2B4LA

Crystal structure of the binding protein opuac in complex with glycine betaine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
268
Chain Sequence
DENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Glycine betaine-binding protein
total genus 98
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2b4lA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2b4lA01
1B0HA 4OETA 3FTOA 4DCXA 4OFOA 2Z23A 1UQWA 2WOLA 3DRJA 4XKNA 3MVWA 3DRFA 3MW0A 4OFLA 4GFRA 3O9PA 3PAMA 3TPAA 3MZBA 1B9JA 4QFNA 1B40A 3MVXA 2NOOA 1B5HA 4OERA 1OLAA 3TCFA 4WEDA 3MVYA 4DCYA 1ZTYA 1B3FA 4TOZA 3DRIA 1B6HA 2WOPA 1UIVA 4GF8A 4QFKA 1QKBA 1RKMA 1B51A 5ICQA 5ISUA 1B2HA 2B4LA 3DRKA 1B58A 4QFOA 5F1QA 2GRVA 1B52A 4JSOA 3QIMA 4ZEBA 1QKAA 1OLCA 1B3GA 1XOCA 4I9DA 4XKRA 1JEUA 4PFTA 3MZ9A 3RQTA 1B4ZA 1VR5A 5L8DA 4PFWA 3LVUA 2D5WA 3TCGA 5KZTA 4ONYA 1B3LA 3T66A 4ZEIA 1JETA 1B3HA 3RY3A 1B5IA 1B7HA 2WOKA 3CHGA 3O6PA 4OEUA 3E3KA 4I8CA 4ZEKA 3DRHA 2RKMA 1DPPA 2O7IA 1ZLQA 3I5OA 4PFYA 1ZU0A 3RYAA 3TCHA 2OLBA 3ZS6A 3MVZA 1B4HA 1JEVA 1B46A 1B05A 4QFLA 4JSDA 4GL8A 3DP8A 4ZEDA 4FAJA 3DRGA 4ZECA 4ZE8A 1DPEA 4XKPA 5HM4B 3RYBA 4PFUA 4ZE9A 1B1HA 3M8UA 2B4MA 1B5JA 4RA1A 4OEVA 1B32A 4QFPA 4OESA 4OFJA 1UIUA 4XKQA
chains in the Genus database with same CATH superfamily
2P1SA 4YB5A 5CM6A 2GH9A 1NNPA 3JV9A 3HHGA 4G8MA 4U1ZA 3T96B 3VLWA 3N94A 5CMKA 1DK4A 1ELJA 4TLMB 1FQAA 1FRPA 2QSXA 3N6TA 4NWCA 1CB6A 4HCWA 3PAMA 1EYIA 3R7XA 1FQBA 2GFEA 2NXOA 2ABHA 3IL1B 4HS7A 5I58A 3K0VA 4FBPA 4H8IA 4N81A 2FHYA 3KSJA 4NF6B 4Q5TA 1AOVA 1A7LA 1D4NA 3FIRA 1IUDA 1URGA 5AA1A 4NMYA 1IZ1A 4POXA 4YMBA 4GX4A 2XXKA 2OX3A 3CFLA 3IX1A 3Q29A 5EQAA 5DYHA 4EF2A 1M5FA 2F7BA 4IR8A 1SYHA 2HEUA 1QKAA 2ZZWA 4KYSA 4F2OA 2V3QA 3C32A 5L8DA 1IXHA 4H8JA 5EHMA 1SPIA 3TCGA 3U93A 4R2FA 1FSAA 1JETA 1H43A 4NGUA 1MM6A 2O1LA 4N17A 1FPDA 1Z7NE 2XXVA 2DXRA 3MJNA 1D9YA 3EPEA 3E4RA 3RUMA 3ONMA 2OLBA 1VDWA 1EYJA 4G68A 1UTHB 4ZEDA 1XVXA 3CVGA 4HE2A 4FAJA 2CEYA 2I48A 1BIYA 4ZE8A 1DPEA 4GWZA 2X26A 2DQVA 3C33A 4PFUA 2XWKA 3MC2A 1A8EA 3TTMA 1KA1A 5TP9A 4OEVA 1US4A 1LBBA 2OCUA 3VDFA 3B50A 4QFPA 3CG3A 2F8DA 3GXAA 1VFDA 3V8XB 4AB6A 2X7PA 4NF8A 5IGAA 4OZ9A 3P7IA 4E0WA 4JB7A 4M4GA 3PUVE 1B7ZA 3E13X 3DRFA 4KR5A 4QFNA 2X7QA 1MXXA 5DEXA 4PF6A 2HAUA 4OERA 1FCKA 1FPEA 5I2NA 3MVYA 3TTKA 3OELA 3PUWE 1SDXA 4X48A 3RT8A 1URDA 4QSEA 2DP8A 4AQ4A 1B2HA 3ILUB 2XWVA 3EHTA 1G0HA 4OVTA 4R6HA 4JSOA 2Z22A 4O7MA 1OLCA 4M1VA 1YCJA 2Q8JA 4AS5A 4F3GA 3VE1B 3SKPA 2GQ1A 3TELA 3QUFA 4NF6A 1NUXA 1B4ZA 2B3BA 4PFWA 4NF8B 4N8YA 5KZTA 2RINA 4XIGQ 5KCJB 4ZEIA 1B7UA 3KOSA 4OWDA 1QUIA 3B6WA 2UYEA 1MQJA 3KOTA 3LSXA 1LBCA 2RKMA 4DIGA 1QUJA 3S9MC 4QXDA 4N07A 3RLFE 5B7DA 1VE4A 4F1UA 4H46A 1SBPA 1SW2A 3CG1A 1DCUA 1ANFA 2NVUB 2ALUA 5HM4B 2XXIA 4NWDA 3PD9A 2RC8A 2B65A 5I84A 2CZHA 4QHQA 4F3BA 4DZ1A 4OVSA 3RPLB 1IMBA 4MX6A 2I3VA 3C36A 4KXPA 1MPDA 3Q26A 3B6QA 1N04A 1NUYA 3EQ1A 3S9NC 2Y7IA 4GXSB 4G4PA 3BFUA 5H8FA 3LSWA 1LBWA 5H8FB 3GZGA 4PDHA 3PV0E 5CMBA 4FEDA 3RN8A 3Q25A 1MPCA 1N7XA 1MPBA 4EQBA 3PMVA 5TP9B 1S7YA 3LC8A 2V25A 3UGWA 2P3NA 1FBPA 3SESA 1K9ZA 1Y4TA 3SDFA 1SI0A 1FTKA 2ZYMA 4GXAA 4JVDA 2XXXA 4MFIA 4N6KA 3U92A 3RPWA 3BFTA 4R2BA 5K2XA 2BJJX 3PGFA 4IO7A 5EHSA 5IZ3A 4DXUA 2O7IA 3KBRA 3R26A 5H8HB 3A29A 1P1UA 1MXVA 1B46A 1F9BA 1FBEA 4HXVA 4GIZA 4PCDA 4U21A 4LZ7A 2V3UA 1KA0A 2CMOA 5ESYA 5H8HA 3FXBA 3VVFA 1PBPA 4ZZEA 3FGSA 2D21A 1FPIA 1OMPA 1JQFA 1SYIA 2OWZA 4XEQA 2WKYA 2XXWA 1MDQA 3EHSA 4MIJA 1IQ7A 4F2QA 2Y7RA 2H98A 3MPLA 4EQ7A 4GFRA 3ROJA 4F1YA 4ECFA 1B40A 4UA8A 2NOOA 1SW1A 1NMUA 1OLAA 2V93A 3MWBA 1LCTA 3TZAA 5CC2A 3OO7A 1LCFA 3G7WA 5I5PA 3G3GA 4H0WA 2VPOA 2WYKA 1B0LA 3TAJA 1LBVA 2PFYA 2GRVA 4AS4A 1HSEA 5AA2B 3U65A 4NF0A 4F3PA 2OWSA 4AB5A 4ZDMA 3MZ9A 3SEUA 3MUQA 3D4CA 4P47A 4YICA 3O97A 1LEVA 4DLDA 4IO5A 4UABA 3UIFA 4YKKA 1FTLA 2XXYA 3C4MA 3CHGA 1MS7A 3ILTB 3E3KA 2VT5A 1FQEA 1LFIA 5DVIA 3IO4A 3O28A 3FVKA 1WVJA 2FIEA 2PYYA 4GL8A 2I4CA 2Q88A 3B6TA 1EU8A 3DM0A 3FASA 2XD3A 3H6VA 4GQOA 4ZE9A 1TT1A 5KDTB 4GRKA 3FZVA 3K6WA 3PPOA 4IO2A 1HSLA 4R9FA 2RF1A 4OESA 4LQ2A 2QPQA 4UACA 1MXYA 1NV6A 1DMBA 3E79A 3G3IA 3K02A 1S9TA 4P11A 4U2RA 3CR9A 3M3FA 1D9QA 2Z8FA 5H8NB 4N8GA 2F97A 4N15A 1A40A 5K2YA 2V4CA 1RYXA 2ZNTA 2I3WA 2WEFA 3OOAA 1A54A 5HBCA 3DRIA 2GHBA 3RT6B 1B51A 3H7MA 1GR2A 3DRKA 2NUVA 1S50A 2P3VA 4GOTA 1B52A 4PAKA 3QAXA 4GBWA 3RNNA 3CSGA 4X1BA 4LATA 2W7YA 5ITOA 2ZNUA 5H8QB 4ONYA 3OMBA 