2B4LA

Crystal structure of the binding protein opuac in complex with glycine betaine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
268
Chain Sequence
DENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine-binding protein
publication title Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 98
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2b4lA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2b4lA01
5ISUA 2WOPA 4OETA 1B46A 4ZEBA 3RY3A 1ZU0A 4OFLA 1JETA 4OFJA 4QFNA 1UQWA 1UIUA 3DRIA 4RA1A 1XOCA 3QIMA 3DRGA 2RKMA 1ZLQA 3RYBA 4QFKA 1VR5A 3T66A 5KZTA 1B3HA 1QKBA 4JSDA 3FTOA 3DP8A 3DRJA 1B58A 4DCYA 1B5HA 1ZTYA 3DRHA 4PFTA 4XKNA 5F1QA 1B05A 4XKQA 3MVYA 3MZ9A 5ICQA 3CHGA 2Z23A 3MVWA 5HM4B 3PAMA 1DPPA 4QFOA 1B6HA 3RYAA 1OLCA 3O9PA 1B1HA 2WOKA 2O7IA 3TCGA 2B4MA 1B2HA 3I5OA 4QFPA 4GFRA 3TCFA 1B4HA 1DPEA 4PFUA 4ZEKA 1B40A 4GF8A 5L8DA 4OERA 1B5IA 1B9JA 3RQTA 4ZEDA 1OLAA 3TPAA 4JSOA 1JEVA 2B4LA 4I8CA 1B32A 3MVZA 4XKRA 2GRVA 4ZE8A 4ZEIA 1B3GA 3TCHA 1B3LA 4OEUA 4I9DA 1QKAA 4PFWA 4OEVA 1B3FA 4XKPA 1JEUA 4FAJA 4TOZA 4GL8A 3MW0A 4QFLA 4OESA 2WOLA 1B51A 1B7HA 3E3KA 4WEDA 2NOOA 3ZS6A 4PFYA 3LVUA 4OFOA 3M8UA 3MVXA 1B5JA 1B4ZA 3DRKA 1B52A 1B0HA 3DRFA 2D5WA 3O6PA 4DCXA 4ZE9A 1RKMA 1UIVA 2OLBA 4ONYA 4ZECA 3MZBA
chains in the Genus database with same CATH superfamily
3QYTA 4ZEBA 2WEFA 3TZAA 1HSEA 3QAXA 4Q5TA 2DE4A 3S9NC 4FEDA 4GWYA 2QMWA 5H8QB 4KHZE 2F5XA 4G8HA 3IFAA 4F1UA 3RYBA 1A8FA 3V5AA 3CFLA 4LN5A 5KZTA 1QGXA 3OSRA 3DP8A 3DRJA 2Q2AA 5B7DA 5KCJA 1SQYA 2KR0A 5KDTB 4QSCA 1JP4A 2I6EA 2VPNA 3QUFA 3W9WA 4MNPA 2VPOA 4YMBA 2FYIA 2QVVA 3VVFA 4U2RA 2G29A 3FJGA 2RC7A 2DDKA 2F6GA 4R72A 4QFPA 2Z8DA 3D4CA 3HSTA 2AIXA 4LONB 3W9VA 4H8IA 1FTLA 5CI5A 3MVZA 3C4MA 3G3KA 1LGBC 2V84A 1XI6A 3FASA 4P11A 2CZLA 1IMEA 4FAJA 4U23A 2ANJA 4GWZA 4GQOA 1B51A 4YMAA 1FPLA 1SW4A 1N3XA 3B8BA 3PV0E 1POTA 1MY4A 4FJPA 2D21A 1RDXA 4OXVA 1H76A 3U94A 1LCFA 1NUXA 3GXAA 3O6PA 4DCXA 3PUWE 5IAIA 4M4GA 4XXUA 3VE1B 4QF9A 3KEIA 5AA1A 3SEWA 3H6UA 3BIHA 1IQ7A 2DE3A 1JETA 4OVRA 4P0GA 3I6VA 4G8NA 1HSLA 4KCCA 4DE8A 3EHUA 4KI0E 1XOCA 4IY6A 4QHQA 4AS4A 1LBCA 3VV5A 1ZBMA 2RC9A 3DELB 2H4IA 3BFUA 4HW8A 4F39A 1D3KA 4ECFA 3D4GA 1KZ8A 5TP9B 4XKQA 1YXIA 2CEYA 4ZS9A 5TP9A 1ZMGA 2NWJA 4HCYA 1Y3PA 4LQ2A 2BJIA 4PGPA 1OLCA 4G4PA 3VLVA 4F3SA 1MPBA 2F78A 4KFQA 3S4UA 3U72A 2FHYA 1B3EA 2XWIA 1FPFA 3VXCA 3QSLA 1DPEA 4PFUA 4OERA 2V93A 1BLFA 4OANA 5EQ8A 3TELA 3DLNA 3D1RA 4I62A 5J1DA 2QL3A 3T96B 1QULA 4OEUA 5DVFA 3MP8A 4LZ7A 4OEVA 2I3WA 5I57B 1I6BA 2AL5A 5I57A 2WYKA 1PDAA 2F7CA 3CSBA 4YKKA 3MVXA 4YAHX 1POY1 4ELQA 4C1TA 1N7XA 3EHTA 3G3JA 3G3FA 3G7WA 1UIVA 2XXTA 5K2XA 3LR1A 1FBEA 2THIA 4NF5B 1UTHB 3RY3A 4MNIA 4H0WA 1URDA 2Q8MA 4U4XA 3FV2A 4YKJA 3QXMA 2OK2A 4IB2A 5I5PA 2DWAA 1QKBA 4JSDA 3EN3A 1TFDA 4OENA 4DCYA 4P1LA 1EYIA 1NV6A 1JNFA 2XWVA 3B6TA 4Q30B 5CMKA 3FVNA 4HE2A 4AS5A 1IEJA 3H03A 2W7YA 4JWXA 4DIGA 3ZKLA 1SW1A 3V89B 1MQDA 4IO2A 4HTGA 5FHNA 4UABA 2O7IA 1OQGA 4KYDA 4LP2B 4BDRA 4N8YA 3I5OA 3O6IA 1TFAA 4F3BA 4BDMA 4OTEA 3OMBA 1EZ9A 2ONRA 2B4LA 3KN3A 5ET5A 3L6HA 3E79A 3FJMA 4GL0A 4XEQA 2PYYA 4O7IA 1J1NA 2VD2A 3KBRA 4H5FA 3K4UA 1US5A 3MJNA 1IMFA 4RXLA 3FVGA 3JV9A 1UTBB 1A99A 1P1NA 1UTBA 1PB8A 3E4RA 4WKMA 1LBBA 2RF1A 3M8UA 3T9UA 3KC1A 3RT6B 1B4ZA 5EQAA 1BIYA 3KSJA 4G2ZA 4PFRA 3PGFA 2D5WA 3HCQA 3EQ1A 4HE1A 1MDQA 4GD5A 1WODA 2PX1A 2F3BA 4OFLA 1MPCA 4GLIA 2V3TA 1FTKA 4ZZAA 1DBZA 1GR2A 3O66A 4U4SA 2V25A 4F18A 5AA4B 1DTZA 1LAGE 1NUZA 5AA4A 4MLQA 3H3GA 5EHSA 3RGYA 4ZZEA 1S9TA 3TODA 5AE4A 1EZPA 4GWXA 4PE5B 2QVRA 4F29A 2UVHA 3TYHA 2UYFA 4KYEA 3Q26A 2P3NA 1N84A 4MMPA 1B4HA 5L8DA 4OZ9A 3TTNA 3T22A 2XXKA 3LSLA 1INPA 3N6TA 2OWZA 4I8CA 3ONMA 3C35A 1DK4A 2ZZWA 5JTYB 2OCUA 4QSEA 1XT8A 2HXWA 5JTYA 3KZGA 3PMXA 1QKAA 1AOVA 3A09A 1SBPA 4HS7A 3KOTA 4HE0A 5I59B 4PFYA 1LB9A 2CMOA 4THIA 4R74A 5I56B 4O7MA 1MDP1 2YLNA 5I56A 1MQIA 4FORA 1LB8A 3NOHA 3IOVA 4R75A 1LSTA 1Y9UA 3KG2A 3HHGA 1GGGA 3MP6A 1B46A 3O97A 1P1QA 4LZ8A 5JEIA 5HBCA 2HAVA 1XVXA 4DXBA 2UVGA 1A7LA 1VR5A 3K6WA 2V4CA 4O3CA 2F6PA 1JW4A 3MAMA 3CR9A 4PC9A 2G93A 2XX8A 4X8RA 2E0SA 2Q74A 5K2YA 4MEVA 2VP1A 2F97A 4BDNA 4MH5A 5TPAB 5ICQA 2Z23A 5TPAA 1P99A 1O63A 2H9BA 2QS1A 3RYAA 3LC8A 3MSTA 2Q9TA 3KC0A 4Z0IA 3K0VA 2F7BA 2VOZA 1YCJA 5ESYA 4EF1A 4KQPA 3MPKA 3KOSA 1FJ9A 1PB7A 1ELJA 5CRYA 4Z7EA 1SYIA 1B5IA 1B9JA 1OLAA 2DE2A 4QBAA 3MPLA 2ZYOA 2DWJA 4H65A 4MHFA 1VFEA 3RLFE 2XXVA 3GLBA 