2B4MA

Crystal structure of the binding protein opuac in complex with proline betaine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
264
Chain Sequence
b'SAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine-binding protein
publication title Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 87
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2b4mA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2b4mA01
1ZLQA 1B5HA 1ZU0A 3RYBA 3MVXA 4OFJA 1OLCA 4JSDA 3QIMA 1UIUA 1DPEA 4TOZA 4ZEBA 3T66A 3DRGA 4ZEDA 3O6PA 3DRFA 4I9DA 1B4HA 2WOLA 1B32A 4GF8A 2WOPA 4ZE8A 3DRIA 4GFRA 3DRHA 1UQWA 1DPPA 4ZECA 4QFKA 1B7HA 5HM4B 1QKAA 4WEDA 1QKBA 3MVZA 4DCYA 4ZEKA 2D5WA 4XKQA 3PAMA 3E3KA 4QFLA 1VR5A 1B9JA 1B2HA 4RA1A 1B05A 3ZS6A 3MZ9A 3MW0A 3LVUA 5ISUA 1JEVA 4JSOA 1B3FA 4QFOA 5F1QA 3I5OA 1B4ZA 4OFOA 3DRJA 2WOKA 3O9PA 4DCXA 4OEUA 4XKNA 4ZE9A 4ZEIA 1JEUA 3MZBA 1B3GA 1B3LA 3CHGA 2NOOA 4OETA 3TCFA 1B3HA 1B52A 4PFWA 1B40A 3MVWA 3FTOA 4XKRA 1JETA 1XOCA 3TPAA 2RKMA 4I8CA 1UIVA 1B6HA 2OLBA 2O7IA 4QFPA 1B5JA 1ZTYA 1B0HA 1B46A 4OFLA 4PFYA 5L8DA 3TCHA 1B5IA 3DRKA 1B1HA 4ONYA 5KZTA 4OESA 3RQTA 4XKPA 2Z23A 1B58A 1OLAA 1B51A 4PFTA 4FAJA 4QFNA 2GRVA 4OERA 4PFUA 3TCGA 1RKMA 3DP8A 4GL8A 5ICQA 3RY3A 3M8UA 2B4LA 3RYAA 2B4MA 3MVYA 4OEVA
chains in the Genus database with same CATH superfamily
4GIZA 5K2XA 2R9JA 4PAFA 4JSDA 2AL5A 5H8NA 4ND9A 4L17A 3RT6B 3U92A 1LBCA 3GBAA 2XD2A 3C36A 5KDTB 4JWOA 1A8FA 3U94A 1FBCA 5FBPA 1SW2A 1LEVA 5F7VA 1QW0A 5CM6A 3FVNA 2GHAA 4OENA 4ESWA 2WBDA 1FQDA 4N81A 3H06B 1EU8A 4IO6A 5IZ3B 4PTKA 3S9NC 4NF4B 4LUBA 4OFOA 2WOKA 3IB2A 4OQOA 4R74A 2GFEA 1NV3A 3RPLA 4ZEIA 1JEUA 3THIA 3K2DA 1M5CA 3FTOA 2CEXA 1TWYA 3MWBA 1AWBA 2VD2A 3RNNA 5ESYA 1PC3A 2DYXA 1EZPA 1B0HA 1QGXA 2OWZA 1YYZA 2D3IA 4N6PA 3RPWA 3PTYA 4XKPA 1FTJA 2W7YA 2MKZA 3SZPA 1O63A 3IL1B 3UK4A 3BFUA 4KCCA 3O97A 4F39A 3IB1A 1J1NA 1KWHA 2Z8EA 2NVUB 1PB8A 1K9YA 1ZU0A 3EPEA 2O69A 5KDTA 2ZZWA 4E0XA 2Q9TA 1BIYA 4NN3A 1FBGA 4H45A 2F6PA 3Q28A 3BBRA 4P8BA 3ZKLA 3KOTA 1US5A 4NHBA 3VXBA 5I3SA 3KJTA 1DTGA 5ET7A 3CIJA 1NH8A 2D5WA 5ET8A 1G0IA 3IOVA 4MBPA 1MXUA 3H6WA 2FHYA 2F36A 5IZ3A 4NF4A 4Q0CA 4IO4A 4RA1A 2VHAA 4WKMA 2OX3A 3ZS6A 1KA0A 3G3JA 3E78A 2ZNUA 4BDOA 2R8TA 5F1QA 3IORA 3EHUA 1A40A 4N8YA 1NV4A 3G3FA 1LAHE 4F31B 1FPFA 4ZE9A 4LA9A 3FVOA 3MZBA 1BLFA 2GHBA 2LAOA 4XTCQ 1Z7NE 2XD3A 1B3LA 2HFBA 1XT8A 3ONMA 4OETA 1SD3A 1B3HA 4DXCA 1RYOA 2Z22A 3K6WA 4F29A 4EQ9A 3IO6A 2F34A 3K1MA 4PFYA 5L8DA 3FXBA 2ONKE 3PPOA 3T9XB 3GYYA 3VLVA 4GXAA 3TODA 4DI4B 3RQTA 4YMBA 4YMAA 2PMSA 4NE4A 2Z23A 3VVFA 1NI9A 4F2QA 3DP8A 4PFRA 2XWKA 3FJMA 1ZKBA 2VP1A 1MY3A 4JB7A 5I84A 3B7DA 3DLNA 4NX1A 4N13A 3S9EA 1R9QA 4H0WA 2G93A 2I0BA 3CVGA 3O6PA 4WEPA 3KBRA 4OVQA 2FIXA 4MNCA 4PDHA 1BKAA 4ZECA 3KSJA 5KCJB 2QMWA 3PV0E 4N91A 3CG1A 1G0HA 2G29A 4HCWA 3E3KA 2UVJA 2YJPA 2A5SA 4KQPA 4NF5A 1JP4A 4HE2A 2XHDA 4YB7A 1INPA 1D9YA 3MZ9A 2B3FA 5TPAB 4QBAA 1S7YA 3C33A 1D4NA 5ELVA 3M3LA 4OEUA 3RN8A 3C9HA 1FW0A 5HPQA 5EQ9A 3KBZA 3LV0A 4YZZA 4ISUA 4PFWA 3MZ1A 1EYIA 1AMFA 2OCUA 1NUWA 3O29A 3K6UA 2Z8DA 3KG2A 3G3GA 1PBPA 3OEMA 3IAZA 4KD5A 3SEUA 1LAGE 4HXVA 4N6KA 3U8QA 1B7UA 1B46A 4DIGA 2Y5KA 3OO9A 2QS2A 5H8FB 3UIFA 5AA4B 1LFHA 1MXXA 1OIBA 4K3FA 2PX1A 4QF9A 3IJOB 5EHSA 3M3KA 4N17A 1EZ9A 2PBWA 2HCAA 4U1OA 1IEJA 1H76A 1RDZA 1LBYA 1MY1A 2DVZA 1SQYA 5DTBA 3M3FA 1UIUA 4GWOA 1DOTA 1FTMA 2I6EA 3E13X 1NV5A 4I62A 1AIVA 4DE8A 4ZE8A 3T93B 4PETA 3O6HA 5LDZA 3TUSA 5I59B 2YLNA 4I40A 4NMYA 1FPKA 1DMBA 4QFLA 1FBPA 1B9JA 4R6YA 1FBFA 4R6KA 1B05A 5IM2A 3VLWA 2DE4A 4I3EA 2QS1A 1DBZA 2WEFA 3GZGA 1LGBC 3I5OA 4PE5B 1JNFA 2F78A 2XXQA 1GGGA 2DOJA 3TYHA 4XKNA 2QMXA 3CHGA 1S50A 4O7IA 3MC2A 5H8FA 1MXZA 1H43A 2DXRA 1FJ9A 4QRZA 1IITA 2OLBA 1MPCA 1HSEA 4AS4A 4YKJA 1ZMGA 1Y20A 5M2VA 4ONYA 3PMWA 2QVRA 2ZZVA 4PBQA 3OO6A 4OERA 1FTKA 4X48A 2F35A 2QJEA 4HE1A 2AYSA 3EHSA 1H45A 4LONB 4YKIA 5CBRA 3D4GA 4H5FA 4RNSA 3SETA 3DRGA 3PU5A 4LVQA 3K6VA 1B32A 2NXOA 3S9MC 1CB6A 2RC8A 4PGPA 4GBVA 3T0JA 1LBZA 4N07A 1MDQA 5ICTA 4RJZA 1DPPA 5BWJA 4X8RA 2QVUA 3H3GA 3FUZA 4NWCA 4ZEKA 1POY1 1YAEA 1MQHA 1NUZA 2F8DA 5A5LA 4AS5A 1CE2A 1IUDA 3D1RA 3IOTA 4THIA 1N04A 1GTKA 3Q27A 4EXLA 1SW4A 1IXHA 5L9MA 1LCFA 2HXRA 1ZJLA 3TEPA 4OVJA 4H8IA 4OHNA 3PGFA 3PMVA 3V89B 1N0TA 2F7BA 3FVKA 2PFYA 2XX9A 1I6BA 4NF8A 1FSAA 1B52A 1YPNA 4XKRA 1MPBA 4RK9A 3LSFB 3IB0A 1N7XA 3K00A 4NF6A 4OFLA 3OSRA 2HZKA 1YZ0A 2RINA 1IIWA 3E9XA 