2B4MA

Crystal structure of the binding protein opuac in complex with proline betaine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
264
Chain Sequence
SAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Glycine betaine-binding protein
total genus 87
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2b4mA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2b4mA01
1B40A 1XOCA 1B05A 3TPAA 3QIMA 1B4ZA 4TOZA 2OLBA 3DRFA 4ZEKA 1B3HA 1B51A 4QFNA 1JEVA 3DRJA 1ZTYA 4OESA 1B52A 1B58A 4JSOA 3RY3A 1OLCA 1B5JA 4GF8A 1B32A 2O7IA 4ZE9A 1UIUA 4PFYA 1JETA 4PFUA 4OFJA 4JSDA 4QFPA 4XKRA 3RYAA 2B4MA 2WOPA 2D5WA 1B5IA 4GL8A 3TCFA 3E3KA 4ZECA 1JEUA 2GRVA 1QKAA 3MVYA 1B3GA 3MW0A 4OFOA 3PAMA 1B2HA 3RQTA 4ZEIA 2WOKA 3TCHA 5ISUA 4QFLA 4ZEDA 3ZS6A 4DCXA 1B9JA 1QKBA 2B4LA 1VR5A 3MZBA 1B6HA 1B4HA 3DP8A 1RKMA 3CHGA 3MVXA 2RKMA 4I8CA 4RA1A 5HM4B 1B1HA 4XKPA 3MVWA 4PFWA 4ZE8A 5ICQA 3I5OA 1UIVA 3DRHA 2Z23A 3MZ9A 4XKNA 5F1QA 2WOLA 3O6PA 4I9DA 1B3FA 4OETA 3DRIA 4QFOA 3DRGA 3T66A 4OEVA 4FAJA 4OERA 3DRKA 1B46A 2NOOA 3M8UA 4XKQA 1DPEA 3LVUA 1UQWA 4PFTA 3O9PA 1B0HA 3FTOA 4GFRA 1B7HA 1DPPA 4ZEBA 3RYBA 5KZTA 4OFLA 5L8DA 3MVZA 1OLAA 4WEDA 3TCGA 1B5HA 4ONYA 1B3LA 4DCYA 1ZLQA 1ZU0A 4QFKA 4OEUA
chains in the Genus database with same CATH superfamily
3CFZA 4NQ8A 5H8NB 1MH4A 1LB8A 4OVJA 1B3HA 5I58A 1KWHA 5H8NA 4KR5A 5EYFA 1NV1A 4GD5A 1A55A 2Q8MA 2XHDA 1QGXA 4I40A 1Y9UA 2V93A 1UIUA 4PFYA 1TXFA 4H6DA 1N7WA 4IY5A 2CZIA 4OFJA 3C31A 1LAXA 5TPAA 2OWSA 1VDWA 1OVTA 1EYKA 2ZXTA 3RYDA 4F3PA 2CZLA 3PAMA 3TDJA 5I2NB 4F3SA 1PC3A 2HXRA 1EU8A 4P3LA 3V89B 3QXMA 1ZBMA 4Q8RA 4PFIA 1FCKA 1O64A 3AXFA 4PC9A 3VDFA 2G93A 1H44A 2ALUA 5J16A 4MX6A 3C35A 1XS5A 4TLMB 4QXDA 1N0TA 1FPFA 4BDMA 3IORA 2I0CA 1YAEA 4ZZAA 4JVIA 2WOLA 3O29A 4EQBA 3VXCA 3FJ7A 4JB7A 1PBQA 3DRKA 5A5XB 3OELA 4JVDA 2QVUA 5CI5A 1B0HA 4PDDA 2HEUA 5KZTA 1LAHE 2OCUA 4QSEA 4DI3D 3HFUA 4LZ8A 1MXZA 2QS1A 1QJMA 4NMYA 1ZU0A 3MC2A 3Q26A 4OEUA 2XXKA 3OO8A 2PFZA 4HCWA 3HSTA 2Q8JA 3SKPA 3U93A 4Q30B 5AA2A 3MZ1A 2GFEA 4PQJA 4NF4A 3RY3A 3CI8A 1ZJLA 3B8BA 3EHSA 4DXCA 2ABHA 4DIGA 4QFPA 5ITOA 3G3GA 2ZMBA 4AB6A 2Q89A 1D4NA 3UORA 4DE8A 5KCJB 2Y5LA 4F2QA 5FHNA 4NF6B 1HSLA 5DW8A 5CBRA 4RPNA 4ZEDA 2B4LA 2WX9A 3GBAA 3MZBA 4GXAA 4MH5A 1AOVA 1XHYA 3SEWA 2ONSA 3IJXB 1MM7A 1SI0A 3T9HB 5DT6A 2DE2A 4YU0A 2Y7WA 3U1OA 2Q88A 3I5OA 3U8QA 4PAIA 3OSRA 1FJ9A 4KCDA 5FTIA 4H46A 4H45A 3O2AA 1VFDA 3FXRA 1AIVA 2XXYA 3UA8A 2F35A 1NL5A 2XD3A 3FV1A 3K00A 4JXIA 4PFTA 2V84A 2F7AA 1A40A 3KN8A 2DS9A 3LSWA 2QS4A 3K6VA 2CMOA 3R6UA 3SEXA 2F3DA 4G68C 5FBPA 2Y84A 4YICA 1B40A 1FQFA 3K6UA 2UVIA 1MRPA 5I2KA 1H3DA 2YJPA 1FTKA 4O7MA 2I0BA 1MY0A 3DRJA 1LCFA 2H98A 1OLCA 2QS2A 4GL0A 3MUQA 1B7ZA 3LUZA 2O6AA 4R72A 5EYHA 1XC1A 2B4MA 1NNFA 3E3KA 2H9BA 3OO9A 3IO6A 4U4XA 1G0HA 3H6UA 5DTBA 2JJKA 3CG3A 4KCCA 2VD3A 1FQDA 2QMWA 3RT6B 1POTA 5TU0A 1YTVA 2E0SA 4F29A 1MXUA 3MQ9A 4KFQA 4Q0CA 3TTRA 4F1UA 1FPLA 2O1LA 2XXPA 5CC2A 1SW2A 1XVYA 2DYXA 3QMFA 1LB9A 5T3JA 1DOTA 2DWJA 4PFBA 4PFWA 2OZZA 2ZNUA 3MSTA 2DXYA 2O68A 4PAFA 3ZKLA 2VD2A 5H8HA 4G68B 3O6IA 5I2KB 1VFEA 4QFOA 1MXWA 2Y7KA 2NOOA 3VLVA 4R9FA 1MPDA 2OK2A 1R6ZA 3MPKA 4ESXA 2I58A 4RPOA 3MJNA 3FZVA 4YMAA 1N76A 1DBZA 4GWOA 4YAHX 1ZLQA 3M3FA 4LUBA 1WDNA 2OX3A 1B05A 1AL3A 3MP8A 4IR8A 2UYEA 1LAFE 3Q29A 3IX1A 4PE3A 4WXJA 1DTGA 3KOSA 4YB7A 1XVXA 3UGWA 4YB6A 3OXNA 1NNKA 4OVTA 1URSA 4H65A 5ET7A 4P1EA 3MYUA 1LBYA 1JQFA 2BJIA 4UACA 1JW5A 3LSLA 1ZKBA 2A5TA 3TCHA 5ISUA 5CRYA 3BFUA 3H03A 3T1BA 1B6HA 4R9GA 1GTKA 2XX8A 2P3VA 3DP8A 1FTJA 3GYYA 3PPNA 4WEPA 5HPQA 3G3FA 4M1VA 2Y5KA 4MAGA 4MJOA 4F18A 2R9JA 2HAVA 4KYEA 4IO2A 1MQHA 3O6PA 3SZPA 1TFDA 5I56A 5CBSA 3M3LA 1FJ6A 3TUSA 4MF3A 4P47A 4AS5A 4I3EA 1UQWA 4XFEA 1NV5A 3HHGA 3TMGA 1HSEA 1FBFA 3DP4A 3PPPA 2XXIA 2FIEA 3KN3A 1XI6A 2GQ1A 4N8YA 2DOJA 4G2ZA 3EHTA 1AMFA 1FBCA 2P3NA 3H6VA 3RT8A 2CZHA 3TPAA 5EQAA 2UXAA 2MKZA 3VLWA 4P56A 5IKBA 1IXCA 1LBBA 3FGSA 1SQYA 2YLNA 1B32A 4O3AA 4DXUA 3RTFB 1EYJA 2Q9TA 5M2VA 4GX3A 3K6XA 1FPGA 1MXYA 1N04A 1IMCA 1B3GA 4F1YA 1QUJA 4OVPA 2ZYNA 4TQUQ 1NV6A 4HTGA 4ZEIA 5IZZA 1FW0A 3TZAA 4YB5A 1M5BA 1VR5A 2XXVA 1A99A 3OEMA 2D21A 4ZZEA 1ANFA 2DE3A 4OVSA 1MQGA 2XXTA 1T0KA 4JWYA 4RA1A 4ZE8A 4NEDA 4MLVA 3R7XA 4I9DA 4F31B 4G68A 3DRGA 3IB0A 3RPLA 4PTKA 3ILUB 4PBQA 3FASA 2PVUA 5IM2A 2AL5A 1B3EA 1IMEA 1NH8A 4EQ7A 2XXQA 1MY2A 4FE8A 2XWVA 3U65A 4U22A 3VFJA 3CVGA 3MPLA 4GBWA 3T0JA 2REJA 2I3WA 2I48A 