM A;  4ZEI A;  4OES A;  4QFP A;  3TCH A;  4GL8 A;  3PAM A;  5F1Q A;  4XKN A;  3MVZ A;  1ZU0 A;  2WOL A;  2Z23 A;  3QIM A;  1RKM A;  1B3G A;  4OFJ A;  4OEU A;  3RY3 A;  1OLC A;  4TOZ A;  1B5I A;  3DRG A;  2OLB A;  4QFN A;  3CHG A;  4QFL A;  1B46 A;  3DP8 A;  5ICQ A;  1UQW A;  1B52 A;  4OFL A;  3T66 A;  3FTO A;  4OER A;  4PFT A;  5HM4 B;  3DRF A;  2O7I A;  3DRK A;  4WED A;  1B6H A;  1ZTY A;  4ZEC A;  1B5J A;  3ZS6 A;  4DCY A;  1B0H A;  4OET A;  4JSD A;  2B4L A;  5ISU A;  1B4H A;  4ZE8 A;  4XKQ A;  1B58 A;  1XOC A;  3MZ9 A; 
#chains in the Genus database with same CATH topology
 1MQI A;  4NF6 B;  5H8H A;  2Q88 A;  1FPK A;  4O3A A;  2XX9 A;  3AXF A;  5DTB A;  2HFB A;  2Z22 A;  1FPJ A;  2X7Q A;  2ZZW A;  3N6U A;  1FBC A;  2Y7K A;  4AQ4 A;  2P3N A;  4OVQ A;  3I5O A;  2VGQ A;  4PF6 A;  2QS1 A;  4QBA A;  4KHZ E;  2GQ1 A;  1FTJ A;  3D1R A;  1HSE A;  1URG A;  5H8Q B;  5TPA A;  2VT5 A;  4HXV A;  4R2F A;  3UK4 A;  1QW0 A;  3I3V A;  2X26 A;  2O1L A;  1EYI A;  3IAZ A;  5L8D A;  1FW0 A;  4F39 A;  2PT2 A;  1A40 A;  1N84 A;  3K6U A;  4PFU A;  3RNN A;  3PU5 A;  4E0X A;  5F1Q A;  2XWK A;  4GWX A;  3EHT A;  5JTY A;  3W9W A;  1LB8 A;  1SYH A;  4XF5 A;  3UP9 A;  2OJT A;  2FYI A;  3S9M C;  2HAV A;  3PGF A;  4N13 A;  1FPE A;  1MM6 A;  4U22 A;  3U72 A;  1D3K A;  1MXZ A;  5H8F A;  4U4X A;  4AB6 A;  2PFY A;  3G3F A;  3KOS A;  1B5J A;  2CZI A;  5DYH A;  4I3Y A;  1NNF A;  2DE3 A;  2B4L A;  1MH3 A;  4YB6 A;  2Y5L A;  3VXB A;  3NOH A;  3HN0 A;  2DWA A;  4GFR A;  4JVC A;  3G3I A;  4R74 A;  1H43 A;  1Q9D A;  1MXW A;  5K2Y A;  4F1Y A;  4C0R A;  2OK2 A;  5I84 A;  5KZT A;  1A55 A;  2F3D A;  4XKR A;  4ZS9 A;  4F29 A;  4JXI A;  1B2H A;  2NOO A;  4POX A;  4NN3 A;  4IO2 A;  3P7I A;  1B3H A;  4EQB A;  1ATG A;  1FSA A;  4GXS B;  3M8U A;  4EXK A;  4IO7 A;  4OVT A;  3RYA A;  1VR5 A;  1LAX A;  3U93 A;  3N94 A;  2R6G E;  4MCO A;  2QRY A;  4RXL A;  3BFU A;  3H06 B;  4R9F A;  1IEJ A;  4RJZ A;  4RPN A;  4HS7 A;  3KOT A;  1NFT A;  2F78 A;  1GR2 A;  2Y7P A;  1MQH A;  3H6V A;  2QS4 A;  3IB0 A;  2XWO A;  3PUV E;  5L9M A;  4AB5 A;  3K01 A;  3TUS A;  4H46 A;  1AIV A;  5IM2 A;  4MIJ A;  4F2O A;  4GIZ A;  2QL3 A;  3KC1 A;  5ET6 A;  3TQW A;  3C34 A;  4LA9 A;  4NE4 A;  3KN8 A;  4OMB A;  1SBP A;  4C1U A;  4FAT A;  5TP9 A;  3E3K A;  4KFQ A;  5F24 A;  1FTO A;  4X9T A;  5CMB A;  3W9V A;  1VFD A;  4MH5 A;  1TXF A;  3MVY A;  4JDF A;  4HW8 A;  1M5D A;  4WKM A;  3KJ7 A;  1B7H A;  4N07 A;  4OZ9 A;  4F3P A;  4ZE9 A;  5TU0 A;  