4MLVA 1IEJA 1L5TA 4ELOA 4ESXA 1B7HA 5TPAA 4RY1A 2VHAA 4OVQA 5CBRA 1DPPA 1MY0A 2E0SA 1CE2A 3RYAA 3TCHA 3GBAA 2DYXA 1MRPA 3W9VA 3TDJA 4QFLA 1BTJA 3CIJA 1JNFA 1H45A 3A09A 4X8RA 3E9XA 4FIMA 4XKPA 5EQ7A 2PMSA 4H6DA 1QJMA 1II5A 5B70A 1N76A 3SEYA 1BLFA 5I59B 3MSTA 1P1OA 2CZKA 3MP8A 3ODBA 3VXBA 3RTFB 4OFOA 3FVGA 3MYUA 2R6GE 2F5XA 4YB7A 4GX3A 1IMDA 3T9VA 3K1NA 4NQ8A 3G3KA 4X1DA 3EKIA 4NX1A 1INPA 3G3FA 1B3FA 1FTMA 1YXIA 3USDA 4MCOA 4NEDA 4OXVA 3OSQA 4BLAA 1ZMGA 5ISUA 1FBHA 5JTYA 1D9VA 4IGTA 4GLIA 1B3EA 4O8MA 2ZYNA 5LDZA 2Z8DA 2H4IA 3BIHA 3MP6A 4HTGA 1B3GA 5L9MA 2PT2A 5CMCA 2H9BA 3K01A 4G68B 5BWJA 1UTHA 3N5LA 4U23A 3IFCA 5IM2A 2D5WA 3RTWB 2DSFA 1FBCA 1US5A 1AWBA 2WYPA 1SD3A 3KJTA 2HPGA 4GX6A 1B3LA 1MQIA 4I8CA 4ZEKA 3CFZA 2DE3A 2Y5LA 3MP1A 3R6UA 4YKJA 4MH5A 4DI3D 1QVSA 5ICTA 4Q0CA 4ELRA 2B3FA 1H44A 2GHAA 4POWA 1B1XA 4PC9A 1A8FA 4MNIA 2OBGA 3HO7A 1MXZA 1FJ9A 3CRBA 4OMBA 5AA2D 3OEMA 4OYVA 5TPAB 4ISUA 1Y3QA 5IKBA 4MF3A 4O3AA 2WBDA 1SQYA 2XD2A 3PD8A 4KYDA 4QBAA 4TLLB 1LBYA 3FTOA 1R1NA 1LLSA 2Z23A 4LVQA 2Y7PA 3HV1A 3MPKA 1MQGA 4KCCA 2XWOA 3M3KA 3MVWA 1FPFA 4BDQA 5A5XA 1Y3PA 2VOZA 4G8NA 1B9JA 3O6IA 3CFXA 5FHNA 3VV5A 2OJTA 5I57A 1IXCA 1IMCA 1FPLA 4WEDA 2H25A 3MQ9A 2XXUA 4LUBA 3TTLA 1Y3NA 1IXIA 2WBBA 1LGBC 5IZ1A 3IOTA 3OXNA 1USYE 1IMFA 2HFBA 5DW8A 2OK2A 4XKRA 2IEEA 4KCDA 2I4BA 4YMAA 3TQLA 2O84X 5CRYA 1N3WA 2WOKA 1NFTA 2G93A 4RK9A 2NWJA 4YB6A 2QJEA 5AA2A 5ET6A 1MQDA 4LQ5A 1B05A 4WKMA 2XX7A 5CMMA 1Q35A 4H5FA 3H03A 1TWYA 2A5TA 2DE4A 4H67A 4HE1A 1LBXA 2HXRA 5JTYB 5F7VA 1B1HA 3M8UA 1FPBA 1NI9A 1SW5A 4JVCA 3T0JA 3EF7A 4OHNA 2QMWA 1A55A 1K9YA 3T1BA 1B0HA 4KQPA 2ONKE 4EF1A 4P0GA 1MY4A 1BK4A 2Y84A 2UVIA 5CBSA 1WODA 3THIA 3HCQA 4PAIA 4NTLA 3PMWA 5J1DA 5I2NB 1FPGA 1Y4CA 3IOUA 5HPQA 3TCFA 1M5DA 4MAGA 3MAMA 1RDZA 4G2ZA 4OANA 2WOPA 1NH8A 4ZZAA 1LBZA 1R9LA 1FBDA 1O7TA 1MXWA 3N26A 2QMXA 1DBZA 3LR1A 3VLUA 1XVYA 3T9UA 4YKIA 4WEPA 2H99A 2M8CA 1FPKA 3S2VA 2F78A 4MJOA 4NF4B 3GYYA 4LZ5A 5ET8A 2Y5KA 3TUSA 1DSNA 1QUKA 1PDAA 2BJIA 2Q8MA 4R72A 1ZBMA 2D3IA 4PFRA 5EQ8A 4HW8A 2Y7KA 4NE4A 1CNQA 1P1WA 2O51A 4E0XA 4MBPA 3HHFA 1FQCA 2AL4A 2HZKA 2RC7A 1H3DA 3DP8A 2F3BA 2QRYA 1OVBA 1OQHA 3RYBA 1MDP1 1R9QA 2CEXA 2F36A 5DEXB 1PB8A 2XWIA 1FW0A 2THIA 3NOHA 4C0RA 1AH5A 4DXCA 2QFLA 4F31B 1LAGE 2XA5A 1NNTA 4R6KA 4WXJA 2ZZXA 1H76A 3TODA 3CSBA 2XXQA 4I3EA 3U1OA 1WDNA 4GBVA 2Z8EA 1GGGA 4P0IA 4OTEA 4EUOA 1M5CA 1ZTYA 1EZPA 4H45A 4TOZA 1IITA 1UIVA 3UP9A 4XTCQ 3F11A 5ICQA 5AA3A 1LSTA 5F1QA 1PEBA 3KFMA 3PPNA 4O3BA 3SZPA 1LAHE 4G8HA 2QS1A 3JZJA 1VR5A 3K00A 1ZJLA 4HE0A 3FXQA 2JJKA 3RY3A 3V83A 5EYFA 4PBQA 3DRHA 3EN3A 4MHFA 2Q2CA 3T9XB 1JW4A 5AE4A 4G77A 2KLFA 1SVXB 4C1TA 1LAXA 1PB7A 1GVCA 3PU5A 2PT1A 3U94A 1NV3A 1TFDA 2DVZA 4X9TA 4JWOA 4PAFA 1LFGA 3H3GA 4H65A 3UA8A 3TFLA 4NG7A 1I6BA 5FBPA 4F19A 2AIXA 3ZKKA 4H5GA 1NUWA 1MY3A 1Y1ZA 1UTBB 4GWXA 1MH3A 4X04A 4QFKA 1QGXA 2FA7A 4RNSA 1R6ZA 1ZKBA 2FIXA 1NNKA 5I2KA 4IO6A 4LONB 3HPIA 4GWOA 3I6VA 4PFTA 4P8BA 4MEVA 1VSOA 3IB1A 4ESWA 4BDLA 3S4UA 1HSJA 2XXTA 2FVZA 3FATA 2HQ0A 3FJGA 5I3SA 1MQHA 4OEUA 1NV4A 1QW0A 3IK6B 3I5OA 2F35A 1YAEA 1XS5A 1RYOA 1J1NA 3A3UA 4IO4A 2R71A 4K3FA 5DTBA 3RYDA 2DOJA 3DELB 3K2DA 1MH4A 1YTVA 4P1EA 1NV0A 4JDFA 4F1VA 2F3DA 4O3CA 1NV7A 2VD2A 4RPOA 3OO8A 2XX8A 4ZEFA 5I2KB 4PGPA 2MKZA 5FHOA 3QSLA 1TXFA 3DLNA 3UORA 2CZLA 2KR0A 3MZBA 4NF5B 3H4ZA 4JVIA 2I0CA 2HAVA 1NV2A 3EHUA 4OVRA 3KN8A 3KC1A 2AL5A 3D1RA 3K1MA 2I49A 1NUZA 3IR1A 4TQUQ 4LP2B 2V84A 4NHBA 3PUYE 4I62A 2B4LA 4QFOA 4PFBA 3O66A 1MY1A 1EZOA 2DS9A 5I7IA 3TKDA 1A99A 3LSLA 3H6UA 4I1DA 5J16A 2XX9A 2HXWA 1OQGA 4Q30B 3UN6A 3KSXA 4EQ9A 3B8BA 1DOTA 4R74A 3H6WA 2VD3A 1FTAA 4JXIA 4GWYA 1O64A 4GL0A 3TEPA 4LN5A 3K6UA 4JSDA 1ZIUA 4JWXA 4EXLA 5DT6A 2A5SA 2Q9TA 3KN3A 2ZXTA 3ZKLA 3WAEA 4QF9A 3IO6A 4P3LA 2VPNA 4F22A 3B7DA 2PCRA 2WX9A 4EDPA 1IMEA 1UTBA 4QRZA 4DCXA 1M5BA 5DVFA 1RDYA 3HFUA 3W15C 2KQZA 3KZGA 1EH3A 2P2AA 2Q89A 4OVJA 4OENA 4THIA 3C31A 3ECRA 4YU0A 4KD5A 3FBPA 1JVXA 3SETA 4O7IA 3Q28A 3FUZA 1YPNA 1B6HA 4GWSA 4GF8A 2DWHA 1LAFE 2DXYA 5KDTA 3G3HA 1JP4A 2I6EA 1MXUA 1Y20A 3OD7A 5I56B 1NL5A 4NF5A 3T93B 1I6QA 4OA4A 4DDDA 2HZLA 5I56A 4ZS9A 1JW1A 4DE8A 3S9LC 4KFQA 1XOCA 4I9DA 2REJA 2Q2AA 3TTNA 3IAZA 4IO3A 5LOMA 3QXMA 2QVVA 1IIWA 4IY6A 2DWAA 3DP6A 3H06B 5EYGA 1P99A 4R73A 3KN7A 4QSCA 3V89B 2ZNSA 1N7WA 4DI4B 1FQFA 3KEIA 1EZ9A 4EXKA 3PPPA 2ZZVA 4G68C 2AYSA 3T9HB 4OFJA 1NV1A 5M2VA 5FHMA 2QL3A 2ZMBA 4IB2A 2I0BA 