1LAFE 3RPLB 3HO7A 1N04A 3RPLA 3U1OA 1B3LA 4TLLB 3FUZA 2Y7PA 5IZ3B 3HPIA 5IZ3A 2UXAA 2YPNA 1IIWA 3MW0A 4NG7A 3TKDA 1URSA 3E3KA 2R9JA 3Q25A 3UA8A 2V3QA 2OX3A 3TTRA 1QVSA 1B0LA 2XA5A 4N4UA 2YJPA 4NTLA 4GX3A 1IITA 1H3DA 3PMWA 1LBZA 1R1NA 4ONYA 3C9HA 3K01A 5H8NB 1VFDA 4IGRA 1FQCA 3KGCA 3PPQA 1FTMA 4NQ8A 4RA1A 4EXLA 3QIMA 3O29A 4RJZA 2NUVA 1GVCA 4LVQA 4QXDA 1PC3A 2L5VA 1B5HA 2VHAA 5A5LA 3C33A 1EU8A 4NGUA 2I3VA 3PD9A 1IMAA 1WVJA 2XXWA 2FBPA 3UGWA 5H8QA 4ISUA 4NX1A 2XXIA 4F2QA 2AYSA 2GHBA 2WYPA 2QSXA 3T93B 3CRBA 3RPWA 3T9XB 5DTBA 3KJ7A 3CG3A 3BKIB 4NF8B 4NHBA 4NF8A 3TEPA 3IB1A 3QK6A 2F3DA 3QUJA 3ROJA 3PU5A 5KDTA 4ZE8A 4YICA 3B7DA 1FPBA 2NXOA 4RYAA 3CSGA 3V8XB 1LLSA 2IEEA 1PBQA 5FTIA 5L9MA 1TT1A 1M5DA 1AMFA 4FE8A 1USYH 5DYHA 4WEDA 5LOMA 3FVOA 3ODBA 4MNCA 3R6UA 3EHSA 3OO9A 4Q8RA 3S9EA 5FBPA 1HSJA 4MX6A 1LBVA 1I6AA 3B6WA 4M1VA 2WOPA 2KLFA 3S2VA 1NV5A 4GWOA 1BKAA 2VD3A 2HQ0A 1XS5A 2HFBA 2QRYA 2ZMBA 2UVJA 3FBPA 4EF2A 4JBZA 3TQWA 1P1OA 3OXNA 2QS2A 3PD8A 2O51A 1B58A 1NNFA 3SEYA 5DVIA 3DP4A 2RCAA 2XXRA 2NVUB 2X7QA 4P3LA 3SEUA 4PCDA 4NF4B 2PT1A 4GBWA 3G3IA 4RY1A 1NL5A 3IX1A 1OMPA 3VXBA 4QSDA 4RNSA 3BIGA 4ESXA 1K9ZA 1B40A 3N26A 3G3GA 1FTAA 3UP9A 3IOUA 1AIVA 1FPJA 4UA8A 4PE3A 2PT2A 3JYRA 4NAPA 1XHYA 4R9FA 4XKRA 4ZEIA 2HCAA 2R8TA 1LEVA 4G68C 4IGTA 1AL3A 1I6QA 1N76A 4H45A 1BTJA 5DW8A 3ILTB 3K1MA 4OQOA 4H1XA 4OESA 1YZ0A 1R9LA 4N15A 4PDDA 4PF6A 1VSOA 3GBBA 1QUIA 1RDZA 4GIZA 2PBWA 5EYFA 1KA1A 4F1YA 5TU0A 3GYYA 1FCKA 1F9BA 1CNQA 1NMUA 4OVQA 4MF3A 3G3HA 5IM2A 2XXUA 3MP1A 2REJA 2XWOA 3CI8A 5CMCA 2DVZA 2I49A 5J16A 1YTVA 3H6VA 2P0SA 1UQWA 3N94A 2HHMA 1UIUA 1N3WA 2QS3A 4PAFA 5CBSA 3L6GA 1JVXA 1MY1A 3LSXA 1D9VA 1IXGA 2Y7KA 3MZ9A 3K2DA 3M3LA 4NF5A 1UTHA 4R2FA 4BDOA 2HZLA 4PTKA 1B6HA 1ZIUA 3IL1B 4EQ7A 2OBGA 3O9PA 5EHMA 1FPDA 3TCGA 2ZZVA 1B2HA 2O1MA 1MXUA 3IORA 3JZJA 3ILUB 4WXJA 4L17A 1FRPA 3RQTA 1K9YA 3FVKA 4EXKA 4DI4B 1Y3QA 3UK4A 3FATA 3FGSA 4GX6A 3VLWA 1NUYA 1B3GA 1XC1A 5FHOA 1G0IA 2Q2CA 3TMGA 1A55A 4G77A 4EUOA 1P1UA 1NKXA 3KBZA 5I2NB 4GBVA 5I2NA 1NV2A 3IJXB 4GWSA 4ND9A 2RC8A 4YZZA 4GXAA 3KN7A 3TTLA 1II5A 4N6DA 3VFJA 4HCWA 4ZE9A 2O6AA 3TUSA 1LBYA 4NF6B 4PAKA 3M3KA 3CIJA 1QW0A 4NF6A 2I0BA 4EQ9A 5HPQA 1FPKA 1O64A 2QVUA 2PMSA 2WBDA 3V83A 1AWBA 1SPIA 4N81A 4LUBA 3T1BA 4FATA 4XTCQ 1NV7A 3S9LC 2RKMA 3W15C 1DSNA 3FTOA 3MC2A 2H99A 1NI9A 3SKPA 1ZTYA 1B05A 1MG1A 1NFTA 3O2AA 3PUZE 3MVWA 2B3FA 5HM4B 4P8BA 4N13A 2R71A 1MY2A 4N8GA 4F31B 4MBPA 2Q89A 5A5XB 2WKYA 1NH7A 1MQJA 3CFXA 5A5XA 3Q29A 2WBBA 4O94A 4KYSA 2DSFA 2MKZA 5DVJA 3OOAA 3R26A 3K1NA 3HV1A 4MJOA 1MH3A 3LBSA 2GRVA 1ZJLA 2O1LA 3OO6A 3IK6B 3O6GA 4ZDMA 1RYXA 3MZ1A 2HPGA 4R73A 4JVDA 1B7HA 4AB5A 3H7MA 4WEPA 1IZ1A 5LTCA 1FQBA 4R9GA 2PFZA 1NV0A 3OD7A 5CMMA 4ESWA 3K6VA 2DOJA 3UN6A 2HEUA 4OMBA 3M3FA 1FBHA 2H5YA 1MQGA 3RT8A 4OFJA 1CB6A 2LAOA 3VLUA 5I59A 4NF0A 1SYHA 2FNCA 1ZLQA 4JDFA 3PTYA 1SD3A 1S7YA 4DLDA 5F1QA 3K00A 3MQ9A 1Y4CA 1FBCA 2I4BA 4YU0A 5L9OA 1Y20A 1B1HA 4K3FA 1FPIA 3HHFA 5B70A 4P56A 4PP0A 4LZ5A 3WAEA 2HZKA 3TCFA 3FXQA 4DZ1A 3BFTA 4ZEKA 2ZNSA 1URGA 3PUXE 4ZEDA 2GH9A 2AL4A 1JEVA 3CFZA 4R6YA 4YB6A 2CEXA 3K02A 3MYUA 3P7IA 4PBQA 3RNNA 4DXCA 2I0CA 4P0IA 3SESA 3PUVE 4I9DA 4ELRA 3ECRA 1NV4A 4N17A 4UACA 1JEUA 1FBFA 4JWOA 3VVEA 4GVOA 2NOOA 3LVUA 2XD3A 2OJTA 3DP6A 2D3IA 4I3YA 2DS9A 5ICTA 4RK2A 3FJ7A 4E0XA 3F11A 1ANFA 2Y7IA 5IKBA 2I58A 3PPRA 3OO8A 2M8CA 4MFIA 4TQUQ 4PDHA 4EQBA 1ZKBA 4HXVA 2DYXA 2DXYA 4N6PA 1FJ6A 1IMDA 4GRKA 3DRGA 1WDNA 4G61A 1USYE 3DRHA 1LCTA 2CZHA 1CE2A 4U21A 3CHGA 1FQAA 1QUJA 5H8NA 1EZOA 4U1OA 1EYKA 4P1EA 3OEMA 4NE4A 5I2KB 4IO5A 5I2KA 4I3EA 4X04A 2O84X 2FVZA 4X48A 4P47A 4GFRA 3UORA 2R6GE 1MM7A 1YYZA 3I3VA 4OVSA 4OVJA 2F35A 1Y4TA 1JW5A 2XWKA 3OO7A 3C32A 3U92A 1B1XA 1D9QA 3RN8A 2F36A 2REGA 5I58B 3EF7A 5I58A 2ZZXA 2QPQA 1Y3NA 1Y1ZA 1AH5A 1OIBA 4DXUA 4QRZA 1T0KA 4OFOA 3MUQA 4O8MA 4BDQA 3PUYE 2WX9A 3PPOA 3DRFA 5EQ7A 3SETA 4DI3D 2Z22A 5KCJB 1RKMA 2OLBA 3TDJA 3H4ZA 3SERA 1MXWA 4F3GA 3B50A 5H8SA 5T3JA 3RTFB 4FIMA 1DCUA 5I84A 3THIA 2RCBA 4PAIA 2Y7WA 2OWTA 4IR8A 1R6ZA 4PFIA 1OVBA 3IO4A 5H8FB 4MAGA 1DOTA 1SI1A 1DPPA 5H8FA 4H46A 4ELPA 2Y7RA 4EDPA 2XXYA 5CC2A 1IMCA 2XX7A 4X1BA 3LUYA 3RTWB 3TQLA 5IZZA 2DP8A 3VDFA 3KSXA 1A54A 1B32A 3B6QA 1Z7NE 4I1DA 1D4NA 4NF4A 3K6UA 5EQ9A 4Q0CA 4NWCA 4R2BA 1EH3A 1M5EA 3H06B 4ZEFA 1SDXA 4QFLA 2FIXA 1TXFA 3UIFA 3U65A 1NNPA 5DT6A 3T9HB 3LSWA 2XX9A 1KWHA 4O3BA 1B52A 4KPTA 2X7PA 1B0HA 4OVPA 