4DCX A;  3PV0 E;  4JBZ A;  5CBS A;  3CSG A;  4FIM A;  1Y4C A;  4XKP A;  2O69 A;  3K0V A;  1DMB A;  4IY5 A;  4Z7E A;  4KCD A;  3E9X A;  2B3F A;  1LFG A;  3SEW A;  4RA1 A;  1WVJ A;  1EH3 A;  4P47 A;  5ET8 A;  5EQ8 A;  4N8Y A;  4JWY A;  3TOD A;  2V84 A;  2WYP A;  1DPP A;  2F34 A;  4G8H A;  4FEC A;  3EHU A;  2I0B A;  3JYR A;  3PPN A;  2XD2 A;  2OWS A;  4THI A;  1GGG A;  5AE4 A;  1RDZ A;  3EN3 A;  1B7U A;  1A8E A;  3GYY A;  1B5I A;  3O6H A;  3DRG A;  3N5L A;  5EYH A;  1MS7 A;  1LAH E;  1ZJL A;  1XS5 A;  3DP8 A;  4P1L A;  4OA4 A;  3IR1 A;  3RPL A;  5DVJ A;  5H8S A;  3RPW A;  5A5L A;  5I58 B;  2VPO A;  3T0J A;  3CRB A;  4XFE A;  3DRK A;  2HEU A;  4Q5T A;  4YZZ A;  1B4H A;  4MMP A;  1NNT A;  1FRP A;  4F3S A;  4OEV A;  1OLA A;  4ZED A;  3RTW B;  1AH5 A;  2E0S A;  2B65 A;  5IZ3 A;  2XXR A;  3FBP A;  1JEV A;  4O7M A;  1PBQ A;  5KDT A;  1SD3 A;  1JET A;  4PFR A;  3PTY A;  2ESN A;  3A09 A;  5H8N B;  2FIE A;  4U23 A;  2M8C A;  2AL4 A;  1YXI A;  1Y20 A;  2ZZV A;  4OAN A;  1VSO A;  2O6A A;  3IO4 A;  2R71 A;  5M2V A;  1MRP A;  2P0S A;  2DVC A;  1NH8 A;  3LVU A;  3UGW A;  5K2X A;  5IAI A;  1LLS A;  4NTL A;  3FXR A;  4R73 A;  2OZZ A;  5EYF A;  4NF5 B;  2HAU A;  4FE8 A;  3HO7 A;  4QXD A;  2PT1 A;  4YMB A;  3IK6 B;  1JQF A;  3IJO B;  2HZK A;  3VV5 A;  4Q0C A;  5FHN A;  1URS A;  4G61 A;  1DOT A;  4QSD A;  2RCB A;  3U1O A;  1SYI A;  4G4P A;  5J16 A;  2X7P A;  3OOA A;  4F3G A;  2FBP A;  5CRY A;  4IY6 A;  1A99 A;  3KSX A;  4OER A;  3G3G A;  3G7W A;  4F1U A;  1YAE A;  2H5Y A;  4PDD A;  3MYU A;  2GH9 A;  2QMW A;  3VLV A;  1NUZ A;  4PF8 A;  1LAF E;  1K9Z A;  4MLQ A;  3EF7 A;  1AOV A;  3L6G A;  5IZZ A;  2DP8 A;  2NWJ A;  1EZP A;  3CIJ A;  4UAC A;  5HBC A;  5L9O A;  1A7L A;  1G0H A;  2G29 A;  1IMD A;  1K9Y A;  4NHB A;  4NMY A;  4GWW A;  3GLB A;  3PUY E;  1LAG E;  5TPA B;  3WAF A;  4PFY A;  4H8I A;  4MBP A;  1JNF A;  4FOR A;  2ONS A;  1R1N A;  1B51 A;  2F36 A;  3KJT A;  5EHM A;  1B40 A;  4P8B A;  3G3H A;  1B05 A;  1T0K A;  4DDD A;  1I6A A;  4NWD A;  4GBW A;  2YLN A;  2V93 A;  1M5F A;  4BLA A;  1O7T A;  1QKB A;  1B9J A;  3H4Z A;  4N81 A;  3Q28 A;  3FJ7 A;  5KCJ A;  3FJG A;  1QVS A;  3MJN A;  4LQ5 A;  4GXA A;  1SQY A;  1BKA A;  3TCH A;  2NUV A;  2YPN A;  5I5P A;  3CR9 A;  2I0C A;  1Y1Z A;  3LUY A;  2HXW A;  3FD3 A;  1RKM A;  3I6V A;  4X48 A;  2DQV A;  4LZ7 A;  2DYX A;  2XXW A;  1MQG A;  2FIX A;  3FXQ A;  4QFL A;  1VFE A;  2Y5K A;  4U21 A;  4DXC A;  2Q8M A;  1Y9U A;  1B52 A;  4OFL A;  4EXL A;  3QXM