2B4MA

Crystal structure of the binding protein opuac in complex with proline betaine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
264
Chain Sequence
SAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Glycine betaine-binding protein
total genus 87
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2b4mA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2b4mA01
4JSOA 4FAJA 1B5HA 4QFLA 2WOKA 4JSDA 4GL8A 2O7IA 4GFRA 1B52A 1OLCA 1DPEA 4QFPA 3PAMA 3RYAA 3DRHA 3MW0A 1B46A 4ZE8A 3E3KA 1B58A 4I8CA 3MZBA 2WOPA 1QKBA 4ZEDA 4PFUA 3QIMA 1B4ZA 4ZEKA 4OFLA 3DP8A 1B05A 3DRKA 4OERA 1B40A 1UIUA 1QKAA 1ZTYA 3M8UA 4DCXA 3DRJA 4QFNA 2B4LA 3MVZA 1B32A 3LVUA 1B3FA 3FTOA 1DPPA 1RKMA 3O6PA 1B5JA 5F1QA 4XKRA 4ZEIA 2Z23A 4ZE9A 4ONYA 3DRGA 1B2HA 1B6HA 1B0HA 1B3HA 3MVXA 1JEVA 3MVYA 1UQWA 1JEUA 4XKPA 4DCYA 1XOCA 4XKQA 5HM4B 4I9DA 4RA1A 1B4HA 4XKNA 4WEDA 4QFOA 2NOOA 3RYBA 4OFJA 4TOZA 1B3LA 3TCGA 2GRVA 3DRFA 5KZTA 5ICQA 3T66A 3TCHA 3RQTA 4OETA 1ZLQA 3I5OA 3DRIA 4PFTA 3TPAA 1B7HA 1JETA 2OLBA 1B5IA 5L8DA 4OEVA 3RY3A 1B9JA 2RKMA 3O9PA 1B51A 4ZECA 3TCFA 1B3GA 1B1HA 3CHGA 3ZS6A 1VR5A 1OLAA 2D5WA 4GF8A 2WOLA 4OFOA 1ZU0A 4PFYA 4ZEBA 3MVWA 4OEUA 1UIVA 3MZ9A 4QFKA 2B4MA 4OESA 4PFWA 5ISUA
chains in the Genus database with same CATH superfamily
5JK4A 3IJOB 4MLVA 4DXUA 1NH8A 1EH3A 2QSXA 2O51A 4GX3A 2VGQA 1IMFA 2XD3A 2Y7WA 4FE8A 3TELA 1GTKA 1BKAA 1MS7A 1VE4A 2XXWA 4PBHA 4F39A 5FHOA 3EF7A 3IB1A 5H8FB 3K4UA 1P1WA 3FZVA 1B7UA 1FTAA 1SW2A 3DP8A 5J1DA 1MY0A 3QYTA 4R6HA 4WKMA 1INPA 3UGWA 4KD5A 1RYXA 1ZIUA 1Y9UA 4IB2A 3W9VA 4BDRA 1PBPA 2F3BA 5CM6A 4POWA 3IO6A 1PDAA 1YZ0A 2DQVA 1MM7A 4ZEFA 4OFJA 2R8TA 5CBRA 4RXLA 2FVZA 2O6AA 3RGYA 5ET5A 2ZZXA 1IQ7A 4DXCA 1VSOA 1XC1A 3B7DA 2I6EA 1A99A 1RYOA 1FCKA 2WYPA 1YAEA 4O3AA 1SBPA 1PB8A 1NUXA 1RDZA 2QVUA 1Y3PA 2XXPA 2B4MA 2ZZVA 2UVJA 1FPKA 4JVCA 3MP1A 4U1OA 2GH9A 2QMWA 4IO5A 2QRYA 1FBDA 1OLCA 1D9YA 3IOUA 5ITOA 5EQ7A 4BDLA 4O7IA 4JVDA 4U1ZA 5TU0A 2W7YA 1TFAA 4G68B 5LOMA 2A5TB 4ZEKA 1HSLA 5CMCA 2E1SA 3OOAA 2V4CA 1BLFA 3PUWE 4OXVA 3EHSA 2O7UA 4NF4B 4ONYA 2QS3A 4QHQA 2JJKA 1LEVA 1B6HA 4U21A 5CRYA 3CFLA 3MVYA 1JW5A 1MXZA 2P2AA 1URGA 1JQFA 3C31A 2PYYA 2VPNA 4H8JA 4YKPA 4F1VA 4MLQA 1VFEA 3BKIB 1NV0A 1MY2A 3SEUA 3A3CA 2V3TA 3OENA 1LSTA 3RT6B 1IMEA 3Q26A 2F7AA 2Z8EA 1LCTA 1QUIA 1VR5A 2WKYA 2A5TA 1URSA 4DI3D 3KSXA 2I4BA 2H5YA 2CZKA 4JVIA 4MNPA 2HZLA 1Y4TA 5ISUA 1IMBA 1KZ8A 2I48A 3TQWA 4JBZA 2UVHA 4UACA 1LFHA 3IFAA 1MQIA 5H8SA 2O7IA 1AH5A 1G0IA 3VLWA 1UTBA 3QK6A 3KBZA 5AA4A 2ZYOA 3H6WA 3N94A 2VPOA 3W9WA 3SERA 3DELB 1LCFA 4I8CA 2RC8A 4BDNA 1LFIA 1URDA 4G4PA 1XS5A 3E9XA 3WAFA 5EQ9A 1TWYA 4MAGA 1FPBA 2REGA 4RY1A 2AL4A 4HW8A 1ZKBA 4IO2A 1AIVA 3HSTA 5F1QA 2HFBA 3B6WA 3FD3A 2OWSA 1B2HA 5EYGA 1GR2A 2Y5KA 3S9EA 4X1BA 1FTKA 1PBQA 5CC2A 2Q88A 5JEIA 4YKKA 1P1OA 1IMAA 3D1RA 5AA2B 2DSFA 4QXDA 1OVTA 3PU5A 3KBRA 4F2OA 2F34A 3JV9A 2OLBA 2V25A 3ISPA 1I6AA 3FJMA 4EQ7A 1FBGA 2WEFA 5I59B 1JW1A 3U65A 4ZEBA 3R7XA 1YXIA 2UYEA 3U94A 3CSBA 4L17A 4F1YA 4PFWA 4OVTA 4NF6B 4NF5B 2DS9A 4F2QA 5I56A 4YB6A 2ONSA 2Q74A 4KFQA 4NWDA 3LUYA 5B7DA 2VHAA 1A54A 4R73A 3EQ1A 1MXXA 4PP0A 3H3GA 3JYRA 2CZIA 2Y7PA 3HCQA 5TP9B 3KC1A 1A8FA 1LAHE 1FQDA 4ZEDA 2QVRA 4IO4A 3Q25A 3V8XB 2RCAA 3MPLA 4LONB 3OEMA 4GWYA 3A09A 3LVUA 1M5DA 3LBSA 1SQYA 3O6GA 4GWSA 4KYDA 2Y5LA 2XWIA 2CZHA 2XXKA 3UORA 3G3JA 3RPWA 1H44A 4XKNA 4GQOA 1M5FA 4HXVA 4O94A 3R6UA 4NMYA 4NF5A 3B8BA 3FJGA 2XXTA 5H8FA 2DWAA 2H98A 1FJ9A 1SYIA 2RC9A 2THIA 4PETA 3O6IA 4THIA 4QF9A 1SDXA 3FVNA 3KG2A 3E78A 3PTYA 3SEWA 3FBPA 1B3GA 1B1HA 3CHGA 1N0TA 1FBEA 4LQ2A 1D9VA 1QJMA 4NG7A 4O8MA 4YAHX 3V5AA 5I7IA 2Q89A 4PAFA 1NFTA 4ELOA 4IY5A 3UIFA 3H7MA 3VXCA 4GVOA 4LZ8A 3EHTA 5ICTA 1B52A 4U2RA 5AA2A 3RTWB 1A7LA 1POTA 1O64A 4ZE8A 3K0VA 3DP4A 2GHBA 4UA8A 1JNFA 1MG1A 1SI1A 1NUYA 2DWJA 3IOWA 1HSEA 3PMXA 1A40A 4OVJA 1AOVA 4DCXA 4R74A 4ECFA 1LAXA 1LLSA 5K2XA 2HAUA 2QL3A 2P3VA 1VFDA 3KZGA 2PCRA 3CG1A 5IKBA 1QUJA 3PMWA 4F19A 1NV1A 1B0HA 5DVFA 4TQUQ 4GLIA 1B4HA 3T93B 4WEDA 2G29A 3IOVA 4OMBA 4OYVA 2R71A 4EXLA 3HO7A 3D4GA 2DDKA 3C33A 2Q9TA 3KOSA 3U93A 3VVFA 4R9FA 4MIJA 1PB9A 1TXFA 2DWIA 2FNCA 3V89B 2D5WA 4K3FA 2ZNSA 1BP5A 2WBDA 4N4UA 1UIVA 5CI5A 3N6UA 5I2NA 4AS4A 1XI6A 4N91A 2DXYA 4DLDA 2QVVA 3FUZA 1POY1 3OXNA 4MH5A 4Q0CA 1NV5A 4JSOA 3RPLB 3MC2A 1NUZA 4QBAA 3FIRA 4R72A 4GX6A 4XF5A 4LA9A 3BIHA 4UABA 4KPTA 3L6GA 4NN3A 4FATA 3N26A 3TODA 1MXVA 1CNQA 4LATA 