3QSLA 4FAJA 1P1UA 4PFUA 1RKMA 5IAIA 4I1DA 4QXDA 1FBEA 4AB6A 1ZIUA 2PFZA 4OEVA 2FYIA 1B5HA 3ROJA 2F97A 1MPDA 3B8BA 1DPEA 3C32A 3UGWA 1LCTA 4IY6A 3QMFA 2Z8FA 5F24A 2HEUA 2QS4A 3FBPA 1DSNA 1DK4A 2DVCA 2UYFA 3LR1A 4C1UA 1MH4A 5HM4B 4HTGA 4DCYA 2HQ0A 3FV2A 4IO7A 1SBPA 3MPKA 2KR0A 5CMKA 1NV7A 3B6QA 3HV1A 3BKIB 5J1DA 1Z7ME 3D4CA 4NAPA 2ONSA 3HN0A 3USDA 3KN7A 4FE8A 3DP4A 5ISUA 4GRKA 4IGTA 2CZLA 2H25A 1FQAA 4R2BA 1SI1A 1FTAA 4IO2A 3PUZE 1B40A 2CMOA 4MX6A 1IZ1A 5LTCA 1FPJA 1BTJA 4I8CA 1UIVA 1LAFE 2Y7PA 1ELJA 1B1XA 4DDDA 4H46A 2V93A 3DRKA 4R9GA 1HSLA 1FPLA 1IQ7A 3KOSA 5ICQA 3SKPA 3FXRA 2BJIA 4OZ9A 1OVBA 3RYAA 4PP0A 3TTKA 2ABHA 4DLDA 2VD3A 4GLIA 3MYUA 1PB7A 1SW1A 1FPDA 2I4BA 1AOVA 4G2ZA 4MIJA 4XIGQ 4PE3A 2WYPA 5ET5A 4PGNA 3BFTA 4PAKA 2I49A 3N5LA 1DTZA 2Q2CA 3MSTA 4MEVA 1LBVA 3TFLA 4GWUA 2E0SA 2QL3A 5I7IA 4EDPA 5EQ7A 2DWJA 4UABA 1XHYA 1VR5A 2O6AA 3O2AA 4FBPA 2DSFA 2H99A 4BDLA 5FHOA 3VDFA 4JSOA 4OANA 1R6ZA 3RUMA 3VE1B 4NF0A 2HPGA 3OENA 3VFJA 5JTYB 5H8QB 4LZ5A 4G61A 4G77A 3R6UA 4YKPA 1D9VA 3OXNA 5HBCA 1I6AA 5ET6A 2XA5A 4FIMA 1K9ZA 3T22A 1XI6A 2ONRA 5BUUA 3MAMA 1XVYA 3FJGA 1FPIA 2XWIA 2V25A 3N6UA 1B5IA 5JEIA 4OESA 2DWAA 4PFTA 3H7MA 2FNCA 3PUWE 4IO3A 1URDA 4GL8A 1EYKA 3RY3A 4F1UA 2I58A 3KC0A 3TKDA 1B3EA 3FATA 2H4IA 5FTIA 3IK6B 3LSWA 1TXFA 4RXLA 3KJ7A 3PPNA 4IY5A 2ANJA 3EKIA 1NNTA 4X04A 3UN6A 1IXGA 1B0LA 4R72A 3IR1A 2P3VA 4GFRA 4PFBA 4KXPA 3N26A 3NOHA 2XXVA 3L6HA 3SDFA 1LFIA 1MQGA 4XKQA 5FHNA 1NKXA 1LB9A 4O3BA 5EQAA 1IXCA 3UP9A 4O8MA 4WXJA 3CFLA 3LVUA 5JTYA 2R71A 5H8QA 1ANFA 2X7PA 3CI8A 3TQLA 4MHFA 4RY1A 1A99A 1Y3NA 2HXWA 4GL0A 2I4CA 3I6VA 1HSJA 1F9BA 4MFIA 4R6HA 3HHGA 5DVIA 4ZDMA 5TU0A 1VE4A 3B6TA 4XEQA 4F19A 5IKBA 1LFGA 2WX9A 3CR9A 2ZXTA 4MMPA 5I58B 4F2OA 2UYEA 2Q74A 4H67A 4G8MA 1JW5A 5DT6A 1UTHB 4KYDA 3RTFB 5AA2D 2H5YA 1LLSA 4IR8A 4YAHX 4LQ2A 2PYYA 2KLFA 2OWTA 2B4MA 4GQOA 1FPEA 1JW1A 4ESXA 2V3UA 3H6UA 4ZEDA 3OSQA 3RLFE 2P1SA 3HHFA 4FECA 4P56A 1P1QA 3PD9A 4JDFA 2UVGA 4HCYA 3TMGA 3DRHA 1UQWA 3SEYA 3N94A 1B7HA 3MVZA 1FBDA 2RCBA 1TFDA 4HE0A 3VVEA 2ALUA 2IEEA 2X26A 4RPOA 2DS9A 5I57B 4HS7A 3VVDA 5KCJA 4KCDA 3R7XA 4Q5TA 2GH9A 3B6WA 3N6TA 3TZAA 3A3CA 4JWXA 5DYHA 2THIA 3UORA 4XF5A 3CSGA 1RDXA 3O9PA 5AA1A 4PQJA 4G8HA 1QJMA 3FD3A 4RPNA 5TPAA 1S9TA 1N7WA 2DWHA 2H9BA 4P1EA 2RF1A 5I58A 1P99A 1WDNA 3C4MA 1XOCA 3OEKA 2ZNSA 2RKMA 2Q89A 1UTHA 1MM6A 4LZ8A 3I3VA 5H8HB 4ECFA 4P0GA 4GX3A 1A7LA 2Y7KA 4DZ1A 3G3KA 3OO8A 4IGRA 4NWDA 1IMDA 3CFXA 4OWDA 3ILUB 4GD5A 3W15C 4ELQA 4DI3D 5AA4A 1FPGA 1RDYA 1OVTA 4MH5A 3TDJA 1N3WA 4R9FA 2Q8MA 3SEVA 4BDNA 3ECRA 1Y1MA 1QUIA 4RYAA 1XVXA 3U1OA 3QIMA 2Y7RA 3OD7A 4TOZA 3T66A 4ZEBA 1Y4CA 1B7ZA 3K01A 4MJOA 4MNIA 3GBBA 1B4HA 2PCRA 2WOLA 1II5A 4PF8A 5I2KB 5A5XB 2QVVA 4O7MA 4YKKA 3MBPA 1OMPA 1NUXA 1P1NA 3G7WA 5DVJA 3FZVA 4ZS9A 4KR5A 4BDMA 4G68B 4GX6A 1GVCA 3WAFA 5DVFA 3CFZA 4JWYA 1UTBB 3TAJA 3FJ7A 5I59A 2ZYKA 2A5TB 1IMCA 3Q25A 4JVIA 2UVHA 3V83A 3RYDA 4F3SA 1MXVA 3DRJA 3CSBA 1Y3PA 1NMUA 4LATA 1POTA 4KPTA 5CMCA 3GXAA 3MVWA 3JZJA 2I48A 1NL5A 1NNKA 2KQZA 4F3PA 3PD8A 1MXWA 4P3LA 5H8HA 2RC7A 4QFPA 3EQ1A 4TQUQ 4F22A 3KN3A 3QUJA 3O28A 3TCHA 1CNQA 1A55A 1N76A 2XX7A 4MCOA 5AE4A 2NWJA 2F5XA 3FV1A 1WODA 3TCGA 1TT1A 4P0IA 3MPLA 3CRBA 1MS7A 2PVUA 2B4LA 1LBXA 1OQGA 5K2YA 3KFMA 1MY2A 5FTHA 2D21A 3FXUA 2ZZXA 1JQFA 1RYXA 1VFDA 3B50A 3T1BA 1M5EA 1MDP1 3LUYA 5I2KA 1H44A 5A5XA 3PUVE 1P1WA 1QUJA 2VT5A 4FATA 5TP9B 3Q26A 3DRFA 3PPPA 4GF8A 1LBBA 5AA3A 4POWA 2V3TA 3DRIA 2Y7IA 2P2AA 3UA8A 3CG3A 2Y84A 3JYRA 2M8CA 3LSLA 1UTBA 1MQDA 2DE3A 2I3VA 2AL4A 2A5TA 2ZYOA 2I0CA 2Y5LA 5B7DA 2OZZA 4PBHA 1VSOA 3KZGA 4GXSB 4X1BA 2DDKA 3O6GA 3E4RA 3RPLB 5CI5A 3MW0A 1FPBA 2UXAA 2ESNA 3FASA 4U4SA 4GWYA 1B3GA 2NOOA 1US4A 3C31A 2B3BA 3FXQA 4P9KA 1IMBA 4UACA 3S2VA 1NNPA 2F3DA 3U65A 1IMFA 4GOTA 4QSEA 4NG7A 3U93A 3H6VA 3KSXA 5J16A 1FTOA 4XXUA 4MNPA 5IZ1A 3DELB 1PDAA 1JW4A 1Q9DA 4X9TA 2P0SA 2V3QA 4H5GA 4AB5A 1NV2A 4F1VA 2F6GA 5FHMA 1Y9UA 1I69A 1NH7A 2DE2A 2CEYA 1LBWA 5TP9A 3PUYE 2VOZA 1SI0A 3OO7A 2B65A 2VPNA 3MVXA 2O7UA 3IO4A 3MJNA 4GVOA 4KFQA 1M5DA 1SPIA 4OMBA 3W9WA 1Y4TA 4OVPA 4Q8RA 4U23A 2XXTA 3S9LC 2YPNA 1SVXB 4O3CA 4TLMB 4F3GA 1FQCA 1QKAA 3PAMA 2Y7WA 3LBSA 4OVSA 4OVTA 2FIEA 2ZNTA 3PPRA 3TTLA 3ISPA 4ELRA 1NNFA 1A8EA 5EQ8A 1Q1KA 3VXCA 3SEWA 3MP6A 3SERA 3O6IA 2BJJX 3A29A 4Q30B 3EN3A 1IMAA 3H6TA 2V4CA 5JK4A 5ITPA 1MRPA 3QXMA 4ZEFA 3TTRA 1URGA 2ZYMA 1GR2A 2GQ1A 4AQ4A 3R26A 1URSA 1MQJA 3H4ZA 1T0KA 