1FPEA 1AWBA 3QSLA 4LZ5A 2DP8A 1TT1A 5H8QB 4LATA 2NXOA 2DWHA 5ICTA 4PFUA 1EH3A 2IEEA 3O66A 3Q25A 4AB5A 3FXQA 3KSJA 4AQ4A 3I6VA 3PPRA 4GVOA 4L17A 3TODA 1L5TA 2RC9A 4KYDA 3O6HA 1RDYA 4BDLA 4QFLA 1B7UA 3ZS6A 3QUFA 3NOHA 3PD9A 5A5LA 2Y7PA 4EDPA 3C32A 3JYRA 2RKMA 1LBCA 2GHAA 3TTLA 3K6WA 1MQIA 3TTMA 3MVWA 2FYIA 1UIVA 3LSXA 3DLNA 5LDZA 2XXWA 3OMBA 3E4RA 4F1VA 4E0WA 4OEVA 2D3IA 4F3BA 1DPEA 3WAEA 3RTWB 1SW1A 3PU5A 4GFRA 4FECA 4BDQA 3KC0A 2DDKA 3ROJA 3W15C 4OFLA 5H8FA 3I3VA 1OLAA 3HHFA 1MY1A 1N84A 3C34A 2O7UA 3D1RA 4MMPA 1S9TA 1VSOA 4PP0A 1IEJA 3FXUA 3THIA 4HE1A 2DXRA 3KJ7A 2RC7A 1WODA 3KJTA 3DRFA 4R73A 3ODBA 1JEVA 3PUXE 3K01A 4JSOA 2HQ0A 4PDHA 3U94A 1O63A 2Y7IA 3UP9A 5EHMA 3G3JA 5L9SA 4XKRA 4N15A 4QSDA 4HW8A 2P2AA 2CEYA 4TLLB 2ONRA 2I4CA 3U92A 3M3KA 4H5FA 3H6TA 2VT5A 2ZZWA 5JK4A 2QL3A 1IMDA 4G8HA 4OANA 3EPEA 3S9EA 4P1LA 3SETA 3OD7A 1M5EA 5CMMA 1JVXA 4G8NA 1TWYA 3IL1B 5HM4B 1IXGA 3E79A 3E9XA 4EXKA 5A5XA 3ISPA 3PUYE 2V3QA 4FEBA 1Q1KA 3DELB 4POWA 1A8FA 4P8BA 3H7MA 1B46A 3M8UA 1LFGA 5AA2D 1NV0A 1FBEA 5B7DA 2HHMA 4OXVA 1EZ9A 1DPPA 2ZNSA 3S9NC 4C1UA 3K4UA 4O3CA 2FBPA 2Z22A 3V8XB 2O51A 2DVCA 4Z7EA 5IGAA 1MH3A 3USDA 1DCUA 3Q28A 3OEKA 2ESNA 1SBPA 4GWUA 3SESA 1B4ZA 4NG7A 1MQJA 1G0IA 4P0IA 3MAMA 1K9YA 4KHZE 4GF8A 3VV5A 1CE2A 2PMSA 3HCQA 3K2DA 5IZ1A 3E78A 4PETA 3VVDA 1EYIA 3KFMA 1QUKA 1TFAA 4JWOA 1YYZA 2Z8DA 3QK6A 1LGBC 2P0SA 3SEYA 5DYHA 3RUMA 1FPBA 2A5SA 1S50A 3MW0A 4Q5TA 1A7LA 2QS3A 1DSNA 4H8JA 4E0XA 3RQTA 3N6UA 3QYTA 4YKKA 3HV1A 2UVGA 4R6HA 4NN3A 5DVIA 4HS7A 1UTBB 3G3IA 3FATA 1A8EA 1YZ0A 3CHGA 1UTHA 4IO6A 1P1OA 3A3CA 2NVUB 2XXRA 1YPNA 3DRHA 4FORA 4PCDA 1IMAA 4RYAA 1Q35A 2FVZA 1M5DA 4OHNA 1FSAA 3VVEA 3K1PA 4I1DA 3KN7A 3QAXA 2XXHA 3KSXA 3RGYA 4MHFA 5B70A 3K02A 1LCTA 1I6QA 3ILTB 2GHBA 5K2YA 4GX6A 3B6QA 3C9HA 1GR2A 3TQLA 5DEXB 4ONYA 5DVJA 1B3LA 3H4ZA 1NV3A 4MIJA 1OVBA 2DVZA 3H3GA 1NV4A 2XXUA 4ESWA 5BWJA 1Y1ZA 2WKYA 4KQPA 3SEUA 1I6BA 2RINA 3OO7A 4R75A 4IO3A 1OMPA 5H8FB 4XTCQ 3CRBA 3IOWA 3IR1A 2QVRA 4JSDA 4KI0E 2R71A 3TAJA 4UABA 5CMBA 1D9YA 4U1OA 5AA2B 4NX1A 1JW1A 2RCAA 1NI9A 1OQHA 4BDRA 1Y3QA 3KGCA 3ONMA 1LFIA 2REGA 1AH5A 2M8CA 3E13X 1LAGE 1P1UA 2QPQA 4P11A 4PGNA 2HXWA 4OQOA 4GRKA 1FBPA 4LP2B 4P9KA 4ELQA 1Y1MA 3IFAA 1RDXA 1UTHB 2XA5A 2PCRA 3H06B 4R74A 4GIZA 1D3KA 3OO6A 2I3VA 3IB2A 1INPA 1FBDA 5DEXA 3ECRA 1QVSA 4OERA 4N17A 3WAFA 1F9BA 4XKQA 4N13A 4GLIA 4DLDA 3LVUA 2VHAA 1Y3PA 3UIFA 4QHQA 4RXLA 3B6TA 2PBWA 2ZYMA 2ZZVA 1YXIA 1USYE 4G77A 3O6GA 1EZOA 5IZ3B 3IK6B 3B7DA 1FQBA 1IMFA 4NGUA 4PF8A 1LBVA 3D4GA 5ELVA 2X7PA 4LVQA 4EUOA 3PUZE 1NKXA 1B51A 4QFNA 5EHSA 2DWIA 1UTBA 4XIGQ 4OZ9A 3CG1A 5F7VA 1IITA 4H0WA 4U23A 2ZYOA 2Z8EA 4M4GA 2HZKA 4KXPA 2GH9A 3RPLB 1SW5A 2F6GA 4IO4A 1CB6A 4OMBA 1FPJA 2GRVA 4F19A 3LV0A 4MCOA 3FIRA 5IAIA 1R9LA 1B2HA 2F34A 5CMKA 4ELPA 3T9UA 4DI4B 1FQAA 3GLBA 5I59B 5F24A 4F3GA 5JTYB 2H5YA 3GZGA 1WVJA 3G3KA 3PPQA 3MVXA 2I6EA 4MNPA 4XKPA 5L9OA 1I69A 1N3WA 5KDTB 5ITPA 5ICQA 3IAZA 3ZKKA 3MZ9A 4O3BA 4FATA 1LFHA 3MBPA 4NF8A 4OETA 1JW4A 2PT2A 4YKPA 4P0GA 3EKIA 1H76A 2F36A 1MY3A 3F11A 2VOZA 2X7QA 3N26A 4ZEBA 1IIWA 4H67A 4U4SA 3VE1B 3LSFB 4F2OA 4DCYA 4WKMA 5I3SA 4EF1A 1NUZA 3GBBA 4QFKA 1FBGA 3BFTA 1IXIA 4GOTA 5LTCA 3FVKA 4QBAA 3S2VA 1B52A 3FBPA 3QUJA 2IA4A 4G61A 3CSGA 4N81A 2KQZA 2UYFA 4HCYA 2DE4A 3PGFA 1SI1A 2XWOA 4O8MA 1PDAA 2WBBA 4YZZA 4N6DA 4OA4A 3TYHA 2VPNA 3PD8A 4X8RA 3FJGA 2CEXA 4LN5A 1B9JA 2W7YA 1FTAA 2V3TA 3HPIA 2UVJA 3EQ1A 3PMWA 3HN0A 3B6WA 1B3FA 3A09A 3D4CA 1RYOA 5AA3A 1NH7A 4I62A 2HZLA 3FTOA 1LBZA 3C36A 4C0RA 1M5CA 5L8DA 4ND9A 1FTLA 3PMXA 4LONB 4DZ1A 3IOVA 4ECFA 5K2XA 3TCGA 2XD2A 1B5HA 1GV8A 1BIYA 1Q9DA 4ELRA 5I7IA 2QRYA 5ESYA 4NWDA 2VPOA 1II5A 3KG2A 3BKIB 1BK4A 3P7IA 4NF8B 3O97A 3PUVE 5AA4A 2XX7A 1ZTYA 4OESA 3G3HA 4IGRA 4BDOA 4O94A 1FQCA 2QFLA 1XT8A 4PE5B 1KA1A 2ZZXA 2B3FA 3CSBA 1R9QA 1MG1A 5JTYA 1NUYA 3SEVA 3T9XB 3W9WA 4ZECA 5H8HB 4QF9A 2H25A 4PBHA 4OFOA 4JVCA 4R6KA 3BIHA 4PAKA 4UA8A 2F5XA 1K9ZA 1US4A 2WOKA 5FHMA 2AYSA 3FVGA 4HXVA 4GWYA 4GQOA 1QKBA 1FQEA 3S9LC 1MPCA 4JDFA 1RKMA 1MY4A 1USYH 1B1HA 4POXA 2KR0A 2I49A 3C33A 4AS4A 3UN6A 5I2NA 4GWWA 3RNNA 3DRIA 3IFCA 2G29A 5TPAB 1MS7A 2F8DA 4MEVA 4N4UA 5I59A 1FPIA 3N94A 5IZ3A 3T22A 3PTYA 2WYPA 4RK2A 1IMBA 5L9MA 4ELOA 1US5A 1P1QA 4FIMA 4H8IA 2QVVA 1NNPA 5I58B 4IO5A 4WEDA 2FA7A 4GBVA 3BIGA 5I5PA 5BUUA 4C1TA 5CMCA 2RC8A 3TQWA 4XEQA 2VGQA 3FUZA 2R6GE 3N5LA 1FPKA 2F7CA 2L5VA 3VLUA 1H43A 3IJOB 