1OVBA 3P7IA 1MXYA 4PFUA 3MJNA 1GV8A 1AWBA 1RDYA 5EHSA 2B4LA 4PGNA 1LB8A 3K1NA 1EYIA 1B32A 5LDZA 1US4A 5J16A 1LGBC 2H9BA 4KI0E 4NX1A 3A29A 2XXXA 3OO8A 3K01A 1IEJA 4OHNA 3KN8A 1BIYA 3TCGA 4MNCA 4HCWA 1R1NA 4GXSB 2Q8JA 3MYUA 1K9YA 3E4RA 4PFIA 2KR0A 4ESWA 2F6GA 3RPLA 5ESYA 2GQ1A 1FBCA 1JETA 2Q8MA 5L8DA 3B6QA 3T96B 4EF1A 2XXRA 5H8NA 1S9TA 2XWVA 3K00A 4LZ7A 2Y7KA 3OO6A 4RJZA 3KN3A 3TYHA 4Q5TA 3K02A 1EZOA 1H3DA 4DXBA 5L9MA 2HHMA 1FTJA 3H6TA 2KLFA 2BJIA 1FTLA 2V3UA 4F3SA 4JWXA 4NAPA 3FATA 1UTHA 3CFXA 4H67A 3H4ZA 4QFLA 4GL8A 3PUZE 5AA1A 4PF6A 1AMFA 1D3KA 2UVGA 2YJPA 2X7QA 4AQ4A 3OSQA 3BIGA 3A3UA 1IXGA 3USDA 5A5XA 1MXUA 3GXAA 4N15A 1B46A 5DEXB 3EHUA 1EYKA 3IL1B 2WOPA 5EQAA 4G68A 1F9BA 1MQGA 3TTLA 3S4UA 1EYJA 5I58A 5ET8A 3TFLA 3DRKA 2I3WA 1QKAA 3MUQA 1MH4A 2ONRA 1RKMA 4PFBA 3ECRA 4U23A 1FBHA 5IZ3B 4GWOA 1LBCA 1I69A 4M4GA 1KA1A 1NNKA 2FIEA 5CMBA 4PFRA 3DRFA 3T66A 2YLNA 3O2AA 1MM6A 1FPJA 1R9QA 3C9HA 1FQFA 3HHGA 1B7HA 4YB7A 2B3BA 2OWZA 2PVUA 3OD7A 2NUVA 3KJ7A 2I4CA 1H76A 2LAOA 4IGRA 3GZGA 3KFMA 2REJA 3L6HA 3S9NC 5K2YA 2VP1A 4I3EA 2M8CA 4OENA 4XXUA 1MH3A 1FPLA 1Z7ME 1IIWA 1BTJA 3IO4A 1LBXA 2DXRA 3K6UA 3ROJA 4GWWA 1MPBA 1N3XA 3IAZA 4H65A 4YZZA 1VDWA 4QSCA 2CZLA 3TQLA 4IO7A 1LBVA 3Q29A 1FPDA 2O1MA 5H8QA 4N81A 4TLMB 1FQCA 2ABHA 2F3DA 3GLBA 3FVOA 4OFLA 2F36A 5I3SA 4QFNA 1CE2A 2VOZA 4KCCA 5I59A 2XXHA 3Q28A 2R6GE 2ZYKA 3VLVA 1IXHA 2I58A 4N6KA 4C1TA 3MVXA 1NV3A 3IORA 1K9ZA 1UQWA 2OWTA 2ZNUA 4XKQA 2X26A 3K2DA 4KYSA 3SKPA 1B3LA 2DE4A 1H45A 4P0GA 5ICQA 3MQ9A 2ZMBA 3FXBA 3TCHA 1Z7NE 3AXFA 4OETA 4ZZAA 4XEQA 4OQOA 3IFCA 4EXKA 1FW0A 2F7BA 3VFJA 4OEVA 3M3FA 4F3PA 5T3JA 1FRPA 3SESA 2R9JA 3TCFA 2P3NA 4U22A 4DDDA 3LSLA 5TPAA 1Y1MA 5H8QB 3MSTA 4C1UA 5IZ3A 1M5BA 2P0SA 2Z8FA 2F97A 2DE2A 2H99A 2DVZA 2UVIA 3PUYE 3CFZA 2AL5A 2RF1A 1JVXA 2PT1A 4GFRA 1R9LA 3FJ7A 3V83A 3G3HA 3RYAA 1WVJA 4GOTA 1MY3A 1IMDA 2XX7A 1B58A 1JP4A 1QVSA 1TFDA 3UP9A 4F31B 2PFZA 4P8BA 1QKBA 3H6VA 5ITPA 4MMPA 1DK4A 3CSGA 4TLLB 2FHYA 4NTLA 1SW4A 5I57A 4F18A 4OERA 3M8UA 3QUFA 3MVZA 3H6UA 3C4MA 4POXA 5HBCA 1P1NA 1MQJA 1D9QA 4PTKA 3RLFE 5A5XB 4ELQA 2H4IA 5BUUA 4Z7EA 4KCDA 5AA4B 5IGAA 2Y84A 1L5TA 3N5LA 4BDOA 4P1LA 4EDPA 1NUWA 4N8GA 2NWJA 1UTHB 2F78A 1SI0A 5L9OA 1N76A 4GL0A 2I49A 3QSLA 1WODA 1MQHA 1N7XA 4GWUA 4N8YA 2XXQA 4PFTA 5KCJB 1KWHA 3RY3A 4H45A 5EQ8A 1FPGA 4O3CA 4C0RA 3ILUB 3FV2A 3RUMA 3E13X 3ODBA 3Q27A 4OEUA 5LTCA 3FXUA 4X04A 1MRPA 5ET6A 3TZAA 2L5VA 4BDMA 3LV0A 5JTYB 5I2KB 3T0JA 2O69A 3T9HB 2F5XA 1Y20A 1NNPA 2Y7IA 3KJTA 3TDJA 1DPEA 3T9XB 3VDFA 1MPDA 3PAMA 2Q2CA 1OMPA 3DRHA 1NV7A 3PPQA 2ZYNA 3TEPA 3MZBA 4ZZEA 4GWZA 4GBVA 5DEXA 1R6ZA 1B4ZA 1O63A 2RINA 3QUJA 3CIJA 1B1XA 2I3VA 1SW1A 3S2VA 1IUDA 1SYHA 1N04A 4AS5A 2XXVA 2ZXTA 4NF8B 5I2NB 2I0BA 1FSAA 2Z23A 4ZE9A 1LFGA 4YU0A 3BFTA 1CB6A 4GRKA 2OX3A 4NQ8A 3VV5A 1XT8A 4F3BA 4AB6A 4JDFA 2GRVA 2V84A 4HCYA 3PMVA 3HFUA 1P99A 4GBWA 4LZ5A 4BLAA 2XX8A 1ELJA 4FIMA 1PEBA 4HE2A 1B5IA 3ZSFA 2ALUA 4X48A 4ZECA 4RNSA 2O84X 1FTMA 4PE5B 4MF3A 4G8MA 4GF8A 3JZJA 3MVWA 4MHFA 4H46A 1M5EA 4OVSA 1LAFE 3G3IA 3ZKLA 1NNFA 4MCOA 4R2FA 2O68A 4OESA 3BFUA 2I0CA 2NXOA 4I3YA 3QXMA 4PQJA 2WOKA 3LR1A 1Q35A 2H25A 3CRBA 4Z0IA 4WEPA 1UTBB 3O29A 5FHMA 4JB7A 3ILTB 3NOHA 1LBZA 3FV1A 4XTCQ 5M2VA 2CMOA 1FQEA 3FGSA 4F29A 2RCBA 2AYSA 2NVUB 3GYYA 4YMAA 3U72A 2VT5A 4R2BA 1UIUA 2HXWA 1EU8A 1ZMGA 3PPOA 1NV4A 4H0WA 1NMUA 1MPCA 1B5JA 4PDDA 4XKRA 1SW5A 1YTVA 4NF4A 3PV0E 4NF6A 5KDTB 4LUBA 1JW4A 1NKXA 4JWYA 3KEIA 5DW8A 3IR1A 5KZTA 5IZZA 5KDTA 3RQTA 5H8HA 4BDQA 3MAMA 3TPAA 2HAVA 2XX9A 2RC7A 2FBPA 5DT6A 3OO9A 1B9JA 1NV6A 4AB5A 3S9LC 4OVPA 4R75A 5I2KA 1D4NA 3PUXE 4F3GA 3KC0A 4EQ9A 3DM0A 4NE4A 4MNIA 3ONMA 4H5GA 4OFOA 3HV1A 4ZS9A 5TPAB 3RYDA 3QAXA 3R26A 5DYHA 3SEVA 2Y7RA 3FXQA 1B7ZA 3SZPA 4P3LA 2QFLA 4MBPA 3RT8A 4FAJA 1YCJA 3F11A 3K6VA 4H6DA 3U1OA 1QUKA 2UYFA 1N3WA 2F35A 4F22A 4FORA 3HN0A 4U4XA 2BJJX 2HPGA 4M1VA 4FBPA 1FQBA 3SEXA 4NF8A 3ZKKA 2F8DA 2VD2A 3OO7A 1Y4CA 5DTBA 4KR5A 5B70A 3QIMA 3TMGA 5EHMA 1ZTYA 3RN8A 5IZ1A 4H5FA 2PMSA 1B3EA 4OVQA 3H03A 3WAEA 1O7TA 3UK4A 4GXAA 1JEUA 1HSJA 4KXPA 4NEDA 5HM4B 4RA1A 4QFOA 2NOOA 2ONKE 4H8IA 4TOZA 3K1MA 3PPPA 5H8HB 4P11A 4GD5A 2YPNA 2CEYA 5H8NB 1Q1KA 1ZJLA 4XIGQ 1N7WA 3VVDA 4H1XA 3O6HA 1OIBA 1OQGA 3RNNA 2OZZA 4E0XA 4N17A 3OMBA 2DWHA 1DSNA 5DVJA 2D21A 2XWKA 4EF2A 4HE0A 3KOTA 4P56A 5I57B 4QFKA 3GBBA 3CVGA 1SVXB 1SD3A 2DE3A 2ZZWA 2Z22A 3VXBA 4NHBA 5F7VA 3O97A 1YPNA 5I56B 