1MG1A 3V5AA 1SYHA 3IOWA 4G68C 1JETA 4ZZAA 3TPAA 3K0VA 1ZTYA 4PFIA 1TFAA 2XXWA 1NV6A 2XWOA 2OWSA 2O1MA 3WAEA 2PT1A 4U2RA 4U1ZA 4FJPA 5DEXB 3MP8A 1OLAA 5CRYA 2QS3A 3QUFA 1SW5A 1ATGA 4YU0A 5CBSA 5I2NB 2P3NA 3KEIA 4GWZA 3EHTA 3MVYA 4H8JA 3TELA 1VDWA 3VV5A 4NQ8A 2F7CA 4H65A 3U72A 1ZLQA 5CMBA 3HCQA 3MUQA 4FORA 4PDDA 1SDXA 2QPQA 1A54A 5T3JA 3LUZA 5ITOA 4I9DA 4XFEA 1YTVA 4QSDA 2UVIA 5EYFA 3H03A 3KN8A 4NF5B 1NUYA 2H98A 2IA4A 3S4UA 4TLLB 2DP8A 3FVGA 5I5PA 1IXIA 4F3BA 2QFLA 1SYIA 1QVSA 3SEXA 1L5TA 1B2HA 3T96B 1PBQA 4MLQA 1FCKA 2FVZA 4M1VA 3DM0A 3IX1A 1Y1ZA 3MP1A 3L6GA 3K02A 3T9HB 3JV9A 4OXVA 3AXFA 4RK2A 1R1NA 3PMXA 4PC9A 4KYEA 1XC1A 4GWSA 5CMMA 5DEXA 3PPQA 2XXRA 1MXYA 1VFEA 1M5FA 1WVJA 2DXYA 1XS5A 2I3WA 4KHZE 4EXKA 5I2NA 2CZIA 2HZLA 1B51A 3K1NA 2V84A 3IJXB 4OYVA 3BIHA 5AA2B 3M8UA 3G3HA 3MQ9A 1JVXA 2HAUA 4P47A 4EQBA 5LOMA 3QAXA 5CC2A 4BDRA 4OFJA 4OA4A 3BIGA 3TQWA 2F7AA 4GBWA 3T9UA 3A09A 4JBZA 4N8GA 4H1XA 2DQVA 4QHQA 3KGCA 3HO7A 4LP2B 3DP6A 2ZMBA 3VLUA 3OOAA 2VPOA 2WYKA 3OMBA 4H6DA 3LSXA 1MQIA 4E0WA 1QUKA 3P7IA 2CZHA 3ILTB 4GX4A 4N4UA 5L9OA 3Q29A 4QFOA 1KA1A 3RGYA 1NFTA 4ZZEA 1AL3A 3KC1A 4O94A 1LSTA 4DCXA 2E1SA 1BP5A 1FRPA 4JVCA 2X7QA 1FTLA 4LQ5A 4QSCA 4OVRA 4DXUA 4YB5A 3IFAA 1IMEA 3W9VA 4C1TA 2OJTA 1R9LA 3OELA 4HW8A 1MY4A 3GLBA 3C35A 1Q35A 2HHMA 5AA2A 4FEDA 4YB6A 2VGQA 3C34A 4KI0E 1YCJA 1O64A 4C0RA 4PCDA 3E79A 4MF3A 1B58A 2OK2A 3F11A 4N15A 3LC8A 1PEBA 2ZYNA 4OTEA 3SESA 4MAGA 5H8SA 1O7TA 3IFCA 1PB9A 2XXXA 1BK4A 4Z0IA 4EF2A 1OLCA 1NV1A 4R73A 3QYTA 4EQ7A 1M5BA 2REGA 1OQHA 2Q8JA 4F1YA 4IO5A 2OBGA 1FQFA 4G8NA 4R2FA 4U22A 3ZSFA 1MH3A 4QFKA 4WEDA 2O84X 1MY0A 2DWIA 2XXHA 2XXYA 4YICA 1P1OA 4BDQA 3K6XA 4Z7EA 4NF8B 4P11A 1B3FA 2FA7A 1D3KA 4G4PA 4PF6A 1JVYA 4POXA 5I57A 4GWXA 3RTWB 4O3AA 1H3DA 2WBBA 4NF6B 1USYE 2O51A 3TCFA 3T9VA 2Q2AA 5IZZA 4KYSA 3HSTA 3TTNA 1FJ6A 3QK6A 4BLAA 2NUVA 5B70A 1B6HA 2RCAA 1FQEA 1B5JA 1N3XA 2F3BA 2AIXA 4X1DA 2XXIA 2FBPA 2XXPA 5KZTA 1EZOA 4JVDA 3HPIA 3RT8A 4QFNA 2L5VA 1QULA 2QSXA 4NTLA 2REJA 4PAIA 2RC9A 5I56B 4R75A 4U4XA 1YXIA 1KZ8A 3ZKKA 3HFUA 3RYBA 1AH5A 3V8XB 1N84A 2XWVA 1NV0A 1FQBA 2CZKA 4U21A 2O68A 1EYJA 3K4UA 2WOPA 3G3IA 3FGSA 2XXKA 2JJKA 5H8NB 2HAVA 2R6GE 5EYGA 3IOUA 1QKBA 4M4GA 4GWWA 3PUXE 4LZ7A 4EUOA 3TTMA 5DW8A 4DXBA 2PT2A 1EH3A 3FIRA 1JEVA 1I6QA 5IGAA 4G68A 1ZBMA 2XXUA 2XX8A 1B4ZA 2O1LA 1GV8A 2Q88A 3EF7A 4NEDA 4P1LA 5EHMA 2WKYA 4EF1A 4ELOA 4UA8A 1Y3QA 4NGUA 4LN5A 4JXIA 4ELPA 4I3YA 3O66A 2O7IA 3K1PA 4N6DA 4F18A 5EYHA 1MM7A 1B1HA 1LB8A 4MLVA 2GRVA 1D9QA 5I56A 4IB2A 5L9SA 1LAXA 3ODBA 3A3UA 1DCUA 2QRYA 4FEBA 1FBHA 1USYH
chains in the Genus database with same CATH topology
1ZLQA 4PAFA 4PDDA 2QPQA 4JSDA 3DRGA 4ZEDA 5T3JA 3LUZA 4I9DA 4XFEA 1B32A 4P56A 4PGPA 4GBVA 4HCYA 3T0JA 1LBZA 1NUYA 3DRHA 1UQWA 1DPPA 4X8RA 1B7HA 1FBCA 2QVUA 5FBPA 3MVZA 1FBDA 5I5PA 4ZEKA 1NUZA 2QFLA 4HE0A 1LEVA 5A5LA 5CM6A 4AS5A 1B2HA 2WBDA 3D1RA 4N81A 2HXRA 5IZ3B 4PTKA 4XF5A 2FVZA 4OFOA 1RDXA 4M1VA 2WOKA 3O9PA 1NV3A 3RPLA 4ZEIA 1JEUA 2PFYA 1FSAA 1B52A 4PC9A 3FTOA 4P1EA 2CEXA 4XKRA 4GWSA 1XOCA 1AWBA 2RKMA 5ESYA 1B0HA 4OFLA 1QGXA 2OWZA 1YYZA 4GX3A 3PTYA 2HZKA 4XKPA 1YZ0A 2CZIA 2HZLA 2MKZA 1B51A 4FAJA 3SZPA 4PFUA 1IMDA 1RKMA 3BIHA 3M8UA 4DI3D 1FPGA 1RDYA 4QXDA 1FBEA 2Q8MA 4P47A 2PFZA 4OEVA 1B5HA 1K9YA 1ZU0A 3ROJA 4OFJA 4OA4A 3BIGA 3QIMA 2ZZWA 3B8BA 4TOZA 1DPEA 3T66A 4ZEBA 2Q9TA 4MJOA 4GBWA 4MNIA 3QMFA 4NN3A 1FBGA 1B4HA 2PCRA 4H45A 5F24A 2WOLA 3FBPA 4PF8A 2QVVA 4O7MA 4N8GA 4P8BA 4NHBA 1DK4A 5I3SA 1NUXA 5HM4B 4DCYA 5ET7A 2VPOA 2D5WA 5ET8A 1G0IA 2KR0A 2WYKA 2FHYA 5IZ3A 4GX6A 1NV7A 5J1DA 4RA1A 4NAPA 2OX3A 3ZS6A 1KA0A 2CZHA 4GX4A 4N4UA 3E78A 1IMCA 4JVIA 5ISUA 4QFOA 2R8TA 3RYDA 5F1QA 1KA1A 4N8YA 3DRJA 3KC1A 4O94A 1NV4A 4DCXA 1FPFA 4ZE9A 3MZBA 1FTAA 1B3LA 1FRPA 4JVCA 4OETA 1B3HA 1B40A 3MVWA 4MX6A 4OVRA 3IFAA 2KQZA 1IMEA 3W9VA 5LTCA 1FPJA 4P3LA 4I8CA 1UIVA 4QFPA 4H46A 4PFYA 5L8DA 3FXBA 3TCHA 1CNQA 2HHMA 3GYYA 4MCOA 3DRKA 4DI4B 3RQTA 4PCDA 3E79A 2Z23A 2F5XA 1B58A 1NI9A 1FPLA 3TCGA 3DP8A 5ICQA 4N15A 2BJIA 4PFRA 2XWKA 2B4LA 3RYAA 1LBXA 2ZZXA 4MAGA 3MYUA 3B50A 1FPDA 3T1BA 3IFCA 4NX1A 1BK4A 4MIJA 1OLCA 4PE3A 1NV1A 2VT5A 2WYPA 3O6PA 3DRFA 5ET5A 4OVQA 4PGNA 4GF8A 2FIXA 4MNCA 4PDHA 3DRIA 4PAKA 3MSTA 4ZECA 4MEVA 1LBVA 4QFKA 4N91A 4GWUA 4WEDA 1G0HA 2DE3A 5I7IA 2Y5LA 4HCWA 3E3KA 5EQ7A 4UABA 4YICA 4PBHA 1VR5A 1JP4A 4FBPA 4HE2A 2DDKA 3RPLB 1INPA 3MZ9A 3MW0A 4JSOA 4OANA 1B3FA 