1RYXA 2WEFA 1PEBA 1N3XA 1B5JA 4OVRA 1BTJA 4H1XA 3KBZA 4R6YA 4K3FA 4MNIA 2PFYA 1MDP1 2XWIA 4NF0A 3RYAA 1NUXA 2WOPA 4NTLA 4MNCA 4RNSA 4EF2A 3PV0E 5AA4B 5EQ7A 3MVYA 4LA9A 4GX4A 5DVFA 1Y4CA 1FTMA 4MFIA 3ZSFA 3PPOA 4GWXA 3TTKA 2B65A 3SDFA 2F7BA 1MDQA 2Q2CA 1CNQA 2R8TA 2THIA 1Y3NA 4N07A 5I56B 3LBSA 2QMXA 4JBZA 4OENA 4X1BA 2HAUA 4ZDMA 3EF7A 3HO7A 1PB9A 4ZS9A 2Y7RA 4OWDA 1QUIA 3IOUA 1IZ1A 1DK4A 2UVHA 3S4UA 5KCJA 5CM6A 4U1ZA 3A29A 2WYKA 2Q74A 3LR1A 1OIBA 1NV7A 5F1QA 1IUDA 4F22A 4N8GA 4N91A 3T66A 1ELJA 2A5TB 3MP6A 4NWCA 5EYGA 3FD3A 5ET6A 2FNCA 4NF4B 4YMBA 1BP5A 1HSJA 2F97A 1O7TA 3IOTA 3U72A 5EQ8A 3K1NA 5EQ9A 3H6WA 4THIA 4JWXA 3VXBA 2WBDA 1VE4A 1POY1 2DQVA 2BJJX 1J1NA 1B58A 3L6GA 2DWAA 3JZJA 4ZE9A 3K1MA 1MXVA 1H45A 3FVOA 2FHYA 1JETA 1BLFA 1YCJA 3KC1A 3CFXA 4LZ7A 4RK9A 1QKAA 4NHBA 1KA0A 4KD5A 3CIJA 2ZYKA 1QW0A 1GGGA 2LAOA 4G4PA 4U21A 3UK4A 2OJTA 4RY1A 1NFTA 2VP1A 1IQ7A 2Z8FA 2F6PA 1NMUA 1PB7A 2O1MA 3LC8A 4BDNA 3BBRA 4YKJA 3A3UA 2H4IA 2PYYA 4IY6A 2CZKA 1SVXB 1FTOA 4KPTA 4DDDA 2V4CA 1MXXA 5I84A 3RPWA 4XKNA 4X1DA 1N7XA 2V25A 1S7YA 2Q2AA 1NNTA 1A54A 1Z7NE 1B0LA 1Y4TA 2PX1A 4MBPA 1ZMGA 4XXUA 1LEVA 2NUVA 4DXBA 4GWZA 3FJMA 3PUWE 2QSXA 1MQDA 4ZEFA 1Z7ME 2X26A 2XWKA 3PMVA 4BLAA 3TKDA 4U2RA 3KEIA 3MP1A 4GXSB 1XOCA 4G8MA 4RJZA 2HPGA 4TOZA 2PT1A 2OLBA 4ZEKA 1FRPA 3R26A 4O7IA 4I3YA 5J1DA 4X9TA 3B50A 2AIXA 4IB2A 2FIXA 4NF5A 1PBPA 4LQ5A 3KBRA 2F3BA 1R1NA 2E1SA 1GVCA 4OYVA 4NE4A 4GL8A 1B5IA 3TCFA 3OSQA 4QRZA 2RF1A 1JEUA 1BKAA 1NUWA 1SDXA 2XX9A 3RN8A 2ONKE 3VVFA 5I57A 2DSFA 2OBGA 2OWTA 2ANJA 3KOTA 3FVNA 1ZIUA 2XXXA 1B4HA 3CFLA 3MWBA 2ZNTA 3IB1A 4R2BA 4IO7A 5JEIA 2H99A 3DM0A 1B1XA 3RLFE 5ET8A 1JP4A 4FEDA 5FHOA 2YPNA 3KZGA 2B3BA 1MM6A 4ISUA 2KLFA 4FAJA 1JNFA 4X04A 1RDZA 4HE0A 3O9PA 4EXLA 5ET5A 1DTZA 5TP9B 4XF5A 1SYIA 3IO4A 3MVZA 3G7WA 3EN3A 3DP6A 3W9VA 1LLSA 3N6TA 3K0VA 3OENA 1D9VA 3S9MC 3QIMA 1JVYA 4PGPA 1SD3A 2P1SA 1I6AA 3JV9A 5TP9A 3SERA 5FTHA 2O69A 2O7IA 1LBXA 4QSCA 1NV2A 3TTNA 1LSTA 1SYHA 4NF6A 1P99A 4FJPA 2O84X 1EZPA 3T93B 2D5WA 3FXBA 4YKIA 3CR9A 1LBWA 3T9VA 1D9QA 4IGTA 4MLQA 5HBCA 4N6PA 1IXHA 1PB8A 1QULA 4DCXA 4N6KA 2I4BA 5AA1A 1URGA 4Z0IA 2QJEA 4FBPA 3O28A 1DMBA 2AL4A 4PF6A 1FBHA 1FPDA 4I8CA 3GXAA 4LQ2A 5H8SA 3TFLA 5AE4A 3Q27A 5H8QA 3TELA 1P1NA 1P1WA 2Z23A 5I57B 1OQGA 1Y20A 4R2FA 1KZ8A 2HCAA 2NWJA 4F39A 5LOMA 4NAPA 2V3UA 3EHUA 4KYSA 4X48A 5KDTA 4OVQA 1MPBA 2F78A 3C4MA 4NF5B 2HFBA 3FV2A 3TEPA 4PFRA 4GWSA 4H5GA 4HE2A 1B7HA 3RYBA 1M5FA 3V83A 1ATGA 4OTEA 3L6HA 1SPIA 1SW4A 3LUYA 2RCBA 3T96B 1URDA 3OOAA 2OWZA 3V5AA 4EQ9A
chains in the Genus database with same CATH topology
2P3NA 4NQ8A 2CZHA 4XEQA 3TPAA 5EQAA 2MKZA 1FPKA 1B3HA 4P56A 2L5VA 2WEFA 1NV1A 1B5JA 4OVRA 1B32A 2Q8MA 1QGXA 3KBZA 4I40A 1UIUA 4PFYA 1EYJA 4MNIA 2QVRA 2Q9TA 2CZIA 2PFYA 4OFJA 4JSDA 4GX3A 2XWIA 4NF0A 3RYAA 1NUXA 2WOPA 4UABA 1FPGA 4MNCA 4NX1A 1VDWA 5EQ7A 1EYKA 3MVYA 1NI9A 1IMCA 1B3GA 3RYDA 4GX4A 4OVPA 3PAMA 1NV6A 4ZEIA 4GWXA 5IZZA 2HXRA 4P3LA 1CNQA 2R8TA 1VR5A 2QPQA 4PGNA 4PFIA 2DE3A 4OVSA 1FBPA 4PC9A 4P9KA 5J16A 4MX6A 4RA1A 3IFAA 1RDXA 2XA5A 2PCRA 1DK4A 4QXDA 4ZE8A 5CM6A 1FPFA 3A29A 2WYKA 2Q74A 1NV7A 4JVIA 5F1QA 2WOLA 1INPA 1FBDA 4I9DA 4N8GA 4N91A 3T66A 3DRGA 3RPLA 4PTKA 4OERA 3DRKA 4N17A 4XKQA 4JVDA 4PBQA 3LVUA 2QVUA 5EYGA 5IM2A 1B0HA 4PDDA 5ET6A 1IMEA 5KZTA 2ZZVA 1YXIA 2XWVA 3U65A 4DI3D 3HFUA 5IZ3B 5EQ8A 5EQ9A 1ZU0A 4OEUA 4GBWA 1IMFA 2XXKA 3T0JA 2PFZA 4NGUA 4PF8A 1LBVA 2WBDA 4HCWA 1B51A 4QFNA 1B58A 1FPEA 1AWBA 3RY3A 3B8BA 4ZE9A 2FHYA 1JETA 4PFUA 4QFPA 2HZKA 4KXPA 3RPLB 3KC1A 1FPJA 2GRVA 1QKAA 4NHBA 4F19A 1KA0A 3LV0A 4MCOA 1B2HA 2Y5LA 1RDYA 5DW8A 4DI4B 4QFLA 4ZEDA 3ZS6A 2B4LA 3NOHA 2WX9A 5F24A 3MZBA 5A5LA 3MVXA 2RKMA 4MNPA 4XKPA 3MVWA 2DE2A 5ICQA 2CZKA 3I5OA 1UIVA 4PAIA 2V4CA 5LDZA 3MZ9A 4XKNA 1FJ9A 4H46A 4H45A 4F1VA 4OETA 3EKIA 4OEVA 1DPEA 4PFTA 4GFRA 1LEVA 3KC0A 2DDKA 4ZEBA 3ROJA 4GWZA 4OFLA 1OLAA 2XWKA 3D1RA 4MMPA 4DCYA 5I3SA 2F3DA 5FBPA 1NUZA 4HE1A 4QFKA 1FBGA 4YICA 1B40A 1XOCA 2HPGA 4TOZA 2OLBA 3DRFA 5LTCA 4ZEKA 1FRPA 4QBAA 4O7MA 1JEVA 3DRJA 4O7IA 1B52A 4JSOA 3FBPA 4PDHA 4I3YA 1OLCA 5J1DA 4X9TA 3B50A 2FIXA 4G61A 4N81A 2KQZA 3LUZA 2F3BA 4HCYA 2DE4A 4XKRA 4N15A 5EYHA 2B4MA 4GL8A 1B5IA 3TCFA 2CEYA 3E3KA 1JEUA 2XWOA 1G0HA 4O8MA 1NUWA 2JJKA 2WBBA 4YZZA 4N6DA 4OA4A 2VPNA 2VT5A 2ZZWA 5JK4A 4X8RA 1IMDA 4LN5A 2CEXA 1B9JA 4OANA 4F1UA 1FPLA 1B4HA 1FTAA 4P1LA 3QMFA 5HM4B 5T3JA 4PFBA 4PFWA 