3QMFA 4MJOA 4KQPA 5FTIA 3G3KA 5FBPA 4P9KA 2O1LA 5DVIA 1Y3QA 1Y1ZA 2FIXA 3PPRA 2MKZA 4RK9A 1MXWA 4LP2B 3MPKA 3SDFA 3TKDA 3G3FA 5AA3A 2QS1A 4IR8A 5ET7A 1B40A 1I6BA 2HEUA 4X8RA 2P1SA 4Q30B 2E0SA 1B3FA 4FECA 1DPPA 3VVEA 1B0LA 1DOTA 2Z8DA 5CMMA 4RK2A 5FTHA 3KGCA 3KSJA 5HPQA 1JEVA 1XOCA 2QS4A 4HE1A 2AIXA 2DP8A 5EYHA 5AE4A 2QMXA 2F7CA 3TTRA 3KN7A 4DZ1A 1FBFA 4R9GA 4PC9A 5TP9A 2V3QA 5FHNA 3SEYA 4PAIA 2XXYA 3O28A 4NWCA 3MZ1A 4I40A 4O3BA 4ELRA 1NL5A 3LUZA 5ELVA 4G68C 4O7MA 2XA5A 3PD9A 4P47A 1OLAA 1GGGA 1ZU0A 1SPIA 4G2ZA 4N13A 2ANJA 2UXAA 2F6PA 5JTYA 3TTMA 3U8QA 4ND9A 3CR9A 4G8NA 4PDHA 1NI9A 1ZBMA 4ESXA 4IO6A 1MY4A 1A55A 5EYFA 4JSDA 1RDXA 4EUOA 5I5PA 1IZ1A 2GHAA 1P1UA 3VE1B 5I84A 1IXCA 1NNTA 1IXIA 3E3KA 1J1NA 3C36A 4F1UA 1AL3A 4HS7A 4RPNA 3IX1A 3UN6A 3T22A 4OA4A 3TAJA 1B05A 2PT2A 3C35A 3T9VA 4I62A 1ANFA 1FPEA 1MQDA 1LAGE 4FEBA 3FTOA 3O66A 4IO3A 3IK6B 4ELPA 2KQZA 4R6KA 3K6WA 4R6YA 1B3HA 5BWJA 3FVKA 4DCYA 1KA0A 1N84A 5KCJA 5IM2A 5CMKA 4PAKA 1OQHA 1FPFA 1YYZA 5AA2D 2PBWA 2WYKA 3IB2A 3C32A 4P0IA 1USYE 5L9SA 3FVGA 3OSRA 3I5OA 2PFYA 2HCAA 3OELA 3M3LA 2HQ0A 1P1QA 3T9UA 2WX9A 1B51A 4DE8A 1TT1A 3ZS6A 2OJTA 1A8EA 1QULA 2CEXA 4GIZA 3LSFB 4PFYA 3MP6A 1G0HA 4YICA 4QRZA 3OEKA 1DBZA 2XHDA 4OTEA 1EZPA 3LSWA 3W15C 2IA4A 4G8HA 3EN3A 4P1EA 3H06B 4IGTA 4LQ5A 1B5HA 3MWBA 2HZKA 3PGFA 3TUSA 1S7YA 1FQAA 5CBSA 4DI4B 2GFEA 2DVCA 1I6QA 3MW0A 1H43A 1NV2A 1IMCA 3UA8A 3MP8A 4PBQA 3EKIA 1XVXA 1PB7A 3SETA 4Q8RA 5I58B 4QSDA 2QPQA 3DRJA 4I1DA 5A5LA 3K1PA 4ISUA 4N6PA 3FASA 1NH7A 2V93A 2FYIA 3CI8A 3DP6A 4X9TA 5IAIA 3DLNA 4LVQA 4OANA 3B6TA 4OZ9A 4PGPA 2XXUA 1DMBA 3PPNA 1USYH 2OCUA 4EQBA 1S50A 2B65A 1II5A 3U92A 3THIA 1MDP1 4X1DA 3RYBA 1JVYA 1DTZA 2A5SA 4YB5A 3FXRA 1T0KA 3IB0A 2OBGA 4N07A 1Y3NA 2ESNA 4KYEA 2G93A 1MDQA 2D3IA 2XWOA 3T1BA 4YKJA 1LBYA 4RYAA 4G61A 1FJ6A 4MFIA 3HHFA 3K6XA 3I6VA 3IJXB 2RKMA 4PE3A 3PD8A 3B50A 1LBWA 3I3VA 2QS2A 1XHYA 3MZ9A 4GX4A 1MY1A 1EZ9A 4LN5A 3C34A 3N6TA 4OVRA 1IITA 2Q2AA 4HTGA 2OK2A 4E0WA 4GWXA 4QFPA 2B3FA 2IEEA 1M5CA 1QGXA 3G3GA 4PF8A 2XXIA 3VLUA 4NGUA 3HPIA 4NF0A 1FPIA 1ATGA 2VD3A 1LB9A 4OWDA 4KHZE 4JXIA 3EPEA 4U4SA 4YKIA 4QSEA 2FA7A 3O6PA 3BBRA 4ZDMA 4ZEIA 2WBBA 3DRGA 3GBAA 3S9MC 4FJPA 2HXRA 1BK4A 4XKPA 4I9DA 3E79A 4PCDA 2DOJA 3TTNA 4JWOA 3G7WA 2XD2A 1US5A 4G77A 3M3KA 2PX1A 4YMBA 3PUVE 1Q9DA 4MX6A 2X7PA 5F24A 2ZYMA 2ZNTA 3D4CA 4MEVA 4FEDA 1ZLQA 3DRIA 1LBBA 1PC3A 3TTKA 2QJEA 3RTFB 3MBPA 1XVYA 3O9PA 1DTGA 2DYXA 4WXJA 4N6DA 3LC8A 1FBPA 4IY6A 1FTOA 3CG3A 2WOLA 4DIGA 4RPOA 4XFEA 1DCUA 3IOTA 1GVCA 3LSXA 1QW0A 1WDNA
chains in the Genus database with same CATH topology
5JK4A 4NHBA 4GX3A 1IMFA 3QMFA 4GFRA 1B52A 4MJOA 3RYAA 1IMDA 4PBHA 4ZE8A 5FBPA 1B58A 1JP4A 4P9KA 2FIXA 2PFZA 2MKZA 4P8BA 1QKBA 4MMPA 1DK4A 1NUYA 2FHYA 4IR8A 1FTAA 5ET7A 3DP8A 4F18A 4OERA 5J1DA 1B40A 3M8UA 4DCXA 3MVZA 4X8RA 1B3FA 1INPA 2P3VA 1DPPA 1D9QA 3W9VA 2PCRA 4PTKA 4F19A 1NV1A 2F3BA 1B0HA 5CM6A 1JEVA 1XOCA 5IGAA 1YZ0A 4HE1A 1B4HA 5EYHA 4WEDA 4P1LA 1NUWA 4OFJA 4N8GA 2R8TA 1FBFA 4PC9A 2V3QA 4PAIA 2DDKA 4GWUA 4N8YA 2Q9TA 4PFTA 4I40A 2FVZA 3RY3A 4MIJA 4H45A 5ET5A 3LUZA 5EQ8A 1FPGA 2ZZXA 4O7MA 2XA5A 4P47A 1OLAA 2D5WA 2WBDA 1ZU0A 1SPIA 2WYPA 5LTCA 4OEUA 4N4UA 1UIVA 1RDZA 1NUXA 2QVUA 1XI6A 4N91A 4X04A 4AS4A 2QVVA 2B4MA 2ZZVA 5ET6A 4JVCA 1FPKA 4PDHA 1NV5A 2L5VA 4JSOA 1NI9A 3LV0A 3RPLB 3T0JA 1NUZA 2F5XA 4JSDA 4QBAA 1RDXA 1FBDA 5I5PA 1OLCA 1DPEA 3PAMA 4GX6A 4XF5A 3BIHA 4UABA 4NN3A 5EQ7A 3DRHA 1NV7A 4O7IA 4JVDA 3E3KA 1CNQA 3MZBA 4F1UA 4GWZA 4GBVA 4PFUA 1B4ZA 4ZEKA 2V4CA 4OA4A 1B05A 1AWBA 1RDYA 2B4LA 4PGNA 1EYIA 1B32A 5LDZA 1FPEA 4AS5A 3FTOA 5J16A 4NX1A 2KQZA 3A29A 1FSAA 2Z23A 4ZE9A 4ONYA 2JJKA 1LEVA 1B6HA 1B3HA 2OX3A 3MVYA 4NQ8A 4DCYA 1KA0A 5IM2A 4PAKA 1FPFA 1YYZA 3TCGA 4MNCA 4HCWA 2GRVA 2VPNA 4HCYA 2WYKA 3HFUA 4GBWA 3MYUA 1K9YA 4PFIA 4F1VA 2KR0A 3I5OA 2PFYA 3RPLA 5ESYA 2GQ1A 1FBCA 1NV0A 1JETA 2Q8MA 4HE2A 1B5IA 5L8DA 2WX9A 1IMEA 1B51A 4ZECA 3ZS6A 2XWVA 1VR5A 4GF8A 2CEXA 4DI3D 4PFYA 3MVWA 4MHFA 4H46A 1G0HA 4OVSA 4YICA 2CZKA 2HHMA 1DBZA 4MCOA 2BJIA 4JVIA 4OESA 4MNPA 2HZLA 5ISUA 1IMBA 1KZ8A 4NAPA 4P1EA 4I3YA 1B5HA 2HZKA 3IFAA 4QFLA 2WOKA 4GL8A 2O7IA 1G0IA 4PF6A 3KBZA 4DI4B 3BIGA 3NOHA 1LBZA 4N15A 2VPOA 3MW0A 1B46A 3W9WA 4I8CA 1EYKA 2WOPA 1NV2A 1IMCA 5EQAA 3GYYA 4PBQA 3EKIA 1EYJA 5ET8A 3DRKA 2VT5A 5EQ9A 1UIUA 1QKAA 4MAGA 2QPQA 3DRJA 1FPBA 5A5LA 1NV4A 1RKMA 1B5JA 4PDDA 4PFBA 5F1QA 4XKRA 4X9TA 