2B59B

The type ii cohesin dockerin complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
b'GYKVSGYILPDFSFDATVAPLVKAGFKVEIVGTELYAVTDANGYFEITGVPANASGYTLKISRATYLDRVIANVVVTGDTSVSTSQAPIMMWVGDIVKDNSINLLDVAEVIRCFNATKGSANYVEELDINRNGAINMQDIMIVHKHFGATSSDYDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG1196: Chromosome segregation ATPases
molecule tags Hydrolase/structural protein
source organism Clostridium thermocellum
publication title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00404 Dockerin_1 Dockerin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 2b59B02
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2b59B01
2B59B 4FXTA 4UYPB 1DAQA 1OHZB 3HN5A 4FL4A 4WKZA 2NSMA 4UYQB 3G3LA 2MTEA 4YOKA 3KCPA 4FL4C 4DH2B 3NJVA 2VN6B 3E8VA 5K39B 4WI0B 1NKGA 4U3SB 3MN8A 3UL4B 2XHNA 4EIUA 2OZNB 3NJXA 2CCLB 5G5DB 5LXVB 1DAVA 1UWYA 1H8LA 2Y3NB 5AQ0A 4IU3B 2JNKA 2VN5B 4IU2B 1QMUA 4IYKA
chains in the Genus database with same CATH superfamily
2VMCA 2RB8A 3QFJB 5HGGS 4XO9A 5JIPA 4UYQB 1XMEB 5F0LB 3NA4A 3FB8A 1YEJH 4NCDA 5AVZB 5E4IA 4XCYB 1ETZA 5LG1A 5KVFH 4UZUA 1KJVB 5E2VL 2BIQA 4ZO7A 1I8MA 2H8PA 3LHAA 2AABL 2R1YB 1KXQA 3SDCA 5BO0D 4K5MA 1UYWL 3IFPA 1N64L 4JO5A 4QHMA 4O5LH 4ORGB 1BAFH 5KUMA 3T9WA 1RMFH 1N5AB 3D87B 1FV1A 4Y4FA 3LXCA 4NWTH 3RRQA 4ZJ9A 5EIVA 3Q2NA 2O61A 5D4QA 4DKEH 2ZOUA 3GJFK 4KQ0A 5C0CA 3HPJA 4LXFA 4G7SB 3H3KA 3IETB 1NFDB 3GS0A 5FYJH 2EUZA 3KL5A 4M6OH 1OE3A 3DV4B 1UADC 4ATWA 5IJDC 1CZ8H 3ZKMD 4P8QA 4GUCA 4Y4KC 2X0WA 4PJFA 4UT7L 5B1CA 5CKAA 5IWLA 2VLRE 1O5PA 2AABH 1JHLH 2CMRL 3K80A 3OKLB 4HWZA 4JRYA 4X9YA 3UTSA 4M8QA 2JJUA 1MZYA 2X2IA 1T7XA 3NMEA 1AQ8A 3K81A 4NERA 4UWQB 5AW0B 2YD6A 1U41A 5D2LA 3ZKMC 3GBDA 1CDIA 4YUEL 1W72B 4AGOA 3FT2A 2DQ6A 1J0YA 4YHYB 3H7LA 3UDWC 2J3SA 1QFHA 3TF7C 1GXEA 4AYSA 5T1DH 2MIZA 3KBEA 2DJ4A 1WCBB 2A4CA 1TO5A 2W5PA 1N2RA 1C5DB 3B9KB 4OLXL 2LV4A 4OCWH 1PG7X 3SDDD 5AYUL 1KTJA 1DJYA 4X5WB 3VXMB 1TR7A 2FHBA 5T33L 1JHLL 2VMDA 3UTZB 3ZHLA 1LQSR 2VE6A 1KLFB 4B60A 1U91B 3QYCA 1FE8H 2OI9B 4ANXA 1FBIH 1OZTG 2FNWA 3S5ZA 4M7ZC 4N2AA 1NJ9B 5HGDB 5IROA 4CMHB 3NJVA 2A9MH 3DX8A 3D5OF 1YEFH 4GSDL 3CPLA 1N0LA 3AU1A 4POZD 1YN7A 4QHNA 1CFQA 3JWOL 5T1DL 1JYNA 2ZUVA 3LRSA 5JIHA 2VDOL 5AVTB 1KLUB 1R3IH 2E9JA 2WLIA 4NO2A 5I8KL 1P1VA 2GB2A 4NM8L 3QUGA 15C8L 2CKBL 5F1OB 4F27A 2VL5A 3BUDA 2XACC 3IDIB 4BH8A 4HG4J 2AXGA 3PAVA 4UF7C 2J6WA 2O6DA 1GZPA 1QYGH 5BV7B 