5ET8A 3E79A 3MSTA 1JP4A 4PAFA 3ISPA 2V3QA 1B3FA 4QFOA 4FAJA 4P8BA 1B46A 2NOOA 3M8UA 4X04A 1RDZA 4HE0A 1NV0A 1FBEA 2HZLA 2HHMA 3O9PA 3FTOA 1LBZA 5ET5A 4XF5A 1DPPA 5L8DA 3MVZA 2FBPA 5IGAA 3TCGA 1B5HA 1DBZA 1DCUA 1Q9DA 3W9VA 1ZLQA 5I7IA 5ESYA 2VPOA 4GWUA 1BK4A 2OX3A 1B05A 3QIMA 1B4ZA 4NG7A 4PGPA 4IR8A 1G0IA 1ZTYA 4OESA 1K9YA 4PE3A 4O94A 4GF8A 2O7IA 1LBXA 2QFLA 5IZ1A 3E78A 1NV2A 4PETA 1EYIA 1KA1A 2ZZXA 4OVTA 5ET7A 1YYZA 2D5WA 1NUYA 4P1EA 3MYUA 1FPBA 3W9WA 4ZECA 3FXBA 1LBWA 1LBYA 3MW0A 1D9QA 2BJIA 4PBHA 4OFOA 4JVCA 3BIHA 3RQTA 4PAKA 2F5XA 1K9ZA 2WOKA 3TCHA 5ISUA 4HXVA 4DCXA 4GWYA 1QKBA 4N6KA 4NN3A 3T1BA 1B6HA 1YZ0A 4FBPA 4PF6A 1FBHA 2P3VA 3DP8A 1FPDA 1RKMA 3CHGA 3GYYA 4I8CA 4M1VA 1B1HA 2KR0A 2Y5KA 4AS4A 4MAGA 4MJOA 4F18A 3DRHA 2Z23A 4PCDA 1IMAA 4GWWA 3O6PA 3SZPA 1KZ8A 3DRIA 2FVZA 3IFCA 1FJ6A 4NAPA 1FSAA 4P47A 4MEVA 4AS5A 4N4UA 4OVQA 1FPIA 4I3EA 1UQWA 5IZ3A 4MHFA 3PTYA 4XFEA 1NV5A 2WYPA 1FBFA 4PFRA 4GWSA 4HE2A 1B7HA 1IMBA 3RYBA 4GX6A 2QVVA 2FIEA 4WEDA 4GBVA 4ONYA 1XI6A 1B3LA 2GQ1A 3BIGA 4N8YA 5I5PA 1NV3A 1SPIA 4MIJA 2DVZA 1FBCA 2OWZA 1NV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B40 A;  1XOC A;  1B05 A;  3TPA A;  3QIM A;  1B4Z A;  4TOZ A;  2OLB A;  3DRF A;  4ZEK A;  1B3H A;  1B51 A;  4QFN A;  1JEV A;  3DRJ A;  1ZTY A;  4OES A;  1B52 A;  1B58 A;  4JSO A;  3RY3 A;  1OLC A;  1B5J A;  4GF8 A;  1B32 A;  2O7I A;  4ZE9 A;  1UIU A;  4PFY A;  1JET A;  4PFU A;  4OFJ A;  4JSD A;  4QFP A;  4XKR A;  3RYA A;  2B4M A;  2WOP A;  2D5W A;  1B5I A;  4GL8 A;  3TCF A;  3E3K A;  4ZEC A;  1JEU A;  2GRV A;  1QKA A;  3MVY A;  1B3G A;  3MW0 A;  4OFO A;  3PAM A;  1B2H A;  3RQT A;  4ZEI A;  2WOK A;  3TCH A;  5ISU A;  4QFL A;  4ZED A;  3ZS6 A;  4DCX A;  1B9J A;  1QKB A;  2B4L A;  1VR5 A;  3MZB A;  1B6H A;  1B4H A;  3DP8 A;  1RKM A;  3CHG A;  3MVX A;  2RKM A;  4I8C A;  4RA1 A;  5HM4 B;  1B1H A;  4XKP A;  3MVW A;  4PFW A;  4ZE8 A;  5ICQ A;  3I5O A;  1UIV A;  3DRH A;  2Z23 A;  3MZ9 A;  4XKN A;  5F1Q A;  2WOL A;  3O6P A;  4I9D A;  1B3F A;  4OET A;  3DRI A;  4QFO A;  3DRG A;  3T66 A;  4OEV A;  4FAJ A;  4OER A;  3DRK A;  1B46 A;  2NOO A;  3M8U A;  4XKQ A;  1DPE A;  3LVU A;  1UQW A;  4PFT A;  3O9P A;  1B0H A;  3FTO A;  4GFR A;  1B7H A;  1DPP A;  4ZEB A;  3RYB A;  5KZT A;  4OFL A;  5L8D A;  3MVZ A;  1OLA A;  4WED A;  3TCG A;  1B5H A;  4ONY A;  1B3L A;  4DCY A;  1ZLQ A;  1ZU0 A;  4QFK A;  4OEU A; 
#chains in the Genus database with same CATH topology
 3CFZ A;  4NQ8 A;  5H8N B;  1MH4 A;  1LB8 A;  4OVJ A;  1B3H A;  5I58 A;  1KWH A;  5H8N A;  4KR5 A;  5EYF A;  1NV1 A;  4GD5 A;  1A55 A;  2Q8M A;  2XHD A;  1QGX A;  4I40 A;  1Y9U A;  2V93 A;  1UIU A;  4PFY A;  1TXF A;  4H6D A;  1N7W A;  4IY5 A;  2CZI A;  4OFJ A;  3C31 A;  1LAX A;  5TPA A;  2OWS A;  1VDW A;  1OVT A;  1EYK A;  2ZXT A;  3RYD A;  4F3P A;  2CZL A;  3PAM A;  3TDJ A;  5I2N B;  4F3S A;  1PC3 A;  2HXR A;  1EU8 A;  4P3L A;  3V89 B;  3QXM A;  1ZBM A;  4Q8R A;  4PFI A;  1FCK A;  1O64 A;  3AXF A;  4PC9 A;  3VDF A;  2G93 A;  1H44 A;  2ALU A;  5J16 A;  4MX6 A;  3C35 A;  1XS5 A;  4TLM B;  4QXD A;  1N0T A;  1FPF A;  4BDM A;  3IOR A;  2I0C A;  1YAE A;  4ZZA A;  4JVI A;  2WOL A;  3O29 A;  4EQB A;  3VXC A;  3FJ7 A;  4JB7 A;  1PBQ A;  3DRK A;  5A5X B;  3OEL A;  4JVD A;  2QVU A;  5CI5 A;  1B0H A;  4PDD A;  2HEU A;  5KZT A;  1LAH E;  2OCU A;  4QSE A;  4DI3 D;  3HFU A;  4LZ8 A;  1MXZ A;  2QS1 A;  1QJM A;  4NMY A;  1ZU0 A;  3MC2 A;  3Q26 A;  4OEU A;  2XXK A;  3OO8 A;  2PFZ A;  4HCW A;  3HST A;  2Q8J A;  3SKP A;  3U93 A;  4Q30 B;  5AA2 A;  3MZ1 A;  2GFE A;  4PQJ A;  4NF4 A;  3RY3 A;  3CI8 A;  1ZJL A;  3B8B A;  3EHS A;  4DXC A;  2ABH A;  4DIG A;  4QFP A;  5ITO A;  3G3G A;  2ZMB A;  4AB6 A;  2Q89 A;  1D4N A;  3UOR A;  4DE8 A;  5KCJ B;  2Y5L A;  4F2Q A;  5FHN A;  4NF6 B;  1HSL A;  5DW8 A;  5CBR A;  4RPN A;  4ZED A;  2B4L A;  2WX9 A;  3GBA A;  3MZB A;  4GXA A;  4MH5 A;  1AOV A;  1XHY A;  3SEW A;  2ONS A;  3IJX B;  1MM7 A;  1SI0 A;  3T9H B;  5DT6 A;  2DE2 A;  4YU0 A;  2Y7W A;  3U1O A;  2Q88 A;  3I5O A;  3U8Q A;  4PAI A;  3OSR A;  1FJ9 A;  4KCD A;  5FTI A;  4H46 A;  4H45 A;  3O2A A;  1VFD A;  3FXR A;  1AIV A;  2XXY A;  3UA8 A;  2F35 A;  1NL5 A;  2XD3 A;  3FV1 A;  3K00 A;  4JXI A;  4PFT A;  2V84 A;  2F7A A;  1A40 A;  3KN8 A;  2DS9 A;  3LSW A;  2QS4 A;  3K6V A;  2CMO A;  3R6U A;  3SEX A;  2F3D A;  4G68 C;  5FBP A;  2Y84 A;  4YIC