1FBHA 5IZ3B 1B2HA 4OANA 5EYGA 4PGPA 2Y5KA 1KA1A 2FIEA 3RYBA 4PFRA 5DW8A 3DRFA 5KZTA 1IMAA 5IZZA 3D1RA 3T66A 3RQTA 4QXDA 2XWOA 3T1BA 1LBYA 4G61A 1FPJA 1FJ6A 3TPAA 1B7HA 2OLBA 2FBPA 1B9JA 2RKMA 2OWZA 1NV6A 3ISPA 4PE3A 4OVPA 3B50A 3KC0A 4MNIA 1FBGA 1LBWA 2WEFA 3U65A 4OFOA 3RYDA 4ZEBA 1YXIA 3MZ9A 4I3EA 4GX4A 1FPLA 4PFWA 4OVTA 4P3LA 3SZPA 2QFLA 1LBXA 4LN5A 3ROJA 4FAJA 4GWWA 4OVRA 4YZZA 1VDWA 2Q74A 4GWXA 4QFPA 1QGXA 2HPGA 4M1VA 1LBVA 2CZIA 4FBPA 1FPDA 4PF8A 4NGUA 4N81A 3KC1A 4NF0A 1FPIA 2F3DA 4ZEDA 3QIMA 2QVRA 4OFLA 1ZTYA 5I3SA 4GWYA 4QFNA 5IZ1A 3LVUA 4OVQA 3O6PA 4ZEIA 2WBBA 3DRGA 4GWSA 2Y5LA 4N6KA 2XWIA 2CZHA 3MVXA 1NV3A 2XXKA 1K9ZA 1UQWA 1BK4A 1JEUA 4XKPA 2HXRA 4KXPA 4XKQA 5HM4B 4I9DA 3E79A 4PCDA 4RA1A 4XKNA 4QFOA 2NOOA 4HXVA 4O94A 4TOZA 1B3LA 2DE4A 5ICQA 1Q9DA 3B8BA 4MX6A 3FXBA 3TCHA 5F24A 4OETA 4MEVA 4XEQA 1ZLQA 3IFCA 2CEYA 1FJ9A 3DRIA 4PETA 4OEVA 3E78A 5T3JA 3O9PA 1FRPA 3PTYA 3FBPA 3TCFA 1B3GA 1B1HA 3CHGA 2P3NA 4N6DA 1FBEA 1FBPA 4N17A 2WOLA 2XWKA 4HE0A 4NG7A 4XFEA 4P56A 4O8MA 1DCUA 3MSTA 5IZ3A 4QFKA 5I7IA 4PAFA 2DE2A 2DE3A 2ZZWA 2DVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSO A;  4FAJ A;  1B5H A;  4QFL A;  2WOK A;  4JSD A;  4GL8 A;  2O7I A;  4GFR A;  1B52 A;  1OLC A;  1DPE A;  4QFP A;  3PAM A;  3RYA A;  3DRH A;  3MW0 A;  1B46 A;  4ZE8 A;  3E3K A;  1B58 A;  4I8C A;  3MZB A;  2WOP A;  1QKB A;  4ZED A;  4PFU A;  3QIM A;  1B4Z A;  4ZEK A;  4OFL A;  3DP8 A;  1B05 A;  3DRK A;  4OER A;  1B40 A;  1UIU A;  1QKA A;  1ZTY A;  3M8U A;  4DCX A;  3DRJ A;  4QFN A;  2B4L A;  3MVZ A;  1B32 A;  3LVU A;  1B3F A;  3FTO A;  1DPP A;  1RKM A;  3O6P A;  1B5J A;  5F1Q A;  4XKR A;  4ZEI A;  2Z23 A;  4ZE9 A;  4ONY A;  3DRG A;  1B2H A;  1B6H A;  1B0H A;  1B3H A;  3MVX A;  1JEV A;  3MVY A;  1UQW A;  1JEU A;  4XKP A;  4DCY A;  1XOC A;  4XKQ A;  5HM4 B;  4I9D A;  4RA1 A;  1B4H A;  4XKN A;  4WED A;  4QFO A;  2NOO A;  3RYB A;  4OFJ A;  4TOZ A;  1B3L A;  3TCG A;  2GRV A;  3DRF A;  5KZT A;  5ICQ A;  3T66 A;  3TCH A;  3RQT A;  4OET A;  1ZLQ A;  3I5O A;  3DRI A;  4PFT A;  3TPA A;  1B7H A;  1JET A;  2OLB A;  1B5I A;  5L8D A;  4OEV A;  3RY3 A;  1B9J A;  2RKM A;  3O9P A;  1B51 A;  4ZEC A;  3TCF A;  1B3G A;  1B1H A;  3CHG A;  3ZS6 A;  1VR5 A;  1OLA A;  2D5W A;  4GF8 A;  2WOL A;  4OFO A;  1ZU0 A;  4PFY A;  4ZEB A;  3MVW A;  4OEU A;  1UIV A;  3MZ9 A;  4QFK A;  2B4M A;  4OES A;  4PFW A;  5ISU A; 
#chains in the Genus database with same CATH topology
 5JK4 A;  3IJO B;  4MLV A;  4DXU A;  1NH8 A;  1EH3 A;  2QSX A;  2O51 A;  4GX3 A;  2VGQ A;  1IMF A;  2XD3 A;  2Y7W A;  4FE8 A;  3TEL A;  1GTK A;  1BKA A;  1MS7 A;  1VE4 A;  2XXW A;  4PBH A;  4F39 A;  5FHO A;  3EF7 A;  3IB1 A;  5H8F B;  3K4U A;  1P1W A;  3FZV A;  1B7U A;  1FTA A;  1SW2 A;  3DP8 A;  5J1D A;  1MY0 A;  3QYT A;  4R6H A;  4WKM A;  1INP A;  3UGW A;  4KD5 A;  1RYX A;  1ZIU A;  1Y9U A;  4IB2 A;  3W9V A;  4BDR A;  1PBP A;  2F3B A;  5CM6 A;  4POW A;  3IO6 A;  1PDA A;  1YZ0 A;  2DQV A;  1MM7 A;  4ZEF A;  4OFJ A;  2R8T A;  5CBR A;  4RXL A;  2FVZ A;  2O6A A;  3RGY A;  5ET5 A;  2ZZX A;  1IQ7 A;  4DXC A;  1VSO A;  1XC1 A;  3B7D A;  2I6E A;  1A99 A;  1RYO A;  1FCK A;  2WYP A;  1YAE A;  4O3A A;  1SBP A;  1PB8 A;  1NUX A;  1RDZ A;  2QVU A;  1Y3P A;  2XXP A;  2B4M A;  2ZZV A;  2UVJ A;  1FPK A;  4JVC A;  3MP1 A;  4U1O A;  2GH9 A;  2QMW A;  4IO5 A;  2QRY A;  1FBD A;  1OLC A;  1D9Y A;  3IOU A;  5ITO A;  5EQ7 A;  4BDL A;  4O7I A;  4JVD A;  4U1Z A;  5TU0 A;  2W7Y A;  1TFA A;  4G68 B;  5LOM A;  2A5T B;  4ZEK A;  1HSL A;  5CMC A;  2E1S A;  3OOA A;  2V4C A;  1BLF A;  3PUW E;  4OXV A;  3EHS A;  2O7U A;  4NF4 B;  4ONY A;  2QS3 A;  4QHQ A;  2JJK A;  1LEV A;  1B6H A;  4U21 A;  5CRY A;  3CFL A;  3MVY A;  1JW5 A;  1MXZ A;  2P2A A;  1URG A;  1JQF A;  3C31 A;  2PYY A;  2VPN A;  4H8J A;  4YKP A;  4F1V A;  4MLQ A;  1VFE A;  3BKI B;  1NV0 A;  1MY2 A;  3SEU A;  3A3C A;  2V3T A;  3OEN A;  1LST A;  3RT6 B;  1IME A;  3Q26 A;  2F7A A;  2Z8E A;  1LCT A;  1QUI A;  1VR5 A;  2WKY A;  2A5T A;  1URS A;  4DI3 D;  3KSX A;  2I4B A;  2H5Y A;  2CZK A;  4JVI A;  4MNP A;  2HZL A;  1Y4T A;  5ISU A;  1IMB A;  1KZ8 A;  2I48 A;  3TQW A;  4JBZ A;  2UVH A;  4UAC A;  1LFH A;  3IFA A;  1MQI A;  5H8S A;  2O7I A;  1AH5 A;  1G0I A;  3VLW A;  1UTB A;  3QK6 A;  3KBZ A;  5AA4 A;  2ZYO A;  3H6W A;  3N94 A;  2VPO A;  3W9W A;  3SER A;  3DEL B;  1LCF A;  4I8C A;  2RC8 