5BUUA 2QS2A 4GWUA 2IA4A 2F6PA 3FJMA 1NNFA 2ONRA 3QYTA 3ISPA 5T3JA 1USYH 4N13A 4FECA 1NH7A 3TYHA 2OZZA 3SEWA 3MVXA 4G61A 4KPTA 1O63A 1B5HA 3U72A 3FV1A 3I3VA 4F18A 3LSFB 1URSA 3LV0A 4PP0A 2R8TA 1RKMA 3LUYA 3KGCA 2FYIA 1POY1 3PPQA 2ESNA 3OSRA 5DVJA 5JK4A 1T0KA 4BDNA 1MY2A 5IZ3B 3V5AA 4RXLA 3QIMA 3IOVA 3VVEA 1FTJA 2UYFA 1JEUA 1NV5A 3A3CA 3E78A 2DWJA 3LVUA 4PE3A 1Z7ME 2Y7WA 3C9HA 3VXCA 4P56A 2F7AA 4Z7EA 5H8QA 1B5IA 2QS4A 1PB9A 3O6PA 1P1QA 4I40A 2RCAA 3U8QA 4JBZA 5LTCA 4U1OA 3GBBA 5I59A 3IFAA 3D4GA 1JW5A 5L9OA 4YZZA 4BDMA 3C35A 2H5YA 2V3TA 3HN0A 3DRGA 1G0IA 5EQ9A 2DDKA 3DP4A 3TTRA 4R75A 2ANJA 3O6HA 1XI6A 2UVGA 1PC3A 1N84A 4NN3A 2Q74A 5ITPA 5ET7A 5FTIA 2UVJA 4FJPA 4F39A 4GD5A 4KHZE 4PE5B 1FBFA 4Z0IA 2XXRA 3KC0A 4GWWA 2O6AA 3MZ1A 3O9PA 2DWIA 3TPAA 3QUJA 3LBSA 4FEBA 4BDOA 2PX1A 5CI5A 3BKIB 4HCYA 1LFHA 1DTGA 1XC1A 2QVUA 2FBPA 2QVRA 3Q27A 3RPLA 1OIBA 2RCBA 4P9KA 3PMXA 4FORA 3PUZE 3K4UA 4RYAA 4R9GA 1QKBA 2I58A 1Y9UA 2PVUA 2O1MA 1N3XA 2YPNA 4C1UA 4NAPA 3JYRA 3IOWA 1M5EA 2P0SA 2XXPA 2DE2A 1LB9A 2O7UA 4XFEA 3QMFA 3WAFA 5H8SA 5EYHA 3RQTA 4JWYA 1DTZA 1YYZA 3MBPA 2XXHA 3FD3A 5A5XB 3PUXE 1IXGA 3T66A 3VLVA 3TMGA 3O29A 1OVTA 1QULA 1P1NA 1TFAA 3M3LA 4OVPA 1ZLQA 3C34A 1N0TA 3K1PA 4RK2A 1B4HA 2L5VA 2R9JA 4Q8RA 1ATGA 4PDDA 1VFEA 3FXUA 4LA9A 4ELPA 2DVCA 5FTHA 4N6PA 3QK6A 2B4MA 4MMPA 1B5JA 4RA1A 2PBWA 4YAHX 2OWTA 1FQDA 2ONSA 4IY5A 1UIUA 3KBZA 4N91A 4O94A 2O69A 4BDRA 1POTA 2ZYKA 1Q1KA 3FVNA 2WOLA 3DRJA 3BBRA 3PPRA 1Y1MA 2ZYOA 2YLNA 4OFLA 3SERA 1AL3A 5I58B 1GTKA 5H8NA 5I57B 1SI1A 1FJ6A 4N6DA 4KI0E 4PF8A 4R6YA 2UXAA 4ELQA 4P1LA 1NKXA 2F6GA 4F3SA 3IB2A 1GV8A 1SW4A 4DCYA 3FVOA 1MM7A 5IAIA 4F29A 4I3YA 2REGA 5KCJA 3CI8A 2VGQA 2HHMA 2HCAA 1JVYA 1B58A 1XHYA 3OO9A 4ZEBA 4PTKA 5TU0A 3GLBA 2E1SA 5L9SA 4PGNA 3VVDA 3OENA 2F34A 3W9WA 4IGRA 3LUZA 2VP1A 5ELVA 4XXUA 5AA4B 1ZU0A 4RJZA 5AA4A 4U22A 1IMAA 1YZ0A 2CZIA 5F24A 3H6TA 3HSTA 3FJ7A 3VFJA 2G29A 2UVHA 4U4XA 3SEVA 4PETA 4PFIA 1B32A 3K6VA 4FATA 4OETA 1PBQA 1AIVA 2PFZA 4FE8A 4GVOA 1UQWA 3K6XA 1RDXA 4H1XA 4XKNA 1I69A 4MLQA 3O6GA 1LB8A 4PBHA 1FBGA 3MW0A 3OEKA 4OQOA 4DXBA 2O68A 3RGYA 3BIGA 5IZZA 3S9EA 3IJXB 4MNPA 3L6HA 2A5TB 4XF5A 3O2AA 3FV2A 3IB0A 2YJPA 3N6UA 3G3JA 1BP5A 1EYKA 4KYEA 4PQJA 4YKPA 3KJ7A 4N4UA 5A5LA 1MG1A 3ZSFA 1I6AA 5JEIA 1FPJA 3TQWA 2LAOA 3L6GA 3OO6A 3AXFA 4QSDA 3UK4A 2FNCA 1B3HA 4U4SA 3FXRA 3PTYA 3IORA 1KZ8A 1AMFA 4MNCA 1XT8A 2F7CA 4PFYA 3T22A 5ET5A 3ZS6A 3MVZA 4LZ8A 4ND9A 1JEVA 1Q9DA 4NF4A 1BKAA 2QS3A 3SEXA 3KG2A 4ZECA 1D3KA 1KWHA 2XHDA 2RC9A 1FTOA 4L17A 4XKQA 4RPNA 3IJOB
chains in the Genus database with same CATH topology
5CM6A 3E79A 3NOHA 2QFLA 2XA5A 4GWUA 1DK4A 3ISPA 1D9QA 2ZZXA 5T3JA 1FRPA 4HCWA 3PAMA 1EYIA 4I3EA 4GBVA 4N8GA 4FBPA 3MVXA 4N15A 4G61A 1B5HA 4N81A 2FHYA 2V4CA 2WEFA 1ZTYA 4F18A 4H45A 4TOZA 3DRIA 3LV0A 1UIVA 2R8TA 4GX4A 2XXKA 1RKMA 2OX3A 1B51A 5ICQA 5EQAA 5JK4A 3DRKA 5F1QA 2P3VA 5IZ3B 1B52A 4PAKA 4IR8A 4GBWA 3QIMA 3SZPA 1QKAA 2ZZWA 2V3QA 1JEUA 1NV5A 1VR5A 3E78A 5L8DA 3LVUA 4PE3A 4HE0A 1SPIA 3TCGA 4ONYA 4P56A 1FSAA 1JETA 2JJKA 4NGUA 3RY3A 1B5IA 1B7HA 4PBQA 3O6PA 4I40A 4N17A 1FPDA 3DRHA 4OVQA 1DPPA 5LTCA 4MHFA 3RYAA 3TCHA 3IFAA 2OLBA 4YZZA 3W9VA 1VDWA 4QFLA 1EYJA 4ZEDA 4X8RA 4HE2A 4FAJA 2CEYA 3DRGA 4ZE8A 1DPEA 4XKPA 1G0IA 4GWZA 5EQ9A 5EQ7A 2XWKA 4PFUA 2DDKA 1KA1A 4OEVA 1XI6A 3B50A 1NV3A 4QFPA 2DVZA 3MSTA 2CZKA 4X9TA 4NN3A 2Q74A 4OFOA 5IGAA 4PAFA 5ET7A 3MYUA 2F5XA 4NG7A 4GX3A 1FBFA 1IMDA 5FBPA 3KC0A 3DRFA 4GWWA 4F19A 3O9PA 3TPAA 4NQ8A 1NUWA 4QFNA 4HCYA 4PF6A 3EKIA 4OERA 4GWXA 4NX1A 1INPA 1FPEA 2QVUA 2FBPA 2QVRA 3MVYA 1B3FA 3RPLA 4P9KA 1YXIA 4X04A 4MCOA 4QFKA 1QKBA 1QGXA 5ISUA 1FBHA 1B2HA 2XWVA 4OVTA 1G0HA 4NAPA 2FIXA 4O8MA 5LDZA 4JSOA 3BIHA 2DE2A 4O7MA 1OLCA 1B3GA 4M1VA 4XFEA 4AS5A 3QMFA 2GQ1A 4PFTA 4P8BA 4MEVA 5EYHA 3RQTA 1B4ZA 1NUXA 1YYZA 4PFWA 3IFCA 5IM2A 2D5WA 1FBCA 4N8YA 1AWBA 2WYPA 5KZTA 2FVZA 2HPGA 4GX6A 1B3LA 3T66A 4ZEIA 5I3SA 4OEUA 1NV4A 4I8CA 4ZEKA 2RKMA 2DE3A 2Y5LA 4OVPA 1ZLQA 3I5OA 4QXDA 4DI3D 1B4HA 2L5VA 3RYDA 4F1UA 4H46A 4PC9A 4PDDA 1DCUA 4MNIA 4P1EA 5HM4B 1FJ9A 1NV0A 2B4MA 4MMPA 1B5JA 4RA1A 4F1VA 2F3DA 1NV7A 2CZHA 2WBDA 1UIUA 3KBZA 4N91A 4QBAA 4O94A 1LBYA 3FTOA 4OVSA 2Z23A 4PGPA 2MKZA 3RPLB 1IMBA 4MX6A 2WOLA 3DRJA 2XWOA 4KXPA 3MVWA 1FPFA 4OFLA 1NUYA 2KR0A 3MZBA 1B9JA 4JVIA 1FJ6A 4N6DA 4PF8A 1LBWA 1NV2A 4P1LA 4PDHA 4OVRA 1IMCA 1FPLA 4WEDA 3KC1A 4DCYA 3D1RA 1NUZA 4I3YA 2WBBA 