4PF6A 4QBAA 1FPBA 4NF0A 4GWXA 2HPGA 4OEUA 4GWYA 1B3GA 4G61A 2WBBA 5EQ9A 3KBZA 3LV0A 2NOOA 3TCFA 4YZZA 4PFWA 1EYIA 5IZZA 1NUWA 1FJ6A 5ET6A 2XA5A 4P9KA 1B6HA 1K9ZA 1IMBA 1B5JA 1XI6A 2F3BA 2F3DA 4HXVA 4N6KA 1FPIA 3U65A 1IMFA 1B46A 2Y5KA 4NG7A 2XWIA 2FBPA 1B5IA 5KZTA 4OESA 5J16A 4JVDA 4PFTA 4QFNA 4MNPA 5IZ1A 4GL8A 2L5VA 1EYKA 3RY3A 4N17A 4F1UA 3KC0A 1Q9DA 4X9TA 2V3QA 1NV2A 4F1VA 4PAIA 1RDZA 1LBYA 2DE2A 2CEYA 1LBWA 2DVZA 1YXIA 1KZ8A 3HFUA 3RYBA 2VPNA 3MVXA 2XWVA 1UIUA 1NV0A 2CZKA 3EKIA 4X04A 1SPIA 1EYJA 1NV5A 3W9WA 2WOPA 4OVPA 4ZE8A 2XXKA 2JJKA 4PETA 2P3VA 5EYGA 4GFRA 5LDZA 4PFBA 4KXPA 3NOHA 1QKAA 1QKBA 4I40A 4GWWA 1FPKA 4XKQA 3PAMA 5DW8A 4OVSA 4OVTA 4QFLA 1FBPA 2FIEA 1B9JA 5EQAA 1FBFA 3ISPA 4O8MA 1B05A 5IM2A 5EQ8A 3LVUA 2DE4A 1JEVA 5IGAA 3A29A 4I3EA 1DBZA 2WEFA 1IMAA 3I5OA 2V4CA 5JK4A 1B4ZA 4MHFA 4XKNA 2GQ1A 4P1LA 4NGUA 3CHGA 4LN5A 4O7IA 4I3YA 1JETA 4XEQA 3TPAA 1FJ9A 4F19A 2OLBA 2O7IA 2WX9A 1ZTYA 4PFIA 4AS4A 4MMPA 4N6DA 4F18A 5EYHA 1NV6A 2XWOA 1B1HA 4ONYA 2Q74A 2QVRA 1OLAA 2ZZVA 4PBQA 2GRVA 4OERA 1D9QA 4IR8A 2P3NA 4GWZA 4HE1A 2B4MA 3MVYA 1DCUA 1VDWA 1FPEA 1FBHA 4NQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLQ A;  1B5H A;  1ZU0 A;  3RYB A;  3MVX A;  4OFJ A;  1OLC A;  4JSD A;  3QIM A;  1UIU A;  1DPE A;  4TOZ A;  4ZEB A;  3T66 A;  3DRG A;  4ZED A;  3O6P A;  3DRF A;  4I9D A;  1B4H A;  2WOL A;  1B32 A;  4GF8 A;  2WOP A;  4ZE8 A;  3DRI A;  4GFR A;  3DRH A;  1UQW A;  1DPP A;  4ZEC A;  4QFK A;  1B7H A;  5HM4 B;  1QKA A;  4WED A;  1QKB A;  3MVZ A;  4DCY A;  4ZEK A;  2D5W A;  4XKQ A;  3PAM A;  3E3K A;  4QFL A;  1VR5 A;  1B9J A;  1B2H A;  4RA1 A;  1B05 A;  3ZS6 A;  3MZ9 A;  3MW0 A;  3LVU A;  5ISU A;  1JEV A;  4JSO A;  1B3F A;  4QFO A;  5F1Q A;  3I5O A;  1B4Z A;  4OFO A;  3DRJ A;  2WOK A;  3O9P A;  4DCX A;  4OEU A;  4XKN A;  4ZE9 A;  4ZEI A;  1JEU A;  3MZB A;  1B3G A;  1B3L A;  3CHG A;  2NOO A;  4OET A;  3TCF A;  1B3H A;  1B52 A;  4PFW A;  1B40 A;  3MVW A;  3FTO A;  4XKR A;  1JET A;  1XOC A;  3TPA A;  2RKM A;  4I8C A;  1UIV A;  1B6H A;  2OLB A;  2O7I A;  4QFP A;  1B5J A;  1ZTY A;  1B0H A;  1B46 A;  4OFL A;  4PFY A;  5L8D A;  3TCH A;  1B5I A;  3DRK A;  1B1H A;  4ONY A;  5KZT A;  4OES A;  3RQT A;  4XKP A;  2Z23 A;  1B58 A;  1OLA A;  1B51 A;  4PFT A;  4FAJ A;  4QFN A;  2GRV A;  4OER A;  4PFU A;  3TCG A;  1RKM A;  3DP8 A;  4GL8 A;  5ICQ A;  3RY3 A;  3M8U A;  2B4L A;  3RYA A;  2B4M A;  3MVY A;  4OEV A; 
#chains in the Genus database with same CATH topology
 4GIZ A;  5K2X A;  2R9J A;  4PAF A;  4JSD A;  2AL5 A;  5H8N A;  4ND9 A;  4L17 A;  3RT6 B;  3U92 A;  1LBC A;  3GBA A;  2XD2 A;  3C36 A;  5KDT B;  4JWO A;  1A8F A;  3U94 A;  1FBC A;  5FBP A;  1SW2 A;  1LEV A;  5F7V A;  1QW0 A;  5CM6 A;  3FVN A;  2GHA A;  4OEN A;  4ESW A;  2WBD A;  1FQD A;  4N81 A;  3H06 B;  1EU8 A;  4IO6 A;  5IZ3 B;  4PTK A;  3S9N C;  4NF4 B;  4LUB A;  4OFO A;  2WOK A;  3IB2 A;  4OQO A;  4R74 A;  2GFE A;  1NV3 A;  3RPL A;  4ZEI A;  1JEU A;  3THI A;  3K2D A;  1M5C A;  3FTO A;  2CEX A;  1TWY A;  3MWB A;  1AWB A;  2VD2 A;  3RNN A;  5ESY A;  1PC3 A;  2DYX A;  1EZP A;  1B0H A;  1QGX A;  2OWZ A;  1YYZ A;  2D3I A;  4N6P A;  3RPW A;  3PTY A;  4XKP A;  1FTJ A;  2W7Y A;  2MKZ A;  3SZP A;  1O63 A;  3IL1 B;  3UK4 A;  3BFU A;  4KCC A;  3O97 A;  4F39 A;  3IB1 A;  1J1N A;  1KWH A;  2Z8E A;  2NVU B;  1PB8 A;  1K9Y A;  1ZU0 A;  3EPE A;  2O69 A;  5KDT A;  2ZZW A;  4E0X A;  2Q9T A;  1BIY A;  4NN3 A;  1FBG A;  4H45 A;  2F6P A;  3Q28 A;  3BBR A;  4P8B A;  3ZKL A;  3KOT A;  1US5 A;  4NHB A;  3VXB A;  5I3S A;  3KJT A;  1DTG A;  5ET7 A;  3CIJ A;  1NH8 A;  2D5W A;  5ET8 A;  1G0I A;  3IOV A;  4MBP A;  1MXU A;  3H6W A;  2FHY A;  2F36 A;  5IZ3 A;  4NF4 A;  4Q0C A;  4IO4 A;  4RA1 A;  2VHA A;  4WKM A;  2OX3 A;  3ZS6 A;  1KA0 A;  3G3J A;  3E78 A;  2ZNU A;  4BDO A;  2R8T A;  5F1Q A;  3IOR A;  3EHU A;  1A40 A;  4N8Y A;  1NV4 A;  3G3F A;  1LAH E;  4F31 B;  1FPF A;  4ZE9 A;  4LA9 A;  3FVO A;  3MZB A;  1BLF A;  2GHB A;  2LAO A;  4XTC Q;  1Z7N E;  2XD3 A;  1B3L A;  2HFB A;  1XT8 A;  3ONM A;  4OET A;  1SD3 A;  1B3H A;  4DXC A;  1RYO A;  2Z22 A;  3K6W A;  4F29 A;  4EQ9 A;  3IO6 A;  2F34 A;  3K1M A;  4PFY A;  5L8D A;  3FXB A;  2ONK E;  3PPO A;  3T9X B;  3GYY A;  3VLV A;  4GXA A;  3TOD A;  4DI4 B;  3RQT A;  4YMB A;  4YMA A;  2PMS A;  4NE4 A;  2Z23 A;  3VVF A;  1NI9 A;  4F2Q A;  3DP8 A;  4PFR A;  2XWK A;  3FJM A;  