1NUGA 5TF1L 3IPBA 5INDB 3SKMA 2ZXCA 3UTTB 4HIXL 4N9GB 2AXFB 3BO8A 2IFFH 3D18B 5IK3B 1IGIL 2P5PA 5E2TL 1U8QA 3BT2L 4MA1B 4XBPB 1AS6A 5T3XL 4QEGA 1SQ2N 3T8XA 4R7NA 4DEPC 4M6NH 3TZVD 3QJZA 4H1LB 1IAIL 4G9FE 4WRLA 4AEFA 1HSBB 4OZFA 4N5EC 1GOGA 1RUQH 2CLZA 1ZTMA 5KTEL 3HOGA 4LIQE 1L0QA 5IT2L 5AL8A 1FAKT 5FV1L 3WO4B 3WO4C 2LFGA 5JUEL 5E8EB 1T20A 5JQHC 1KXVA 1RFDH 3VD3A 5C97A 3BUQA 3OB0K 1B0RA 4UBDC 3AS3A 3RPBA 1SN2A 3MRBB 4OT1L 3PDGA 5G5DA 2WIIB 1SOQA 1WC7B 1XF3B 2R1XB 4PD4J 1SJHA 2AJYH 5C0AA 2D2CC 2EIZA 3BP7B 4X5XB 1XB3A 4I88A 4QRUB 4CMMA 1OTTD 3MNVB 5CBAB 5I1AB 5AZEH 1S7SA 3C60D 1JFQL 5LAXB 4ZXBD 2AQPA 1F58H 2ATKA 5EIIB 5IVZA 2KDYA 2ITDA 1LEKA 2H26B 1GSMA 1G6VK 1T4KA 4M7ZB 1V3LA 1HHIB 1FDLH 2J1WA 3NCYS 1NAKH 1TEFA 4GMSL 4YC2C 4CMHC 3LRHA 4YL9A 5KS9F 1LO0L 4UM9A 4ZXBC 4YDMA 4FABH 1R19A 5E2JA 4KMTH 4GO6B 4U6XB 1GGCH 2R83A 1MPAL 1BQLL 1FI8C 4JANA 4Z3TA 3N1FC 4EQ2A 3PGFH 3OG4B 2VR5A 1N6QH 2WKGA 1N9PA 4NI6A 3OKKB 4P2OD 2NYYC 5L4JA 5FHAH 3TX4A 2P52A 4ZI8A 1EBPA 1Q0XL 3KS0H 1OAZH 1P7HL 4PS7A 4PY7A 3AGVA 2BSDA 5FYKH 1AGDA 3AGWA 4WW2C 1NGWA 2VLJA 3D39D 3OL2A 3P3TA 1NA8A 3CDZA 3FB7A 4GH7B 3IDIA 5D2NB 5MEPB 3GSNH 3O3DB 4UIMB 4N1CA 5LNGA 3DJTA 3CZEA 3UCRA 2F5AH 2NDGA 4ETQA 3BSZH 3BMWA 4Z7NB 1A4KA 5ISZB 2HWZL 3FUJA 5J6GB 4OH2A 1G1CA 4Z6AT 3DECA 3I9IA 4WSJA 5EEYA 1Q0XH 1AD9B 3HRZA 2GABA 1KCSL 1HAUA 3WFCL 3MUHL 4AOFA 3O6FC 2CDEB 1WRFA 2QLYA 1OXYA 5LDSA 4YDJA 5J7CC 5MHSD 5HDWA 2VSCA 4MLIA 4FNQA 1KN2H 2IALA 4DGUA 4FXKC 4LSVL 5DFWH 2TRYA 3WKQA 4K71B 3A6BL 3B9KA 4UOW1 4W9EC 1UXWA 1D6VL 4Z0XB 3N40P 5K69A 1INEH 2R69H 5D1XB 2G4EA 5IHZB 5DSCB 4XMUA 2PO6B 3SE9H 3RVTD 5IOPA 3TBYA 3DVGA 5EBLA 4HJ0D 3M88A 2B08A 1T2QH 3ZDZF 1EAJA 1A1OB 5JOEA 1WAPA 1QP1A 4XCEA 5GRUH 4CGTA 1CICA 2DDQH 4MTMA 1BBJA 3BRFA 4X5XA 5I66B 4P0DA 1CK0L 4P48A 5D70H 1YRKA 4G42A 5DJ0B 4PGEA 1J5IA 1XVSA 2EEDA 1QR4A 4YDVB 1DQQA 3V0VA 1S7WB 1KSRA 1G7LA 4FLHA 2DWSA 4BGDA 1TF4A 3P2BA 1J9RA 5DRNA 3R4DA 1V8HA 3GSWA 2ZONA 4A2LA 2LVCA 4IDJL 1WD8A 4PP1D 3VXSB 1T0NA 2O93L 1NIAA 3VD4A 4IRZL 3BFQG 2AQQA 4KK5C 1FL5A 4YLCA 1CI3M 1KYOJ 2VDPH 4LPWA 5ECGA 5CCGE 4JHBA 4PTTB 3C5ZB 4JMNA 4KI1A 4OF6A 4P2RD 3PP4L 3VXSD 2YS4A 4WUUB 4TSBL 4L4VB 1D5MB 1UCBH 4IRSA 4ORZC 4JPKH 1AYRA 1NBVH 2IC2A 1S7QB 2KLRA 2NY1B 1TZIB 3IYLW 1ZDQA 2DY2A 1T0MB 1UXMA 4NKDA 4P9HL 5CSZB 5C0EB 4TUKH 4M5ZL 4HSAC 3F7VA 2XA8H 1CVRA 4AQOA 1RZFH 1BOGA 5F1IB 1KEML 2DYPB 4FCAA 1KBGL 1MHCB 