5IZ1A 2HHMA 2P3NA 4NHBA 1FBPA 2B4LA 1B58A 4QFOA 4PFBA 1K9ZA 5I7IA 4ZEBA 1IMFA 4PTKA 5DW8A 4JVDA 4N6KA 4XKRA 4PGNA 5J16A 3B8BA 3W9WA 3LUZA 1FTAA 2WOKA 5IZ3A 4GWYA 2O7IA 1ZU0A 3A29A 4LN5A 5ET6A 1B46A 1B05A 1IMAA 1YZ0A 4JSDA 1FBEA 2CZIA 4HXVA 5F24A 4PCDA 2Q9TA 2DE4A 4HE1A 1LBXA 2HXRA 4P3LA 2VPNA 1B1HA 3M8UA 1FPBA 1NI9A 1KA0A 4JVCA 4PETA 4XKQA 3T0JA 4PFIA 5ESYA 2PCRA 1B32A 2WX9A 3FXBA 1K9YA 1IMEA 3T1BA 1B0HA 4OETA 1FPIA 2OWZA 4DCXA 2PFZA 4XEQA 1RDYA 3HFUA 2KQZA 1UQWA 4MIJA 1RDXA 4XKNA 4PBHA 1FBGA 3MW0A 4GFRA 1BK4A 3ROJA 1B40A 4PAIA 5J1DA 1FPGA 3BIGA 2NOOA 5IZZA 1OLAA 3TCFA 3FBPA 4MAGA 1RDZA 4O7IA 5I5PA 4OANA 1B6HA 2WOPA 4GWSA 4MNPA 4GF8A 2VPOA 1LBZA 2WYKA 4XF5A 1LBVA 1JP4A 1FBDA 2PFYA 2GRVA 1EYKA 4AS4A 1DBZA 4OA4A 2HZLA 4N4UA 5A5LA 3U65A 4NF0A 1XOCA 4I9DA 1FPJA 3MZ9A 1FPKA 4MJOA 4P47A 4YICA 3GYYA 5ET8A 1LEVA 2Y5KA 4UABA 2QVVA 2BJIA 2Q8MA 1B3HA 4PFRA 5EQ8A 3PTYA 3CHGA 3E3KA 1KZ8A 2VT5A 4MNCA 4PFYA 1CNQA 5ET5A 5EYGA 3ZS6A 3MVZA 1JEVA 2FIEA 2HZKA 1Q9DA 4GL8A 3DP8A 2F3BA 4DI4B 4ZECA 2ZZVA 3RYBA 4ZE9A 2CEXA 4OESA 4OFJA 2QPQA 2XWIA 1NV1A 1NV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0H A;  4OET A;  3FTO A;  4DCX A;  4OFO A;  2Z23 A;  1UQW A;  2WOL A;  3DRJ A;  4XKN A;  3MVW A;  3DRF A;  3MW0 A;  4OFL A;  4GFR A;  3O9P A;  3PAM A;  3TPA A;  3MZB A;  1B9J A;  4QFN A;  1B40 A;  3MVX A;  2NOO A;  1B5H A;  4OER A;  1OLA A;  3TCF A;  4WED A;  3MVY A;  4DCY A;  1ZTY A;  1B3F A;  4TOZ A;  3DRI A;  1B6H A;  2WOP A;  1UIV A;  4GF8 A;  4QFK A;  1QKB A;  1RKM A;  1B51 A;  5ICQ A;  5ISU A;  1B2H A;  2B4L A;  3DRK A;  1B58 A;  4QFO A;  5F1Q A;  2GRV A;  1B52 A;  4JSO A;  3QIM A;  4ZEB A;  1QKA A;  1OLC A;  1B3G A;  1XOC A;  4I9D A;  4XKR A;  1JEU A;  4PFT A;  3MZ9 A;  3RQT A;  1B4Z A;  1VR5 A;  5L8D A;  4PFW A;  3LVU A;  2D5W A;  3TCG A;  5KZT A;  4ONY A;  1B3L A;  3T66 A;  4ZEI A;  1JET A;  1B3H A;  3RY3 A;  1B5I A;  1B7H A;  2WOK A;  3CHG A;  3O6P A;  4OEU A;  3E3K A;  4I8C A;  4ZEK A;  3DRH A;  2RKM A;  1DPP A;  2O7I A;  1ZLQ A;  3I5O A;  4PFY A;  1ZU0 A;  3RYA A;  3TCH A;  2OLB A;  3ZS6 A;  3MVZ A;  1B4H A;  1JEV A;  1B46 A;  1B05 A;  4QFL A;  4JSD A;  4GL8 A;  3DP8 A;  4ZED A;  4FAJ A;  3DRG A;  4ZEC A;  4ZE8 A;  1DPE A;  4XKP A;  5HM4 B;  3RYB A;  4PFU A;  4ZE9 A;  1B1H A;  3M8U A;  2B4M A;  1B5J A;  4RA1 A;  4OEV A;  1B32 A;  4QFP A;  4OES A;  4OFJ A;  1UIU A;  4XKQ A; 
#chains in the Genus database with same CATH topology
 2P1S A;  4YB5 A;  5CM6 A;  2GH9 A;  1NNP A;  3JV9 A;  3HHG A;  4G8M A;  4U1Z A;  3T96 B;  3VLW A;  3N94 A;  5CMK A;  1DK4 A;  1ELJ A;  4TLM B;  1FQA A;  1FRP A;  2QSX A;  3N6T A;  4NWC A;  1CB6 A;  4HCW A;  3PAM A;  1EYI A;  3R7X A;  1FQB A;  2GFE A;  2NXO A;  2ABH A;  3IL1 B;  4HS7 A;  5I58 A;  3K0V A;  4FBP A;  4H8I A;  4N81 A;  2FHY A;  3KSJ A;  4NF6 B;  4Q5T A;  1AOV A;  1A7L A;  1D4N A;  3FIR A;  1IUD A;  1URG A;  5AA1 A;  4NMY A;  1IZ1 A;  4POX A;  4YMB A;  4GX4 A;  2XXK A;  2OX3 A;  3CFL A;  3IX1 A;  3Q29 A;  5EQA A;  5DYH A;  4EF2 A;  1M5F A;  2F7B A;  4IR8 A;  1SYH A;  2HEU A;  1QKA A;  2ZZW A;  4KYS A;  4F2O A;  2V3Q A;  3C32 A;  5L8D A;  1IXH A;  4H8J A;  5EHM A;  1SPI A;  3TCG A;  3U93 A;  4R2F A;  1FSA A;  1JET A;  1H43 A;  4NGU A;  1MM6 A;  2O1L A;  4N17 A;  1FPD A;  1Z7N E;  2XXV A;  2DXR A;  3MJN A;  1D9Y A;  3EPE A;  3E4R A;  3RUM A;  3ONM A;  2OLB A;  1VDW A;  1EYJ A;  4G68 A;  1UTH B;  4ZED A;  1XVX A;  3CVG A;  4HE2 A;  4FAJ A;  2CEY A;  2I48 A;  1BIY A;  4ZE8 A;  1DPE A;  4GWZ A;  2X26 A;  2DQV A;  3C33 A;  4PFU A;  2XWK A;  3MC2 A;  1A8E A;  3TTM A;  1KA1 A;  5TP9 A;  4OEV A;  1US4 A;  1LBB A;  2OCU A;  3VDF A;  3B50 A;  4QFP A;  3CG3 A;  2F8D A;  3GXA A;  1VFD A;  3V8X B;  4AB6 A;  2X7P A;  4NF8 A;  5IGA A;  4OZ9 A;  3P7I A;  4E0W A;  4JB7 A;  4M4G A;  3PUV E;  1B7Z A;  3E13 X;  3DRF A;  4KR5 A;  4QFN A;  2X7Q A;  1MXX A;  5DEX A;  4PF6 A;  2HAU A;  4OER A;  1FCK A;  1FPE A;  5I2N A;  3MVY A;  3TTK A;  3OEL A;  3PUW E;  1SDX A;  4X48 A;  3RT8 A;  1URD A;  4QSE A;  2DP8 A;  4AQ4 A;  1B2H A;  3ILU B;  2XWV A;  3EHT A;  1G0H A;  4OVT A;  4R6H A;  4JSO A;  2Z22 A;  4O7M A;  1OLC A;  4M1V A;  1YCJ A;  2Q8J A;  4AS5 A;  4F3G A;  3VE1 B;  3SKP A;  2GQ1 A;  3TEL A;  3QUF A;  4NF6 A;  1NUX A;  1B4Z A;  2B3B A;  4PFW A;  4NF8 B;  4N8Y A;  5KZT A;  2RIN A;  4XIG Q;  5KCJ B;  4ZEI A;  1B7U A;  3KOS