3U93A 2QMXA 1S50A 2XD2A 2ONKE 1FPGA 5ET8A 2IA4A 2QFLA 5ISUA 4PBHA 2ONSA 1ZU0A 4JWYA 4F2OA 2E1SA 2DWIA 1MY3A 3OELA 3EPEA 3ZSFA 1B3HA 2V3UA 5CMBA 4NEDA 4X1DA 2DWHA 2ZYKA 3N5LA 2Q88A 3PPNA 4JB7A 4H5GA 5AA3A 1IXHA 3H6TA 3K1PA 1NH8A 4PFBA 3S9MC 3A29A 5AA2B 5AA2A 2GHAA 1ATGA 1DMBA 1RDYA 4N6KA 2Y84A 4YB5A 3IO6A 2PVUA 5JK4A 3T0JA 1IXIA 2BJJX 1MQHA 1OVTA 2Y5KA 4GF8A 3ISPA 3U8QA 3DM0A 4H8JA 4JSOA 2HAUA 4MLVA 2XHDA 3RYDA 4KXPA 4XIGQ 4G8MA 5BWJA 1YAEA 2DXRA 3TCHA 1IXCA 1FTJA 4IO4A 4PFWA 2ALUA 3TFLA 2XXXA 4C0RA 3IAZA 4R6KA 1QUKA 1US4A 1BK4A 1FBGA 1Q35A 4RPNA 2OZZA 2O69A 1MY0A 1JQFA 5I7IA 4F19A 3DRKA 1QJMA 4KR5A 2VGQA 1N7WA 4XFEA 3SEVA 1H45A 4GXSB 2O68A 1VDWA 2VT5A 3MZBA 4FEBA 3FXRA 3LUZA 4QFNA 3PMVA 4LATA 2H98A 3DRIA 4JVIA 4BDLA 3HFUA 4IO3A 4QFKA 1BP5A 1GV8A 4PF8A 5I3SA 3O6HA 3CVGA 4PFTA 2DVCA 4I40A 1JVYA 1Y1MA 2FIEA 3AXFA 4GWUA 5M2VA 1A8EA 1FTOA 4RK9A 2B3BA 5F7VA 2P1SA 2XXPA 1FSAA 2ZYNA 4U1ZA 4FECA 3RUMA 4AB6A 1NV1A 3TTKA 1M5BA 2A5SA 1LBXA 2GFEA 1RYOA 1R9QA 1Q1KA 2I4CA 1FPEA 1OQHA 3FZVA 4OYVA 3FV1A 1IMBA 4FBPA 4MCOA 1FQDA 1MXXA 1FQEA 1PBPA 4O3AA 2RINA 1TWYA 3Q28A 3O28A 1B3FA 4TOZA 4GL8A 1MM6A 4GOTA 5ITOA 4JXIA 1PEBA 3IOWA 1NV3A 3TAJA 1EYJA 4H67A 3QMFA 1LFGA 4G68B 4G68A 2F7AA 3T9VA 1LAHE 4IO6A 4ELOA 4KD5A 1SW5A 1LFHA 3E13X 1B7UA 4YB7A 1M5FA 5AA2D 4OETA 2JJKA 3WAFA 2P2AA 1NUWA 5DEXB 5CM6A 3BBRA 2P3VA 5DEXA 1FW0A 4BLAA 2XXQA 2CZIA 2ESNA 1FQFA 2UYEA 1MXVA 4IO7A 4XKNA 4PGNA 2XXHA 2GQ1A 3R7XA 2CZKA 3IR1A 4PETA 4RPOA 4AQ4A 3K6XA 5LDZA 3USDA 1H43A 3PAMA 4TLMB 2FA7A 4QFOA 2PCRA 2KQZA 4NWDA 4C1UA 2ZNTA 1P1WA 1SW2A 2HXRA 3LSFB 5ELVA 3GZGA 3CG1A 5CBRA 5F24A 2ZNUA 3IB0A 2PFYA 3OSQA 2Z8FA 1IUDA 4JVCA 5IZ1A 1JW1A 4KCDA 4XF5A 1MS7A 2X26A 3KFMA 3C36A 4OWDA 2O7UA 4DDDA 3TTMA 5IGAA 3A3CA 5FTHA 1XVYA 2Q8JA 2I48A 1YPNA 1LAXA 4F1VA 2Z8EA 3FXBA 1GTKA 4R6HA 4NMYA 5EYHA 3C31A 2F8DA 2ZXTA 4LQ5A 2H25A 2ZYMA 5ITPA 3PPPA 1L5TA 1G0HA 2B65A 4YKIA 1SVXB 5ET7A 1LBWA 1D9YA 4MIJA 1NNTA 3MWBA 4OA4A 4IY5A 1O7TA 4POXA 1LFIA 1NNKA 3Q27A 3T66A 4N91A 4YKPA 5BUUA 5ET6A 3IJOB 3N6UA 1FBPA 2QJEA 3E78A 3GBAA 4P9KA 5H8HB 1A40A 3MVYA 5H8HA 1H44A 3IOTA 4F22A 4GX4A 3OEKA 3IFCA 3SEXA 5L9SA 1SI0A 2UVIA 4U22A 4OVTA 1Q9DA 3IB2A 1MXYA 2WOKA 2B4MA 3SDFA 2OWSA 3VVDA 4H6DA 3MBPA 1MPDA 4F3PA 3LV0A 3H6WA 1I69A 3TPAA 4POWA 2Y5LA 5FHMA 3FXUA 4E0WA 3A3UA 1Z7ME 3ZKKA 1MXZA 1KA0A 1FBDA 3FIRA 1M5CA 3FD3A 4XKPA 3KJTA 1N0TA 2WOLA 3C34A 1MH4A 3ZS6A 3HN0A 3KN8A 4N07A 2ABHA 2F34A 2A5TB 1VE4A 4OHNA 1B5JA 4LA9A 2QS4A 4NN3A 2A5TA 4PQJA 3E9XA 3EKIA 1PB9A 2DQVA 5EYGA 1DTGA 4ZECA 4GWWA 3OENA 1B7ZA 3SZPA 4X9TA 1MRPA
chains in the Genus database with same CATH topology
5ISUA 4ZEBA 1B46A 4PBHA 2WEFA 1ZU0A 1FPKA 2DE4A 2QVUA 2WBDA 4GWYA 1AWBA 1SPIA 4N81A 3T1BA 2F5XA 1NV7A 3IFAA 4F1UA 2RKMA 3RYBA 1VR5A 4LN5A 2V4CA 5KZTA 1B3HA 1QGXA 3FTOA 3DP8A 3DRJA 4PC9A 1NI9A 4X8RA 1ZTYA 2Q74A 1B05A 4MEVA 5ICQA 2KR0A 2Z23A 3MVWA 5HM4B 4PFBA 4P8BA 1JP4A 2VPNA 3A29A 3W9WA 3RYAA 3MSTA 4N8GA 4MNPA 2VPOA 2Q9TA 3KC0A 1RDYA 2QVVA 4N6KA 5JK4A 2WBBA 3T0JA 4O94A 5ESYA 2DDKA 2MKZA 4QFPA 1FJ9A 2Y5KA 4GF8A 3W9VA 1B5IA 3ISPA 1B9JA 1OLAA 2DE2A 4QBAA 4JSOA 4MJOA 4MHFA 3RYDA 4KXPA 3MVZA 2GRVA 3RPLB 3RPLA 3TCHA 1B3LA 1XI6A 5IZ3B 4PFWA 5IZ3A 1IMEA 2HPGA 4FAJA 3MW0A 4GWZA 4NG7A 4JVDA 1BK4A 1B51A 1B7HA 3E3KA 1FBGA 1FPLA 3B8BA 2V3QA 2OX3A 5LTCA 5I7IA 4F19A 2XA5A 4N4UA 3DRKA 1RDXA 4XFEA 2PFZA 1NV0A 1NUXA 4GX3A 3O6PA 4DCXA 1VDWA 1LBZA 4ONYA 2VT5A 3MZBA 1FBHA 3BIHA 2DE3A 1JETA 3LUZA 4OFJA 4OVRA 4NQ8A 4QFNA 4NF0A 3DRIA 4RA1A 4JVIA 1XOCA 3HFUA 3QIMA 1ZLQA 4AS4A 4QFKA 3PTYA 4QXDA 4PF8A 2L5VA 1B5HA 5I3SA 5A5LA 4PFTA 5F1QA 1KZ8A 4XKQA 1YXIA 2CEYA 4I40A 4NGUA 4HCYA 2FIEA 1IMAA 4GWUA 1FBCA 2BJIA 2FBPA 4PGPA 1OLCA 1B1HA 4NX1A 1FPIA 1FSAA 2WYPA 1NV1A 2FHYA 4P56A 2XWIA 1LBXA 1FPFA 2HZKA 3TCFA 1DPEA 4PFUA 4ZEKA 4OERA 4NHBA 4OANA 4ZEDA 5EQ8A 2F3DA 1FPEA 3D1RA 1JEVA 3ROJA 2CEXA 4ZE8A 1IMBA 4FBPA 4MCOA 4YICA 3MYUA 4PBQA 5J1DA 1FPBA 4OEUA 4I9DA 4OEVA 1B3FA 1NV4A 4N17A 1JEUA 4TOZA 4GL8A 1FBFA 1NV3A 2WYKA 4WEDA 2NOOA 1EYJA 3LVUA 3QMFA 3MVXA 4I3YA 4MNCA 5FBPA 4MX6A 1UIVA 1LBVA 4M1VA 1FBEA 2WOPA 4OETA 2JJKA 1NV5A 3RY3A 4MNIA 1NUWA 4PDHA 2Q8MA 5CM6A 2P3VA 4HXVA 1FJ6A 1IMDA 3FBPA 2CZIA 3DRGA 5I5PA 1QKBA 4JSDA 4G61A 1B58A 4DCYA 4P1LA 3DRHA 4XKNA 2CZHA 4PGNA 1EYIA 1NV6A 2GQ1A 2XWVA 2CZKA 4PETA 3CHGA 5LDZA 4HE2A 4P3LA 4AS5A 3PAMA 4PCDA 4QFOA 2PCRA 2KQZA 4GBWA 1EYKA 4P1EA 2HXRA 4UABA 