A;  4BDN A;  1LFI A;  1URD A;  4G4P A;  1XS5 A;  3E9X A;  3WAF A;  5EQ9 A;  1TWY A;  4MAG A;  1FPB A;  2REG A;  4RY1 A;  2AL4 A;  4HW8 A;  1ZKB A;  4IO2 A;  1AIV A;  3HST A;  5F1Q A;  2HFB A;  3B6W A;  3FD3 A;  2OWS A;  1B2H A;  5EYG A;  1GR2 A;  2Y5K A;  3S9E A;  4X1B A;  1FTK A;  1PBQ A;  5CC2 A;  2Q88 A;  5JEI A;  4YKK A;  1P1O A;  1IMA A;  3D1R A;  5AA2 B;  2DSF A;  4QXD A;  1OVT A;  3PU5 A;  3KBR A;  4F2O A;  2F34 A;  3JV9 A;  2OLB A;  2V25 A;  3ISP A;  1I6A A;  3FJM A;  4EQ7 A;  1FBG A;  2WEF A;  5I59 B;  1JW1 A;  3U65 A;  4ZEB A;  3R7X A;  1YXI A;  2UYE A;  3U94 A;  3CSB A;  4L17 A;  4F1Y A;  4PFW A;  4OVT A;  4NF6 B;  4NF5 B;  2DS9 A;  4F2Q A;  5I56 A;  4YB6 A;  2ONS A;  2Q74 A;  4KFQ A;  4NWD A;  3LUY A;  5B7D A;  2VHA A;  1A54 A;  4R73 A;  3EQ1 A;  1MXX A;  4PP0 A;  3H3G A;  3JYR A;  2CZI A;  2Y7P A;  3HCQ A;  5TP9 B;  3KC1 A;  1A8F A;  1LAH E;  1FQD A;  4ZED A;  2QVR A;  4IO4 A;  3Q25 A;  3V8X B;  2RCA A;  3MPL A;  4LON B;  3OEM A;  4GWY A;  3A09 A;  3LVU A;  1M5D A;  3LBS A;  1SQY A;  3O6G A;  4GWS A;  4KYD A;  2Y5L A;  2XWI A;  2CZH A;  2XXK A;  3UOR A;  3G3J A;  3RPW A;  1H44 A;  4XKN A;  4GQO A;  1M5F A;  4HXV A;  4O94 A;  3R6U A;  4NMY A;  4NF5 A;  3B8B A;  3FJG A;  2XXT A;  5H8F A;  2DWA A;  2H98 A;  1FJ9 A;  1SYI A;  2RC9 A;  2THI A;  4PET A;  3O6I A;  4THI A;  4QF9 A;  1SDX A;  3FVN A;  3KG2 A;  3E78 A;  3PTY A;  3SEW A;  3FBP A;  1B3G A;  1B1H A;  3CHG A;  1N0T A;  1FBE A;  4LQ2 A;  1D9V A;  1QJM A;  4NG7 A;  4O8M A;  4YAH X;  3V5A A;  5I7I A;  2Q89 A;  4PAF A;  1NFT A;  4ELO A;  4IY5 A;  3UIF A;  3H7M A;  3VXC A;  4GVO A;  4LZ8 A;  3EHT A;  5ICT A;  1B52 A;  4U2R A;  5AA2 A;  3RTW B;  1A7L A;  1POT A;  1O64 A;  4ZE8 A;  3K0V A;  3DP4 A;  2GHB A;  4UA8 A;  1JNF A;  1MG1 A;  1SI1 A;  1NUY A;  2DWJ A;  3IOW A;  1HSE A;  3PMX A;  1A40 A;  4OVJ A;  1AOV A;  4DCX A;  4R74 A;  4ECF A;  1LAX A;  1LLS A;  5K2X A;  2HAU A;  2QL3 A;  2P3V A;  1VFD A;  3KZG A;  2PCR A;  3CG1 A;  5IKB A;  1QUJ A;  3PMW A;  4F19 A;  1NV1 A;  1B0H A;  5DVF A;  4TQU Q;  4GLI A;  1B4H A;  3T93 B;  4WED A;  2G29 A;  3IOV A;  4OMB A;  4OYV A;  2R71 A;  4EXL A;  3HO7 A;  3D4G A;  2DDK A;  3C33 A;  2Q9T A;  3KOS A;  3U93 A;  3VVF A;  4R9F A;  4MIJ A;  1PB9 A;  1TXF A;  2DWI A;  2FNC A;  3V89 B;  2D5W A;  4K3F A;  2ZNS A;  1BP5 A;  2WBD A;  4N4U A;  1UIV A;  5CI5 A;  3N6U A;  5I2N A;  4AS4 A;  1XI6 A;  4N91 A;  2DXY A;  4DLD A;  2QVV A;  3FUZ A;  1POY 1;  3OXN A;  4MH5 A;  4Q0C A;  1NV5 A;  4JSO A;  3RPL B;  3MC2 A;  1NUZ A;  4QBA A;  3FIR A;  4R72 A;  4GX6 A;  4XF5 A;  4LA9 A;  3BIH A;  4UAB A;  4KPT A;  3L6G A;  4NN3 A;  4FAT A;  3N26 A;  3TOD A;  1MXV A;  1CNQ A;  4LAT A;  1OVB A;  3P7I A;  1MXY A;  4PFU A;  3MJN A;  1GV8 A;  1AWB A;  1RDY A;  5EHS A;  2B4L A;  4PGN A;  1LB8 A;  3K1N A;  1EYI A;  1B32 A;  5LDZ A;  1US4 A;  5J16 A;  1LGB C;  2H9B A;  4KI0 E;  4NX1 A;  3A29 A;  2XXX A;  3OO8 A;  3K01 A;  1IEJ A;  4OHN A;  3KN8 A;  1BIY A;  3TCG A;  4MNC A;  4HCW A;  1R1N A;  4GXS B;  2Q8J A;  3MYU A;  1K9Y A;  3E4R A;  4PFI A;  2KR0 A;  4ESW A;  2F6G A;  3RPL A;  5ESY A;  2GQ1 A;  1FBC A;  1JET A;  2Q8M A;  5L8D A;  3B6Q A;  3T96 B;  4EF1 A;  2XXR A;  5H8N A;  1S9T A;  2XWV A;  3K00 A;  4LZ7 A;  2Y7K A;  3OO6 A;  4RJZ A;  3KN3 A;  3TYH A;  4Q5T A;  3K02 A;  1EZO A;  1H3D A;  4DXB A;  5L9M A;  2HHM A;  1FTJ A;  3H6T A;  2KLF A;  2BJI A;  1FTL A;  2V3U A;  4F3S A;  4JWX A;  4NAP A;  3FAT A;  1UTH A;  3CFX A;  4H67 A;  3H4Z A;  4QFL A;  4GL8 A;  3PUZ E;  5AA1 A;  4PF6 A;  1AMF A;  1D3K A;  2UVG A;  2YJP A;  2X7Q A;  4AQ4 A;  3OSQ A;  3BIG A;  3A3U A;  1IXG A;  3USD A;  5A5X A;  1MXU A;  3GXA A;  4N15 A;  1B46 A;  5DEX B;  3EHU A;  1EYK A;  3IL1 B;  2WOP A;  5EQA A;  4G68 A;  1F9B A;  1MQG A;  3TTL A;  3S4U A;  1EYJ A;  5I58 A;  5ET8 A;  3TFL A;  3DRK A;  2I3W A;  1QKA A;  3MUQ A;  1MH4 A;  2ONR A;  1RKM A;  4PFB A;  3ECR A;  4U23 A;  1FBH A;  5IZ3 B;  4GWO A;  1LBC A;  1I69 A;  4M4G A;  1KA1 A;  1NNK A;  2FIE A;  5CMB A;  4PFR A;  3DRF A;  3T66 A;  2YLN A;  3O2A A;  1MM6 A;  1FPJ A;  1R9Q A;  3C9H A;  1FQF A;  3HHG A;  1B7H A;  4YB7 A;  2B3B A;  2OWZ A;  2PVU A;  3OD7 A;  2NUV A;  3KJ7 A;  2I4C A;  1H76 A;  2LAO A;  4IGR A;  3GZG A;  3KFM A;  2REJ A;  3L6H A;  3S9N C;  5K2Y A;  2VP1 A;  4I3E A;  2M8C A;  4OEN A;  4XXU A;  1MH3 A;  1FPL A;  1Z7M