A;  4OWD A;  1QUI A;  3B6W A;  2UYE A;  1MQJ A;  3KOT A;  3LSX A;  1LBC A;  2RKM A;  4DIG A;  1QUJ A;  3S9M C;  4QXD A;  4N07 A;  3RLF E;  5B7D A;  1VE4 A;  4F1U A;  4H46 A;  1SBP A;  1SW2 A;  3CG1 A;  1DCU A;  1ANF A;  2NVU B;  2ALU A;  5HM4 B;  2XXI A;  4NWD A;  3PD9 A;  2RC8 A;  2B65 A;  5I84 A;  2CZH A;  4QHQ A;  4F3B A;  4DZ1 A;  4OVS A;  3RPL B;  1IMB A;  4MX6 A;  2I3V A;  3C36 A;  4KXP A;  1MPD A;  3Q26 A;  3B6Q A;  1N04 A;  1NUY A;  3EQ1 A;  3S9N C;  2Y7I A;  4GXS B;  4G4P A;  3BFU A;  5H8F A;  3LSW A;  1LBW A;  5H8F B;  3GZG A;  4PDH A;  3PV0 E;  5CMB A;  4FED A;  3RN8 A;  3Q25 A;  1MPC A;  1N7X A;  1MPB A;  4EQB A;  3PMV A;  5TP9 B;  1S7Y A;  3LC8 A;  2V25 A;  3UGW A;  2P3N A;  1FBP A;  3SES A;  1K9Z A;  1Y4T A;  3SDF A;  1SI0 A;  1FTK A;  2ZYM A;  4GXA A;  4JVD A;  2XXX A;  4MFI A;  4N6K A;  3U92 A;  3RPW A;  3BFT A;  4R2B A;  5K2X A;  2BJJ X;  3PGF A;  4IO7 A;  5EHS A;  5IZ3 A;  4DXU A;  2O7I A;  3KBR A;  3R26 A;  5H8H B;  3A29 A;  1P1U A;  1MXV A;  1B46 A;  1F9B A;  1FBE A;  4HXV A;  4GIZ A;  4PCD A;  4U21 A;  4LZ7 A;  2V3U A;  1KA0 A;  2CMO A;  5ESY A;  5H8H A;  3FXB A;  3VVF A;  1PBP A;  4ZZE A;  3FGS A;  2D21 A;  1FPI A;  1OMP A;  1JQF A;  1SYI A;  2OWZ A;  4XEQ A;  2WKY A;  2XXW A;  1MDQ A;  3EHS A;  4MIJ A;  1IQ7 A;  4F2Q A;  2Y7R A;  2H98 A;  3MPL A;  4EQ7 A;  4GFR A;  3ROJ A;  4F1Y A;  4ECF A;  1B40 A;  4UA8 A;  2NOO A;  1SW1 A;  1NMU A;  1OLA A;  2V93 A;  3MWB A;  1LCT A;  3TZA A;  5CC2 A;  3OO7 A;  1LCF A;  3G7W A;  5I5P A;  3G3G A;  4H0W A;  2VPO A;  2WYK A;  1B0L A;  3TAJ A;  1LBV A;  2PFY A;  2GRV A;  4AS4 A;  1HSE A;  5AA2 B;  3U65 A;  4NF0 A;  4F3P A;  2OWS A;  4AB5 A;  4ZDM A;  3MZ9 A;  3SEU A;  3MUQ A;  3D4C A;  4P47 A;  4YIC A;  3O97 A;  1LEV A;  4DLD A;  4IO5 A;  4UAB A;  3UIF A;  4YKK A;  1FTL A;  2XXY A;  3C4M A;  3CHG A;  1MS7 A;  3ILT B;  3E3K A;  2VT5 A;  1FQE A;  1LFI A;  5DVI A;  3IO4 A;  3O28 A;  3FVK A;  1WVJ A;  2FIE A;  2PYY A;  4GL8 A;  2I4C A;  2Q88 A;  3B6T A;  1EU8 A;  3DM0 A;  3FAS A;  2XD3 A;  3H6V A;  4GQO A;  4ZE9 A;  1TT1 A;  5KDT B;  4GRK A;  3FZV A;  3K6W A;  3PPO A;  4IO2 A;  1HSL A;  4R9F A;  2RF1 A;  4OES A;  4LQ2 A;  2QPQ A;  4UAC A;  1MXY A;  1NV6 A;  1DMB A;  3E79 A;  3G3I A;  3K02 A;  1S9T A;  4P11 A;  4U2R A;  3CR9 A;  3M3F A;  1D9Q A;  2Z8F A;  5H8N B;  4N8G A;  2F97 A;  4N15 A;  1A40 A;  5K2Y A;  2V4C A;  1RYX A;  2ZNT A;  2I3W A;  2WEF A;  3OOA A;  1A54 A;  5HBC A;  3DRI A;  2GHB A;  3RT6 B;  1B51 A;  3H7M A;  1GR2 A;  3DRK A;  2NUV A;  1S50 A;  2P3V A;  4GOT A;  1B52 A;  4PAK A;  3QAX A;  4GBW A;  3RNN A;  3CSG A;  4X1B A;  4LAT A;  2W7Y A;  5ITO A;  2ZNU A;  5H8Q B;  4ONY A;  3OMB A;  4MLV A;  1IEJ A;  1L5T A;  4ELO A;  4ESX A;  1B7H A;  5TPA A;  4RY1 A;  2VHA A;  4OVQ A;  5CBR A;  1DPP A;  1MY0 A;  2E0S A;  1CE2 A;  3RYA A;  3TCH A;  3GBA A;  2DYX A;  1MRP A;  3W9V A;  3TDJ A;  4QFL A;  1BTJ A;  3CIJ A;  1JNF A;  1H45 A;  3A09 A;  4X8R A;  3E9X A;  4FIM A;  4XKP A;  5EQ7 A;  2PMS A;  4H6D A;  1QJM A;  1II5 A;  5B70 A;  1N76 A;  3SEY A;  1BLF A;  5I59 B;  3MST A;  1P1O A;  2CZK A;  3MP8 A;  3ODB A;  3VXB A;  3RTF B;  4OFO A;  3FVG A;  3MYU A;  2R6G E;  2F5X A;  4YB7 A;  4GX3 A;  1IMD A;  3T9V A;  3K1N A;  4NQ8 A;  3G3K A;  4X1D A;  3EKI A;  4NX1 A;  1INP A;  3G3F A;  1B3F A;  1FTM A;  1YXI A;  3USD A;  4MCO A;  4NED A;  4OXV A;  3OSQ A;  4BLA A;  1ZMG A;  5ISU A;  1FBH A;  5JTY A;  1D9V A;  4IGT A;  4GLI A;  1B3E A;  4O8M A;  2ZYN A;  5LDZ A;  2Z8D A;  2H4I A;  3BIH A;  3MP6 A;  4HTG A;  1B3G A;  5L9M A;  2PT2 A;  5CMC A;  2H9B A;  3K01 A;  4G68 B;  5BWJ A;  1UTH A;  3N5L A;  4U23 A;  3IFC A;  5IM2 A;  2D5W A;  3RTW B;  2DSF A;  1FBC A;  1US5 A;  1AWB A;  2WYP A;  1SD3 A;  3KJT A;  2HPG A;  4GX6 A;  1B3L A;  1MQI A;  4I8C A;  4ZEK A;  3CFZ A;  2DE3 A;  2Y5L A;  3MP1 A;  3R6U A;  4YKJ A;  4MH5 A;  4DI3 D;  1QVS A;  5ICT A;  4Q0C A;  4ELR A;  2B3F A;  1H44 A;  2GHA A;  4POW A;  1B1X A;  4PC9 A;  1A8F A;  4MNI A;  2OBG A;  3HO7 A;  1MXZ A;  1FJ9 A;  3CRB A;  4OMB A;  5AA2 D;  3OEM A;  4OYV A;  5TPA B;  4ISU A;  1Y3Q A;  5IKB A;  4MF3 A;  4O3A A;  2WBD A;  1SQY A;  2XD2 A;  3PD8 A;  4KYD A;  4QBA A;  4TLL B;  1LBY A;  3FTO A;  1R1N A;  1LLS A;  2Z23 A;  4LVQ A;  2Y7P A;  3HV1 A;  3MPK A;  1MQG A;  4KCC A;  2XWO A;  3M3K A;  3MVW A;  1FPF A;  4BDQ A;  5A5X A;  1Y3P