2O7IA 4I3EA 4X04A 5F24A 4N8YA 2FVZA 3I5OA 3BIGA 2PFYA 4P47A 4GFRA 1K9ZA 1B40A 1YYZA 1FTAA 4JVCA 5IZ1A 4OVSA 1FPJA 2B4LA 4NAPA 4PE3A 5ET5A 4XKRA 2XWKA 4ZEIA 1D9QA 3E79A 4XF5A 4XEQA 2R8TA 1LEVA 4O7IA 2ZZXA 2QPQA 4H45A 5DW8A 5IGAA 1IMFA 4OESA 1YZ0A 4N15A 4PDDA 4PF6A 4OFOA 4O8MA 3M8UA 1RDZA 4F1VA 3KC1A 3FXBA 1KA1A 1B4ZA 5EQAA 2WX9A 3GYYA 5EYHA 3DRFA 4PFRA 5EQ7A 2D5WA 4DI3D 4HE1A 1CNQA 4OVQA 1RKMA 2OLBA 2F3BA 5IM2A 1G0HA 2XWOA 2DVZA 4OFLA 5J16A 5ET7A 1LBWA 3B50A 1UQWA 5T3JA 1DBZA 2HHMA 4MIJA 1UIUA 4F18A 4OA4A 1DCUA 1NUZA 4PAFA 3T66A 4N91A 5ET6A 4PAIA 1FBPA 3E78A 4IR8A 4P9KA 3MVYA 3MZ9A 4PFIA 4GX4A 3IFCA 4MAGA 2HZLA 1DPPA 4PTKA 1B6HA 3O9PA 4GWXA 4H46A 4OVTA 1Q9DA 2QVRA 2WOKA 1FPDA 1IMCA 3TCGA 2B4MA 1B2HA 2ZZVA 2P3NA 4MMPA 3LV0A 1B4HA 5L8DA 5IZZA 1FRPA 3RQTA 1K9YA 3TPAA 4DI4B 2XXKA 2Y5LA 1INPA 2OWZA 4I8CA 1B32A 4GX6A 1NUYA 1B3GA 1DK4A 5EQ9A 2ZZWA 1KA0A 1G0IA 1FBDA 1QKAA 4XKPA 3KBZA 4QFLA 2WOLA 4GBVA 2FIXA 4HE0A 1NV2A 3U65A 4GWSA 3ZS6A 4PFYA 4YZZA 1B5JA 4NN3A 4O7MA 1B52A 1B0HA 4OVPA 3NOHA 4N6DA 3EKIA 4HCWA 1FPGA 5ET8A 5EYGA 4ZE9A 4GWWA 4ZECA 1LBYA 2QFLA 4PAKA 3SZPA 4X9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ISU A;  2WOP A;  4OET A;  1B46 A;  4ZEB A;  3RY3 A;  1ZU0 A;  4OFL A;  1JET A;  4OFJ A;  4QFN A;  1UQW A;  1UIU A;  3DRI A;  4RA1 A;  1XOC A;  3QIM A;  3DRG A;  2RKM A;  1ZLQ A;  3RYB A;  4QFK A;  1VR5 A;  3T66 A;  5KZT A;  1B3H A;  1QKB A;  4JSD A;  3FTO A;  3DP8 A;  3DRJ A;  1B58 A;  4DCY A;  1B5H A;  1ZTY A;  3DRH A;  4PFT A;  4XKN A;  5F1Q A;  1B05 A;  4XKQ A;  3MVY A;  3MZ9 A;  5ICQ A;  3CHG A;  2Z23 A;  3MVW A;  5HM4 B;  3PAM A;  1DPP A;  4QFO A;  1B6H A;  3RYA A;  1OLC A;  3O9P A;  1B1H A;  2WOK A;  2O7I A;  3TCG A;  2B4M A;  1B2H A;  3I5O A;  4QFP A;  4GFR A;  3TCF A;  1B4H A;  1DPE A;  4PFU A;  4ZEK A;  1B40 A;  4GF8 A;  5L8D A;  4OER A;  1B5I A;  1B9J A;  3RQT A;  4ZED A;  1OLA A;  3TPA A;  4JSO A;  1JEV A;  2B4L A;  4I8C A;  1B32 A;  3MVZ A;  4XKR A;  2GRV A;  4ZE8 A;  4ZEI A;  1B3G A;  3TCH A;  1B3L A;  4OEU A;  4I9D A;  1QKA A;  4PFW A;  4OEV A;  1B3F A;  4XKP A;  1JEU A;  4FAJ A;  4TOZ A;  4GL8 A;  3MW0 A;  4QFL A;  4OES A;  2WOL A;  1B51 A;  1B7H A;  3E3K A;  4WED A;  2NOO A;  3ZS6 A;  4PFY A;  3LVU A;  4OFO A;  3M8U A;  3MVX A;  1B5J A;  1B4Z A;  3DRK A;  1B52 A;  1B0H A;  3DRF A;  2D5W A;  3O6P A;  4DCX A;  4ZE9 A;  1RKM A;  1UIV A;  2OLB A;  4ONY A;  4ZEC A;  3MZB A; 
#chains in the Genus database with same CATH topology
 3QYT A;  4ZEB A;  2WEF A;  3TZA A;  1HSE A;  3QAX A;  4Q5T A;  2DE4 A;  3S9N C;  4FED A;  4GWY A;  2QMW A;  5H8Q B;  4KHZ E;  2F5X A;  4G8H A;  3IFA A;  4F1U A;  3RYB A;  1A8F A;  3V5A A;  3CFL A;  4LN5 A;  5KZT A;  1QGX A;  3OSR A;  3DP8 A;  3DRJ A;  2Q2A A;  5B7D A;  5KCJ A;  1SQY A;  2KR0 A;  5KDT B;  4QSC A;  1JP4 A;  2I6E A;  2VPN A;  3QUF A;  3W9W A;  4MNP A;  2VPO A;  4YMB A;  2FYI A;  2QVV A;  3VVF A;  4U2R A;  2G29 A;  3FJG A;  2RC7 A;  2DDK A;  2F6G A;  4R72 A;  4QFP A;  2Z8D A;  3D4C A;  3HST A;  2AIX A;  4LON B;  3W9V A;  4H8I A;  1FTL A;  5CI5 A;  3MVZ A;  3C4M A;  3G3K A;  1LGB C;  2V84 A;  1XI6 A;  3FAS A;  4P11 A;  2CZL A;  1IME A;  4FAJ A;  4U23 A;  2ANJ A;  4GWZ A;  4GQO A;  1B51 A;  4YMA A;  1FPL A;  1SW4 A;  1N3X A;  3B8B A;  3PV0 E;  1POT A;  1MY4 A;  4FJP A;  2D21 A;  1RDX A;  4OXV A;  1H76 A;  3U94 A;  1LCF A;  1NUX A;  3GXA A;  3O6P A;  4DCX A;  3PUW E;  5IAI A;  4M4G A;  4XXU A;  3VE1 B;  4QF9 A;  3KEI A;  5AA1 A;  3SEW A;  3H6U A;  3BIH A;  1IQ7 A;  2DE3 A;  1JET A;  4OVR A;  4P0G A;  3I6V A;  4G8N A;  1HSL A;  4KCC A;  4DE8 A;  3EHU A;  4KI0 E;  1XOC A;  4IY6 A;  4QHQ A;  4AS4 A;  1LBC A;  3VV5 A;  1ZBM A;  2RC9 A;  3DEL B;  2H4I A;  3BFU A;  4HW8 A;  4F39 A;  1D3K A;  4ECF A;  3D4G A;  1KZ8 A;  5TP9 B;  4XKQ A;  1YXI A;  2CEY A;  4ZS9 A;  5TP9 A;  1ZMG A;  2NWJ A;  4HCY A;  1Y3P A;  4LQ2 A;  2BJI A;  4PGP A;  1OLC A;  4G4P A;  3VLV A;  4F3S A;  1MPB A;  2F78 A;  4KFQ A;  3S4U A;  3U72 A;  2FHY A;  1B3E A;  2XWI A;  1FPF A;  3VXC A;  3QSL A;  1DPE A;  4PFU A;  4OER A;  2V93 A;  1BLF A;  4OAN A;  5EQ8 A;  3TEL A;  3DLN A;  3D1R A;  4I62 A;  5J1D A;  2QL3 A;  3T96 B;  1QUL A;  4OEU A;  5DVF A;  3MP8 A;  4LZ7 A;  4OEV A;  2I3W A;  5I57 B;  1I6B A;  2AL5 A;  5I57 A;  2WYK A;  1PDA A;  2F7C A;  3CSB A;  4YKK A;  3MVX A;  4YAH X;  1POY 1;  4ELQ A;  4C1T A;  1N7X A;  