A;  4WXJ A;  1EYK A;  1SW5 A;  3OSQ A;  4JSD A;  5ISU A;  4GD5 A;  5CC2 A;  3IOV A;  1SI0 A;  4XIG Q;  3ZSF A;  1UTB B;  3U8Q A;  4NX1 A;  1MG1 A;  4P0G A;  1LEV A;  4X1B A;  4H5G A;  4N8G A;  3PMW A;  2DXY A;  4N15 A;  4G68 A;  4IGR A;  1LBZ A;  3TDJ A;  2WBB A;  1B3F A;  3E4R A;  4NF4 A;  1N7X A;  1FCK A;  2H9B A;  3ZKL A;  2Q8J A;  4F18 A;  1FPG A;  2DOJ A;  3CG1 A;  2WYK A;  4PTK A;  2I48 A;  3B6Q A;  1LBC A;  4F22 A;  4PE5 B;  1FTM A;  1FBE A;  1ANF A;  3FJM A;  4R72 A;  1O63 A;  1R9L A;  5B70 A;  1N04 A;  1OQG A;  4UAB A;  4GWO A;  3ZKK A;  1B1H A;  4R6H A;  5DEX A;  4E0W A;  4N6D A;  3JZJ A;  1TWY A;  3VLW A;  1AMF A;  2F6P A;  4L17 A;  4MX6 A;  1AWB A;  5EYG A;  4N17 A;  2ONK E;  5AA1 A;  3HCQ A;  4JWX A;  3R6U A;  1WOD A;  3EQ1 A;  5CMM A;  5HPQ A;  2F5X A;  2ABH A;  3A29 A;  2A5T A;  4PGP A;  2PX1 A;  2O7U A;  3TEL A;  4IO3 A;  4HE2 A;  2XX8 A;  3FAT A;  3KZG A;  3OEK A;  1B1X A;  4OTE A;  2GFE A;  2I3V A;  5CI5 A;  5AA2 A;  4LP2 B;  4XKQ A;  1FBG A;  1MQJ A;  2HXR A;  2ZYO A;  5FBP A;  3MUQ A;  5AA4 B;  3S2V A;  3A3U A;  1N3X A;  1FJ9 A;  4F31 B;  3O6G A;  1IQ7 A;  4PE3 A;  4BDL A;  4KXP A;  1H44 A;  1MXV A;  4LZ5 A;  2Z8E A;  5AA2 D;  4KR5 A;  4BDR A;  3PD9 A;  2I3W A;  2XXP A;  3VE1 B;  3JV9 A;  2IA4 A;  4GL0 A;  5DVF A;  3KSJ A;  5I57 A;  1RYO A;  3H7M A;  3FGS A;  1FTL A;  1Z7N E;  1GV8 A;  2R9J A;  5I56 A;  4AS4 A;  3FAS A;  2H25 A;  2Q9T A;  3VLU A;  3OXN A;  4GWU A;  1UIV A;  4Z0I A;  3N6T A;  3R26 A;  1SDX A;  4GL8 A;  4OVR A;  4WEP A;  3FZV A;  3SEV A;  1LB9 A;  1CB6 A;  2XXV A;  2I58 A;  5CM6 A;  4Q30 B;  1JP4 A;  5J1D A;  1MQD A;  5ET5 A;  4QFN A;  4YB5 A;  4R2B A;  3TMG A;  2XA5 A;  4EQ7 A;  2PMS A;  2WBD A;  3KBR A;  1YCJ A;  3CFX A;  5JEI A;  2Y7W A;  4NF6 A;  1ZIU A;  1XI6 A;  3VVD A;  4M4G A;  2WKY A;  3THI A;  4LZ8 A;  3EKI A;  4IGT A;  4OEN A;  5IZ3 B;  2QVV A;  1EZ9 A;  1IMC A;  1QUK A;  3MP6 A;  4PBH A;  1MXU A;  1OVT A;  4H6D A;  5KDT B;  4GOT A;  3IOW A;  2QS2 A;  4ZZA A;  2GRV A;  4ESX A;  5BUU A;  2B3B A;  1UTH B;  5AA3 A;  2QFL A;  2Q2A A;  4GWY A;  5H8Q A;  4KYS A;  4KQP A;  1UIU A;  2HHM A;  2Q74 A;  1J1N A;  4P56 A;  3UA8 A;  3Q29 A;  3VFJ A;  2I6E A;  4HE0 A;  3O6P A;  3O9P A;  1FBD A;  1POT A;  2QVR A;  4PGN A;  2O68 A;  4N6P A;  5CMK A;  3S4U A;  1MPD A;  3OEL A;  2ZNT A;  3FV2 A;  1BK4 A;  4OYV A;  1NV4 A;  2KQZ A;  4H5F A;  3RUM A;  2V3U A;  1MXY A;  1MY4 A;  4TQU Q;  2JJK A;  2YJP A;  3DM0 A;  1PB7 A;  2XWI A;  4LON