A;  2VOZ A;  4G8N A;  1B9J A;  3O6I A;  3CFX A;  5FHN A;  3VV5 A;  2OJT A;  5I57 A;  1IXC A;  1IMC A;  1FPL A;  4WED A;  2H25 A;  3MQ9 A;  2XXU A;  4LUB A;  3TTL A;  1Y3N A;  1IXI A;  2WBB A;  1LGB C;  5IZ1 A;  3IOT A;  3OXN A;  1USY E;  1IMF A;  2HFB A;  5DW8 A;  2OK2 A;  4XKR A;  2IEE A;  4KCD A;  2I4B A;  4YMA A;  3TQL A;  2O84 X;  5CRY A;  1N3W A;  2WOK A;  1NFT A;  2G93 A;  4RK9 A;  2NWJ A;  4YB6 A;  2QJE A;  5AA2 A;  5ET6 A;  1MQD A;  4LQ5 A;  1B05 A;  4WKM A;  2XX7 A;  5CMM A;  1Q35 A;  4H5F A;  3H03 A;  1TWY A;  2A5T A;  2DE4 A;  4H67 A;  4HE1 A;  1LBX A;  2HXR A;  5JTY B;  5F7V A;  1B1H A;  3M8U A;  1FPB A;  1NI9 A;  1SW5 A;  4JVC A;  3T0J A;  3EF7 A;  4OHN A;  2QMW A;  1A55 A;  1K9Y A;  3T1B A;  1B0H A;  4KQP A;  2ONK E;  4EF1 A;  4P0G A;  1MY4 A;  1BK4 A;  2Y84 A;  2UVI A;  5CBS A;  1WOD A;  3THI A;  3HCQ A;  4PAI A;  4NTL A;  3PMW A;  5J1D A;  5I2N B;  1FPG A;  1Y4C A;  3IOU A;  5HPQ A;  3TCF A;  1M5D A;  4MAG A;  3MAM A;  1RDZ A;  4G2Z A;  4OAN A;  2WOP A;  1NH8 A;  4ZZA A;  1LBZ A;  1R9L A;  1FBD A;  1O7T A;  1MXW A;  3N26 A;  2QMX A;  1DBZ A;  3LR1 A;  3VLU A;  1XVY A;  3T9U A;  4YKI A;  4WEP A;  2H99 A;  2M8C A;  1FPK A;  3S2V A;  2F78 A;  4MJO A;  4NF4 B;  3GYY A;  4LZ5 A;  5ET8 A;  2Y5K A;  3TUS A;  1DSN A;  1QUK A;  1PDA A;  2BJI A;  2Q8M A;  4R72 A;  1ZBM A;  2D3I A;  4PFR A;  5EQ8 A;  4HW8 A;  2Y7K A;  4NE4 A;  1CNQ A;  1P1W A;  2O51 A;  4E0X A;  4MBP A;  3HHF A;  1FQC A;  2AL4 A;  2HZK A;  2RC7 A;  1H3D A;  3DP8 A;  2F3B A;  2QRY A;  1OVB A;  1OQH A;  3RYB A;  1MDP 1;  1R9Q A;  2CEX A;  2F36 A;  5DEX B;  1PB8 A;  2XWI A;  1FW0 A;  2THI A;  3NOH A;  4C0R A;  1AH5 A;  4DXC A;  2QFL A;  4F31 B;  1LAG E;  2XA5 A;  1NNT A;  4R6K A;  4WXJ A;  2ZZX A;  1H76 A;  3TOD A;  3CSB A;  2XXQ A;  4I3E A;  3U1O A;  1WDN A;  4GBV A;  2Z8E A;  1GGG A;  4P0I A;  4OTE A;  4EUO A;  1M5C A;  1ZTY A;  1EZP A;  4H45 A;  4TOZ A;  1IIT A;  1UIV A;  3UP9 A;  4XTC Q;  3F11 A;  5ICQ A;  5AA3 A;  1LST A;  5F1Q A;  1PEB A;  3KFM A;  3PPN A;  4O3B A;  3SZP A;  1LAH E;  4G8H A;  2QS1 A;  3JZJ A;  1VR5 A;  3K00 A;  1ZJL A;  4HE0 A;  3FXQ A;  2JJK A;  3RY3 A;  3V83 A;  5EYF A;  4PBQ A;  3DRH A;  3EN3 A;  4MHF A;  2Q2C A;  3T9X B;  1JW4 A;  5AE4 A;  4G77 A;  2KLF A;  1SVX B;  4C1T A;  1LAX A;  1PB7 A;  1GVC A;  3PU5 A;  2PT1 A;  3U94 A;  1NV3 A;  1TFD A;  2DVZ A;  4X9T A;  4JWO A;  4PAF A;  1LFG A;  3H3G A;  4H65 A;  3UA8 A;  3TFL A;  4NG7 A;  1I6B A;  5FBP A;  4F19 A;  2AIX A;  3ZKK A;  4H5G A;  1NUW A;  1MY3 A;  1Y1Z A;  1UTB B;  4GWX A;  1MH3 A;  4X04 A;  4QFK A;  1QGX A;  2FA7 A;  4RNS A;  1R6Z A;  1ZKB A;  2FIX A;  1NNK A;  5I2K A;  4IO6 A;  4LON B;  3HPI A;  4GWO A;  3I6V A;  4PFT A;  4P8B A;  4MEV A;  1VSO A;  3IB1 A;  4ESW A;  4BDL A;  3S4U A;  1HSJ A;  2XXT A;  2FVZ A;  3FAT A;  2HQ0 A;  3FJG A;  5I3S A;  1MQH A;  4OEU A;  1NV4 A;  1QW0 A;  3IK6 B;  3I5O A;  2F35 A;  1YAE A;  1XS5 A;  1RYO A;  1J1N A;  3A3U A;  4IO4 A;  2R71 A;  4K3F A;  5DTB A;  3RYD A;  2DOJ A;  3DEL B;  3K2D A;  1MH4 A;  1YTV A;  4P1E A;  1NV0 A;  4JDF A;  4F1V A;  2F3D A;  4O3C A;  1NV7 A;  2VD2 A;  4RPO A;  3OO8 A;  2XX8 A;  4ZEF A;  5I2K B;  4PGP A;  2MKZ A;  5FHO A;  3QSL A;  1TXF A;  3DLN A;  3UOR A;  2CZL A;  2KR0 A;  3MZB A;  4NF5 B;  3H4Z A;  4JVI A;  2I0C A;  2HAV A;  1NV2 A;  3EHU A;  4OVR A;  3KN8 A;  3KC1 A;  2AL5 A;  3D1R A;  3K1M A;  2I49 A;  1NUZ A;  3IR1 A;  4TQU Q;  4LP2 B;  2V84 A;  4NHB A;  3PUY E;  4I62 A;  2B4L A;  4QFO A;  4PFB A;  3O66 A;  1MY1 A;  1EZO A;  2DS9 A;  5I7I A;  3TKD A;  1A99 A;  3LSL A;  3H6U A;  4I1D A;  5J16 A;  2XX9 A;  2HXW A;  1OQG A;  4Q30 B;  3UN6 A;  3KSX A;  4EQ9 A;  3B8B A;  1DOT A;  4R74 A;  3H6W A;  2VD3 A;  1FTA A;  4JXI A;  4GWY A;  1O64 A;  4GL0 A;  3TEP A;  4LN5 A;  3K6U A;  4JSD A;  1ZIU A;  4JWX A;  4EXL A;  5DT6 A;  2A5S A;  2Q9T A;  3KN3 A;  2ZXT A;  3ZKL A;  3WAE A;  4QF9 A;  3IO6 A;  4P3L A;  2VPN A;  4F22 A;  3B7D A;  2PCR A;  2WX9 A;  4EDP A;  1IME A;  1UTB A;  4QRZ A;  4DCX A;  1M5B A;  5DVF A;  1RDY A;  3HFU A;  3W15 C;  2KQZ A;  3KZG A;  1EH3 A;  2P2A A;  2Q89 A;  4OVJ A;  4OEN A;  4THI A;  3C31 A;  3ECR A;  4YU0 A;  4KD5 A;  3FBP A;  1JVX A;  3SET A;  4O7I A;  3Q28 A;  3FUZ A;  1YPN A;  1B6H A;  4GWS A;  4GF8 A;  2DWH A;  1LAF E;  2DXY A;  5KDT A;  3G3H A;  1JP4 A;  2I6E A;  1MXU A;  1Y20 A;  