3EHT A;  3G3J A;  3G3F A;  3G7W A;  1UIV A;  2XXT A;  5K2X A;  3LR1 A;  1FBE A;  2THI A;  4NF5 B;  1UTH B;  3RY3 A;  4MNI A;  4H0W A;  1URD A;  2Q8M A;  4U4X A;  3FV2 A;  4YKJ A;  3QXM A;  2OK2 A;  4IB2 A;  5I5P A;  2DWA A;  1QKB A;  4JSD A;  3EN3 A;  1TFD A;  4OEN A;  4DCY A;  4P1L A;  1EYI A;  1NV6 A;  1JNF A;  2XWV A;  3B6T A;  4Q30 B;  5CMK A;  3FVN A;  4HE2 A;  4AS5 A;  1IEJ A;  3H03 A;  2W7Y A;  4JWX A;  4DIG A;  3ZKL A;  1SW1 A;  3V89 B;  1MQD A;  4IO2 A;  4HTG A;  5FHN A;  4UAB A;  2O7I A;  1OQG A;  4KYD A;  4LP2 B;  4BDR A;  4N8Y A;  3I5O A;  3O6I A;  1TFA A;  4F3B A;  4BDM A;  4OTE A;  3OMB A;  1EZ9 A;  2ONR A;  2B4L A;  3KN3 A;  5ET5 A;  3L6H A;  3E79 A;  3FJM A;  4GL0 A;  4XEQ A;  2PYY A;  4O7I A;  1J1N A;  2VD2 A;  3KBR A;  4H5F A;  3K4U A;  1US5 A;  3MJN A;  1IMF A;  4RXL A;  3FVG A;  3JV9 A;  1UTB B;  1A99 A;  1P1N A;  1UTB A;  1PB8 A;  3E4R A;  4WKM A;  1LBB A;  2RF1 A;  3M8U A;  3T9U A;  3KC1 A;  3RT6 B;  1B4Z A;  5EQA A;  1BIY A;  3KSJ A;  4G2Z A;  4PFR A;  3PGF A;  2D5W A;  3HCQ A;  3EQ1 A;  4HE1 A;  1MDQ A;  4GD5 A;  1WOD A;  2PX1 A;  2F3B A;  4OFL A;  1MPC A;  4GLI A;  2V3T A;  1FTK A;  4ZZA A;  1DBZ A;  1GR2 A;  3O66 A;  4U4S A;  2V25 A;  4F18 A;  5AA4 B;  1DTZ A;  1LAG E;  1NUZ A;  5AA4 A;  4MLQ A;  3H3G A;  5EHS A;  3RGY A;  4ZZE A;  1S9T A;  3TOD A;  5AE4 A;  1EZP A;  4GWX A;  4PE5 B;  2QVR A;  4F29 A;  2UVH A;  3TYH A;  2UYF A;  4KYE A;  3Q26 A;  2P3N A;  1N84 A;  4MMP A;  1B4H A;  5L8D A;  4OZ9 A;  3TTN A;  3T22 A;  2XXK A;  3LSL A;  1INP A;  3N6T A;  2OWZ A;  4I8C A;  3ONM A;  3C35 A;  1DK4 A;  2ZZW A;  5JTY B;  2OCU A;  4QSE A;  1XT8 A;  2HXW A;  5JTY A;  3KZG A;  3PMX A;  1QKA A;  1AOV A;  3A09 A;  1SBP A;  4HS7 A;  3KOT A;  4HE0 A;  5I59 B;  4PFY A;  1LB9 A;  2CMO A;  4THI A;  4R74 A;  5I56 B;  4O7M A;  1MDP 1;  2YLN A;  5I56 A;  1MQI A;  4FOR A;  1LB8 A;  3NOH A;  3IOV A;  4R75 A;  1LST A;  1Y9U A;  3KG2 A;  3HHG A;  1GGG A;  3MP6 A;  1B46 A;  3O97 A;  1P1Q A;  4LZ8 A;  5JEI A;  5HBC A;  2HAV A;  1XVX A;  4DXB A;  2UVG A;  1A7L A;  1VR5 A;  3K6W A;  2V4C A;  4O3C A;  2F6P A;  1JW4 A;  3MAM A;  3CR9 A;  4PC9 A;  2G93 A;  2XX8 A;  4X8R A;  2E0S A;  2Q74 A;  5K2Y A;  4MEV A;  2VP1 A;  2F97 A;  4BDN A;  4MH5 A;  5TPA B;  5ICQ A;  2Z23 A;  5TPA A;  1P99 A;  1O63 A;  2H9B A;  2QS1 A;  3RYA A;  3LC8 A;  3MST A;  2Q9T A;  3KC0 A;  4Z0I A;  3K0V A;  2F7B A;  2VOZ A;  1YCJ A;  5ESY A;  4EF1 A;  4KQP A;  3MPK A;  3KOS A;  1FJ9 A;  1PB7 A;  1ELJ A;  5CRY A;  4Z7E A;  1SYI A;  1B5I A;  1B9J A;  1OLA A;  2DE2 A;  4QBA A;  3MPL A;  2ZYO A;  2DWJ A;  4H65 A;  4MHF A;  1VFE A;  3RLF E;  2XXV A;  3GLB A;  1LAF E;  3RPL B;  3HO7 A;  1N04 A;  3RPL A;  3U1O A;  1B3L A;  4TLL B;  3FUZ A;  2Y7P A;  5IZ3 B;  3HPI A;  5IZ3 A;  2UXA A;  2YPN A;  1IIW A;  3MW0 A;  4NG7 A;  3TKD A;  1URS A;  3E3K A;  2R9J A;  3Q25 A;  3UA8 A;  2V3Q A;  2OX3 A;  3TTR A;  1QVS A;  1B0L A;  2XA5 A;  4N4U A;  2YJP A;  4NTL A;  4GX3 A;  1IIT A;  1H3D A;  3PMW A;  1LBZ A;  1R1N A;  4ONY A;  3C9H A;  3K01 A;  5H8N B;  1VFD A;  4IGR A;  1FQC A;  3KGC A;  3PPQ A;  1FTM A;  4NQ8 A;  4RA1 A;  4EXL A;  3QIM A;  3O29 A;  4RJZ A;  2NUV A;  1GVC A;  4LVQ A;  4QXD A;  1PC3 A;  2L5V A;  1B5H A;  2VHA A;  5A5L A;  3C33 A;  1EU8 A;  4NGU A;  2I3V A;  3PD9 A;  1IMA A;  1WVJ A;  2XXW A;  2FBP A;  3UGW A;  5H8Q A;  4ISU A;  4NX1 A;  2XXI A;  4F2Q A;  2AYS A;  2GHB A;  2WYP A;  2QSX A;  3T93 B;  3CRB A;  3RPW A;  3T9X B;  5DTB A;  3KJ7 A;  3CG3 A;  3BKI B;  4NF8 B;  4NHB A;  4NF8 A;  3TEP A;  3IB1 A;  3QK6 A;  2F3D A;  3QUJ A;  3ROJ A;  3PU5 A;  5KDT A;  4ZE8 A;  4YIC A;  3B7D A;  1FPB A;  2NXO A;  4RYA A;  3CSG A;  3V8X B;  1LLS A;  2IEE A;  1PBQ A;  5FTI A;  5L9M A;  1TT1 A;  1M5D A;  1AMF A;  4FE8 A;  1USY H;  5DYH A;  4WED A;  5LOM A;  3FVO A;  3ODB A;  4MNC A;  3R6U A;  3EHS A;  3OO9 A;  4Q8R A;  3S9E A;  5FBP A;  1HSJ A;  4MX6 A;  1LBV A;  1I6A A;  3B6W A;  4M1V A;  2WOP A;  2KLF A;  3S2V A;  1NV5 A;  4GWO A;  1BKA A;  2VD3 A;  2HQ0 A;  1XS5 A;  2HFB A;  2QRY A;  2ZMB A;  2UVJ A;  3FBP A;  4EF2 A;  4JBZ A;  3TQW A;  1P1O A;  3OXN A;  2QS2 A;  3PD8 A;  2O51 A;  1B58 A;  1NNF A;  3SEY A;  5DVI A;  3DP4 A;  2RCA A;  2XXR A;  2NVU B;  2X7Q A;  4P3L A;  3SEU A;  4PCD A;  4NF4 B;  2PT1 A;  4GBW A;  3G3I A;  4RY1 A;  1NL5 A;  3IX1 A;  1OMP A;  3VXB A;  4QSD A;  4RNS