2XG4B 3KLAA 3ORJA 1RERA 2ZCZA 3LH2L 2DQUL 2XQYG 1CFNB 4ZO9A 3VFNB 5GSRB 4LOFA 1JV2B 5E6UB 4AV0A 5FEBA 5FECA 5IM7B 4MD0A 1YPZA 3I6SA 4WCYL 1FNLA 4HJGB 4F57H 1GCYA 3C5JB 1FIGH 1SGKA 4BQCA 4XE0A 3ZT7A 4QY8A 2NX5D 4PJIA 2H8PB 4AYID 1MIMH 3H6AA 3KH4A 3Q5YA 5B22A 3VJ6B 4NHCH 5EUOB 1P4LA 2HYMA 2XA8L 4W6XB 1KXHA 3L3DB 5F7UA 1BMZA 4IBUA 3EW3B 1UFGA 4XX1G 3G6JE 5F3HB 3MODL 4IBZA 1U8LB 2VJ0A 3LEVH 4F8NA 1KJMB 4PI2A 3OBAA 3K72B 4HUVB 5KYWB 2GEEA 3Q8BA 4EAEA 1MLCA 3MA7A 4XMPL 3RL2A 4ZX3A 2K8QA 3WJJA 4D0BB 4DP0X 3OHXA 4B95C 3CXDH 4RVBA 3W9EB 5I1DB 2KYIA 1RZQA 1FYTA 4L3EB 4A7SA 3GO1H 1ILUA 1XGYL 3PYCA 4OLUL 1E9PA 1NMAH 1PBYA 1ZLVK 2JIXA 3BKJH 3KXFE 3DO7A 4Y5XB 4UNIA 4YDVA 3NABH 4R0LA 3MNWA 5CJQL 4R8WH 3RX5A 3S88L 3VDBA 3QUZD 3PXHA 2YPLB 4GRLD 3BE1H 4JFQA 4XNDA 3L6FA 4JDVA 2H1PH 1I7TA 2EVIA 2FQEA 2OJEA 1AXIB 4KHXL 2BNRD 5EUKA 2PR4L 4APXA 3WXVL 1N8OE 1A7OH 2EO7A 3CXDL 4U4IA 1UJ3C 2HFEB 4WI0A 2AC0A 5GGSB 3X13B 3RFZB 1AO7A 5C6TL 4Z7NE 1KJ2B 4I77L 1AGCB 3C8KB 3KJ4C 3OZKA 3QDJE 3QG6A 4TTGA 1J86A 3ZPDA 4PS4H 5GPRA 3VWKA 3PGDB 1UM5H 3GNML 3R1GL 2CDEA 1MCIA 1NLDL 4BM7A 1T04A 2CCLB 2AJZA 4WW2F 2Y36L 2IF7A 1EHXA 4OZHE 4A2DA 4JHVA 2FZ3A 1L9SA 2FWOA 4LCWA 4HMEA 2MRYA 3GK8H 2YAPA 1SLVA 4KUCD 4LGRB 3IK2A 1AO7E 1T3FB 4OI9A 5KVFL 3IMTA 1NGZB 5D1XE 2OCJA 1U8CA 1JRHI 2WXGA 1E4KC 1F97A 4QNPF 5F2FA 3D39A 4XX1E 5ICZB 1OAYH 4LLDA 4OGAC 3INUL 1N8ZA 3PP3K 2VXTL 2X42A 4GW5A 4CC0A 4W9ZA 3MV01 3GJFA 1A4JA 5AFAA 5EORH 3VD2A 1PX4A 3V0WL 1R3HB 4GRLA 4ZS6D 3S3PA 4AE0A 1TFHA 2M1KA 4N2FA 3SDAA 1ZJBA 4W9LC 4PB0L 4ZYKA 3IAGC 3ARDC 4O00A 1CQKA 4FYQA 3BUPA 3QCUL 2A77L 4OCYH 1BVKA 1JJUA 4R26L 4OAWB 4H26A 1WF5A 3HMWH 4PJHB 5I17A 4OKVB 1UT1A 4JY5L 3IDGA 5D2NE 3WE6B 3ASOB 5I26A 2ZF8A 3AZUA 3Q5TA 4Y5VB 4RZCB 2CUHA 5C08A 5HYJD 4GKOA 3VFUA 1N5YL 2VLLB 5DK0A 4GS7B 3RWFB 2ILLA 1MY7A 4P4RB 1YNLL 1G94A 1OGAB 5CU9A 4BFJA 1UCTA 2EDLA 3W9DA 3D30A 1DO6A 5L4IA 1GGTA 3MTXA 1KJ2H 1CLZL 4EI6B 3QB7C 5E7BA 1U8MB 3MXVH 1FFQA 1AOHA 2EO1A 2QQKL 2AJXL 4M6ML 4U1HB 1R1CA 2BNQE 4KPHL 3TEUA 4OCRH 3BW9A 2Y1ZA 3RNQB 3HE7A 5AYUH 3TO4A 4E9WA 5KVGL 2JB6B 1JF5A 1WFMA 3GTNA 4LHUB 4ZUUA 1F3JB 2YAOA 2C4FT 1YEWA 2F0CA 1TLMA 4HJJL 4U7MA 2Y7OA 4A63A 3IBOA 1HIMH 4JDTL 4KROD 1QSVA 1GKEA 3BSZA 5KWYC 2VW6A 1TSRA 1YEFL 4GSDH 2W8CA 5KJRH 2X2HA 3P4MA 4MDRA 4XAKE 5E70A 1QQDB 5AVUB 3K6IA 4YZFF 2GG1A 3ZTEA 5AVSB 5HYQA 4N8VA 4LLVB 4MMXB 4JQVA 1OHQA 1T04B 4NM4L 1I1AB 2QEJA 3QZWA 