3OD7 A;  5I56 B;  1NL5 A;  4NF5 A;  3T93 B;  1I6Q A;  4OA4 A;  4DDD A;  2HZL A;  5I56 A;  4ZS9 A;  1JW1 A;  4DE8 A;  3S9L C;  4KFQ A;  1XOC A;  4I9D A;  2REJ A;  2Q2A A;  3TTN A;  3IAZ A;  4IO3 A;  5LOM A;  3QXM A;  2QVV A;  1IIW A;  4IY6 A;  2DWA A;  3DP6 A;  3H06 B;  5EYG A;  1P99 A;  4R73 A;  3KN7 A;  4QSC A;  3V89 B;  2ZNS A;  1N7W A;  4DI4 B;  1FQF A;  3KEI A;  1EZ9 A;  4EXK A;  3PPP A;  2ZZV A;  4G68 C;  2AYS A;  3T9H B;  4OFJ A;  1NV1 A;  5M2V A;  5FHM A;  2QL3 A;  2ZMB A;  4IB2 A;  2I0B A;  5BUU A;  2QS2 A;  4GWU A;  2IA4 A;  2F6P A;  3FJM A;  1NNF A;  2ONR A;  3QYT A;  3ISP A;  5T3J A;  1USY H;  4N13 A;  4FEC A;  1NH7 A;  3TYH A;  2OZZ A;  3SEW A;  3MVX A;  4G61 A;  4KPT A;  1O63 A;  1B5H A;  3U72 A;  3FV1 A;  3I3V A;  4F18 A;  3LSF B;  1URS A;  3LV0 A;  4PP0 A;  2R8T A;  1RKM A;  3LUY A;  3KGC A;  2FYI A;  1POY 1;  3PPQ A;  2ESN A;  3OSR A;  5DVJ A;  5JK4 A;  1T0K A;  4BDN A;  1MY2 A;  5IZ3 B;  3V5A A;  4RXL A;  3QIM A;  3IOV A;  3VVE A;  1FTJ A;  2UYF A;  1JEU A;  1NV5 A;  3A3C A;  3E78 A;  2DWJ A;  3LVU A;  4PE3 A;  1Z7M E;  2Y7W A;  3C9H A;  3VXC A;  4P56 A;  2F7A A;  4Z7E A;  5H8Q A;  1B5I A;  2QS4 A;  1PB9 A;  3O6P A;  1P1Q A;  4I40 A;  2RCA A;  3U8Q A;  4JBZ A;  5LTC A;  4U1O A;  3GBB A;  5I59 A;  3IFA A;  3D4G A;  1JW5 A;  5L9O A;  4YZZ A;  4BDM A;  3C35 A;  2H5Y A;  2V3T A;  3HN0 A;  3DRG A;  1G0I A;  5EQ9 A;  2DDK A;  3DP4 A;  3TTR A;  4R75 A;  2ANJ A;  3O6H A;  1XI6 A;  2UVG A;  1PC3 A;  1N84 A;  4NN3 A;  2Q74 A;  5ITP A;  5ET7 A;  5FTI A;  2UVJ A;  4FJP A;  4F39 A;  4GD5 A;  4KHZ E;  4PE5 B;  1FBF A;  4Z0I A;  2XXR A;  3KC0 A;  4GWW A;  2O6A A;  3MZ1 A;  3O9P A;  2DWI A;  3TPA A;  3QUJ A;  3LBS A;  4FEB A;  4BDO A;  2PX1 A;  5CI5 A;  3BKI B;  4HCY A;  1LFH A;  1DTG A;  1XC1 A;  2QVU A;  2FBP A;  2QVR A;  3Q27 A;  3RPL A;  1OIB A;  2RCB A;  4P9K A;  3PMX A;  4FOR A;  3PUZ E;  3K4U A;  4RYA A;  4R9G A;  1QKB A;  2I58 A;  1Y9U A;  2PVU A;  2O1M A;  1N3X A;  2YPN A;  4C1U A;  4NAP A;  3JYR A;  3IOW A;  1M5E A;  2P0S A;  2XXP A;  2DE2 A;  1LB9 A;  2O7U A;  4XFE A;  3QMF A;  3WAF A;  5H8S A;  5EYH A;  3RQT A;  4JWY A;  1DTZ A;  1YYZ A;  3MBP A;  2XXH A;  3FD3 A;  5A5X B;  3PUX E;  1IXG A;  3T66 A;  3VLV A;  3TMG A;  3O29 A;  1OVT A;  1QUL A;  1P1N A;  1TFA A;  3M3L A;  4OVP A;  1ZLQ A;  3C34 A;  1N0T A;  3K1P A;  4RK2 A;  1B4H A;  2L5V A;  2R9J A;  4Q8R A;  1ATG A;  4PDD A;  1VFE A;  3FXU A;  4LA9 A;  4ELP A;  2DVC A;  5FTH A;  4N6P A;  3QK6 A;  2B4M A;  4MMP A;  1B5J A;  4RA1 A;  2PBW A;  4YAH X;  2OWT A;  1FQD A;  2ONS A;  4IY5 A;  1UIU A;  3KBZ A;  4N91 A;  4O94 A;  2O69 A;  4BDR A;  1POT A;  2ZYK A;  1Q1K A;  3FVN A;  2WOL A;  3DRJ A;  3BBR A;  3PPR A;  1Y1M A;  2ZYO A;  2YLN A;  4OFL A;  3SER A;  1AL3 A;  5I58 B;  1GTK A;  5H8N A;  5I57 B;  1SI1 A;  1FJ6 A;  4N6D A;  4KI0 E;  4PF8 A;  4R6Y A;  2UXA A;  4ELQ A;  4P1L A;  1NKX A;  2F6G A;  4F3S A;  3IB2 A;  1GV8 A;  1SW4 A;  4DCY A;  3FVO A;  1MM7 A;  5IAI A;  4F29 A;  4I3Y A;  2REG A;  5KCJ A;  3CI8 A;  2VGQ A;  2HHM A;  2HCA A;  1JVY A;  1B58 A;  1XHY A;  3OO9 A;  4ZEB A;  4PTK A;  5TU0 A;  3GLB A;  2E1S A;  5L9S A;  4PGN A;  3VVD A;  3OEN A;  2F34 A;  3W9W A;  4IGR A;  3LUZ A;  2VP1 A;  5ELV A;  4XXU A;  5AA4 B;  1ZU0 A;  4RJZ A;  5AA4 A;  4U22 A;  1IMA A;  1YZ0 A;  2CZI A;  5F24 A;  3H6T A;  3HST A;  3FJ7 A;  3VFJ A;  2G29 A;  2UVH A;  4U4X A;  3SEV A;  4PET A;  4PFI A;  1B32 A;  3K6V A;  4FAT A;  4OET A;  1PBQ A;  1AIV A;  2PFZ A;  4FE8 A;  4GVO A;  1UQW A;  3K6X A;  1RDX A;  4H1X A;  4XKN A;  1I69 A;  4MLQ A;  3O6G A;  1LB8 A;  4PBH A;  1FBG A;  3MW0 A;  3OEK A;  4OQO A;  4DXB A;  2O68 A;  3RGY A;  3BIG A;  5IZZ A;  3S9E A;  3IJX B;  4MNP A;  3L6H A;  2A5T B;  4XF5 A;  3O2A A;  3FV2 A;  3IB0 A;  2YJP A;  3N6U A;  3G3J A;  1BP5 A;  1EYK A;  4KYE A;  4PQJ A;  4YKP A;  3KJ7 A;  4N4U A;  5A5L A;  1MG1 A;  3ZSF A;  1I6A A;  5JEI A;  1FPJ A;  3TQW A;  2LAO A;  3L6G A;  3OO6 A;  3AXF A;  4QSD A;  3UK4 A;  2FNC A;  1B3H A;  4U4S A;  3FXR A;  3PTY A;  3IOR A;  1KZ8 A;  1AMF A;  4MNC A;  1XT8 A;  2F7C A;  4PFY A;  3T22 A;  5ET5 A;  3ZS6 A;  3MVZ A;  4LZ8 A;  4ND9 A;  1JEV A;  1Q9D A;  4NF4 A;  1BKA A;  2QS3 A;  3SEX A;  3KG2 A;  4ZEC A;  1D3K A;  1KWH A;  2XHD A;  2RC9 A;  1FTO A;  4L17 A;  4XKQ A;  4RPN A;  3IJO B; 
#chains in the Genus database with same CATH homology