A;  3BIG A;  4ESX A;  1K9Z A;  1B40 A;  3N26 A;  3G3G A;  1FTA A;  3UP9 A;  3IOU A;  1AIV A;  1FPJ A;  4UA8 A;  4PE3 A;  2PT2 A;  3JYR A;  4NAP A;  1XHY A;  4R9F A;  4XKR A;  4ZEI A;  2HCA A;  2R8T A;  1LEV A;  4G68 C;  4IGT A;  1AL3 A;  1I6Q A;  1N76 A;  4H45 A;  1BTJ A;  5DW8 A;  3ILT B;  3K1M A;  4OQO A;  4H1X A;  4OES A;  1YZ0 A;  1R9L A;  4N15 A;  4PDD A;  4PF6 A;  1VSO A;  3GBB A;  1QUI A;  1RDZ A;  4GIZ A;  2PBW A;  5EYF A;  1KA1 A;  4F1Y A;  5TU0 A;  3GYY A;  1FCK A;  1F9B A;  1CNQ A;  1NMU A;  4OVQ A;  4MF3 A;  3G3H A;  5IM2 A;  2XXU A;  3MP1 A;  2REJ A;  2XWO A;  3CI8 A;  5CMC A;  2DVZ A;  2I49 A;  5J16 A;  1YTV A;  3H6V A;  2P0S A;  1UQW A;  3N94 A;  2HHM A;  1UIU A;  1N3W A;  2QS3 A;  4PAF A;  5CBS A;  3L6G A;  1JVX A;  1MY1 A;  3LSX A;  1D9V A;  1IXG A;  2Y7K A;  3MZ9 A;  3K2D A;  3M3L A;  4NF5 A;  1UTH A;  4R2F A;  4BDO A;  2HZL A;  4PTK A;  1B6H A;  1ZIU A;  3IL1 B;  4EQ7 A;  2OBG A;  3O9P A;  5EHM A;  1FPD A;  3TCG A;  2ZZV A;  1B2H A;  2O1M A;  1MXU A;  3IOR A;  3JZJ A;  3ILU B;  4WXJ A;  4L17 A;  1FRP A;  3RQT A;  1K9Y A;  3FVK A;  4EXK A;  4DI4 B;  1Y3Q A;  3UK4 A;  3FAT A;  3FGS A;  4GX6 A;  3VLW A;  1NUY A;  1B3G A;  1XC1 A;  5FHO A;  1G0I A;  2Q2C A;  3TMG A;  1A55 A;  4G77 A;  4EUO A;  1P1U A;  1NKX A;  3KBZ A;  5I2N B;  4GBV A;  5I2N A;  1NV2 A;  3IJX B;  4GWS A;  4ND9 A;  2RC8 A;  4YZZ A;  4GXA A;  3KN7 A;  3TTL A;  1II5 A;  4N6D A;  3VFJ A;  4HCW A;  4ZE9 A;  2O6A A;  3TUS A;  1LBY A;  4NF6 B;  4PAK A;  3M3K A;  3CIJ A;  1QW0 A;  4NF6 A;  2I0B A;  4EQ9 A;  5HPQ A;  1FPK A;  1O64 A;  2QVU A;  2PMS A;  2WBD A;  3V83 A;  1AWB A;  1SPI A;  4N81 A;  4LUB A;  3T1B A;  4FAT A;  4XTC Q;  1NV7 A;  3S9L C;  2RKM A;  3W15 C;  1DSN A;  3FTO A;  3MC2 A;  2H99 A;  1NI9 A;  3SKP A;  1ZTY A;  1B05 A;  1MG1 A;  1NFT A;  3O2A A;  3PUZ E;  3MVW A;  2B3F A;  5HM4 B;  4P8B A;  4N13 A;  2R71 A;  1MY2 A;  4N8G A;  4F31 B;  4MBP A;  2Q89 A;  5A5X B;  2WKY A;  1NH7 A;  1MQJ A;  3CFX A;  5A5X A;  3Q29 A;  2WBB A;  4O94 A;  4KYS A;  2DSF A;  2MKZ A;  5DVJ A;  3OOA A;  3R26 A;  3K1N A;  3HV1 A;  4MJO A;  1MH3 A;  3LBS A;  2GRV A;  1ZJL A;  2O1L A;  3OO6 A;  3IK6 B;  3O6G A;  4ZDM A;  1RYX A;  3MZ1 A;  2HPG A;  4R73 A;  4JVD A;  1B7H A;  4AB5 A;  3H7M A;  4WEP A;  1IZ1 A;  5LTC A;  1FQB A;  4R9G A;  2PFZ A;  1NV0 A;  3OD7 A;  5CMM A;  4ESW A;  3K6V A;  2DOJ A;  3UN6 A;  2HEU A;  4OMB A;  3M3F A;  1FBH A;  2H5Y A;  1MQG A;  3RT8 A;  4OFJ A;  1CB6 A;  2LAO A;  3VLU A;  5I59 A;  4NF0 A;  1SYH A;  2FNC A;  1ZLQ A;  4JDF A;  3PTY A;  1SD3 A;  1S7Y A;  4DLD A;  5F1Q A;  3K00 A;  3MQ9 A;  1Y4C A;  1FBC A;  2I4B A;  4YU0 A;  5L9O A;  1Y20 A;  1B1H A;  4K3F A;  1FPI A;  3HHF A;  5B70 A;  4P56 A;  4PP0 A;  4LZ5 A;  3WAE A;  2HZK A;  3TCF A;  3FXQ A;  4DZ1 A;  3BFT A;  4ZEK A;  2ZNS A;  1URG A;  3PUX E;  4ZED A;  2GH9 A;  2AL4 A;  1JEV A;  3CFZ A;  4R6Y A;  4YB6 A;  2CEX A;  3K02 A;  3MYU A;  3P7I A;  4PBQ A;  3RNN A;  4DXC A;  2I0C A;  4P0I A;  3SES A;  3PUV E;  4I9D A;  4ELR A;  3ECR A;  1NV4 A;  4N17 A;  4UAC A;  1JEU A;  1FBF A;  4JWO A;  3VVE A;  4GVO A;  2NOO A;  3LVU A;  2XD3 A;  2OJT A;  3DP6 A;  2D3I A;  4I3Y A;  2DS9 A;  5ICT A;  4RK2 A;  3FJ7 A;  4E0X A;  3F11 A;  1ANF A;  2Y7I A;  5IKB A;  2I58 A;  3PPR A;  3OO8 A;  2M8C A;  4MFI A;  4TQU Q;  4PDH A;  4EQB A;  1ZKB A;  4HXV A;  2DYX A;  2DXY A;  4N6P A;  1FJ6 A;  1IMD A;  4GRK A;  3DRG A;  1WDN A;  4G61 A;  1USY E;  3DRH A;  1LCT A;  2CZH A;  1CE2 A;  4U21 A;  3CHG A;  1FQA A;  1QUJ A;  5H8N A;  1EZO A;  4U1O A;  1EYK A;  4P1E A;  3OEM A;  4NE4 A;  5I2K B;  4IO5 A;  5I2K A;  4I3E A;  4X04 A;  2O84 X;  2FVZ A;  4X48 A;  4P47 A;  4GFR A;  3UOR A;  2R6G E;  1MM7 A;  1YYZ A;  3I3V A;  4OVS A;  4OVJ A;  2F35 A;  1Y4T A;  1JW5 A;  2XWK A;  3OO7 A;  3C32 A;  3U92 A;  1B1X A;  1D9Q A;  3RN8 A;  2F36 A;  2REG A;  5I58 B;  3EF7 A;  5I58 A;  2ZZX A;  2QPQ A;  1Y3N A;  1Y1Z A;  1AH5 A;  1OIB A;  4DXU A;  4QRZ A;  1T0K A;  4OFO A;  3MUQ A;  4O8M A;  4BDQ A;  3PUY E;  2WX9 A;  3PPO A;  3DRF A;  5EQ7 A;  3SET A;  4DI3 D;  2Z22 A;  5KCJ B;  1RKM A;  2OLB A;  3TDJ A;  3H4Z A;  3SER A;  1MXW A;  4F3G A;  3B50 A;  5H8S A;  5T3J A;  3RTF B;  4FIM A;  1DCU A;  5I84 A;  3THI A;  2RCB A;  4PAI A;  2Y7W A;  2OWT A;  4IR8 A;  1R6Z A;  4PFI A;  1OVB A;  3IO4 A;  5H8F B;  4MAG A;  1DOT A;  1SI1 A;  1DPP A;  