1ZKB A;  2VP1 A;  1MY3 A;  4JB7 A;  5I84 A;  3B7D A;  3DLN A;  4NX1 A;  4N13 A;  3S9E A;  1R9Q A;  4H0W A;  2G93 A;  2I0B A;  3CVG A;  3O6P A;  4WEP A;  3KBR A;  4OVQ A;  2FIX A;  4MNC A;  4PDH A;  1BKA A;  4ZEC A;  3KSJ A;  5KCJ B;  2QMW A;  3PV0 E;  4N91 A;  3CG1 A;  1G0H A;  2G29 A;  4HCW A;  3E3K A;  2UVJ A;  2YJP A;  2A5S A;  4KQP A;  4NF5 A;  1JP4 A;  4HE2 A;  2XHD A;  4YB7 A;  1INP A;  1D9Y A;  3MZ9 A;  2B3F A;  5TPA B;  4QBA A;  1S7Y A;  3C33 A;  1D4N A;  5ELV A;  3M3L A;  4OEU A;  3RN8 A;  3C9H A;  1FW0 A;  5HPQ A;  5EQ9 A;  3KBZ A;  3LV0 A;  4YZZ A;  4ISU A;  4PFW A;  3MZ1 A;  1EYI A;  1AMF A;  2OCU A;  1NUW A;  3O29 A;  3K6U A;  2Z8D A;  3KG2 A;  3G3G A;  1PBP A;  3OEM A;  3IAZ A;  4KD5 A;  3SEU A;  1LAG E;  4HXV A;  4N6K A;  3U8Q A;  1B7U A;  1B46 A;  4DIG A;  2Y5K A;  3OO9 A;  2QS2 A;  5H8F B;  3UIF A;  5AA4 B;  1LFH A;  1MXX A;  1OIB A;  4K3F A;  2PX1 A;  4QF9 A;  3IJO B;  5EHS A;  3M3K A;  4N17 A;  1EZ9 A;  2PBW A;  2HCA A;  4U1O A;  1IEJ A;  1H76 A;  1RDZ A;  1LBY A;  1MY1 A;  2DVZ A;  1SQY A;  5DTB A;  3M3F A;  1UIU A;  4GWO A;  1DOT A;  1FTM A;  2I6E A;  3E13 X;  1NV5 A;  4I62 A;  1AIV A;  4DE8 A;  4ZE8 A;  3T93 B;  4PET A;  3O6H A;  5LDZ A;  3TUS A;  5I59 B;  2YLN A;  4I40 A;  4NMY A;  1FPK A;  1DMB A;  4QFL A;  1FBP A;  1B9J A;  4R6Y A;  1FBF A;  4R6K A;  1B05 A;  5IM2 A;  3VLW A;  2DE4 A;  4I3E A;  2QS1 A;  1DBZ A;  2WEF A;  3GZG A;  1LGB C;  3I5O A;  4PE5 B;  1JNF A;  2F78 A;  2XXQ A;  1GGG A;  2DOJ A;  3TYH A;  4XKN A;  2QMX A;  3CHG A;  1S50 A;  4O7I A;  3MC2 A;  5H8F A;  1MXZ A;  1H43 A;  2DXR A;  1FJ9 A;  4QRZ A;  1IIT A;  2OLB A;  1MPC A;  1HSE A;  4AS4 A;  4YKJ A;  1ZMG A;  1Y20 A;  5M2V A;  4ONY A;  3PMW A;  2QVR A;  2ZZV A;  4PBQ A;  3OO6 A;  4OER A;  1FTK A;  4X48 A;  2F35 A;  2QJE A;  4HE1 A;  2AYS A;  3EHS A;  1H45 A;  4LON B;  4YKI A;  5CBR A;  3D4G A;  4H5F A;  4RNS A;  3SET A;  3DRG A;  3PU5 A;  4LVQ A;  3K6V A;  1B32 A;  2NXO A;  3S9M C;  1CB6 A;  2RC8 A;  4PGP A;  4GBV A;  3T0J A;  1LBZ A;  4N07 A;  1MDQ A;  5ICT A;  4RJZ A;  1DPP A;  5BWJ A;  4X8R A;  2QVU A;  3H3G A;  3FUZ A;  4NWC A;  4ZEK A;  1POY 1;  1YAE A;  1MQH A;  1NUZ A;  2F8D A;  5A5L A;  4AS5 A;  1CE2 A;  1IUD A;  3D1R A;  3IOT A;  4THI A;  1N04 A;  1GTK A;  3Q27 A;  4EXL A;  1SW4 A;  1IXH A;  5L9M A;  1LCF A;  2HXR A;  1ZJL A;  3TEP A;  4OVJ A;  4H8I A;  4OHN A;  3PGF A;  3PMV A;  3V89 B;  1N0T A;  2F7B A;  3FVK A;  2PFY A;  2XX9 A;  1I6B A;  4NF8 A;  1FSA A;  1B52 A;  1YPN A;  4XKR A;  1MPB A;  4RK9 A;  3LSF B;  3IB0 A;  1N7X A;  3K00 A;  4NF6 A;  4OFL A;  3OSR A;  2HZK A;  1YZ0 A;  2RIN A;  1IIW A;  3E9X A;  3QSL A;  4FAJ A;  1P1U A;  4PFU A;  1RKM A;  5IAI A;  4I1D A;  4QXD A;  1FBE A;  4AB6 A;  1ZIU A;  2PFZ A;  4OEV A;  2FYI A;  1B5H A;  3ROJ A;  2F97 A;  1MPD A;  3B8B A;  1DPE A;  3C32 A;  3UGW A;  1LCT A;  4IY6 A;  3QMF A;  2Z8F A;  5F24 A;  2HEU A;  2QS4 A;  3FBP A;  1DSN A;  1DK4 A;  2DVC A;  2UYF A;  3LR1 A;  4C1U A;  1MH4 A;  5HM4 B;  4HTG A;  4DCY A;  2HQ0 A;  3FV2 A;  4IO7 A;  1SBP A;  3MPK A;  2KR0 A;  5CMK A;  1NV7 A;  3B6Q A;  3HV1 A;  3BKI B;  5J1D A;  1Z7M E;  3D4C A;  4NAP A;  2ONS A;  3HN0 A;  3USD A;  3KN7 A;  4FE8 A;  3DP4 A;  5ISU A;  4GRK A;  4IGT A;  2CZL A;  2H25 A;  1FQA A;  4R2B A;  1SI1 A;  1FTA A;  4IO2 A;  3PUZ E;  1B40 A;  2CMO A;  4MX6 A;  1IZ1 A;  5LTC A;  1FPJ A;  1BTJ A;  4I8C A;  1UIV A;  1LAF E;  2Y7P A;  1ELJ A;  1B1X A;  4DDD A;  4H46 A;  2V93 A;  3DRK A;  4R9G A;  1HSL A;  1FPL A;  1IQ7 A;  3KOS A;  5ICQ A;  3SKP A;  3FXR A;  2BJI A;  4OZ9 A;  1OVB A;  3RYA A;  4PP0 A;  3TTK A;  2ABH A;  4DLD A;  2VD3 A;  4GLI A;  3MYU A;  1PB7 A;  1SW1 A;  1FPD A;  2I4B A;  1AOV A;  4G2Z A;  4MIJ A;  4XIG Q;  4PE3 A;  2WYP A;  5ET5 A;  4PGN A;  3BFT A;  4PAK A;  2I49 A;  3N5L A;  1DTZ A;  2Q2C A;  3MST A;  4MEV A;  1LBV A;  3TFL A;  4GWU A;  2E0S A;  2QL3 A;  5I7I A;  4EDP A;  5EQ7 A;  2DWJ A;  4UAB A;  1XHY A;  1VR5 A;  2O6A A;  3O2A A;  4FBP A;  2DSF A;  2H99 A;  4BDL A;  5FHO A;  3VDF A;  4JSO A;  4OAN A;  1R6Z A;  3RUM A;  3VE1 B;  4NF0 A;  2HPG A;  3OEN A;  3VFJ A;  5JTY B;  5H8Q B;  4LZ5 A;  4G61 A;  4G77 A;  3R6U A;  4YKP A;  1D9V A;  3OXN A;  5HBC A;  1I6A A;  5ET6 A;  2XA5 A;  4FIM A;  1K9Z A;  3T22 A;  1XI6 A;  2ONR A;  5BUU A;  3MAM A;  1XVY A;  3FJG A;  1FPI A;  2XWI A;  2V25 A;  3N6U A;  1B5I