B;  4JVI A;  3VXC A;  3B50 A;  4DIG A;  4OEU A;  2H98 A;  4ZDM A;  3H6U A;  1OQH A;  2DDK A;  3IO6 A;  2ALU A;  3BFT A;  1MDQ A;  2WX9 A;  4H65 A;  3Q25 A;  4QF9 A;  1LGB C;  3HHF A;  4NF0 A;  1GTK A;  3RT6 B;  1MPC A;  3H03 A;  4H8J A;  3UIF A;  1DBZ A;  4NG7 A;  3G3K A;  1ZKB A;  3PMX A;  3KG2 A;  3C36 A;  1NL5 A;  4YAH X;  3GBB A;  4EDP A;  4ECF A;  2RF1 A;  4ZEK A;  2BJI A;  1VE4 A;  1B4Z A;  4JVD A;  1FQD A;  1S50 A;  3SDF A;  1DCU A;  4I9D A;  3TTL A;  1B5H A;  3MST A;  1INP A;  4XXU A;  3IL1 B;  4MNI A;  2VOZ A;  3M3L A;  1MPB A;  1B3L A;  4OVJ A;  5FHM A;  4I1D A;  3MVW A;  3KGC A;  1MY1 A;  2F7B A;  3QAX A;  3B8B A;  3MPL A;  4LAT A;  4ND9 A;  5KCJ B;  3TFL A;  4AS5 A;  3OSR A;  4IO6 A;  1BP5 A;  1URD A;  2P2A A;  3UN6 A;  1FTA A;  3LC8 A;  4MAG A;  3T93 B;  3BIH A;  2PYY A;  1SPI A;  2OBG A;  3MZB A;  1ZBM A;  4PCD A;  1DPE A;  4EF1 A;  2RKM A;  3MC2 A;  1GVC A;  3B6W A;  5IKB A;  4JB7 A;  3SEY A;  3MBP A;  1SI1 A;  1P1W A;  1MH4 A;  1SW2 A;  4ISU A;  1IME A;  2VPN A;  5I2N B;  5LOM A;  3PD8 A;  3U94 A;  2XXU A;  3T9U A;  3S9L C;  1FPD A;  1B46 A;  5T3J A;  5FHO A;  2FA7 A;  1YTV A;  4NF8 B;  1FPB A;  2CZL A;  2ZYK A;  4DI4 B;  3K1P A;  1I69 A;  3ODB A;  3QYT A;  4PFI A;  2XWV A;  3GZG A;  3LSL A;  4FJP A;  4ZE8 A;  4O94 A;  3RYD A;  5BWJ A;  4YKP A;  4G68 B;  1FPF A;  1MM7 A;  2DE2 A;  1TT1 A;  1D9Y A;  4QFO A;  2AL5 A;  5CMC A;  2CEX A;  2KLF A;  3K1M A;  3IFA A;  2F97 A;  3USD A;  4MEV A;  3ILT B;  5H8H B;  4ELQ A;  2REJ A;  4NQ8 A;  1PDA A;  1OIB A;  2RIN A;  2HPG A;  4X04 A;  1US5 A;  1YPN A;  3PUX E;  1JEU A;  2DVZ A;  3TTR A;  1NV6 A;  1HSL A;  4O3C A;  3V5A A;  3MVX A;  3DRJ A;  2VP1 A;  3EPE A;  5ICT A;  1RDX A;  4GQO A;  3MAM A;  5DEX B;  4ZEB A;  3D4C A;  1JW4 A;  3RTF B;  2Y84 A;  2AIX A;  3R7X A;  3RT8 A;  4RK9 A;  1LBB A;  4PAI A;  1MXX A;  1IMB A;  4PAK A;  4O8M A;  2P1S A;  4R75 A;  4XTC Q;  2V4C A;  4IB2 A;  1PB9 A;  1B3G A;  2I4B A;  5CBR A;  1USY E;  3UOR A;  4TOZ A;  5I58 A;  2CZH A;  1NV7 A;  3N26 A;  1TFA A;  4X8R A;  5JTY B;  3PPR A;  1KA1 A;  1UQW A;  5A5X A;  4FED A;  3T66 A;  3FTO A;  3A3C A;  3QK6 A;  4PFT A;  1FJ6 A;  1QUJ A;  2QPQ A;  2QMX A;  3O28 A;  3QUJ A;  2DE4 A;  3HHG A;  1ZTY A;  3QMF A;  1QUI A;  1R9Q A;  4HE1 A;  5H8F B;  2RCA A;  1Q1K A;  1PBP A;  4GX3 A;  5LDZ A;  5ITO A;  3OO6 A;  4DLD A;  4QFK A;  2BJJ X;  2DWH A;  4G8M A;  3CFL A;  2UVJ A;  1EU8 A;  3C35 A;  2ZYM A;  3MZ1 A;  4LN5 A;  2QS3 A;  2B4M A;  4GX4 