5H8F A;  4H46 A;  4ELP A;  2Y7R A;  4EDP A;  2XXY A;  5CC2 A;  1IMC A;  2XX7 A;  4X1B A;  3LUY A;  3RTW B;  3TQL A;  5IZZ A;  2DP8 A;  3VDF A;  3KSX A;  1A54 A;  1B32 A;  3B6Q A;  1Z7N E;  4I1D A;  1D4N A;  4NF4 A;  3K6U A;  5EQ9 A;  4Q0C A;  4NWC A;  4R2B A;  1EH3 A;  1M5E A;  3H06 B;  4ZEF A;  1SDX A;  4QFL A;  2FIX A;  1TXF A;  3UIF A;  3U65 A;  1NNP A;  5DT6 A;  3T9H B;  3LSW A;  2XX9 A;  1KWH A;  4O3B A;  1B52 A;  4KPT A;  2X7P A;  1B0H A;  4OVP A;  3U93 A;  2QMX A;  1S50 A;  2XD2 A;  2ONK E;  1FPG A;  5ET8 A;  2IA4 A;  2QFL A;  5ISU A;  4PBH A;  2ONS A;  1ZU0 A;  4JWY A;  4F2O A;  2E1S A;  2DWI A;  1MY3 A;  3OEL A;  3EPE A;  3ZSF A;  1B3H A;  2V3U A;  5CMB A;  4NED A;  4X1D A;  2DWH A;  2ZYK A;  3N5L A;  2Q88 A;  3PPN A;  4JB7 A;  4H5G A;  5AA3 A;  1IXH A;  3H6T A;  3K1P A;  1NH8 A;  4PFB A;  3S9M C;  3A29 A;  5AA2 B;  5AA2 A;  2GHA A;  1ATG A;  1DMB A;  1RDY A;  4N6K A;  2Y84 A;  4YB5 A;  3IO6 A;  2PVU A;  5JK4 A;  3T0J A;  1IXI A;  2BJJ X;  1MQH A;  1OVT A;  2Y5K A;  4GF8 A;  3ISP A;  3U8Q A;  3DM0 A;  4H8J A;  4JSO A;  2HAU A;  4MLV A;  2XHD A;  3RYD A;  4KXP A;  4XIG Q;  4G8M A;  5BWJ A;  1YAE A;  2DXR A;  3TCH A;  1IXC A;  1FTJ A;  4IO4 A;  4PFW A;  2ALU A;  3TFL A;  2XXX A;  4C0R A;  3IAZ A;  4R6K A;  1QUK A;  1US4 A;  1BK4 A;  1FBG A;  1Q35 A;  4RPN A;  2OZZ A;  2O69 A;  1MY0 A;  1JQF A;  5I7I A;  4F19 A;  3DRK A;  1QJM A;  4KR5 A;  2VGQ A;  1N7W A;  4XFE A;  3SEV A;  1H45 A;  4GXS B;  2O68 A;  1VDW A;  2VT5 A;  3MZB A;  4FEB A;  3FXR A;  3LUZ A;  4QFN A;  3PMV A;  4LAT A;  2H98 A;  3DRI A;  4JVI A;  4BDL A;  3HFU A;  4IO3 A;  4QFK A;  1BP5 A;  1GV8 A;  4PF8 A;  5I3S A;  3O6H A;  3CVG A;  4PFT A;  2DVC A;  4I40 A;  1JVY A;  1Y1M A;  2FIE A;  3AXF A;  4GWU A;  5M2V A;  1A8E A;  1FTO A;  4RK9 A;  2B3B A;  5F7V A;  2P1S A;  2XXP A;  1FSA A;  2ZYN A;  4U1Z A;  4FEC A;  3RUM A;  4AB6 A;  1NV1 A;  3TTK A;  1M5B A;  2A5S A;  1LBX A;  2GFE A;  1RYO A;  1R9Q A;  1Q1K A;  2I4C A;  1FPE A;  1OQH A;  3FZV A;  4OYV A;  3FV1 A;  1IMB A;  4FBP A;  4MCO A;  1FQD A;  1MXX A;  1FQE A;  1PBP A;  4O3A A;  2RIN A;  1TWY A;  3Q28 A;  3O28 A;  1B3F A;  4TOZ A;  4GL8 A;  1MM6 A;  4GOT A;  5ITO A;  4JXI A;  1PEB A;  3IOW A;  1NV3 A;  3TAJ A;  1EYJ A;  4H67 A;  3QMF A;  1LFG A;  4G68 B;  4G68 A;  2F7A A;  3T9V A;  1LAH E;  4IO6 A;  4ELO A;  4KD5 A;  1SW5 A;  1LFH A;  3E13 X;  1B7U A;  4YB7 A;  1M5F A;  5AA2 D;  4OET A;  2JJK A;  3WAF A;  2P2A A;  1NUW A;  5DEX B;  5CM6 A;  3BBR A;  2P3V A;  5DEX A;  1FW0 A;  4BLA A;  2XXQ A;  2CZI A;  2ESN A;  1FQF A;  2UYE A;  1MXV A;  4IO7 A;  4XKN A;  4PGN A;  2XXH A;  2GQ1 A;  3R7X A;  2CZK A;  3IR1 A;  4PET A;  4RPO A;  4AQ4 A;  3K6X A;  5LDZ A;  3USD A;  1H43 A;  3PAM A;  4TLM B;  2FA7 A;  4QFO A;  2PCR A;  2KQZ A;  4NWD A;  4C1U A;  2ZNT A;  1P1W A;  1SW2 A;  2HXR A;  3LSF B;  5ELV A;  3GZG A;  3CG1 A;  5CBR A;  5F24 A;  2ZNU A;  3IB0 A;  2PFY A;  3OSQ A;  2Z8F A;  1IUD A;  4JVC A;  5IZ1 A;  1JW1 A;  4KCD A;  4XF5 A;  1MS7 A;  2X26 A;  3KFM A;  3C36 A;  4OWD A;  2O7U A;  4DDD A;  3TTM A;  5IGA A;  3A3C A;  5FTH A;  1XVY A;  2Q8J A;  2I48 A;  1YPN A;  1LAX A;  4F1V A;  2Z8E A;  3FXB A;  1GTK A;  4R6H A;  4NMY A;  5EYH A;  3C31 A;  2F8D A;  2ZXT A;  4LQ5 A;  2H25 A;  2ZYM A;  5ITP A;  3PPP A;  1L5T A;  1G0H A;  2B65 A;  4YKI A;  1SVX B;  5ET7 A;  1LBW A;  1D9Y A;  4MIJ A;  1NNT A;  3MWB A;  4OA4 A;  4IY5 A;  1O7T A;  4POX A;  1LFI A;  1NNK A;  3Q27 A;  3T66 A;  4N91 A;  4YKP A;  5BUU A;  5ET6 A;  3IJO B;  3N6U A;  1FBP A;  2QJE A;  3E78 A;  3GBA A;  4P9K A;  5H8H B;  1A40 A;  3MVY A;  5H8H A;  1H44 A;  3IOT A;  4F22 A;  4GX4 A;  3OEK A;  3IFC A;  3SEX A;  5L9S A;  1SI0 A;  2UVI A;  4U22 A;  4OVT A;  1Q9D A;  3IB2 A;  1MXY A;  2WOK A;  2B4M A;  3SDF A;  2OWS A;  3VVD A;  4H6D A;  3MBP A;  1MPD A;  4F3P A;  3LV0 A;  3H6W A;  1I69 A;  3TPA A;  4POW A;  2Y5L A;  5FHM A;  3FXU A;  4E0W A;  3A3U A;  1Z7M E;  3ZKK A;  1MXZ A;  1KA0 A;  1FBD A;  3FIR A;  1M5C A;  3FD3 A;  4XKP A;  3KJT A;  1N0T A;  2WOL A;  3C34 A;  1MH4 A;  3ZS6 A;  3HN0 A;  3KN8 A;  4N07 A;  2ABH A;  2F34 A;  2A5T B;  1VE4 A;  4OHN A;  1B5J A;  4LA9 A;  2QS4 A;  4NN3 A;  2A5T A;  4PQJ A;  3E9X A;  3EKI A;  1PB9 A;  2DQV A;  5EYG A;  1DTG A;  4ZEC A;  4GWW A;  3OEN A;  1B7Z A;  3SZP A;  4X9T A;  1MRP A; 
#chains in the Genus database with same CATH homology