A;  5JEI A;  4OES A;  2DWA A;  4PFT A;  3H7M A;  2FNC A;  3PUW E;  4IO3 A;  1URD A;  4GL8 A;  1EYK A;  3RY3 A;  4F1U A;  2I58 A;  3KC0 A;  3TKD A;  1B3E A;  3FAT A;  2H4I A;  5FTI A;  3IK6 B;  3LSW A;  1TXF A;  4RXL A;  3KJ7 A;  3PPN A;  4IY5 A;  2ANJ A;  3EKI A;  1NNT A;  4X04 A;  3UN6 A;  1IXG A;  1B0L A;  4R72 A;  3IR1 A;  2P3V A;  4GFR A;  4PFB A;  4KXP A;  3N26 A;  3NOH A;  2XXV A;  3L6H A;  3SDF A;  1LFI A;  1MQG A;  4XKQ A;  5FHN A;  1NKX A;  1LB9 A;  4O3B A;  5EQA A;  1IXC A;  3UP9 A;  4O8M A;  4WXJ A;  3CFL A;  3LVU A;  5JTY A;  2R71 A;  5H8Q A;  1ANF A;  2X7P A;  3CI8 A;  3TQL A;  4MHF A;  4RY1 A;  1A99 A;  1Y3N A;  2HXW A;  4GL0 A;  2I4C A;  3I6V A;  1HSJ A;  1F9B A;  4MFI A;  4R6H A;  3HHG A;  5DVI A;  4ZDM A;  5TU0 A;  1VE4 A;  3B6T A;  4XEQ A;  4F19 A;  5IKB A;  1LFG A;  2WX9 A;  3CR9 A;  2ZXT A;  4MMP A;  5I58 B;  4F2O A;  2UYE A;  2Q74 A;  4H67 A;  4G8M A;  1JW5 A;  5DT6 A;  1UTH B;  4KYD A;  3RTF B;  5AA2 D;  2H5Y A;  1LLS A;  4IR8 A;  4YAH X;  4LQ2 A;  2PYY A;  2KLF A;  2OWT A;  2B4M A;  4GQO A;  1FPE A;  1JW1 A;  4ESX A;  2V3U A;  3H6U A;  4ZED A;  3OSQ A;  3RLF E;  2P1S A;  3HHF A;  4FEC A;  4P56 A;  1P1Q A;  3PD9 A;  4JDF A;  2UVG A;  4HCY A;  3TMG A;  3DRH A;  1UQW A;  3SEY A;  3N94 A;  1B7H A;  3MVZ A;  1FBD A;  2RCB A;  1TFD A;  4HE0 A;  3VVE A;  2ALU A;  2IEE A;  2X26 A;  4RPO A;  2DS9 A;  5I57 B;  4HS7 A;  3VVD A;  5KCJ A;  4KCD A;  3R7X A;  4Q5T A;  2GH9 A;  3B6W A;  3N6T A;  3TZA A;  3A3C A;  4JWX A;  5DYH A;  2THI A;  3UOR A;  4XF5 A;  3CSG A;  1RDX A;  3O9P A;  5AA1 A;  4PQJ A;  4G8H A;  1QJM A;  3FD3 A;  4RPN A;  5TPA A;  1S9T A;  1N7W A;  2DWH A;  2H9B A;  4P1E A;  2RF1 A;  5I58 A;  1P99 A;  1WDN A;  3C4M A;  1XOC A;  3OEK A;  2ZNS A;  2RKM A;  2Q89 A;  1UTH A;  1MM6 A;  4LZ8 A;  3I3V A;  5H8H B;  4ECF A;  4P0G A;  4GX3 A;  1A7L A;  2Y7K A;  4DZ1 A;  3G3K A;  3OO8 A;  4IGR A;  4NWD A;  1IMD A;  3CFX A;  4OWD A;  3ILU B;  4GD5 A;  3W15 C;  4ELQ A;  4DI3 D;  5AA4 A;  1FPG A;  1RDY A;  1OVT A;  4MH5 A;  3TDJ A;  1N3W A;  4R9F A;  2Q8M A;  3SEV A;  4BDN A;  3ECR A;  1Y1M A;  1QUI A;  4RYA A;  1XVX A;  3U1O A;  3QIM A;  2Y7R A;  3OD7 A;  4TOZ A;  3T66 A;  4ZEB A;  1Y4C A;  1B7Z A;  3K01 A;  4MJO A;  4MNI A;  3GBB A;  1B4H A;  2PCR A;  2WOL A;  1II5 A;  4PF8 A;  5I2K B;  5A5X B;  2QVV A;  4O7M A;  4YKK A;  3MBP A;  1OMP A;  1NUX A;  1P1N A;  3G7W A;  5DVJ A;  3FZV A;  4ZS9 A;  4KR5 A;  4BDM A;  4G68 B;  4GX6 A;  1GVC A;  3WAF A;  5DVF A;  3CFZ A;  4JWY A;  1UTB B;  3TAJ A;  3FJ7 A;  5I59 A;  2ZYK A;  2A5T B;  1IMC A;  3Q25 A;  4JVI A;  2UVH A;  3V83 A;  3RYD A;  4F3S A;  1MXV A;  3DRJ A;  3CSB A;  1Y3P A;  1NMU A;  4LAT A;  1POT A;  4KPT A;  5CMC A;  3GXA A;  3MVW A;  3JZJ A;  2I48 A;  1NL5 A;  1NNK A;  2KQZ A;  4F3P A;  3PD8 A;  1MXW A;  4P3L A;  5H8H A;  2RC7 A;  4QFP A;  3EQ1 A;  4TQU Q;  4F22 A;  3KN3 A;  3QUJ A;  3O28 A;  3TCH A;  1CNQ A;  1A55 A;  1N76 A;  2XX7 A;  4MCO A;  5AE4 A;  2NWJ A;  2F5X A;  3FV1 A;  1WOD A;  3TCG A;  1TT1 A;  4P0I A;  3MPL A;  3CRB A;  1MS7 A;  2PVU A;  2B4L A;  1LBX A;  1OQG A;  5K2Y A;  3KFM A;  1MY2 A;  5FTH A;  2D21 A;  3FXU A;  2ZZX A;  1JQF A;  1RYX A;  1VFD A;  3B50 A;  3T1B A;  1M5E A;  1MDP 1;  3LUY A;  5I2K A;  1H44 A;  5A5X A;  3PUV E;  1P1W A;  1QUJ A;  2VT5 A;  4FAT A;  5TP9 B;  3Q26 A;  3DRF A;  3PPP A;  4GF8 A;  1LBB A;  5AA3 A;  4POW A;  2V3T A;  3DRI A;  2Y7I A;  2P2A A;  3UA8 A;  3CG3 A;  2Y84 A;  3JYR A;  2M8C A;  3LSL A;  1UTB A;  1MQD A;  2DE3 A;  2I3V A;  2AL4 A;  2A5T A;  2ZYO A;  2I0C A;  2Y5L A;  5B7D A;  2OZZ A;  4PBH A;  1VSO A;  3KZG A;  4GXS B;  4X1B A;  2DDK A;  3O6G A;  3E4R A;  3RPL B;  5CI5 A;  3MW0 A;  1FPB A;  2UXA A;  2ESN A;  3FAS A;  4U4S A;  4GWY A;  1B3G A;  2NOO A;  1US4 A;  3C31 A;  2B3B A;  3FXQ A;  4P9K A;  1IMB A;  4UAC A;  3S2V A;  1NNP A;  2F3D A;  3U65 A;  1IMF A;  4GOT A;  4QSE A;  4NG7 A;  3U93 A;  3H6V A;  3KSX A;  5J16 A;  1FTO A;  4XXU A;  4MNP A;  5IZ1 A;  3DEL B;  1PDA A;  1JW4 A;  1Q9D A;  4X9T A;  2P0S A;  2V3Q A;  4H5G A;  4AB5 A;  1NV2 A;  4F1V A;  2F6G A;  5FHM A;  1Y9U A;  1I69 A;  1NH7 A;  2DE2 A;  2CEY A;  1LBW A;  5TP9 A;  3PUY E;  2VOZ A;  1SI0 A;  3OO7 A;  2B65 A;  2VPN A;  3MVX A;  2O7U A;  3IO4 A;  3MJN A;  4GVO A;  4KFQ A;  1M5D A;  1SPI A;  4OMB A;  3W9W A;  1Y4T A;  4OVP A;  4Q8R A;  4U23 A;  2XXT A;  