A;  1B40 A;  1FQF A;  3K6U A;  2UVI A;  1MRP A;  5I2K A;  1H3D A;  2YJP A;  1FTK A;  4O7M A;  2I0B A;  1MY0 A;  3DRJ A;  1LCF A;  2H98 A;  1OLC A;  2QS2 A;  4GL0 A;  3MUQ A;  1B7Z A;  3LUZ A;  2O6A A;  4R72 A;  5EYH A;  1XC1 A;  2B4M A;  1NNF A;  3E3K A;  2H9B A;  3OO9 A;  3IO6 A;  4U4X A;  1G0H A;  3H6U A;  5DTB A;  2JJK A;  3CG3 A;  4KCC A;  2VD3 A;  1FQD A;  2QMW A;  3RT6 B;  1POT A;  5TU0 A;  1YTV A;  2E0S A;  4F29 A;  1MXU A;  3MQ9 A;  4KFQ A;  4Q0C A;  3TTR A;  4F1U A;  1FPL A;  2O1L A;  2XXP A;  5CC2 A;  1SW2 A;  1XVY A;  2DYX A;  3QMF A;  1LB9 A;  5T3J A;  1DOT A;  2DWJ A;  4PFB A;  4PFW A;  2OZZ A;  2ZNU A;  3MST A;  2DXY A;  2O68 A;  4PAF A;  3ZKL A;  2VD2 A;  5H8H A;  4G68 B;  3O6I A;  5I2K B;  1VFE A;  4QFO A;  1MXW A;  2Y7K A;  2NOO A;  3VLV A;  4R9F A;  1MPD A;  2OK2 A;  1R6Z A;  3MPK A;  4ESX A;  2I58 A;  4RPO A;  3MJN A;  3FZV A;  4YMA A;  1N76 A;  1DBZ A;  4GWO A;  4YAH X;  1ZLQ A;  3M3F A;  4LUB A;  1WDN A;  2OX3 A;  1B05 A;  1AL3 A;  3MP8 A;  4IR8 A;  2UYE A;  1LAF E;  3Q29 A;  3IX1 A;  4PE3 A;  4WXJ A;  1DTG A;  3KOS A;  4YB7 A;  1XVX A;  3UGW A;  4YB6 A;  3OXN A;  1NNK A;  4OVT A;  1URS A;  4H65 A;  5ET7 A;  4P1E A;  3MYU A;  1LBY A;  1JQF A;  2BJI A;  4UAC A;  1JW5 A;  3LSL A;  1ZKB A;  2A5T A;  3TCH A;  5ISU A;  5CRY A;  3BFU A;  3H03 A;  3T1B A;  1B6H A;  4R9G A;  1GTK A;  2XX8 A;  2P3V A;  3DP8 A;  1FTJ A;  3GYY A;  3PPN A;  4WEP A;  5HPQ A;  3G3F A;  4M1V A;  2Y5K A;  4MAG A;  4MJO A;  4F18 A;  2R9J A;  2HAV A;  4KYE A;  4IO2 A;  1MQH A;  3O6P A;  3SZP A;  1TFD A;  5I56 A;  5CBS A;  3M3L A;  1FJ6 A;  3TUS A;  4MF3 A;  4P47 A;  4AS5 A;  4I3E A;  1UQW A;  4XFE A;  1NV5 A;  3HHG A;  3TMG A;  1HSE A;  1FBF A;  3DP4 A;  3PPP A;  2XXI A;  2FIE A;  3KN3 A;  1XI6 A;  2GQ1 A;  4N8Y A;  2DOJ A;  4G2Z A;  3EHT A;  1AMF A;  1FBC A;  2P3N A;  3H6V A;  3RT8 A;  2CZH A;  3TPA A;  5EQA A;  2UXA A;  2MKZ A;  3VLW A;  4P56 A;  5IKB A;  1IXC A;  1LBB A;  3FGS A;  1SQY A;  2YLN A;  1B32 A;  4O3A A;  4DXU A;  3RTF B;  1EYJ A;  2Q9T A;  5M2V A;  4GX3 A;  3K6X A;  1FPG A;  1MXY A;  1N04 A;  1IMC A;  1B3G A;  4F1Y A;  1QUJ A;  4OVP A;  2ZYN A;  4TQU Q;  1NV6 A;  4HTG A;  4ZEI A;  5IZZ A;  1FW0 A;  3TZA A;  4YB5 A;  1M5B A;  1VR5 A;  2XXV A;  1A99 A;  3OEM A;  2D21 A;  4ZZE A;  1ANF A;  2DE3 A;  4OVS A;  1MQG A;  2XXT A;  1T0K A;  4JWY A;  4RA1 A;  4ZE8 A;  4NED A;  4MLV A;  3R7X A;  4I9D A;  4F31 B;  4G68 A;  3DRG A;  3IB0 A;  3RPL A;  4PTK A;  3ILU B;  4PBQ A;  3FAS A;  2PVU A;  5IM2 A;  2AL5 A;  1B3E A;  1IME A;  1NH8 A;  4EQ7 A;  2XXQ A;  1MY2 A;  4FE8 A;  2XWV A;  3U65 A;  4U22 A;  3VFJ A;  3CVG A;  3MPL A;  4GBW A;  3T0J A;  2REJ A;  2I3W A;  2I48 A;  1FPE A;  1AWB A;  3QSL A;  4LZ5 A;  2DP8 A;  1TT1 A;  5H8Q B;  4LAT A;  2NXO A;  2DWH A;  5ICT A;  4PFU A;  1EH3 A;  2IEE A;  3O66 A;  3Q25 A;  4AB5 A;  3FXQ A;  3KSJ A;  4AQ4 A;  3I6V A;  3PPR A;  4GVO A;  4L17 A;  3TOD A;  1L5T A;  2RC9 A;  4KYD A;  3O6H A;  1RDY A;  4BDL A;  4QFL A;  1B7U A;  3ZS6 A;  3QUF A;  3NOH A;  3PD9 A;  5A5L A;  2Y7P A;  4EDP A;  3C32 A;  3JYR A;  2RKM A;  1LBC A;  2GHA A;  3TTL A;  3K6W A;  1MQI A;  3TTM A;  3MVW A;  2FYI A;  1UIV A;  3LSX A;  3DLN A;  5LDZ A;  2XXW A;  3OMB A;  3E4R A;  4F1V A;  4E0W A;  4OEV A;  2D3I A;  4F3B A;  1DPE A;  3WAE A;  3RTW B;  1SW1 A;  3PU5 A;  4GFR A;  4FEC A;  4BDQ A;  3KC0 A;  2DDK A;  3ROJ A;  3W15 C;  4OFL A;  5H8F A;  3I3V A;  1OLA A;  3HHF A;  1MY1 A;  1N84 A;  3C34 A;  2O7U A;  3D1R A;  4MMP A;  1S9T A;  1VSO A;  4PP0 A;  1IEJ A;  3FXU A;  3THI A;  4HE1 A;  2DXR A;  3KJ7 A;  2RC7 A;  1WOD A;  3KJT A;  3DRF A;  4R73 A;  3ODB A;  1JEV A;  3PUX E;  3K01 A;  4JSO A;  2HQ0 A;  4PDH A;  3U94 A;  1O63 A;  2Y7I A;  3UP9 A;  5EHM A;  3G3J A;  5L9S A;  4XKR A;  4N15 A;  4QSD A;  4HW8 A;  2P2A A;  2CEY A;  4TLL B;  2ONR A;  2I4C A;  3U92 A;  3M3K A;  4H5F A;  3H6T A;  2VT5 A;  2ZZW A;  5JK4 A;  2QL3 A;  1IMD A;  4G8H A;  4OAN A;  3EPE A;  3S9E A;  4P1L A;  3SET A;  3OD7 A;  1M5E A;  5CMM A;  1JVX A;  4G8N A;  1TWY A;  3IL1 B;  5HM4 B;  1IXG A;  3E79 A;  3E9X A;  4EXK A;  5A5X A;  3ISP A;  3PUY E;  2V3Q A;  4FEB A;  1Q1K A;  3DEL B;  4POW A;  1A8F A;  4P8B A;  3H7M A;  1B46 A;  3M8U A;  1LFG A;  5AA2 D;  1NV0 A;  1FBE A;  5B7D A;  2HHM A;  4OXV A;  1EZ9 A;  1DPP A;  2ZNS A;  3S9N C;  4C1U A;  3K4U A;  4O3C A;  2FBP