 5ISU A;  4ZEB A;  1B46 A;  4PBH A;  2WEF A;  1ZU0 A;  1FPK A;  2DE4 A;  2QVU A;  2WBD A;  4GWY A;  1AWB A;  1SPI A;  4N81 A;  3T1B A;  2F5X A;  1NV7 A;  3IFA A;  4F1U A;  2RKM A;  3RYB A;  1VR5 A;  4LN5 A;  2V4C A;  5KZT A;  1B3H A;  1QGX A;  3FTO A;  3DP8 A;  3DRJ A;  4PC9 A;  1NI9 A;  4X8R A;  1ZTY A;  2Q74 A;  1B05 A;  4MEV A;  5ICQ A;  2KR0 A;  2Z23 A;  3MVW A;  5HM4 B;  4PFB A;  4P8B A;  1JP4 A;  2VPN A;  3A29 A;  3W9W A;  3RYA A;  3MST A;  4N8G A;  4MNP A;  2VPO A;  2Q9T A;  3KC0 A;  1RDY A;  2QVV A;  4N6K A;  5JK4 A;  2WBB A;  3T0J A;  4O94 A;  5ESY A;  2DDK A;  2MKZ A;  4QFP A;  1FJ9 A;  2Y5K A;  4GF8 A;  3W9V A;  1B5I A;  3ISP A;  1B9J A;  1OLA A;  2DE2 A;  4QBA A;  4JSO A;  4MJO A;  4MHF A;  3RYD A;  4KXP A;  3MVZ A;  2GRV A;  3RPL B;  3RPL A;  3TCH A;  1B3L A;  1XI6 A;  5IZ3 B;  4PFW A;  5IZ3 A;  1IME A;  2HPG A;  4FAJ A;  3MW0 A;  4GWZ A;  4NG7 A;  4JVD A;  1BK4 A;  1B51 A;  1B7H A;  3E3K A;  1FBG A;  1FPL A;  3B8B A;  2V3Q A;  2OX3 A;  5LTC A;  5I7I A;  4F19 A;  2XA5 A;  4N4U A;  3DRK A;  1RDX A;  4XFE A;  2PFZ A;  1NV0 A;  1NUX A;  4GX3 A;  3O6P A;  4DCX A;  1VDW A;  1LBZ A;  4ONY A;  2VT5 A;  3MZB A;  1FBH A;  3BIH A;  2DE3 A;  1JET A;  3LUZ A;  4OFJ A;  4OVR A;  4NQ8 A;  4QFN A;  4NF0 A;  3DRI A;  4RA1 A;  4JVI A;  1XOC A;  3HFU A;  3QIM A;  1ZLQ A;  4AS4 A;  4QFK A;  3PTY A;  4QXD A;  4PF8 A;  2L5V A;  1B5H A;  5I3S A;  5A5L A;  4PFT A;  5F1Q A;  1KZ8 A;  4XKQ A;  1YXI A;  2CEY A;  4I40 A;  4NGU A;  4HCY A;  2FIE A;  1IMA A;  4GWU A;  1FBC A;  2BJI A;  2FBP A;  4PGP A;  1OLC A;  1B1H A;  4NX1 A;  1FPI A;  1FSA A;  2WYP A;  1NV1 A;  2FHY A;  4P56 A;  2XWI A;  1LBX A;  1FPF A;  2HZK A;  3TCF A;  1DPE A;  4PFU A;  4ZEK A;  4OER A;  4NHB A;  4OAN A;  4ZED A;  5EQ8 A;  2F3D A;  1FPE A;  3D1R A;  1JEV A;  3ROJ A;  2CEX A;  4ZE8 A;  1IMB A;  4FBP A;  4MCO A;  4YIC A;  3MYU A;  4PBQ A;  5J1D A;  1FPB A;  4OEU A;  4I9D A;  4OEV A;  1B3F A;  1NV4 A;  4N17 A;  1JEU A;  4TOZ A;  4GL8 A;  1FBF A;  1NV3 A;  2WYK A;  4WED A;  2NOO A;  1EYJ A;  3LVU A;  3QMF A;  3MVX A;  4I3Y A;  4MNC A;  5FBP A;  4MX6 A;  1UIV A;  1LBV A;  4M1V A;  1FBE A;  2WOP A;  4OET A;  2JJK A;  1NV5 A;  3RY3 A;  4MNI A;  1NUW A;  4PDH A;  2Q8M A;  5CM6 A;  2P3V A;  4HXV A;  1FJ6 A;  1IMD A;  3FBP A;  2CZI A;  3DRG A;  5I5P A;  1QKB A;  4JSD A;  4G61 A;  1B58 A;  4DCY A;  4P1L A;  3DRH A;  4XKN A;  2CZH A;  4PGN A;  1EYI A;  1NV6 A;  2GQ1 A;  2XWV A;  2CZK A;  4PET A;  3CHG A;  5LDZ A;  4HE2 A;  4P3L A;  4AS5 A;  3PAM A;  4PCD A;  4QFO A;  2PCR A;  2KQZ A;  4GBW A;  1EYK A;  4P1E A;  2HXR A;  4UAB A;  2O7I A;  4I3E A;  4X04 A;  5F24 A;  4N8Y A;  2FVZ A;  3I5O A;  3BIG A;  2PFY A;  4P47 A;  4GFR A;  1K9Z A;  1B40 A;  1YYZ A;  1FTA A;  4JVC A;  5IZ1 A;  4OVS A;  1FPJ A;  2B4L A;  4NAP A;  4PE3 A;  5ET5 A;  4XKR A;  2XWK A;  4ZEI A;  1D9Q A;  3E79 A;  4XF5 A;  4XEQ A;  2R8T A;  1LEV A;  4O7I A;  2ZZX A;  2QPQ A;  4H45 A;  5DW8 A;  5IGA A;  1IMF A;  4OES A;  1YZ0 A;  4N15 A;  4PDD A;  4PF6 A;  4OFO A;  4O8M A;  3M8U A;  1RDZ A;  4F1V A;  3KC1 A;  3FXB A;  1KA1 A;  1B4Z A;  5EQA A;  2WX9 A;  3GYY A;  5EYH A;  3DRF A;  4PFR A;  5EQ7 A;  2D5W A;  4DI3 D;  4HE1 A;  1CNQ A;  4OVQ A;  1RKM A;  2OLB A;  2F3B A;  5IM2 A;  1G0H A;  2XWO A;  2DVZ A;  4OFL A;  5J16 A;  5ET7 A;  1LBW A;  3B50 A;  1UQW A;  5T3J A;  1DBZ A;  2HHM A;  4MIJ A;  1UIU A;  4F18 A;  4OA4 A;  1DCU A;  1NUZ A;  4PAF A;  3T66 A;  4N91 A;  5ET6 A;  4PAI A;  1FBP A;  3E78 A;  4IR8 A;  4P9K A;  3MVY A;  3MZ9 A;  4PFI A;  4GX4 A;  3IFC A;  4MAG A;  2HZL A;  1DPP A;  4PTK A;  1B6H A;  3O9P A;  4GWX A;  4H46 A;  4OVT A;  1Q9D A;  2QVR A;  2WOK A;  1FPD A;  1IMC A;  3TCG A;  2B4M A;  1B2H A;  2ZZV A;  2P3N A;  4MMP A;  3LV0 A;  1B4H A;  5L8D A;  5IZZ A;  1FRP A;  3RQT A;  1K9Y A;  3TPA A;  4DI4 B;  2XXK A;  2Y5L A;  1INP A;  2OWZ A;  4I8C A;  1B32 A;  4GX6 A;  1NUY A;  1B3G A;  1DK4 A;  5EQ9 A;  2ZZW A;  1KA0 A;  1G0I A;  1FBD A;  1QKA A;  4XKP A;  3KBZ A;  4QFL A;  2WOL A;  4GBV A;  2FIX A;  4HE0 A;  1NV2 A;  3U65 A;  4GWS A;  3ZS6 A;  4PFY A;  4YZZ A;  1B5J A;  4NN3 A;  4O7M A;  1B52 A;  1B0H A;  4OVP A;  3NOH A;  4N6D A;  3EKI A;  4HCW A;  1FPG A;  5ET8 A;  5EYG A;  4ZE9 A;  4GWW A;  4ZEC A;  1LBY A;  2QFL A;  4PAK A;  3SZP A;  4X9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...