E;  1IIW A;  1BTJ A;  3IO4 A;  1LBX A;  2DXR A;  3K6U A;  3ROJ A;  4GWW A;  1MPB A;  1N3X A;  3IAZ A;  4H65 A;  4YZZ A;  1VDW A;  4QSC A;  2CZL A;  3TQL A;  4IO7 A;  1LBV A;  3Q29 A;  1FPD A;  2O1M A;  5H8Q A;  4N81 A;  4TLM B;  1FQC A;  2ABH A;  2F3D A;  3GLB A;  3FVO A;  4OFL A;  2F36 A;  5I3S A;  4QFN A;  1CE2 A;  2VOZ A;  4KCC A;  5I59 A;  2XXH A;  3Q28 A;  2R6G E;  2ZYK A;  3VLV A;  1IXH A;  2I58 A;  4N6K A;  4C1T A;  3MVX A;  1NV3 A;  3IOR A;  1K9Z A;  1UQW A;  2OWT A;  2ZNU A;  4XKQ A;  2X26 A;  3K2D A;  4KYS A;  3SKP A;  1B3L A;  2DE4 A;  1H45 A;  4P0G A;  5ICQ A;  3MQ9 A;  2ZMB A;  3FXB A;  3TCH A;  1Z7N E;  3AXF A;  4OET A;  4ZZA A;  4XEQ A;  4OQO A;  3IFC A;  4EXK A;  1FW0 A;  2F7B A;  3VFJ A;  4OEV A;  3M3F A;  4F3P A;  5T3J A;  1FRP A;  3SES A;  2R9J A;  3TCF A;  2P3N A;  4U22 A;  4DDD A;  3LSL A;  5TPA A;  1Y1M A;  5H8Q B;  3MST A;  4C1U A;  5IZ3 A;  1M5B A;  2P0S A;  2Z8F A;  2F97 A;  2DE2 A;  2H99 A;  2DVZ A;  2UVI A;  3PUY E;  3CFZ A;  2AL5 A;  2RF1 A;  1JVX A;  2PT1 A;  4GFR A;  1R9L A;  3FJ7 A;  3V83 A;  3G3H A;  3RYA A;  1WVJ A;  4GOT A;  1MY3 A;  1IMD A;  2XX7 A;  1B58 A;  1JP4 A;  1QVS A;  1TFD A;  3UP9 A;  4F31 B;  2PFZ A;  4P8B A;  1QKB A;  3H6V A;  5ITP A;  4MMP A;  1DK4 A;  3CSG A;  4TLL B;  2FHY A;  4NTL A;  1SW4 A;  5I57 A;  4F18 A;  4OER A;  3M8U A;  3QUF A;  3MVZ A;  3H6U A;  3C4M A;  4POX A;  5HBC A;  1P1N A;  1MQJ A;  1D9Q A;  4PTK A;  3RLF E;  5A5X B;  4ELQ A;  2H4I A;  5BUU A;  4Z7E A;  4KCD A;  5AA4 B;  5IGA A;  2Y84 A;  1L5T A;  3N5L A;  4BDO A;  4P1L A;  4EDP A;  1NUW A;  4N8G A;  2NWJ A;  1UTH B;  2F78 A;  1SI0 A;  5L9O A;  1N76 A;  4GL0 A;  2I49 A;  3QSL A;  1WOD A;  1MQH A;  1N7X A;  4GWU A;  4N8Y A;  2XXQ A;  4PFT A;  5KCJ B;  1KWH A;  3RY3 A;  4H45 A;  5EQ8 A;  1FPG A;  4O3C A;  4C0R A;  3ILU B;  3FV2 A;  3RUM A;  3E13 X;  3ODB A;  3Q27 A;  4OEU A;  5LTC A;  3FXU A;  4X04 A;  1MRP A;  5ET6 A;  3TZA A;  2L5V A;  4BDM A;  3LV0 A;  5JTY B;  5I2K B;  3T0J A;  2O69 A;  3T9H B;  2F5X A;  1Y20 A;  1NNP A;  2Y7I A;  3KJT A;  3TDJ A;  1DPE A;  3T9X B;  3VDF A;  1MPD A;  3PAM A;  2Q2C A;  1OMP A;  3DRH A;  1NV7 A;  3PPQ A;  2ZYN A;  3TEP A;  3MZB A;  4ZZE A;  4GWZ A;  4GBV A;  5DEX A;  1R6Z A;  1B4Z A;  1O63 A;  2RIN A;  3QUJ A;  3CIJ A;  1B1X A;  2I3V A;  1SW1 A;  3S2V A;  1IUD A;  1SYH A;  1N04 A;  4AS5 A;  2XXV A;  2ZXT A;  4NF8 B;  5I2N B;  2I0B A;  1FSA A;  2Z23 A;  4ZE9 A;  1LFG A;  4YU0 A;  3BFT A;  1CB6 A;  4GRK A;  2OX3 A;  4NQ8 A;  3VV5 A;  1XT8 A;  4F3B A;  4AB6 A;  4JDF A;  2GRV A;  2V84 A;  4HCY A;  3PMV A;  3HFU A;  1P99 A;  4GBW A;  4LZ5 A;  4BLA A;  2XX8 A;  1ELJ A;  4FIM A;  1PEB A;  4HE2 A;  1B5I A;  3ZSF A;  2ALU A;  4X48 A;  4ZEC A;  4RNS A;  2O84 X;  1FTM A;  4PE5 B;  4MF3 A;  4G8M A;  4GF8 A;  3JZJ A;  3MVW A;  4MHF A;  4H46 A;  1M5E A;  4OVS A;  1LAF E;  3G3I A;  3ZKL A;  1NNF A;  4MCO A;  4R2F A;  2O68 A;  4OES A;  3BFU A;  2I0C A;  2NXO A;  4I3Y A;  3QXM A;  4PQJ A;  2WOK A;  3LR1 A;  1Q35 A;  2H25 A;  3CRB A;  4Z0I A;  4WEP A;  1UTB B;  3O29 A;  5FHM A;  4JB7 A;  3ILT B;  3NOH A;  1LBZ A;  3FV1 A;  4XTC Q;  5M2V A;  2CMO A;  1FQE A;  3FGS A;  4F29 A;  2RCB A;  2AYS A;  2NVU B;  3GYY A;  4YMA A;  3U72 A;  2VT5 A;  4R2B A;  1UIU A;  2HXW A;  1EU8 A;  1ZMG A;  3PPO A;  1NV4 A;  4H0W A;  1NMU A;  1MPC A;  1B5J A;  4PDD A;  4XKR A;  1SW5 A;  1YTV A;  4NF4 A;  3PV0 E;  4NF6 A;  5KDT B;  4LUB A;  1JW4 A;  1NKX A;  4JWY A;  3KEI A;  5DW8 A;  3IR1 A;  5KZT A;  5IZZ A;  5KDT A;  3RQT A;  5H8H A;  4BDQ A;  3MAM A;  3TPA A;  2HAV A;  2XX9 A;  2RC7 A;  2FBP A;  5DT6 A;  3OO9 A;  1B9J A;  1NV6 A;  4AB5 A;  3S9L C;  4OVP A;  4R75 A;  5I2K A;  1D4N A;  3PUX E;  4F3G A;  3KC0 A;  4EQ9 A;  3DM0 A;  4NE4 A;  4MNI A;  3ONM A;  4H5G A;  4OFO A;  3HV1 A;  4ZS9 A;  5TPA B;  3RYD A;  3QAX A;  3R26 A;  5DYH A;  3SEV A;  2Y7R A;  3FXQ A;  1B7Z A;  3SZP A;  4P3L A;  2QFL A;  4MBP A;  3RT8 A;  4FAJ A;  1YCJ A;  3F11 A;  3K6V A;  4H6D A;  3U1O A;  1QUK A;  2UYF A;  1N3W A;  2F35 A;  4F22 A;  4FOR A;  3HN0 A;  4U4X A;  2BJJ X;  2HPG A;  4M1V A;  4FBP A;  1FQB A;  3SEX A;  4NF8 A;  3ZKK A;  2F8D A;  2VD2 A;  3OO7 A;  1Y4C A;  5DTB A;  4KR5 A;  5B70 A;  3QIM A;  3TMG A;  5EHM A;  1ZTY A;  3RN8 A;  5IZ1 A;  4H5F A;  2PMS A;  1B3E A;  4OVQ A;  3H03 A;  3WAE A;  1O7T A;  3UK4 A;  4GXA A;  1JEU A;  