A;  4POW A;  3LR1 A;  1XT8 A;  4YU0 A;  5I57 B;  2I49 A;  1P99 A;  2CMO A;  2Y7I A;  5EQ9 A;  3V83 A;  1IZ1 A;  1EYJ A;  1N7W A;  1Y4T A;  4F2Q A;  1QKA A;  1IXG A;  1IMA A;  2D21 A;  3TZA A;  1MY2 A;  2L5V A;  4RYA A;  1YYZ A;  4NF5 A;  1A54 A;  4JWO A;  2XD3 A;  4H45 A;  1XVX A;  1NKX A;  4LUB A;  1O64 A;  2O51 A;  1MY3 A;  5DVI A;  4OFO A;  1NV3 A;  3OO9 A;  2UVH A;  5I2K A;  3RN8 A;  2F3B A;  3HST A;  4DXB A;  4GLI A;  1HSJ A;  4YKJ A;  1YZ0 A;  1H76 A;  1KZ8 A;  4O3B A;  1Y1M A;  3PPO A;  1PEB A;  4ZEF A;  4N4U A;  2AYS A;  1FQB A;  3CHG A;  3TAJ A;  3W15 C;  4DZ1 A;  2THI A;  3FIR A;  5B7D A;  2XXQ A;  3FXU A;  4ELR A;  4WED A;  2LAO A;  4MHF A;  1Y3Q A;  2DWI A;  4MF3 A;  4PDH A;  2D3I A;  4PP0 A;  4G68 C;  2OX3 A;  3PPP A;  4XEQ A;  3ILU B;  5I59 A;  1BIY A;  3TTN A;  2HQ0 A;  3FUZ A;  3VVE A;  2V3T A;  3Q27 A;  4FAJ A;  1I6B A;  5EHS A;  5TP9 B;  2ZXT A;  2UXA A;  3E79 A;  2PFZ A;  5DW8 A;  3TKD A;  3O97 A;  4KD5 A;  1I6Q A;  3ROJ A;  1NNP A;  3F11 A;  2RC8 A;  3QUF A;  3PUZ E;  3Q26 A;  4QHQ A;  1Y3N A;  3K02 A;  4K3F A;  2O1M A;  3H3G A;  1NV2 A;  3DLN A;  3T9X B;  4BDM A;  3C31 A;  2DSF A;  1MDP 1;  2WOK A;  2F7A A;  2ZNS A;  2Z8F A;  4X1D A;  1WDN A;  3C32 A;  4F19 A;  2ONR A;  1Z7M E;  4YMA A;  3K1N A;  3HV1 A;  4G2Z A;  4OES A;  3ECR A;  3LUZ A;  4P3L A;  3K6X A;  3LSW A;  1ZU0 A;  1NV5 A;  1FQA A;  5EQA A;  2REG A;  4PAF A;  1AL3 A;  2I4C A;  5ELV A;  1P1U A;  3BBR A;  4OFJ A;  2H4I A;  2OWT A;  3HFU A;  4ELO A;  2ZMB A;  2O84 X;  2DXR A;  1M5C A;  3OO7 A;  1D9Q A;  2GHB A;  2XHD A;  3TTK A;  2F7C A;  3CG3 A;  3DRF A;  3MWB A;  1FPL A;  5ESY A;  2NVU B;  4MFI A;  1QJM A;  3RPL B;  1UTB A;  1LCF A;  3K6V A;  1CNQ A;  1FQE A;  4GBV A;  1JW5 A;  4TLM B;  2R8T A;  4KCC A;  3MZ9 A;  3DEL B;  4PC9 A;  4GF8 A;  2MKZ A;  4YKK A;  4U1Z A;  2Z8D A;  4I62 A;  2NXO A;  5DT6 A;  3O66 A;  5IGA A;  4ESW A;  4KI0 E;  1NUY A;  4P11 A;  2V25 A;  3KBZ A;  2XXY A;  3T9H B;  2UYE A;  1QGX A;  3PPQ A;  1LST A;  3S9E A;  3M3K A;  4JSO A;  1ELJ A;  4N91 A;  1M5E A;  3TCF A;  1KA0 A;  1XHY A;  1Q35 A;  1LBV A;  3ONM A;  3CI8 A;  1FBH A;  3TCG A;  2QSX A;  1FPI A;  3IOT A;  1DTG A;  1IIT A;  3KFM A;  1SW4 A;  2UVI A;  4PQJ A;  2V3Q A;  4I8C A;  1P1O A;  2D5W A;  4U4S A;  3V8X B;  3DP4 A;  3SKP A;  4M1V A;  4BDN A;  4GX6 A;  3OD7 A;  2XXH A;  4RK2 A;  4QFP A;  4XKN A;  1VDW A;  4O7I A;  2WOL A;  3OO8 A;  4UA8 A;  4PET A;  3RGY A;  2VHA A;  3GBA A;  1OLC A;  2RC7 A;  1N76 