3S9L C;  2YPN A;  1SVX B;  4O3C A;  4TLM B;  4F3G A;  1FQC A;  1QKA A;  3PAM A;  2Y7W A;  3LBS A;  4OVS A;  4OVT A;  2FIE A;  2ZNT A;  3PPR A;  3TTL A;  3ISP A;  4ELR A;  1NNF A;  1A8E A;  5EQ8 A;  1Q1K A;  3VXC A;  3SEW A;  3MP6 A;  3SER A;  3O6I A;  2BJJ X;  3A29 A;  4Q30 B;  3EN3 A;  1IMA A;  3H6T A;  2V4C A;  5JK4 A;  5ITP A;  1MRP A;  3QXM A;  4ZEF A;  3TTR A;  1URG A;  2ZYM A;  1GR2 A;  2GQ1 A;  4AQ4 A;  3R26 A;  1URS A;  1MQJ A;  3H4Z A;  1T0K A;  1MG1 A;  3V5A A;  1SYH A;  3IOW A;  4G68 C;  1JET A;  4ZZA A;  3TPA A;  3K0V A;  1ZTY A;  4PFI A;  1TFA A;  2XXW A;  1NV6 A;  2XWO A;  2OWS A;  2O1M A;  3WAE A;  2PT1 A;  4U2R A;  4U1Z A;  4FJP A;  5DEX B;  3MP8 A;  1OLA A;  5CRY A;  2QS3 A;  3QUF A;  1SW5 A;  1ATG A;  4YU0 A;  5CBS A;  5I2N B;  2P3N A;  3KEI A;  4GWZ A;  3EHT A;  3MVY A;  4H8J A;  3TEL A;  1VDW A;  3VV5 A;  4NQ8 A;  2F7C A;  4H65 A;  3U72 A;  1ZLQ A;  5CMB A;  3HCQ A;  3MUQ A;  4FOR A;  4PDD A;  1SDX A;  2QPQ A;  1A54 A;  5T3J A;  3LUZ A;  5ITO A;  4I9D A;  4XFE A;  1YTV A;  4QSD A;  2UVI A;  5EYF A;  3H03 A;  3KN8 A;  4NF5 B;  1NUY A;  2H98 A;  2IA4 A;  3S4U A;  4TLL B;  2DP8 A;  3FVG A;  5I5P A;  1IXI A;  4F3B A;  2QFL A;  1SYI A;  1QVS A;  3SEX A;  1L5T A;  1B2H A;  3T96 B;  1PBQ A;  4MLQ A;  1FCK A;  2FVZ A;  4M1V A;  3DM0 A;  3IX1 A;  1Y1Z A;  3MP1 A;  3L6G A;  3K02 A;  3T9H B;  3JV9 A;  4OXV A;  3AXF A;  4RK2 A;  1R1N A;  3PMX A;  4PC9 A;  4KYE A;  1XC1 A;  4GWS A;  5CMM A;  5DEX A;  3PPQ A;  2XXR A;  1MXY A;  1VFE A;  1M5F A;  1WVJ A;  2DXY A;  1XS5 A;  2I3W A;  4KHZ E;  4EXK A;  5I2N A;  2CZI A;  2HZL A;  1B51 A;  3K1N A;  2V84 A;  3IJX B;  4OYV A;  3BIH A;  5AA2 B;  3M8U A;  3G3H A;  3MQ9 A;  1JVX A;  2HAU A;  4P47 A;  4EQB A;  5LOM A;  3QAX A;  5CC2 A;  4BDR A;  4OFJ A;  4OA4 A;  3BIG A;  3TQW A;  2F7A A;  4GBW A;  3T9U A;  3A09 A;  4JBZ A;  4N8G A;  4H1X A;  2DQV A;  4QHQ A;  3KGC A;  3HO7 A;  4LP2 B;  3DP6 A;  2ZMB A;  3VLU A;  3OOA A;  2VPO A;  2WYK A;  3OMB A;  4H6D A;  3LSX A;  1MQI A;  4E0W A;  1QUK A;  3P7I A;  2CZH A;  3ILT B;  4GX4 A;  4N4U A;  5L9O A;  3Q29 A;  4QFO A;  1KA1 A;  3RGY A;  1NFT A;  4ZZE A;  1AL3 A;  3KC1 A;  4O94 A;  1LST A;  4DCX A;  2E1S A;  1BP5 A;  1FRP A;  4JVC A;  2X7Q A;  1FTL A;  4LQ5 A;  4QSC A;  4OVR A;  4DXU A;  4YB5 A;  3IFA A;  1IME A;  3W9V A;  4C1T A;  2OJT A;  1R9L A;  3OEL A;  4HW8 A;  1MY4 A;  3GLB A;  3C35 A;  1Q35 A;  2HHM A;  5AA2 A;  4FED A;  4YB6 A;  2VGQ A;  3C34 A;  4KI0 E;  1YCJ A;  1O64 A;  4C0R A;  4PCD A;  3E79 A;  4MF3 A;  1B58 A;  2OK2 A;  3F11 A;  4N15 A;  3LC8 A;  1PEB A;  2ZYN A;  4OTE A;  3SES A;  4MAG A;  5H8S A;  1O7T A;  3IFC A;  1PB9 A;  2XXX A;  1BK4 A;  4Z0I A;  4EF2 A;  1OLC A;  1NV1 A;  4R73 A;  3QYT A;  4EQ7 A;  1M5B A;  2REG A;  1OQH A;  2Q8J A;  4F1Y A;  4IO5 A;  2OBG A;  1FQF A;  4G8N A;  4R2F A;  4U22 A;  3ZSF A;  1MH3 A;  4QFK A;  4WED A;  2O84 X;  1MY0 A;  2DWI A;  2XXH A;  2XXY A;  4YIC A;  1P1O A;  4BDQ A;  3K6X A;  4Z7E A;  4NF8 B;  4P11 A;  1B3F A;  2FA7 A;  1D3K A;  4G4P A;  4PF6 A;  1JVY A;  4POX A;  5I57 A;  4GWX A;  3RTW B;  4O3A A;  1H3D A;  2WBB A;  4NF6 B;  1USY E;  2O51 A;  3TCF A;  3T9V A;  2Q2A A;  5IZZ A;  4KYS A;  3HST A;  3TTN A;  1FJ6 A;  3QK6 A;  4BLA A;  2NUV A;  5B70 A;  1B6H A;  2RCA A;  1FQE A;  1B5J A;  1N3X A;  2F3B A;  2AIX A;  4X1D A;  2XXI A;  2FBP A;  2XXP A;  5KZT A;  1EZO A;  4JVD A;  3HPI A;  3RT8 A;  4QFN A;  2L5V A;  1QUL A;  2QSX A;  4NTL A;  2REJ A;  4PAI A;  2RC9 A;  5I56 B;  4R75 A;  4U4X A;  1YXI A;  1KZ8 A;  3ZKK A;  3HFU A;  3RYB A;  1AH5 A;  3V8X B;  1N84 A;  2XWV A;  1NV0 A;  1FQB A;  2CZK A;  4U21 A;  2O68 A;  1EYJ A;  3K4U A;  2WOP A;  3G3I A;  3FGS A;  2XXK A;  2JJK A;  5H8N B;  2HAV A;  2R6G E;  5EYG A;  3IOU A;  1QKB A;  4M4G A;  4GWW A;  3PUX E;  4LZ7 A;  4EUO A;  3TTM A;  5DW8 A;  4DXB A;  2PT2 A;  1EH3 A;  3FIR A;  1JEV A;  1I6Q A;  5IGA A;  4G68 A;  1ZBM A;  2XXU A;  2XX8 A;  1B4Z A;  2O1L A;  1GV8 A;  2Q88 A;  3EF7 A;  4NED A;  4P1L A;  5EHM A;  2WKY A;  4EF1 A;  4ELO A;  4UA8 A;  1Y3Q A;  4NGU A;  4LN5 A;  4JXI A;  4ELP A;  4I3Y A;  3O66 A;  2O7I A;  3K1P A;  4N6D A;  4F18 A;  5EYH A;  1MM7 A;  1B1H A;  1LB8 A;  4MLV A;  2GRV A;  1D9Q A;  5I56 A;  4IB2 A;  5L9S A;  1LAX A;  3ODB A;  3A3U A;  1DCU A;  2QRY A;  4FEB A;  1FBH A;  1USY H; 
#chains in the Genus database with same CATH homology