1HSJ A;  4KXP A;  4NED A;  5HM4 B;  4RA1 A;  4QFO A;  2NOO A;  2ONK E;  4H8I A;  4TOZ A;  3K1M A;  3PPP A;  5H8H B;  4P11 A;  4GD5 A;  2YPN A;  2CEY A;  5H8N B;  1Q1K A;  1ZJL A;  4XIG Q;  1N7W A;  3VVD A;  4H1X A;  3O6H A;  1OIB A;  1OQG A;  3RNN A;  2OZZ A;  4E0X A;  4N17 A;  3OMB A;  2DWH A;  1DSN A;  5DVJ A;  2D21 A;  2XWK A;  4EF2 A;  4HE0 A;  3KOT A;  4P56 A;  5I57 B;  4QFK A;  3GBB A;  3CVG A;  1SVX B;  1SD3 A;  2DE3 A;  2ZZW A;  2Z22 A;  3VXB A;  4NHB A;  5F7V A;  3O97 A;  1YPN A;  5I56 B;  3QMF A;  4MJO A;  4KQP A;  5FTI A;  3G3K A;  5FBP A;  4P9K A;  2O1L A;  5DVI A;  1Y3Q A;  1Y1Z A;  2FIX A;  3PPR A;  2MKZ A;  4RK9 A;  1MXW A;  4LP2 B;  3MPK A;  3SDF A;  3TKD A;  3G3F A;  5AA3 A;  2QS1 A;  4IR8 A;  5ET7 A;  1B40 A;  1I6B A;  2HEU A;  4X8R A;  2P1S A;  4Q30 B;  2E0S A;  1B3F A;  4FEC A;  1DPP A;  3VVE A;  1B0L A;  1DOT A;  2Z8D A;  5CMM A;  4RK2 A;  5FTH A;  3KGC A;  3KSJ A;  5HPQ A;  1JEV A;  1XOC A;  2QS4 A;  4HE1 A;  2AIX A;  2DP8 A;  5EYH A;  5AE4 A;  2QMX A;  2F7C A;  3TTR A;  3KN7 A;  4DZ1 A;  1FBF A;  4R9G A;  4PC9 A;  5TP9 A;  2V3Q A;  5FHN A;  3SEY A;  4PAI A;  2XXY A;  3O28 A;  4NWC A;  3MZ1 A;  4I40 A;  4O3B A;  4ELR A;  1NL5 A;  3LUZ A;  5ELV A;  4G68 C;  4O7M A;  2XA5 A;  3PD9 A;  4P47 A;  1OLA A;  1GGG A;  1ZU0 A;  1SPI A;  4G2Z A;  4N13 A;  2ANJ A;  2UXA A;  2F6P A;  5JTY A;  3TTM A;  3U8Q A;  4ND9 A;  3CR9 A;  4G8N A;  4PDH A;  1NI9 A;  1ZBM A;  4ESX A;  4IO6 A;  1MY4 A;  1A55 A;  5EYF A;  4JSD A;  1RDX A;  4EUO A;  5I5P A;  1IZ1 A;  2GHA A;  1P1U A;  3VE1 B;  5I84 A;  1IXC A;  1NNT A;  1IXI A;  3E3K A;  1J1N A;  3C36 A;  4F1U A;  1AL3 A;  4HS7 A;  4RPN A;  3IX1 A;  3UN6 A;  3T22 A;  4OA4 A;  3TAJ A;  1B05 A;  2PT2 A;  3C35 A;  3T9V A;  4I62 A;  1ANF A;  1FPE A;  1MQD A;  1LAG E;  4FEB A;  3FTO A;  3O66 A;  4IO3 A;  3IK6 B;  4ELP A;  2KQZ A;  4R6K A;  3K6W A;  4R6Y A;  1B3H A;  5BWJ A;  3FVK A;  4DCY A;  1KA0 A;  1N84 A;  5KCJ A;  5IM2 A;  5CMK A;  4PAK A;  1OQH A;  1FPF A;  1YYZ A;  5AA2 D;  2PBW A;  2WYK A;  3IB2 A;  3C32 A;  4P0I A;  1USY E;  5L9S A;  3FVG A;  3OSR A;  3I5O A;  2PFY A;  2HCA A;  3OEL A;  3M3L A;  2HQ0 A;  1P1Q A;  3T9U A;  2WX9 A;  1B51 A;  4DE8 A;  1TT1 A;  3ZS6 A;  2OJT A;  1A8E A;  1QUL A;  2CEX A;  4GIZ A;  3LSF B;  4PFY A;  3MP6 A;  1G0H A;  4YIC A;  4QRZ A;  3OEK A;  1DBZ A;  2XHD A;  4OTE A;  1EZP A;  3LSW A;  3W15 C;  2IA4 A;  4G8H A;  3EN3 A;  4P1E A;  3H06 B;  4IGT A;  4LQ5 A;  1B5H A;  3MWB A;  2HZK A;  3PGF A;  3TUS A;  1S7Y A;  1FQA A;  5CBS A;  4DI4 B;  2GFE A;  2DVC A;  1I6Q A;  3MW0 A;  1H43 A;  1NV2 A;  1IMC A;  3UA8 A;  3MP8 A;  4PBQ A;  3EKI A;  1XVX A;  1PB7 A;  3SET A;  4Q8R A;  5I58 B;  4QSD A;  2QPQ A;  3DRJ A;  4I1D A;  5A5L A;  3K1P A;  4ISU A;  4N6P A;  3FAS A;  1NH7 A;  2V93 A;  2FYI A;  3CI8 A;  3DP6 A;  4X9T A;  5IAI A;  3DLN A;  4LVQ A;  4OAN A;  3B6T A;  4OZ9 A;  4PGP A;  2XXU A;  1DMB A;  3PPN A;  1USY H;  2OCU A;  4EQB A;  1S50 A;  2B65 A;  1II5 A;  3U92 A;  3THI A;  1MDP 1;  4X1D A;  3RYB A;  1JVY A;  1DTZ A;  2A5S A;  4YB5 A;  3FXR A;  1T0K A;  3IB0 A;  2OBG A;  4N07 A;  1Y3N A;  2ESN A;  4KYE A;  2G93 A;  1MDQ A;  2D3I A;  2XWO A;  3T1B A;  4YKJ A;  1LBY A;  4RYA A;  4G61 A;  1FJ6 A;  4MFI A;  3HHF A;  3K6X A;  3I6V A;  3IJX B;  2RKM A;  4PE3 A;  3PD8 A;  3B50 A;  1LBW A;  3I3V A;  2QS2 A;  1XHY A;  3MZ9 A;  4GX4 A;  1MY1 A;  1EZ9 A;  4LN5 A;  3C34 A;  3N6T A;  4OVR A;  1IIT A;  2Q2A A;  4HTG A;  2OK2 A;  4E0W A;  4GWX A;  4QFP A;  2B3F A;  2IEE A;  1M5C A;  1QGX A;  3G3G A;  4PF8 A;  2XXI A;  3VLU A;  4NGU A;  3HPI A;  4NF0 A;  1FPI A;  1ATG A;  2VD3 A;  1LB9 A;  4OWD A;  4KHZ E;  4JXI A;  3EPE A;  4U4S A;  4YKI A;  4QSE A;  2FA7 A;  3O6P A;  3BBR A;  4ZDM A;  4ZEI A;  2WBB A;  3DRG A;  3GBA A;  3S9M C;  4FJP A;  2HXR A;  1BK4 A;  4XKP A;  4I9D A;  3E79 A;  4PCD A;  2DOJ A;  3TTN A;  4JWO A;  3G7W A;  2XD2 A;  1US5 A;  4G77 A;  3M3K A;  2PX1 A;  4YMB A;  3PUV E;  1Q9D A;  4MX6 A;  2X7P A;  5F24 A;  2ZYM A;  2ZNT A;  3D4C A;  4MEV A;  4FED A;  1ZLQ A;  3DRI A;  1LBB A;  1PC3 A;  3TTK A;  2QJE A;  3RTF B;  3MBP A;  1XVY A;  3O9P A;  1DTG A;  2DYX A;  4WXJ A;  4N6D A;  3LC8 A;  1FBP A;  4IY6 A;  1FTO A;  3CG3 A;  2WOL A;  4DIG A;  4RPO A;  4XFE A;  1DCU A;  3IOT A;  1GVC A;  3LSX A;  1QW0 A;  1WDN A; 
#chains in the Genus database with same CATH homology