A;  2Z22 A;  3V8X B;  2O51 A;  2DVC A;  4Z7E A;  5IGA A;  1MH3 A;  3USD A;  1DCU A;  3Q28 A;  3OEK A;  2ESN A;  1SBP A;  4GWU A;  3SES A;  1B4Z A;  4NG7 A;  1MQJ A;  1G0I A;  4P0I A;  3MAM A;  1K9Y A;  4KHZ E;  4GF8 A;  3VV5 A;  1CE2 A;  2PMS A;  3HCQ A;  3K2D A;  5IZ1 A;  3E78 A;  4PET A;  3VVD A;  1EYI A;  3KFM A;  1QUK A;  1TFA A;  4JWO A;  1YYZ A;  2Z8D A;  3QK6 A;  1LGB C;  2P0S A;  3SEY A;  5DYH A;  3RUM A;  1FPB A;  2A5S A;  1S50 A;  3MW0 A;  4Q5T A;  1A7L A;  2QS3 A;  1DSN A;  4H8J A;  4E0X A;  3RQT A;  3N6U A;  3QYT A;  4YKK A;  3HV1 A;  2UVG A;  4R6H A;  4NN3 A;  5DVI A;  4HS7 A;  1UTB B;  3G3I A;  3FAT A;  1A8E A;  1YZ0 A;  3CHG A;  1UTH A;  4IO6 A;  1P1O A;  3A3C A;  2NVU B;  2XXR A;  1YPN A;  3DRH A;  4FOR A;  4PCD A;  1IMA A;  4RYA A;  1Q35 A;  2FVZ A;  1M5D A;  4OHN A;  1FSA A;  3VVE A;  3K1P A;  4I1D A;  3KN7 A;  3QAX A;  2XXH A;  3KSX A;  3RGY A;  4MHF A;  5B70 A;  3K02 A;  1LCT A;  1I6Q A;  3ILT B;  2GHB A;  5K2Y A;  4GX6 A;  3B6Q A;  3C9H A;  1GR2 A;  3TQL A;  5DEX B;  4ONY A;  5DVJ A;  1B3L A;  3H4Z A;  1NV3 A;  4MIJ A;  1OVB A;  2DVZ A;  3H3G A;  1NV4 A;  2XXU A;  4ESW A;  5BWJ A;  1Y1Z A;  2WKY A;  4KQP A;  3SEU A;  1I6B A;  2RIN A;  3OO7 A;  4R75 A;  4IO3 A;  1OMP A;  5H8F B;  4XTC Q;  3CRB A;  3IOW A;  3IR1 A;  2QVR A;  4JSD A;  4KI0 E;  2R71 A;  3TAJ A;  4UAB A;  5CMB A;  1D9Y A;  4U1O A;  5AA2 B;  4NX1 A;  1JW1 A;  2RCA A;  1NI9 A;  1OQH A;  4BDR A;  1Y3Q A;  3KGC A;  3ONM A;  1LFI A;  2REG A;  1AH5 A;  2M8C A;  3E13 X;  1LAG E;  1P1U A;  2QPQ A;  4P11 A;  4PGN A;  2HXW A;  4OQO A;  4GRK A;  1FBP A;  4LP2 B;  4P9K A;  4ELQ A;  1Y1M A;  3IFA A;  1RDX A;  1UTH B;  2XA5 A;  2PCR A;  3H06 B;  4R74 A;  4GIZ A;  1D3K A;  3OO6 A;  2I3V A;  3IB2 A;  1INP A;  1FBD A;  5DEX A;  3ECR A;  1QVS A;  4OER A;  4N17 A;  3WAF A;  1F9B A;  4XKQ A;  4N13 A;  4GLI A;  4DLD A;  3LVU A;  2VHA A;  1Y3P A;  3UIF A;  4QHQ A;  4RXL A;  3B6T A;  2PBW A;  2ZYM A;  2ZZV A;  1YXI A;  1USY E;  4G77 A;  3O6G A;  1EZO A;  5IZ3 B;  3IK6 B;  3B7D A;  1FQB A;  1IMF A;  4NGU A;  4PF8 A;  1LBV A;  3D4G A;  5ELV A;  2X7P A;  4LVQ A;  4EUO A;  3PUZ E;  1NKX A;  1B51 A;  4QFN A;  5EHS A;  2DWI A;  1UTB A;  4XIG Q;  4OZ9 A;  3CG1 A;  5F7V A;  1IIT A;  4H0W A;  4U23 A;  2ZYO A;  2Z8E A;  4M4G A;  2HZK A;  4KXP A;  2GH9 A;  3RPL B;  1SW5 A;  2F6G A;  4IO4 A;  1CB6 A;  4OMB A;  1FPJ A;  2GRV A;  4F19 A;  3LV0 A;  4MCO A;  3FIR A;  5IAI A;  1R9L A;  1B2H A;  2F34 A;  5CMK A;  4ELP A;  3T9U A;  4DI4 B;  1FQA A;  3GLB A;  5I59 B;  5F24 A;  4F3G A;  5JTY B;  2H5Y A;  3GZG A;  1WVJ A;  3G3K A;  3PPQ A;  3MVX A;  2I6E A;  4MNP A;  4XKP A;  5L9O A;  1I69 A;  1N3W A;  5KDT B;  5ITP A;  5ICQ A;  3IAZ A;  3ZKK A;  3MZ9 A;  4O3B A;  4FAT A;  1LFH A;  3MBP A;  4NF8 A;  4OET A;  1JW4 A;  2PT2 A;  4YKP A;  4P0G A;  3EKI A;  1H76 A;  2F36 A;  1MY3 A;  3F11 A;  2VOZ A;  2X7Q A;  3N26 A;  4ZEB A;  1IIW A;  4H67 A;  4U4S A;  3VE1 B;  3LSF B;  4F2O A;  4DCY A;  4WKM A;  5I3S A;  4EF1 A;  1NUZ A;  3GBB A;  4QFK A;  1FBG A;  3BFT A;  1IXI A;  4GOT A;  5LTC A;  3FVK A;  4QBA A;  3S2V A;  1B52 A;  3FBP A;  3QUJ A;  2IA4 A;  4G61 A;  3CSG A;  4N81 A;  2KQZ A;  2UYF A;  4HCY A;  2DE4 A;  3PGF A;  1SI1 A;  2XWO A;  4O8M A;  1PDA A;  2WBB A;  4YZZ A;  4N6D A;  4OA4 A;  3TYH A;  2VPN A;  3PD8 A;  4X8R A;  3FJG A;  2CEX A;  4LN5 A;  1B9J A;  2W7Y A;  1FTA A;  2V3T A;  3HPI A;  2UVJ A;  3EQ1 A;  3PMW A;  3HN0 A;  3B6W A;  1B3F A;  3A09 A;  3D4C A;  1RYO A;  5AA3 A;  1NH7 A;  4I62 A;  2HZL A;  3FTO A;  1LBZ A;  3C36 A;  4C0R A;  1M5C A;  5L8D A;  4ND9 A;  1FTL A;  3PMX A;  4LON B;  4DZ1 A;  3IOV A;  4ECF A;  5K2X A;  3TCG A;  2XD2 A;  1B5H A;  1GV8 A;  1BIY A;  1Q9D A;  4ELR A;  5I7I A;  2QRY A;  5ESY A;  4NWD A;  2VPO A;  1II5 A;  3KG2 A;  3BKI B;  1BK4 A;  3P7I A;  4NF8 B;  3O97 A;  3PUV E;  5AA4 A;  2XX7 A;  1ZTY A;  4OES A;  3G3H A;  4IGR A;  4BDO A;  4O94 A;  1FQC A;  2QFL A;  1XT8 A;  4PE5 B;  1KA1 A;  2ZZX A;  2B3F A;  3CSB A;  1R9Q A;  1MG1 A;  5JTY A;  1NUY A;  3SEV A;  3T9X B;  3W9W A;  4ZEC A;  5H8H B;  4QF9 A;  2H25 A;  4PBH A;  4OFO A;  4JVC A;  4R6K A;  3BIH A;  4PAK A;  4UA8 A;  2F5X A;  1K9Z A;  1US4 A;  2WOK A;  5FHM A;  2AYS A;  3FVG A;  4HXV A;  4GWY A;  4GQO A;  1QKB A;  1FQE A;  3S9L C;  1MPC A;  4JDF A;  1RKM A;  1MY4 A;  1USY H;  1B1H A;  4POX A;  