1JERA 3MCKA 4ZMYA 2Y3AA 3QPKA 3L95B 2BLFA 2J88L 3TO2A 4PJEF 2QMJA 1KN4H 2E7MA 4J4PD 4NQCB 1RU9L 1MWAA 5I19H 4XI5D 5A2FA 2X3BA 1NCCH 1MCJA 1EJ8A 1OSEA 2HJLA 2XV0A 3UTPD 1URIA 3MJGX 2IH1B 2GBAA 4FJYA 4IIQB 1G9HA 1C08A 2APXA 1ZT1B 1NKOA 4HPOL 4YWGL 4EN3D 4ODTH 2XZQH 4KJYB 5TK2A 2XWBA 2F1BA 4FYRA 1DLFL 3D2UD 4BEIA 4U33A 3ZE0E 3RX9A 5FA3A 1N0LB 1OWWA 1AY1L 4QHNB 5IT2H 3QC6X 2VO8A 3SDAB 3QJFA 5LKNA 1N70A 3DDFA 1DVFD 4JFQB 5IGXL 2C5DC 3HPLB 5A2AA 4HWBA 2CE6A 3EO1A 1MCFA 3ETTA 3HZVA 1UD8A 2WZPD 4LLQB 3S35X 2Z8VC 1UYWH 3IBEA 5HHVL 4URTB 2E9GA 4A2HA 4LLMA 4AQ1A 5DI8B 4MCZA 5AG9A 4BIKA 1PCXA 4YBLC 3UX9B 3P9MA 2X1QA 3RDTD 4ADJA 3O8XD 4P46A 2AFNA 5HY9A 3I50H 3N0PB 2BP5M 4GAJH 3VH8A 5LQBH 3LVEA 1ZA6B 2PPEA 2COVD 1A6WH 1D7DA 1HKLL 4UT9L 4WI3A 3KYAA 4M8VA 4QO1B 2JKJA 2WLLA 5F8RC 5I15H 5MEPA 1YMHB 3ARGA 4KH2A 3K6SA 4NN5C 2WBXA 3B83A 5E08H 1G7HA 1IMHC 1KIQA 3I74A 3P1VA 4GKSA 4MDIB 3QUKB 3DIFA 2FYYB 4JG1H 4J6RH 4MWFB 2C7FA 2QPUA 3FSAA 1DQJB 2ZG2A 1OD9A 2BX5A 2YPLD 3T2QA 4BQ9A 1UZ6F 1HHGA 1QWHA 1CD0A 3MLXH 5FKAB 2AEQL 2EE3A 3QQXA 2JKXA 5DVOA 3EYQC 2X5PA 3BH4A 4BDVB 1ZEAH 2AK1H 5LQBL 1P84K 3WAJA 4FOMA 4EO5A 2QADB 4ZW7A 1W8OA 5AOMA 3MNWB 4IMKC 5D1ZA 1J88A 5I5MA 1HHJA 1UUNA 5IVZB 2FH6A 5EIIA 5AOJA 2G9KA 4TKWA 4JO4H 3CH8A 4QRTB 3BD5A 5TH2B 4PGBB 2XWJA 4YGVB 4BK8A 1WA2X 4NKMA 4TPRH 1UASA 4NN6C 4KX7A 1D5BA 3L3HA 1BVOA 4FJ6A 1SDDB 4IGBC 1PYWA 2RQEA 4PJAB 1N12A 3VXOA 4G11A 4BRJA 2XXMB 2XG5A 1RI8A 4X7DC 4X83A 3BWAA 1QFUH 4TLUA 3S37H 4JDEB 5EOCH 2R9HD 3HZYA 3FONB 3T09A 1TJIH 1BQHG 2YFNA 1WGOA 5AEAA 1OAXH 3APFA 4R7NB 3V0AC 4RGNC 4K73A 1YSOA 3WFCH 2CK2A 3SKNB 2CLRB 2J6EH 1PFOA 2FLBT 4NM8H 2D3NA 2BSRB 5HDRA 2R2EB 2ATPA 1Z1WA 1F0LA 3MLRH 4L5FH 3SN6N 1EFXB 3MRRB 2B8OT 3BPNB 3KE0A 5ALBH 1F45A 4OI7A 3MUGB 3MBED 3RZCA 1RVFH 5F7EL 3DTUB 3ME0A 1ZPLA 5FB8A 1N59B 3RNKA 4XP5L 5IMKA 3JWDL 43CAB 3ILEA 4GAYB 2FR4A 3AS2A 2NNXA 5AAMA 2YQ2A 3IKCA 5DHVH 2Y06H 2XQBH 2EKSA 4TULL 1KNOA 2DMHA 5B7FA 4DN4L 4HPYL 4GT0A 2CO7B 4TNFA 4YHKL 4Z77B 2ADFH 2NX5B 1KF9B 4JFYA 2VNCA 2X4RB 2HLFC 3TASA 2EH7L 1IGFL 2Z34A 3H4HA 1GVIA 3U7AA 3DSFH 5LBSA 2W9EL 4YHOL 4NKDB 4MA7H 4EUPH 3T0EC 4YDNA 1P2CA 3E1F1 1GS6X 3F7QA 4PJBF 4X9HA 4NEHB 4YAQA 1CU4L 2G2RB 1YN6B 4JQIA 5I6MA 2BRRL 2F74A 1JWSB 3B9KC 4RFNC 1CDUA 4J6IA 4P3CL 1BPVA 1K72A 1RJLB 2WNWA 4P3DA 5I8OL 2BY1A 4G7VH 5GRWA 2MCAA 4R5TA 1BXVA 3NJLA 1KFAH 5ANME 3L3GB 1OE1A 1KPRA 3AB0C 2YQ3A 2NY3C 