A;  4OXV A;  1M5B A;  1S7Y A;  2OLB A;  2VD3 A;  5ICQ A;  2XXT A;  3KC0 A;  3LBS A;  1LFH A;  4YKI A;  4DE8 A;  5HM4 B;  1JVY A;  3LV0 A;  5AA4 A;  3E78 A;  4H67 A;  4TLL B;  3OEM A;  2H99 A;  4LVQ A;  2A5S A;  1XVY A;  4EF2 A;  1XOC A;  1JVX A;  3LSF B;  1LFI A;  2XXK A;  2ZZX A;  1OMP A;  1IIW A;  3SEU A;  1B32 A;  3C9H A;  1CE2 A;  3TPA A;  3MW0 A;  3SEX A;  3TTM A;  4F1V A;  4GWS A;  2XXX A;  2IEE A;  3H6W A;  4I40 A;  5FTI A;  3HPI A;  1PC3 A;  2ANJ A;  1FTK A;  1SW1 A;  4EQ9 A;  3GXA A;  3QSL A;  2DS9 A;  4IO5 A;  2GHA A;  3EHS A;  4DXU A;  3PMV A;  3DRI A;  3FXB A;  4MNC A;  2HCA A;  3SZP A;  4F3B A;  2XXI A;  3C33 A;  5I3S A;  1TFD A;  3MPK A;  1R6Z A;  1N0T A;  4R9G A;  3QIM A;  1G0I A;  1RDY A;  3FVO A;  3H6T A;  3VVF A;  2OWZ A;  2QVU A;  5A5X B;  2HZL A;  3RY3 A;  4QRZ A;  3TQL A;  4OHN A;  3MQ9 A;  4MJO A;  4Q8R A;  1LCT A;  3CVG A;  1FQC A;  4N6K A;  4QSC A;  5JK4 A;  3IX1 A;  1A8F A;  1II5 A;  4KYE A;  1XC1 A;  5L9S A;  3U65 A;  4NED A;  1NUW A;  1SVX B;  4P0I A;  5ET7 A;  4R6K A;  4BDO A;  4HCW A;  1P1Q A;  3L6H A;  3ISP A;  4I3E A;  4U2R A;  1B58 A;  1UTH A;  4PFW A;  1US4 A;  1DSN A;  3IJX B;  3IOR A;  3TEP A;  3MP1 A;  3FV1 A;  4P1E A;  4QSE A;  2Q2C A;  1DTZ A;  2P3V A;  1P1N A;  1H45 A;  4H1X A;  1FQF A;  4LQ2 A;  4MNP A;  4BDQ A;  2WOP A;  2QJE A;  4U1O A;  4ZZE A;  3RQT A;  4NGU A;  2F35 A;  1B3E A;  4NF4 B;  2CEY A;  4R6Y A;  4ONY A;  3G3J A;  3OEN A;  5I2K B;  2F8D A;  5IZ1 A;  1NV0 A;  1B0L A;  3B7D A;  5F7V A;  2OCU A;  3RYB A;  1KWH A;  1OVB A;  4ZEI A;  3O6I A;  1POY 1;  1USY H;  2PVU A;  3IB2 A;  4OWD A;  1LBW A;  3E13 X;  4RNS A;  3S9N C;  4H0W A;  1D4N A;  4IR8 A;  1B7Z A;  2G93 A;  3FVN A;  4HCY A;  3FVK A;  4IO4 A;  4ELP A;  4PFB A;  3K6W A;  3BKI B;  3C4M A;  4NWC A;  3CSB A;  3K2D A;  1IMF A;  1N3W A;  2UVG A;  4YIC A;  1FBF A;  4GVO A;  3T96 B;  2KR0 A;  1B6H A;  2FHY A;  4ZEC A;  4OET A;  5I59 B;  4DI3 D;  2A5T B;  3T1B A;  2ZYN A;  2WEF A;  3KN7 A;  4MLV A;  1Y3P A;  3WAE A;  2DWJ A;  3T9V A;  1PB8 A;  2RC9 A;  2VD2 A;  3M3F A;  3T22 A;  2W7Y A;  5AA2 B;  3CFZ A;  3BIG A;  4RPO A;  1LBX A;  4YB7 A;  3D4G A;  1ZMG A;  3PUW E;  2PCR A;  2F6G A;  1DK4 A;  1F9B A;  5I7I A;  1EZO A;  1ZLQ A;  1NNK A;  1D9V A;  1NH7 A;  3DRH A;  1BLF A;  3O2A A;  4FBP A;  4NAP A;  4P9K A;  3VDF A;  4GRK A;  2UYF A;  1FBP A;  2Y7R A;  4OVS A;  2CZK A;  1S9T A;  2FNC A;  4OQO A;  5H8N A;  1L5T A;  3U92 A;  1MY0 A;  2Q89 A;  1H3D A;  1IUD A;  1LBY