2KR0 A;  2I49 A;  3C33 A;  4AS4 A;  3UN6 A;  5I2N A;  4GWW A;  3RNN A;  3DRI A;  3IFC A;  2G29 A;  5TPA B;  1MS7 A;  2F8D A;  4MEV A;  4N4U A;  5I59 A;  1FPI A;  3N94 A;  5IZ3 A;  3T22 A;  3PTY A;  2WYP A;  4RK2 A;  1IMB A;  5L9M A;  4ELO A;  1US5 A;  1P1Q A;  4FIM A;  4H8I A;  2QVV A;  1NNP A;  5I58 B;  4IO5 A;  4WED A;  2FA7 A;  4GBV A;  3BIG A;  5I5P A;  5BUU A;  4C1T A;  5CMC A;  2RC8 A;  3TQW A;  4XEQ A;  2VGQ A;  3FUZ A;  2R6G E;  3N5L A;  1FPK A;  2F7C A;  2L5V A;  3VLU A;  1H43 A;  3IJO B;  1RYX A;  2WEF A;  1PEB A;  1N3X A;  1B5J A;  4OVR A;  1BTJ A;  4H1X A;  3KBZ A;  4R6Y A;  4K3F A;  4MNI A;  2PFY A;  1MDP 1;  2XWI A;  4NF0 A;  3RYA A;  1NUX A;  2WOP A;  4NTL A;  4MNC A;  4RNS A;  4EF2 A;  3PV0 E;  5AA4 B;  5EQ7 A;  3MVY A;  4LA9 A;  4GX4 A;  5DVF A;  1Y4C A;  1FTM A;  4MFI A;  3ZSF A;  3PPO A;  4GWX A;  3TTK A;  2B65 A;  3SDF A;  2F7B A;  1MDQ A;  2Q2C A;  1CNQ A;  2R8T A;  2THI A;  1Y3N A;  4N07 A;  5I56 B;  3LBS A;  2QMX A;  4JBZ A;  4OEN A;  4X1B A;  2HAU A;  4ZDM A;  3EF7 A;  3HO7 A;  1PB9 A;  4ZS9 A;  2Y7R A;  4OWD A;  1QUI A;  3IOU A;  1IZ1 A;  1DK4 A;  2UVH A;  3S4U A;  5KCJ A;  5CM6 A;  4U1Z A;  3A29 A;  2WYK A;  2Q74 A;  3LR1 A;  1OIB A;  1NV7 A;  5F1Q A;  1IUD A;  4F22 A;  4N8G A;  4N91 A;  3T66 A;  1ELJ A;  2A5T B;  3MP6 A;  4NWC A;  5EYG A;  3FD3 A;  5ET6 A;  2FNC A;  4NF4 B;  4YMB A;  1BP5 A;  1HSJ A;  2F97 A;  1O7T A;  3IOT A;  3U72 A;  5EQ8 A;  3K1N A;  5EQ9 A;  3H6W A;  4THI A;  4JWX A;  3VXB A;  2WBD A;  1VE4 A;  1POY 1;  2DQV A;  2BJJ X;  1J1N A;  1B58 A;  3L6G A;  2DWA A;  3JZJ A;  4ZE9 A;  3K1M A;  1MXV A;  1H45 A;  3FVO A;  2FHY A;  1JET A;  1BLF A;  1YCJ A;  3KC1 A;  3CFX A;  4LZ7 A;  4RK9 A;  1QKA A;  4NHB A;  1KA0 A;  4KD5 A;  3CIJ A;  2ZYK A;  1QW0 A;  1GGG A;  2LAO A;  4G4P A;  4U21 A;  3UK4 A;  2OJT A;  4RY1 A;  1NFT A;  2VP1 A;  1IQ7 A;  2Z8F A;  2F6P A;  1NMU A;  1PB7 A;  2O1M A;  3LC8 A;  4BDN A;  3BBR A;  4YKJ A;  3A3U A;  2H4I A;  2PYY A;  4IY6 A;  2CZK A;  1SVX B;  1FTO A;  4KPT A;  4DDD A;  2V4C A;  1MXX A;  5I84 A;  3RPW A;  4XKN A;  4X1D A;  1N7X A;  2V25 A;  1S7Y A;  2Q2A A;  1NNT A;  1A54 A;  1Z7N E;  1B0L A;  1Y4T A;  2PX1 A;  4MBP A;  1ZMG A;  4XXU A;  1LEV A;  2NUV A;  4DXB A;  4GWZ A;  3FJM A;  3PUW E;  2QSX A;  1MQD A;  4ZEF A;  1Z7M E;  2X26 A;  2XWK A;  3PMV A;  4BLA A;  3TKD A;  4U2R A;  3KEI A;  3MP1 A;  4GXS B;  1XOC A;  4G8M A;  4RJZ A;  2HPG A;  4TOZ A;  2PT1 A;  2OLB A;  4ZEK A;  1FRP A;  3R26 A;  4O7I A;  4I3Y A;  5J1D A;  4X9T A;  3B50 A;  2AIX A;  4IB2 A;  2FIX A;  4NF5 A;  1PBP A;  4LQ5 A;  3KBR A;  2F3B A;  1R1N A;  2E1S A;  1GVC A;  4OYV A;  4NE4 A;  4GL8 A;  1B5I A;  3TCF A;  3OSQ A;  4QRZ A;  2RF1 A;  1JEU A;  1BKA A;  1NUW A;  1SDX A;  2XX9 A;  3RN8 A;  2ONK E;  3VVF A;  5I57 A;  2DSF A;  2OBG A;  2OWT A;  2ANJ A;  3KOT A;  3FVN A;  1ZIU A;  2XXX A;  1B4H A;  3CFL A;  3MWB A;  2ZNT A;  3IB1 A;  4R2B A;  4IO7 A;  5JEI A;  2H99 A;  3DM0 A;  1B1X A;  3RLF E;  5ET8 A;  1JP4 A;  4FED A;  5FHO A;  2YPN A;  3KZG A;  2B3B A;  1MM6 A;  4ISU A;  2KLF A;  4FAJ A;  1JNF A;  4X04 A;  1RDZ A;  4HE0 A;  3O9P A;  4EXL A;  5ET5 A;  1DTZ A;  5TP9 B;  4XF5 A;  1SYI A;  3IO4 A;  3MVZ A;  3G7W A;  3EN3 A;  3DP6 A;  3W9V A;  1LLS A;  3N6T A;  3K0V A;  3OEN A;  1D9V A;  3S9M C;  3QIM A;  1JVY A;  4PGP A;  1SD3 A;  2P1S A;  1I6A A;  3JV9 A;  5TP9 A;  3SER A;  5FTH A;  2O69 A;  2O7I A;  1LBX A;  4QSC A;  1NV2 A;  3TTN A;  1LST A;  1SYH A;  4NF6 A;  1P99 A;  4FJP A;  2O84 X;  1EZP A;  3T93 B;  2D5W A;  3FXB A;  4YKI A;  3CR9 A;  1LBW A;  3T9V A;  1D9Q A;  4IGT A;  4MLQ A;  5HBC A;  4N6P A;  1IXH A;  1PB8 A;  1QUL A;  4DCX A;  4N6K A;  2I4B A;  5AA1 A;  1URG A;  4Z0I A;  2QJE A;  4FBP A;  3O28 A;  1DMB A;  2AL4 A;  4PF6 A;  1FBH A;  1FPD A;  4I8C A;  3GXA A;  4LQ2 A;  5H8S A;  3TFL A;  5AE4 A;  3Q27 A;  5H8Q A;  3TEL A;  1P1N A;  1P1W A;  2Z23 A;  5I57 B;  1OQG A;  1Y20 A;  4R2F A;  1KZ8 A;  2HCA A;  2NWJ A;  4F39 A;  5LOM A;  4NAP A;  2V3U A;  3EHU A;  4KYS A;  4X48 A;  5KDT A;  4OVQ A;  1MPB A;  2F78 A;  3C4M A;  4NF5 B;  2HFB A;  3FV2 A;  3TEP A;  4PFR A;  4GWS A;  4H5G A;  4HE2 A;  1B7H A;  3RYB A;  1M5F A;  3V83 A;  1ATG A;  4OTE A;  3L6H A;  1SPI A;  1SW4 A;  3LUY A;  2RCB A;  3T96 B;  1URD A;  3OOA A;  2OWZ A;  3V5A A;  4EQ9 A; 
#chains in the Genus database with same CATH homology