 5JK4 A;  4NHB A;  4GX3 A;  1IMF A;  3QMF A;  4GFR A;  1B52 A;  4MJO A;  3RYA A;  1IMD A;  4PBH A;  4ZE8 A;  5FBP A;  1B58 A;  1JP4 A;  4P9K A;  2FIX A;  2PFZ A;  2MKZ A;  4P8B A;  1QKB A;  4MMP A;  1DK4 A;  1NUY A;  2FHY A;  4IR8 A;  1FTA A;  5ET7 A;  3DP8 A;  4F18 A;  4OER A;  5J1D A;  1B40 A;  3M8U A;  4DCX A;  3MVZ A;  4X8R A;  1B3F A;  1INP A;  2P3V A;  1DPP A;  1D9Q A;  3W9V A;  2PCR A;  4PTK A;  4F19 A;  1NV1 A;  2F3B A;  1B0H A;  5CM6 A;  1JEV A;  1XOC A;  5IGA A;  1YZ0 A;  4HE1 A;  1B4H A;  5EYH A;  4WED A;  4P1L A;  1NUW A;  4OFJ A;  4N8G A;  2R8T A;  1FBF A;  4PC9 A;  2V3Q A;  4PAI A;  2DDK A;  4GWU A;  4N8Y A;  2Q9T A;  4PFT A;  4I40 A;  2FVZ A;  3RY3 A;  4MIJ A;  4H45 A;  5ET5 A;  3LUZ A;  5EQ8 A;  1FPG A;  2ZZX A;  4O7M A;  2XA5 A;  4P47 A;  1OLA A;  2D5W A;  2WBD A;  1ZU0 A;  1SPI A;  2WYP A;  5LTC A;  4OEU A;  4N4U A;  1UIV A;  1RDZ A;  1NUX A;  2QVU A;  1XI6 A;  4N91 A;  4X04 A;  4AS4 A;  2QVV A;  2B4M A;  2ZZV A;  5ET6 A;  4JVC A;  1FPK A;  4PDH A;  1NV5 A;  2L5V A;  4JSO A;  1NI9 A;  3LV0 A;  3RPL B;  3T0J A;  1NUZ A;  2F5X A;  4JSD A;  4QBA A;  1RDX A;  1FBD A;  5I5P A;  1OLC A;  1DPE A;  3PAM A;  4GX6 A;  4XF5 A;  3BIH A;  4UAB A;  4NN3 A;  5EQ7 A;  3DRH A;  1NV7 A;  4O7I A;  4JVD A;  3E3K A;  1CNQ A;  3MZB A;  4F1U A;  4GWZ A;  4GBV A;  4PFU A;  1B4Z A;  4ZEK A;  2V4C A;  4OA4 A;  1B05 A;  1AWB A;  1RDY A;  2B4L A;  4PGN A;  1EYI A;  1B32 A;  5LDZ A;  1FPE A;  4AS5 A;  3FTO A;  5J16 A;  4NX1 A;  2KQZ A;  3A29 A;  1FSA A;  2Z23 A;  4ZE9 A;  4ONY A;  2JJK A;  1LEV A;  1B6H A;  1B3H A;  2OX3 A;  3MVY A;  4NQ8 A;  4DCY A;  1KA0 A;  5IM2 A;  4PAK A;  1FPF A;  1YYZ A;  3TCG A;  4MNC A;  4HCW A;  2GRV A;  2VPN A;  4HCY A;  2WYK A;  3HFU A;  4GBW A;  3MYU A;  1K9Y A;  4PFI A;  4F1V A;  2KR0 A;  3I5O A;  2PFY A;  3RPL A;  5ESY A;  2GQ1 A;  1FBC A;  1NV0 A;  1JET A;  2Q8M A;  4HE2 A;  1B5I A;  5L8D A;  2WX9 A;  1IME A;  1B51 A;  4ZEC A;  3ZS6 A;  2XWV A;  1VR5 A;  4GF8 A;  2CEX A;  4DI3 D;  4PFY A;  3MVW A;  4MHF A;  4H46 A;  1G0H A;  4OVS A;  4YIC A;  2CZK A;  2HHM A;  1DBZ A;  4MCO A;  2BJI A;  4JVI A;  4OES A;  4MNP A;  2HZL A;  5ISU A;  1IMB A;  1KZ8 A;  4NAP A;  4P1E A;  4I3Y A;  1B5H A;  2HZK A;  3IFA A;  4QFL A;  2WOK A;  4GL8 A;  2O7I A;  1G0I A;  4PF6 A;  3KBZ A;  4DI4 B;  3BIG A;  3NOH A;  1LBZ A;  4N15 A;  2VPO A;  3MW0 A;  1B46 A;  3W9W A;  4I8C A;  1EYK A;  2WOP A;  1NV2 A;  1IMC A;  5EQA A;  3GYY A;  4PBQ A;  3EKI A;  1EYJ A;  5ET8 A;  3DRK A;  2VT5 A;  5EQ9 A;  1UIU A;  1QKA A;  4MAG A;  2QPQ A;  3DRJ A;  1FPB A;  5A5L A;  1NV4 A;  1RKM A;  1B5J A;  4PDD A;  4PFB A;  5F1Q A;  4XKR A;  4X9T A;  1FBH A;  5IZ3 B;  1B2H A;  4OAN A;  5EYG A;  4PGP A;  2Y5K A;  1KA1 A;  2FIE A;  3RYB A;  4PFR A;  5DW8 A;  3DRF A;  5KZT A;  1IMA A;  5IZZ A;  3D1R A;  3T66 A;  3RQT A;  4QXD A;  2XWO A;  3T1B A;  1LBY A;  4G61 A;  1FPJ A;  1FJ6 A;  3TPA A;  1B7H A;  2OLB A;  2FBP A;  1B9J A;  2RKM A;  2OWZ A;  1NV6 A;  3ISP A;  4PE3 A;  4OVP A;  3B50 A;  3KC0 A;  4MNI A;  1FBG A;  1LBW A;  2WEF A;  3U65 A;  4OFO A;  3RYD A;  4ZEB A;  1YXI A;  3MZ9 A;  4I3E A;  4GX4 A;  1FPL A;  4PFW A;  4OVT A;  4P3L A;  3SZP A;  2QFL A;  1LBX A;  4LN5 A;  3ROJ A;  4FAJ A;  4GWW A;  4OVR A;  4YZZ A;  1VDW A;  2Q74 A;  4GWX A;  4QFP A;  1QGX A;  2HPG A;  4M1V A;  1LBV A;  2CZI A;  4FBP A;  1FPD A;  4PF8 A;  4NGU A;  4N81 A;  3KC1 A;  4NF0 A;  1FPI A;  2F3D A;  4ZED A;  3QIM A;  2QVR A;  4OFL A;  1ZTY A;  5I3S A;  4GWY A;  4QFN A;  5IZ1 A;  3LVU A;  4OVQ A;  3O6P A;  4ZEI A;  2WBB A;  3DRG A;  4GWS A;  2Y5L A;  4N6K A;  2XWI A;  2CZH A;  3MVX A;  1NV3 A;  2XXK A;  1K9Z A;  1UQW A;  1BK4 A;  1JEU A;  4XKP A;  2HXR A;  4KXP A;  4XKQ A;  5HM4 B;  4I9D A;  3E79 A;  4PCD A;  4RA1 A;  4XKN A;  4QFO A;  2NOO A;  4HXV A;  4O94 A;  4TOZ A;  1B3L A;  2DE4 A;  5ICQ A;  1Q9D A;  3B8B A;  4MX6 A;  3FXB A;  3TCH A;  5F24 A;  4OET A;  4MEV A;  4XEQ A;  1ZLQ A;  3IFC A;  2CEY A;  1FJ9 A;  3DRI A;  4PET A;  4OEV A;  3E78 A;  5T3J A;  3O9P A;  1FRP A;  3PTY A;  3FBP A;  3TCF A;  1B3G A;  1B1H A;  3CHG A;  2P3N A;  4N6D A;  1FBE A;  1FBP A;  4N17 A;  2WOL A;  2XWK A;  4HE0 A;  4NG7 A;  4XFE A;  4P56 A;  4O8M A;  1DCU A;  3MST A;  5IZ3 A;  4QFK A;  5I7I A;  4PAF A;  2DE2 A;  2DE3 A;  2ZZW A;  2DVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...