2LLNA 3DV6A 4CN1A 1AZUA 1ZRUA 1W8EA 4JFXA 2WCGA 4H7VA 5DQ9A 2FJUB 1NGWB 2ENPA 2VLJB 1RZFL 3ZRSA 1S7WA 3CVIL 1C5CH 2H0EA 3TA3D 2BJML 4JUSA 3FO0H 2VR4A 1Z66A 4KJPC 1JF6A 3CDZB 4W9IC 2B39A 2RTTA 5DZAA 3V95A 2QDVA 2WWKO 1X7TA 4YFDB 1G0YR 1I3VA 2HTKD 1LDSA 4LMQE 4ETQB 4KVNL 4QAMB 5CINH 4ODUA 5DI8A 3HR5B 5BV7C 1NAML 5L88H 5DO2C 5HHXH 3MLSL 5LHDA 5LWYL 4YHNB 2Y7QA 5K1VA 1P4UA 1SYVA 2WWMD 5IESH 4AEIL 3FT4A 1F6FB 1F41A 1FWXA 1QKZL 3UEQA 1PSKH 3E80A 4I3RL 3SIKA 3MROB 4Y1AE 4F2EA 5I71C 3B43A 2H26A 2XKSA 3QJQB 5DUJA 3ZL2A 3N1MC 1T5XA 4YDJB 4YXKH 1BM3L 2ZJSH 3TBWB 4EKJA 4R83A 1UXLA 4IOIB 4UUJA 1Q0YH 2IFFL 3BSZL 2YC1A 3MJ7B 1BD2A 1I85A 3BGMB 3N91A 1SLUA 2RFXA 1VA9A 3BLBA 5CO1A 1SFDA 3WE1A 2GY5A 1UEYA 5JXAL 4OJDH 4Y2OB 1DSFH 2BSTB 3HB3B 5EPMB 3QA3B 1NCJA 4F7CA 4PJFE 5C3LD 4Q14A 3L7EA 1T5KA 3OKDA 1R5WA 2O30A 1L4IA 2V37A 3X1FA 2AV7A 4MMZC 3OR7B 4O58H 3LIZA 1YYLH 5C8JB 4GO8A 5IHUH 4XAWL 4D0DA 1MHPL 1ZANH 4JZJA 2PCFA 4ONHA 4JZOA 5DUBB 5JO5B 1MW3A 1CDHA 2YLHA 1VZHA 1UKQA 1ASPA 2FB4L 4N5UA 3ZX1A 4WJG3 5AAPA 4BH7A 3CDGA 3DIVA 1XGQB 4X4MA 1KGYE 3EF4A 4EMZA 4ZNEA 3HNVH 5E9AA 3TNMB 4H1LA 2EC8A 2XQ0A 4GKZA 5L2KE 2FDBP 5E6IA 1Q90A 3ARUA 4ACPA 2R29A 2FEJA 3TVMD 2WTPA 4F92B 4N0FB 1EJOH 2DDQL 4LVOB 2X41A 3L9RB 1FVEA 2DYPD 2XBZA 1DE4A 3UG4A 2XPGB 4PB9L 2DW5A 1V3MA 2A9DA 1E65A 5TQ2H 3UP6A 3AT8A 2W38A 2YD9A 2OMBA 1INQA 2YGVA 3VAEA 2Z9TA 4KKCC 3CX2A 3G5VB 4I0PA 3IMSA 3GNMH 1DCEA 3VI4B 2MMXA 3I6GB 3CFTA 3WGUB 5DU7A 3NCBB 2XTJE 4H8VA 3WJLA 3DMMA 1OM3L 2K1MA 2R56L 3L3JA 1LMIA 2OZ4A 3MO1B 4BA0A 2DLGA 2ZP8A 1TVHB 2BH0A 4JB9H 3C09C 3ZHDA 5C3IA 4N9GA 3P77A 4RRPA 2OCFD 2YD1A 2ZCLL 2R0LH 1XD1A 4LPTA 5KSAC 4F1SA 4IYKA 1LO4L 3N42B 4EE2A 5EUKB 3SE3A 1VADB 5GRYA 2YPKA 2DMGA 3T77A 2HVKA 3N55A 5TPWL 3VU1A 2JKWA 2YKLH 4ODWB 2BNRB 4LDEB 3NH7H 2ADJA 4X80H 4PGCA 2A1WL 1YCSA 3QNFA 1X5KA 1OV8A 2NYYD 5EO0B 5DVNA 2MCG1 3E9UA 1KEMH 2H3NB 4G9DA 5I1EH 1MF2L 2NNFA 3KBFA 1M7DB 2OXHB 3EDFA 1XR8A 3HNSL 2NY0C 1GIGH 1OGTB 3OHMB 2NSXA 4Z7QB 5DJAB 4JZNB 4TYUA 3O4LE 3H9SA 5CP3H 4EDWL 1TVBA 4JQXA 3RKDC 3BUTA 1NQBA 4Z7UB 1VFAB 4F8TA 1ZVSA 2DYRB 4PG9B 3KPTA 1NSNH 3L9YA 5FOJA 3OKYA 3T8MA 4D0BA 4MB3A 3V6FB 1LO5A 4O02A 1HDMA 1M2OA 4PJ5E 4FQQA 2J44A 1F3DJ 4C56D 3FJTA 2YD2A 4J3WA 1CDCA 4MS8C 3KR3H 4U3HA 3KWXA 2YRLA 1BHGA 3HZ3A 1HH9A 4JEGB 4ZO6A 3FULA 1QW9A 2GITB 1IFGA 2UZYB 1QQDA 4EI5D 4KPHH 4R2GC 1CFQB 3MUZ1 5M7QA 4CVWA 4ZOCA 1DJGA 1DVFC 3IETA 