A;  4FEB A;  3K00 A;  1IXC A;  1NI9 A;  4G8N A;  4OVP A;  4C1T A;  4KPT A;  2PBW A;  1NMU A;  3B6T A;  4HTG A;  4RY1 A;  5I56 B;  2FVZ A;  3PAM A;  3O29 A;  3FVG A;  1QUL A;  5I2N A;  3MVZ A;  1NUX A;  5LTC A;  2Z23 A;  3SET A;  3MP8 A;  3KEI A;  3IFC A;  3SER A;  5ITP A;  4NF8 A;  4PBQ A;  3IOU A;  4G77 A;  3DP6 A;  3SES A;  4GWZ A;  4EUO A;  3IB1 A;  1IXI A;  2XX7 A;  3KN3 A;  1NV1 A;  3RLF E;  3TYH A;  3K4U A;  2O7I A;  5EQ7 A;  3ZS6 A;  4DCY A;  2ZNU A;  3OMB A;  1B0H A;  2E1S A;  1BTJ A;  1RYX A;  3V89 B;  1JW1 A;  4KYD A;  1IXH A;  3LSX A;  5FTH A; 
#chains in the Genus database with same CATH homology
 4PC9 A;  4GF8 A;  2MKZ A;  1FPK A;  4ZEK A;  2BJI A;  5IZZ A;  1FPJ A;  1B4Z A;  2ZZW A;  4JVD A;  1FBC A;  1DCU A;  4I9D A;  1G0H A;  2P3N A;  1IMD A;  5IGA A;  1K9Y A;  1B5H A;  3MST A;  1NUY A;  1INP A;  4NHB A;  3KBZ A;  4MNI A;  4OVQ A;  4GWW A;  3I5O A;  1B3L A;  1QGX A;  4PF6 A;  4QBA A;  4PFY A;  4JSO A;  2GQ1 A;  4N91 A;  3MVW A;  3TCF A;  1KA0 A;  3D1R A;  1LBV A;  3B8B A;  1B51 A;  1FBH A;  3TCG A;  1B40 A;  2VT5 A;  4P8B A;  1FPI A;  4HXV A;  1B05 A;  4AS5 A;  2V3Q A;  4GBW A;  1FTA A;  4I8C A;  4MAG A;  2D5W A;  3BIH A;  1EYI A;  1QKB A;  1B9J A;  5L8D A;  4N81 A;  1SPI A;  3MZB A;  4PFU A;  4M1V A;  4GX6 A;  4PCD A;  1DPE A;  2RKM A;  4QFP A;  3TCH A;  5F1Q A;  5I5P A;  4XKN A;  1VDW A;  2XWK A;  4O7I A;  2WOL A;  4GWX A;  1RKM A;  4PET A;  3W9W A;  1OLC A;  1IME A;  4XF5 A;  2VPN A;  2FIX A;  2OLB A;  4QFL A;  1FPD A;  1FPE A;  1B46 A;  2Y5K A;  5T3J A;  5ICQ A;  3KC0 A;  1B52 A;  4OFL A;  2Q8M A;  1FPB A;  2PFY A;  5HM4 B;  3LV0 A;  4DI4 B;  1B5J A;  1EYK A;  2CZI A;  4PFI A;  3E78 A;  2XWV A;  4I3Y A;  4JSD A;  2DE3 A;  2B4L A;  5ISU A;  4ZE8 A;  4O94 A;  3RYD A;  1XOC A;  2Y5L A;  1FPF A;  2XXK A;  2ZZX A;  3NOH A;  2DE2 A;  4NX1 A;  4QFO A;  4GFR A;  4JVC A;  2CEX A;  1LEV A;  3IFA A;  1Q9D A;  1B32 A;  4N8G A;  3TPA A;  4MEV A;  3MW0 A;  4N15 A;  1LBZ A;  4NQ8 A;  4F1V A;  4GWS A;  2WBB A;  1B3F A;  5KZT A;  2HPG A;  4X04 A;  2F3D A;  4I40 A;  4XKR A;  1JEU A;  4F18 A;  1B2H A;  2DVZ A;  1FPG A;  1NV6 A;  2WYK A;  4PTK A;  2NOO A;  3MVX A;  3DRJ A;  4NN3 A;  1RDX A;  1B3H A;  3DRI A;  1FSA A;  3FXB A;  1FBE A;  3M8U A;  4ZEB A;  4MNC A;  4OVT A;  3RYA A;  3SZP A;  4UAB A;  1VR5 A;  1B1H A;  5I3S A;  4MCO A;  4PAI A;  4N6D A;  1IMB A;  4PAK A;  4O8M A;  2V4C A;  3QIM A;  1G0I A;  4MX6 A;  1RDY A;  1AWB A;  2OWZ A;  1B3G A;  2QVU A;  2HZL