 2P3N A;  4NQ8 A;  2CZH A;  4XEQ A;  3TPA A;  5EQA A;  2MKZ A;  1FPK A;  1B3H A;  4P56 A;  2L5V A;  2WEF A;  1NV1 A;  1B5J A;  4OVR A;  1B32 A;  2Q8M A;  1QGX A;  3KBZ A;  4I40 A;  1UIU A;  4PFY A;  1EYJ A;  4MNI A;  2QVR A;  2Q9T A;  2CZI A;  2PFY A;  4OFJ A;  4JSD A;  4GX3 A;  2XWI A;  4NF0 A;  3RYA A;  1NUX A;  2WOP A;  4UAB A;  1FPG A;  4MNC A;  4NX1 A;  1VDW A;  5EQ7 A;  1EYK A;  3MVY A;  1NI9 A;  1IMC A;  1B3G A;  3RYD A;  4GX4 A;  4OVP A;  3PAM A;  1NV6 A;  4ZEI A;  4GWX A;  5IZZ A;  2HXR A;  4P3L A;  1CNQ A;  2R8T A;  1VR5 A;  2QPQ A;  4PGN A;  4PFI A;  2DE3 A;  4OVS A;  1FBP A;  4PC9 A;  4P9K A;  5J16 A;  4MX6 A;  4RA1 A;  3IFA A;  1RDX A;  2XA5 A;  2PCR A;  1DK4 A;  4QXD A;  4ZE8 A;  5CM6 A;  1FPF A;  3A29 A;  2WYK A;  2Q74 A;  1NV7 A;  4JVI A;  5F1Q A;  2WOL A;  1INP A;  1FBD A;  4I9D A;  4N8G A;  4N91 A;  3T66 A;  3DRG A;  3RPL A;  4PTK A;  4OER A;  3DRK A;  4N17 A;  4XKQ A;  4JVD A;  4PBQ A;  3LVU A;  2QVU A;  5EYG A;  5IM2 A;  1B0H A;  4PDD A;  5ET6 A;  1IME A;  5KZT A;  2ZZV A;  1YXI A;  2XWV A;  3U65 A;  4DI3 D;  3HFU A;  5IZ3 B;  5EQ8 A;  5EQ9 A;  1ZU0 A;  4OEU A;  4GBW A;  1IMF A;  2XXK A;  3T0J A;  2PFZ A;  4NGU A;  4PF8 A;  1LBV A;  2WBD A;  4HCW A;  1B51 A;  4QFN A;  1B58 A;  1FPE A;  1AWB A;  3RY3 A;  3B8B A;  4ZE9 A;  2FHY A;  1JET A;  4PFU A;  4QFP A;  2HZK A;  4KXP A;  3RPL B;  3KC1 A;  1FPJ A;  2GRV A;  1QKA A;  4NHB A;  4F19 A;  1KA0 A;  3LV0 A;  4MCO A;  1B2H A;  2Y5L A;  1RDY A;  5DW8 A;  4DI4 B;  4QFL A;  4ZED A;  3ZS6 A;  2B4L A;  3NOH A;  2WX9 A;  5F24 A;  3MZB A;  5A5L A;  3MVX A;  2RKM A;  4MNP A;  4XKP A;  3MVW A;  2DE2 A;  5ICQ A;  2CZK A;  3I5O A;  1UIV A;  4PAI A;  2V4C A;  5LDZ A;  3MZ9 A;  4XKN A;  1FJ9 A;  4H46 A;  4H45 A;  4F1V A;  4OET A;  3EKI A;  4OEV A;  1DPE A;  4PFT A;  4GFR A;  1LEV A;  3KC0 A;  2DDK A;  4ZEB A;  3ROJ A;  4GWZ A;  4OFL A;  1OLA A;  2XWK A;  3D1R A;  4MMP A;  4DCY A;  5I3S A;  2F3D A;  5FBP A;  1NUZ A;  4HE1 A;  4QFK A;  1FBG A;  4YIC A;  1B40 A;  1XOC A;  2HPG A;  4TOZ A;  2OLB A;  3DRF A;  5LTC A;  4ZEK A;  1FRP A;  4QBA A;  4O7M A;  1JEV A;  3DRJ A;  4O7I A;  1B52 A;  4JSO A;  3FBP A;  4PDH A;  4I3Y A;  1OLC A;  5J1D A;  4X9T A;  3B50 A;  2FIX A;  4G61 A;  4N81 A;  2KQZ A;  3LUZ A;  2F3B A;  4HCY A;  2DE4 A;  4XKR A;  4N15 A;  5EYH A;  2B4M A;  4GL8 A;  1B5I A;  3TCF A;  2CEY A;  3E3K A;  1JEU A;  2XWO A;  1G0H A;  4O8M A;  1NUW A;  2JJK A;  2WBB A;  4YZZ A;  4N6D A;  4OA4 A;  2VPN A;  2VT5 A;  2ZZW A;  5JK4 A;  4X8R A;  1IMD A;  4LN5 A;  2CEX A;  1B9J A;  4OAN A;  4F1U A;  1FPL A;  1B4H A;  1FTA A;  4P1L A;  3QMF A;  5HM4 B;  5T3J A;  4PFB A;  4PFW A;  5ET8 A;  3E79 A;  3MST A;  1JP4 A;  4PAF A;  3ISP A;  2V3Q A;  1B3F A;  4QFO A;  4FAJ A;  4P8B A;  1B46 A;  2NOO A;  3M8U A;  4X04 A;  1RDZ A;  4HE0 A;  1NV0 A;  1FBE A;  2HZL A;  2HHM A;  3O9P A;  3FTO A;  1LBZ A;  5ET5 A;  4XF5 A;  1DPP A;  5L8D A;  3MVZ A;  2FBP A;  5IGA A;  3TCG A;  1B5H A;  1DBZ A;  1DCU A;  1Q9D A;  3W9V A;  1ZLQ A;  5I7I A;  5ESY A;  2VPO A;  4GWU A;  1BK4 A;  2OX3 A;  1B05 A;  3QIM A;  1B4Z A;  4NG7 A;  4PGP A;  4IR8 A;  1G0I A;  1ZTY A;  4OES A;  1K9Y A;  4PE3 A;  4O94 A;  4GF8 A;  2O7I A;  1LBX A;  2QFL A;  5IZ1 A;  3E78 A;  1NV2 A;  4PET A;  1EYI A;  1KA1 A;  2ZZX A;  4OVT A;  5ET7 A;  1YYZ A;  2D5W A;  1NUY A;  4P1E A;  3MYU A;  1FPB A;  3W9W A;  4ZEC A;  3FXB A;  1LBW A;  1LBY A;  3MW0 A;  1D9Q A;  2BJI A;  4PBH A;  4OFO A;  4JVC A;  3BIH A;  3RQT A;  4PAK A;  2F5X A;  1K9Z A;  2WOK A;  3TCH A;  5ISU A;  4HXV A;  4DCX A;  4GWY A;  1QKB A;  4N6K A;  4NN3 A;  3T1B A;  1B6H A;  1YZ0 A;  4FBP A;  4PF6 A;  1FBH A;  2P3V A;  3DP8 A;  1FPD A;  1RKM A;  3CHG A;  3GYY A;  4I8C A;  4M1V A;  1B1H A;  2KR0 A;  2Y5K A;  4AS4 A;  4MAG A;  4MJO A;  4F18 A;  3DRH A;  2Z23 A;  4PCD A;  1IMA A;  4GWW A;  3O6P A;  3SZP A;  1KZ8 A;  3DRI A;  2FVZ A;  3IFC A;  1FJ6 A;  4NAP A;  1FSA A;  4P47 A;  4MEV A;  4AS5 A;  4N4U A;  4OVQ A;  1FPI A;  4I3E A;  1UQW A;  5IZ3 A;  4MHF A;  3PTY A;  4XFE A;  1NV5 A;  2WYP A;  1FBF A;  4PFR A;  4GWS A;  4HE2 A;  1B7H A;  1IMB A;  3RYB A;  4GX6 A;  2QVV A;  2FIE A;  4WED A;  4GBV A;  4ONY A;  1XI6 A;  1B3L A;  2GQ1 A;  3BIG A;  4N8Y A;  5I5P A;  1NV3 A;  1SPI A;  4MIJ A;  2DVZ A;  1FBC A;  2OWZ A;  1NV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...