3VXUE 3U30C 3U30B 2ZUXA 3REWB 4AGMA 4KMLB 2XT1B 4QKTA 3SEPA 1TPXB 4Z0XA 1UD2A 2AP2A 4FG0A 4Y7OC 1W8NA 4ELMB 1F00I 4C59B 5FR3A 1UUSA 4OGYH 3DVFA 5KVEL 1HXMB 3ZQ9A 2CHNA 3GBNH 3RGHA 4ICWA 4DPAX 1DZBA 5J3HD 2V5MA 5BW7A 5TDNB 1O7DC 3VXUA 3BVDB 3GMNB 4KTDH 4D8OA 3QJRB 1LEGB 3Q2WA 3TEXA 5C0FA 4MAYD 3AQYA 5DVPA 1I7UA 4B9PA 1A7OL 4LPVA 5KSBA 1F4AA 1TTCA 4KOBA 5E8OA 3S5YA 1BZ9B 2NW3A 4X4ME 3FQNA 3G9VA 3SQBA 3TO4C 2GTQA 4R4BA 3QEQE 1JZDC 2NY0B 1FJ1A 2AGJL 3IXAA 1OCRB 4O4YH 2EIMB 2VRKA 2P44B 3VFPA 2AQNA 1RZGB 5FHBL 1YG9A 3DX2A 4N0CC 2GC4C 2JELH 3SGKC 3FONA 2E9WA 5LXGL 5GGQL 1XMWA 3BYTA 3SKNA 3CFNA 4X9GA 3D39E 4WCYH 3WN5A 4YSQA 3L9EA 2MQ3A 4M7LT 4MQSB 1CJYA 3VSUA 1T5WB 3AROA 3SKOB 3TTSA 3MX0B 1F56A 5F6HI 4ZTOL 3QXAA 5FO9B 4EVNB 2B5IC 5ILTH 1RZ7L 4Y2DA 3I3DA 2VRAA 3NZHH 3QHTC 3SCMB 5SWZD 1NCBH 3W0WD 1KGUA 3RB5A 4XO3A 3NESA 3NJMA 4F3FA 3NIGE 3RURA 4PRBB 3ECVA 4XN1A 3GZOA 4QWWC 4Y5YC 1UVQB 4NENA 5HHOD 1A21A 3W5MA 2VDQH 4XVTH 1IEHA 1M71A 2WBWB 4PW9A 3ARRA 1T83C 2RHEA 3QG7H 3PCYA 4G6JL 4AGPA 3RWCB 4KRNA 1L5GB 3K8LA 3WIFB 1E4XL 2ZYHA 4L4TE 4P05A 2EDWA 4P2QA 3TYFA 1NFDE 4UILH 1A9EA 3VFGH 1U9KA 3NZHL 3OKOB 1A7QL 4FQHB 4BWUA 3RWIB 5AB0A 3VNZA 3RWEA 3C6LA 3UPRA 1JMXA 4L3ED 1EIBA 2CM5A 1YJDL 3UJTH 1UGNA 1O9ZA 3W56A 3GIZL 4L29B 1HSAB 4M6OL 5DC9B 2CRZA 5A2BA 1IT9L 2WCSA 4OCRL 5F1SA 4NZUL 4J5VA 2OMVA 4Y8DC 1ZHKA 3U6XS 3KEHA 5HJGA 4M93C 1F1GA 2CBTA 2BWDA 3KW8A 1BAWA 1NIFA 4JFXB 3QNYB 3ARGC 1JFHA 1KELH 5TDOB 2ICWA 1KIQB 3H9SB 3W38A 2QGDA 1HX0A 3PL6A 2YWYA 3MRNB 1TETL 4IKJA 3VD5A 4NUPA 5INDA 1UG9A 1I9RH 5GGSA 3ZKND 5I5JA 1IGMH 2VR8A 4NRYA 2PO6A 2EYTB 1TZ8A 3O45B 3QHZH 1J7VR 1HILB 3GHBH 3OX8A 5AB9A 1A7PH 2XWBB 4NM4H 2NR6C 2BK8A 1GYWA 4J8QA 4N86A 1WHOA 1E5YA 3GMRA 4OUUB 1TQCC 3NTCH 1K4DA 4DKFL 3G5YB 5EZOL 3HNTH 2NYZA 4M7KH 1KPVA 1WH0A 2FNBA 4LHUD 3WFEL 4ZFFB 1KDJA 1JE6A 2H2PC 3AMLA 3PS6A 3Q3GB 2Q8AH 3BDBA 5F21B 2CHWA 1F13A 4P4KA 3WL9A 2WJ5A 2ZQKA 1FAIH 4L3EA 5ICXA 4GW1A 5IFJA 4HWNA 2Z31D 1CE6A 5GZOD 3ROLA 3VG0H 3N3EA 2BPBA 4OJAA 4QHKI 1IBZA 1QFPA 3IJYA 4PJCA 2K9FB 3VXQB 5KS9E 5ESVB 1P7KA 1JZ3A 3MA9L 2WWMC 2YUWA 4QYOB 1UC6A 4L37B 2NX5E 4JG0L 2ZWZA 3UH8A 3MOBH 2GKIA 1HH6B 3MLTA 4JKLA 3CZFA 4J3OC 1FZJA 1RK1A 5GGTH 3EFOB 2ZYRA 1V7ML 2C3XA 2Q3XA 3HS0C 4KO5A 1EEYB 1L9OA 4IGBB 5CIPA 2NW3B 4X8GA 4KJQC 4LVNC 4F93B 3B6SA 3N44F 3Q2LA 5KOMC 2IXQB 3ETSA 2RBLA 3EOBA 3L4XA 1E28B 1E4JA 4M56A 1NC4B 2LFEA 1QLEL 3EBIA 3QUHA 