 1ZLQ A;  4PAF A;  4PDD A;  2QPQ A;  4JSD A;  3DRG A;  4ZED A;  5T3J A;  3LUZ A;  4I9D A;  4XFE A;  1B32 A;  4P56 A;  4PGP A;  4GBV A;  4HCY A;  3T0J A;  1LBZ A;  1NUY A;  3DRH A;  1UQW A;  1DPP A;  4X8R A;  1B7H A;  1FBC A;  2QVU A;  5FBP A;  3MVZ A;  1FBD A;  5I5P A;  4ZEK A;  1NUZ A;  2QFL A;  4HE0 A;  1LEV A;  5A5L A;  5CM6 A;  4AS5 A;  1B2H A;  2WBD A;  3D1R A;  4N81 A;  2HXR A;  5IZ3 B;  4PTK A;  4XF5 A;  2FVZ A;  4OFO A;  1RDX A;  4M1V A;  2WOK A;  3O9P A;  1NV3 A;  3RPL A;  4ZEI A;  1JEU A;  2PFY A;  1FSA A;  1B52 A;  4PC9 A;  3FTO A;  4P1E A;  2CEX A;  4XKR A;  4GWS A;  1XOC A;  1AWB A;  2RKM A;  5ESY A;  1B0H A;  4OFL A;  1QGX A;  2OWZ A;  1YYZ A;  4GX3 A;  3PTY A;  2HZK A;  4XKP A;  1YZ0 A;  2CZI A;  2HZL A;  2MKZ A;  1B51 A;  4FAJ A;  3SZP A;  4PFU A;  1IMD A;  1RKM A;  3BIH A;  3M8U A;  4DI3 D;  1FPG A;  1RDY A;  4QXD A;  1FBE A;  2Q8M A;  4P47 A;  2PFZ A;  4OEV A;  1B5H A;  1K9Y A;  1ZU0 A;  3ROJ A;  4OFJ A;  4OA4 A;  3BIG A;  3QIM A;  2ZZW A;  3B8B A;  4TOZ A;  1DPE A;  3T66 A;  4ZEB A;  2Q9T A;  4MJO A;  4GBW A;  4MNI A;  3QMF A;  4NN3 A;  1FBG A;  1B4H A;  2PCR A;  4H45 A;  5F24 A;  2WOL A;  3FBP A;  4PF8 A;  2QVV A;  4O7M A;  4N8G A;  4P8B A;  4NHB A;  1DK4 A;  5I3S A;  1NUX A;  5HM4 B;  4DCY A;  5ET7 A;  2VPO A;  2D5W A;  5ET8 A;  1G0I A;  2KR0 A;  2WYK A;  2FHY A;  5IZ3 A;  4GX6 A;  1NV7 A;  5J1D A;  4RA1 A;  4NAP A;  2OX3 A;  3ZS6 A;  1KA0 A;  2CZH A;  4GX4 A;  4N4U A;  3E78 A;  1IMC A;  4JVI A;  5ISU A;  4QFO A;  2R8T A;  3RYD A;  5F1Q A;  1KA1 A;  4N8Y A;  3DRJ A;  3KC1 A;  4O94 A;  1NV4 A;  4DCX A;  1FPF A;  4ZE9 A;  3MZB A;  1FTA A;  1B3L A;  1FRP A;  4JVC A;  4OET A;  1B3H A;  1B40 A;  3MVW A;  4MX6 A;  4OVR A;  3IFA A;  2KQZ A;  1IME A;  3W9V A;  5LTC A;  1FPJ A;  4P3L A;  4I8C A;  1UIV A;  4QFP A;  4H46 A;  4PFY A;  5L8D A;  3FXB A;  3TCH A;  1CNQ A;  2HHM A;  3GYY A;  4MCO A;  3DRK A;  4DI4 B;  3RQT A;  4PCD A;  3E79 A;  2Z23 A;  2F5X A;  1B58 A;  1NI9 A;  1FPL A;  3TCG A;  3DP8 A;  5ICQ A;  4N15 A;  2BJI A;  4PFR A;  2XWK A;  2B4L A;  3RYA A;  1LBX A;  2ZZX A;  4MAG A;  3MYU A;  3B50 A;  1FPD A;  3T1B A;  3IFC A;  4NX1 A;  1BK4 A;  4MIJ A;  1OLC A;  4PE3 A;  1NV1 A;  2VT5 A;  2WYP A;  3O6P A;  3DRF A;  5ET5 A;  4OVQ A;  4PGN A;  4GF8 A;  2FIX A;  4MNC A;  4PDH A;  3DRI A;  4PAK A;  3MST A;  4ZEC A;  4MEV A;  1LBV A;  4QFK A;  4N91 A;  4GWU A;  4WED A;  1G0H A;  2DE3 A;  5I7I A;  2Y5L A;  4HCW A;  3E3K A;  5EQ7 A;  4UAB A;  4YIC A;  4PBH A;  1VR5 A;  1JP4 A;  4FBP A;  4HE2 A;  2DDK A;  3RPL B;  1INP A;  3MZ9 A;  3MW0 A;  4JSO A;  4OAN A;  1B3F A;  4PF6 A;  4QBA A;  1FPB A;  4NF0 A;  4GWX A;  2HPG A;  4OEU A;  4GWY A;  1B3G A;  4G61 A;  2WBB A;  5EQ9 A;  3KBZ A;  3LV0 A;  2NOO A;  3TCF A;  4YZZ A;  4PFW A;  1EYI A;  5IZZ A;  1NUW A;  1FJ6 A;  5ET6 A;  2XA5 A;  4P9K A;  1B6H A;  1K9Z A;  1IMB A;  1B5J A;  1XI6 A;  2F3B A;  2F3D A;  4HXV A;  4N6K A;  1FPI A;  3U65 A;  1IMF A;  1B46 A;  2Y5K A;  4NG7 A;  2XWI A;  2FBP A;  1B5I A;  5KZT A;  4OES A;  5J16 A;  4JVD A;  4PFT A;  4QFN A;  4MNP A;  5IZ1 A;  4GL8 A;  2L5V A;  1EYK A;  3RY3 A;  4N17 A;  4F1U A;  3KC0 A;  1Q9D A;  4X9T A;  2V3Q A;  1NV2 A;  4F1V A;  4PAI A;  1RDZ A;  1LBY A;  2DE2 A;  2CEY A;  1LBW A;  2DVZ A;  1YXI A;  1KZ8 A;  3HFU A;  3RYB A;  2VPN A;  3MVX A;  2XWV A;  1UIU A;  1NV0 A;  2CZK A;  3EKI A;  4X04 A;  1SPI A;  1EYJ A;  1NV5 A;  3W9W A;  2WOP A;  4OVP A;  4ZE8 A;  2XXK A;  2JJK A;  4PET A;  2P3V A;  5EYG A;  4GFR A;  5LDZ A;  4PFB A;  4KXP A;  3NOH A;  1QKA A;  1QKB A;  4I40 A;  4GWW A;  1FPK A;  4XKQ A;  3PAM A;  5DW8 A;  4OVS A;  4OVT A;  4QFL A;  1FBP A;  2FIE A;  1B9J A;  5EQA A;  1FBF A;  3ISP A;  4O8M A;  1B05 A;  5IM2 A;  5EQ8 A;  3LVU A;  2DE4 A;  1JEV A;  5IGA A;  3A29 A;  4I3E A;  1DBZ A;  2WEF A;  1IMA A;  3I5O A;  2V4C A;  5JK4 A;  1B4Z A;  4MHF A;  4XKN A;  2GQ1 A;  4P1L A;  4NGU A;  3CHG A;  4LN5 A;  4O7I A;  4I3Y A;  1JET A;  4XEQ A;  3TPA A;  1FJ9 A;  4F19 A;  2OLB A;  2O7I A;  2WX9 A;  1ZTY A;  4PFI A;  4AS4 A;  4MMP A;  4N6D A;  4F18 A;  5EYH A;  1NV6 A;  2XWO A;  1B1H A;  4ONY A;  2Q74 A;  2QVR A;  1OLA A;  2ZZV A;  4PBQ A;  2GRV A;  4OER A;  1D9Q A;  4IR8 A;  2P3N A;  4GWZ A;  4HE1 A;  2B4M A;  3MVY A;  1DCU A;  1VDW A;  1FPE A;  1FBH A;  4NQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...