 5CM6 A;  3E79 A;  3NOH A;  2QFL A;  2XA5 A;  4GWU A;  1DK4 A;  3ISP A;  1D9Q A;  2ZZX A;  5T3J A;  1FRP A;  4HCW A;  3PAM A;  1EYI A;  4I3E A;  4GBV A;  4N8G A;  4FBP A;  3MVX A;  4N15 A;  4G61 A;  1B5H A;  4N81 A;  2FHY A;  2V4C A;  2WEF A;  1ZTY A;  4F18 A;  4H45 A;  4TOZ A;  3DRI A;  3LV0 A;  1UIV A;  2R8T A;  4GX4 A;  2XXK A;  1RKM A;  2OX3 A;  1B51 A;  5ICQ A;  5EQA A;  5JK4 A;  3DRK A;  5F1Q A;  2P3V A;  5IZ3 B;  1B52 A;  4PAK A;  4IR8 A;  4GBW A;  3QIM A;  3SZP A;  1QKA A;  2ZZW A;  2V3Q A;  1JEU A;  1NV5 A;  1VR5 A;  3E78 A;  5L8D A;  3LVU A;  4PE3 A;  4HE0 A;  1SPI A;  3TCG A;  4ONY A;  4P56 A;  1FSA A;  1JET A;  2JJK A;  4NGU A;  3RY3 A;  1B5I A;  1B7H A;  4PBQ A;  3O6P A;  4I40 A;  4N17 A;  1FPD A;  3DRH A;  4OVQ A;  1DPP A;  5LTC A;  4MHF A;  3RYA A;  3TCH A;  3IFA A;  2OLB A;  4YZZ A;  3W9V A;  1VDW A;  4QFL A;  1EYJ A;  4ZED A;  4X8R A;  4HE2 A;  4FAJ A;  2CEY A;  3DRG A;  4ZE8 A;  1DPE A;  4XKP A;  1G0I A;  4GWZ A;  5EQ9 A;  5EQ7 A;  2XWK A;  4PFU A;  2DDK A;  1KA1 A;  4OEV A;  1XI6 A;  3B50 A;  1NV3 A;  4QFP A;  2DVZ A;  3MST A;  2CZK A;  4X9T A;  4NN3 A;  2Q74 A;  4OFO A;  5IGA A;  4PAF A;  5ET7 A;  3MYU A;  2F5X A;  4NG7 A;  4GX3 A;  1FBF A;  1IMD A;  5FBP A;  3KC0 A;  3DRF A;  4GWW A;  4F19 A;  3O9P A;  3TPA A;  4NQ8 A;  1NUW A;  4QFN A;  4HCY A;  4PF6 A;  3EKI A;  4OER A;  4GWX A;  4NX1 A;  1INP A;  1FPE A;  2QVU A;  2FBP A;  2QVR A;  3MVY A;  1B3F A;  3RPL A;  4P9K A;  1YXI A;  4X04 A;  4MCO A;  4QFK A;  1QKB A;  1QGX A;  5ISU A;  1FBH A;  1B2H A;  2XWV A;  4OVT A;  1G0H A;  4NAP A;  2FIX A;  4O8M A;  5LDZ A;  4JSO A;  3BIH A;  2DE2 A;  4O7M A;  1OLC A;  1B3G A;  4M1V A;  4XFE A;  4AS5 A;  3QMF A;  2GQ1 A;  4PFT A;  4P8B A;  4MEV A;  5EYH A;  3RQT A;  1B4Z A;  1NUX A;  1YYZ A;  4PFW A;  3IFC A;  5IM2 A;  2D5W A;  1FBC A;  4N8Y A;  1AWB A;  2WYP A;  5KZT A;  2FVZ A;  2HPG A;  4GX6 A;  1B3L A;  3T66 A;  4ZEI A;  5I3S A;  4OEU A;  1NV4 A;  4I8C A;  4ZEK A;  2RKM A;  2DE3 A;  2Y5L A;  4OVP A;  1ZLQ A;  3I5O A;  4QXD A;  4DI3 D;  1B4H A;  2L5V A;  3RYD A;  4F1U A;  4H46 A;  4PC9 A;  4PDD A;  1DCU A;  4MNI A;  4P1E A;  5HM4 B;  1FJ9 A;  1NV0 A;  2B4M A;  4MMP A;  1B5J A;  4RA1 A;  4F1V A;  2F3D A;  1NV7 A;  2CZH A;  2WBD A;  1UIU A;  3KBZ A;  4N91 A;  4QBA A;  4O94 A;  1LBY A;  3FTO A;  4OVS A;  2Z23 A;  4PGP A;  2MKZ A;  3RPL B;  1IMB A;  4MX6 A;  2WOL A;  3DRJ A;  2XWO A;  4KXP A;  3MVW A;  1FPF A;  4OFL A;  1NUY A;  2KR0 A;  3MZB A;  1B9J A;  4JVI A;  1FJ6 A;  4N6D A;  4PF8 A;  1LBW A;  1NV2 A;  4P1L A;  4PDH A;  4OVR A;  1IMC A;  1FPL A;  4WED A;  3KC1 A;  4DCY A;  3D1R A;  1NUZ A;  4I3Y A;  2WBB A;  5IZ1 A;  2HHM A;  2P3N A;  4NHB A;  1FBP A;  2B4L A;  1B58 A;  4QFO A;  4PFB A;  1K9Z A;  5I7I A;  4ZEB A;  1IMF A;  4PTK A;  5DW8 A;  4JVD A;  4N6K A;  4XKR A;  4PGN A;  5J16 A;  3B8B A;  3W9W A;  3LUZ A;  1FTA A;  2WOK A;  5IZ3 A;  4GWY A;  2O7I A;  1ZU0 A;  3A29 A;  4LN5 A;  5ET6 A;  1B46 A;  1B05 A;  1IMA A;  1YZ0 A;  4JSD A;  1FBE A;  2CZI A;  4HXV A;  5F24 A;  4PCD A;  2Q9T A;  2DE4 A;  4HE1 A;  1LBX A;  2HXR A;  4P3L A;  2VPN A;  1B1H A;  3M8U A;  1FPB A;  1NI9 A;  1KA0 A;  4JVC A;  4PET A;  4XKQ A;  3T0J A;  4PFI A;  5ESY A;  2PCR A;  1B32 A;  2WX9 A;  3FXB A;  1K9Y A;  1IME A;  3T1B A;  1B0H A;  4OET A;  1FPI A;  2OWZ A;  4DCX A;  2PFZ A;  4XEQ A;  1RDY A;  3HFU A;  2KQZ A;  1UQW A;  4MIJ A;  1RDX A;  4XKN A;  4PBH A;  1FBG A;  3MW0 A;  4GFR A;  1BK4 A;  3ROJ A;  1B40 A;  4PAI A;  5J1D A;  1FPG A;  3BIG A;  2NOO A;  5IZZ A;  1OLA A;  3TCF A;  3FBP A;  4MAG A;  1RDZ A;  4O7I A;  5I5P A;  4OAN A;  1B6H A;  2WOP A;  4GWS A;  4MNP A;  4GF8 A;  2VPO A;  1LBZ A;  2WYK A;  4XF5 A;  1LBV A;  1JP4 A;  1FBD A;  2PFY A;  2GRV A;  1EYK A;  4AS4 A;  1DBZ A;  4OA4 A;  2HZL A;  4N4U A;  5A5L A;  3U65 A;  4NF0 A;  1XOC A;  4I9D A;  1FPJ A;  3MZ9 A;  1FPK A;  4MJO A;  4P47 A;  4YIC A;  3GYY A;  5ET8 A;  1LEV A;  2Y5K A;  4UAB A;  2QVV A;  2BJI A;  2Q8M A;  1B3H A;  4PFR A;  5EQ8 A;  3PTY A;  3CHG A;  3E3K A;  1KZ8 A;  2VT5 A;  4MNC A;  4PFY A;  1CNQ A;  5ET5 A;  5EYG A;  3ZS6 A;  3MVZ A;  1JEV A;  2FIE A;  2HZK A;  1Q9D A;  4GL8 A;  3DP8 A;  2F3B A;  4DI4 B;  4ZEC A;  2ZZV A;  3RYB A;  4ZE9 A;  2CEX A;  4OES A;  4OFJ A;  2QPQ A;  2XWI A;  1NV1 A;  1NV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...