4HHAB 5AZ2L 2BVQA 4HUUA 3VFNA 3P4OA 5D8JH 3LXUX 4RGNB 3AITA 1TOXA 2E0PA 3TNNB 4FNTA 5BOPA 3RWIA 4L8DA 3AREB 4FL4A 4WKZA 1CZ8L 3LKNA 5B8CC 4HUMB 3ROOA 5K33A 3RJQB 4LIQL 1XGTA 3GUTB 5JPNA 5B4MC 1I4FA 2Z8RA 1QR1B 1SXCA 5D1XD 3S34H 2WBJA 1JNJA 1U8NB 3JT0A 1JI2A 5H4YA 2V8LA 2B9AA 4NKOA 3NJNA 4XBGB 1L0PA 3TP4A 5HHME 1RD6A 2R0WL 3RUGB 1JZ4A 4UUJB 3BZFA 3OJVC 4H5SA 4K8RH 5HHPB 1CFMA 1Z0MA 2BNUB 2XZZA 2MKLC 1ETZB 2X40A 3DGCR 1J8RA 5DRWB 1LWRA 4U1IB 3RTQA 3ESPA 1PKQA 4YEFA 5DA0B 3OX8B 2WMPB 2D3JA 1OF0A 4WW1A 5EBGA 1FPTH 1K6QL 1Q1JL 2NT0A 5F3FA 3WBDA 5ITFA 1M42A 3STBA 5HXMA 4DO5A 1YEKH 1FBIL 2CHXA 4L1DA 3POCA 5FYKD 2KPNA 2OSXA 3V0GA 1EXUB 3T4AC 4MASA 4XNQA 4N2GA 3HAEA 5T1JA 3TNMA 3KLQA 1TJXA 1ZD6A 3KYNB 4K3JL 5FHAL 5DJAA 1E50A 2O5YH 3DTXA 3UGUA 5C0JB 4NZTL 2A3TA 4N2IA 3ZDZB 1CLYL 5EU6B 4F9LC 3NPSC 4YO0A 1Q72L 3BVNB 1O0VA 1TENA 4AIZB 4JNXA 4M1CD 1FFRA 1PU0A 1ACYH 1DYZA 2HFGL 2J21A 2O5XH 3PPEA 4TVUA 5D1QD 1RY7B 5FDYA 3VCLB 4YSCA 2XTJB 4KNQA 1LO5B 5CEZL 3S48A 1EAQA 1J9SA 1BQ5A 2FJHB 3OF6A 3SGDI 1TNMA 4CGUB 4N22A 5KYYA 1NFIB 2EXYD 3PGDA 2XN9D 4P5KA 2PTTB 1BFTA 1H8OA 4M1CC 2B0SL 2GK0A 3PJLA 5JHDE 3WFHB 2F5BH 2Y2WA 3N6YA 4OV5A 3KPLB 1YN6A 3AXHA 3QFDB 3MJ7A 4K3JH 4NSKA 2FLRT 3QZLA 2CRYA 5C0BD 1ADWA 4XTRD 4DN4H 2P8PA 3G5XB 2HKFL 1Q72H 1A1MB 4G6FD 4U49A 2JFCA 3QWNA 2A74C 5E4EC 4LNVA 3V4VB 4NUJB 3VI3F 1OAQL 3UXFA 2W81C 4XT1C 4YFLI 1D6VH 2ODIA 2F9BT 5JIQA 4EDXA 1FNSL 1JUFA 2R7EA 3DO7B 2YOCA 4L48A 2HXAA 1BAFL 2OQJB 3VM7A 5AYTA 4OV6F 3F05A 2EDBA 4I0CC 2YEZA 1IM9D 5FB8B 2JB5L 2IADB 1A65A 3P3YA 2ZCLH 5ANMA 1KYAA 2BNQD 4AVIA 5DRXB 2GY7B 1G1YA 2A6JA 2P42B 1Y6NR 2CDFA 3QQ3A 1NICA 3QPXL 1UEMA 3I9GL 4JM4H 1I8UA 3KJ6H 4GW4B 1MCQA 3MJWA 3T1FB 4FQXA 2XPGA 2EACA 3O8XC 2GJZB 2DS4A 4RAVB 5C0IA 1H6FA 1MCEA 4ELKA 1ZSDA 3IN0A 5JORA 3KM1A 3IFOA 4HJ0C 2ERJB 1K5NB 3WTWA 3R0MA 1WFOA 4KUZH 4EN3B 4J12A 3FU6A 2P5WD 3MCYA 3OPZH 3MDJA 4F8PA 2VLKA 1CXIA 1SBSH 3FPYA 2KMWA 1NAMH 2X7LB 4BHUI 1YQVH 3KH3A 3EOAA 4QF1B 4PRIA 1RZIB 1RAMA 1RCYA 3SCMA 1HVXA 4D7PA 1A3LL 1B0GA 2IPUK 3K4DA 3KJ6L 1ZIBA 4BUHA 2ZUQB 1F3RB 2WXHA 4NKMB 1A6ZA 1NLBH 1I9JH 4H20H 1XQ4A 2L0DA 5KVMC 4MS8D 3GSNL 1MRCH 4M48H 3NZ8B 4N2OA 1S7VA 3WNJA 1U3NA 2EZ0C 1DUYA 2QLVB 1BD2E 1ET8A 1QLFB 2XXCB 4NXSA 5JIMA 2B14A 4PGDB 3U9PL 5CEZD 3PJSA 4FFYL 1UZ8B 3QUYA 1DSFL 2FLMA 5GS1A 3T0EB 1BWMA 4BKLA 4QRRA 3VMOA 4Y4FC 3WFZA 3CZUB 2K8MA 2ADFL 5C2UB 1L9MA 5B39B 2J1ZA 2NXZB 