A;  3RY3 A;  5EYG A;  4TOZ A;  4N17 A;  4MJO A;  2CZH A;  1NV7 A;  4X8R A;  2XWO A;  1KA1 A;  4N6K A;  1UQW A;  2F5X A;  3A29 A;  5JK4 A;  4PGP A;  3T66 A;  3FTO A;  3U65 A;  4PFT A;  1FJ6 A;  1NUW A;  5ET7 A;  2QPQ A;  4H46 A;  5IM2 A;  4MIJ A;  4HE2 A;  2DE4 A;  4HCW A;  1ZTY A;  3QMF A;  3KC1 A;  5ET6 A;  4HE1 A;  3ISP A;  4I3E A;  4XKQ A;  1B58 A;  4GX3 A;  1FBG A;  4PFW A;  5LDZ A;  2HXR A;  5FBP A;  4QFK A;  1FJ9 A;  4PE3 A;  3E3K A;  5F24 A;  4X9T A;  4KXP A;  3W9V A;  4P1E A;  4LN5 A;  2B4M A;  4GX4 A;  3MVY A;  2P3V A;  1B7H A;  4MNP A;  5EQ9 A;  4ZE9 A;  1EYJ A;  2WOP A;  1QKA A;  3RQT A;  4DCX A;  1IMA A;  4NGU A;  2L5V A;  1YYZ A;  4XKP A;  2CEY A;  4RA1 A;  4ONY A;  4P47 A;  5ET8 A;  4AS4 A;  4H45 A;  5EQ8 A;  4N8Y A;  5IZ1 A;  2Q9T A;  4GWU A;  1UIV A;  1NV0 A;  4OFO A;  2WYP A;  3RYB A;  1NV3 A;  1DPP A;  4ZEI A;  4GL8 A;  4OVR A;  2F3B A;  1LBW A;  1RDZ A;  1YZ0 A;  1KZ8 A;  5CM6 A;  4IR8 A;  1JP4 A;  4HCY A;  5J1D A;  3GYY A;  1B5I A;  3DRG A;  5EYH A;  4PFB A;  4N4U A;  5ET5 A;  4QFN A;  3CHG A;  3DP8 A;  1IMF A;  4P1L A;  4OA4 A;  3RPL A;  4YIC A;  1FBF A;  5A5L A;  2XA5 A;  2VPO A;  3T0J A;  2KR0 A;  2WBD A;  4XFE A;  3DRK A;  4WED A;  1B6H A;  1XI6 A;  2FHY A;  4ZEC A;  4MHF A;  4OET A;  3EKI A;  4YZZ A;  5IZ3 B;  4DI3 D;  2QVV A;  3T1B A;  1B4H A;  1IMC A;  2WEF A;  4PDH A;  4MMP A;  4PBH A;  1FRP A;  4OEV A;  1OLA A;  4ZED A;  2OX3 A;  4XEQ A;  5IZ3 A;  2GRV A;  3BIG A;  1LBX A;  3FBP A;  1JEV A;  2PCR A;  4O7M A;  2QFL A;  1DK4 A;  5I7I A;  1JET A;  4PFR A;  1ZLQ A;  4GWY A;  3PTY A;  1UIU A;  4FAJ A;  2HHM A;  2Q74 A;  3DRH A;  4P56 A;  3E79 A;  2PFZ A;  5DW8 A;  2FIE A;  4FBP A;  4NAP A;  4P9K A;  4HE0 A;  1YXI A;  3O6P A;  2ZZV A;  4OAN A;  3O9P A;  1FBD A;  1FBP A;  2QVR A;  3ROJ A;  4PGN A;  4OVS A;  2CZK A;  3LVU A;  1BK4 A;  1NV2 A;  1LBY A;  1NV4 A;  2KQZ A;  1NI9 A;  4OVP A;  2WOK A;  4F19 A;  2JJK A;  4QXD A;  4OES A;  2FVZ A;  4P3L A;  3PAM A;  3LUZ A;  2XWI A;  3MVZ A;  1NUX A;  4JVI A;  5LTC A;  1ZU0 A;  1NV5 A;  2Z23 A;  3B50 A;  5EQA A;  2HZK A;  4PAF A;  3IFC A;  4OFJ A;  4OEU A;  4PBQ A;  2DDK A;  4G61 A;  3HFU A;  2WX9 A;  4GWZ A;  5J16 A;  2FBP A;  1D9Q A;  1NV1 A;  4OER A;  3DRF A;  4NF0 A;  2O7I A;  4F1U A;  1FPL A;  5ESY A;  5EQ7 A;  3ZS6 A;  4DCY A;  3MYU A;  1B0H A;  1DBZ A;  4NG7 A;  4PDD A;  3RPL B;  1NUZ A;  4PF8 A;  1CNQ A;  4GBV A;  1K9Z A;  2R8T A;  3MZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...