3QPQD 1MW0A 3MV9D 1AHWC 1D7FA 3LB6D 3UIYA 3VMNA 2MQGA 4A2FA 1BCIA 5DWUL 1XZ0A 2B4CC 5TF1H 2WQSA 1HI6B 3FK3A 4GY4A 2ZXAA 4UQ2A 2KQNA 2WIMA 3Q48A 2OKMA 4X7EC 2JCWA 4CA4A 3TV3L 4RSYA 2R7EB 2ZWLT 5E6RB 4HKBA 4MAUL 5JZ7C 3D3VA 1NFKA 2PCPB 2NY6D 3KGTA 5D1ZD 1UH2A 2LE9A 3ILQD 4F7EA 3PV6A 1N10A 3DGGB 2RFXB 3G6DH 3TBBA 4FC3E 4ERSL 4H4NA 1FP5A 8PAZA 5JA8B 2IBGA 1PZ5A 4F9PA 3SE4A 1S7UA 3SPVA 1UWXK 4JFTA 1F86A 1XGRA 4LLQA 5JPMB 1T89A 2MSPA 2WSDA 2Y5EA 4KK9D 3FTVA 5DXWA 3SPGA 1G1OA 4NFCA 1T66C 3TURA 3EXJA 5D1ZI 4UQ9A 2PW2B 2BJMH 1ETB1 5H94A 4EI0A 5EN2B 4LHJB 4CDGC 1YEIH 1KPVB 3DX3A 1A8JH 1GHFL 2VRQA 3NIDB 2VE6B 4AIXA 4ZUSA 3UTSD 3NDYE 1NEUA 5HDOA 1NKRA 4LAQL 2VQUA 4ZRGA 1AC0A 5I71B 1CBVH 4BV1A 1JNHB 4WHTA 1Y6KR 1NJ9A 2CGRL 4L4TA 4AUYA 3MLSH 2FD6L 3F65A 1LO4H 2QZ5A 5J5EA 3APMA 1HOCA 1OY3B 1DQIA 3PXLA 4G9FA 4MDIA 2X4NB 3ARDD 3NSCA 4KKBC 3UROR 1FDLL 5FFLA 2ZKHH 4Y89A 3V6FA 4N2EA 3HG2A 4WWKB 4WWKC 3BKML 3SYPA 4RA3A 4PJIE 3IJ8A 4KOCA 2DQUH 3QE5A 2CIIA 4G70B 2E86A 4HWZB 4MA8H 2F19H 4QOKD 4G8FB 1JNNH 3RWGB 3VACA 1AHWB 3SGKA 1MCWM 4QRRE 5D71H 3X12A 4D2NA 1TMQA 3MRKA 4HFWB 3OWRA 1IBFA 2E4FA 3KPRE 1VRSA 4I0KA 5ERWB 3D0AA 5FYKL 3J2PA 1NSNL 1OP5K 4JO2H 2PO6D 1G9EA 2ZNXA 4XWOC 5EORL 1GJUA 3L5XL 4QT5A 4FXKB 2WQRA 3KWUA 5EOQH 1AC6A 1E9QA 1ZPUA 2NY4C 1ND0A 1KXVC 2F5AL 4PB0H 2BP3A 2BNRA 1FNAA 1D9KC 4TQIA 5LAXA 3N06B 1WGVA 4G1EA 1KB5A 3L3OB 2CPUA 1KEGH 2WQVA 4R26H 3TS8A 2ARWA 3B1TA 3IJSA 3W11C 5DVLA 5GJSL 2LOEA 4LKXB 3V0HA 3ROOB 2F1AA 3BWUF 4WGWB 5FDWB 2D7NA 1RUAH 3CQPA 4GXUN 3MV8D 4PCYA 3PP3H 5I5IA 3QZMA 5CNHA 3N43B 4JFPB 3VFVA 1FLTX 5CGMA 1CFBA 4OIBA 4PVLA 4C56B 1LP9B 4WJ5B 4JKWA 1Y0LA 1UXSA 4LSDA 3QO1A 3VFSA 3S88H 1KTLA 2J1YA 5T3ZH 4F15C 2J5LB 1X5YA 4P07A 5B1JC 1ES0B 5F7DB 1B4RA 1YY8A 4BDVA 1C12A 1ZVHA 1H6TA 5K9QG 4B9JA 1KB9K 1J8HA 4OCLC 2D7QA 2DM7A 5IK3A 1G7LB 4F7MB 2GFBB 2GTWB 2JNZA 4ZFQA 3PJNA 5C6TH 4C4KO 1JXKA 2C34A 5ANMB 3E3QE 3VI3E 4NUGL 3CLEH 1RIUH 3EO1B 5CJBA 3HN5A 3O3BB 5KJRL 4Q9QL 2AV7B 4HOXA 4NJ9H 3CMOL 5ALCL 4Q97A 3IKKA 2OZ4H 5DTFB 2VDKB 5H2BB 3RAJH 3HNSH 3QORD 4JKNA 3V0FA 4F58H 1HXMA 7PCYA 2CO3A 1JGEA 1L3WA 3NQKA 2AXHA 3OMIB 1KN4L 3IE9A 2BSBA 5IVXA 3ZZQA 4QHLA 1UOVA 1N18A 4UQIM 5E6IC 2DQDL 3OKMA 4NZDA 3KS0J 4IBTA 4BKTC 2D03H 3V5KB 2B3IA 2W0KA 1UACL 4QCIA 1NCOA 1C1EL 4JRYD 3VI4F 3C9NB 3MVSA 1JXDA 3SQRA 2VUOA 1JGVH 1DVFB 3ZYIA 3QDMD 2I07B 3UO8B 5E5RB 2YPVA 4JAMB 4NAQA 4Z0BL 4Z18A 1J8KA 2VXQH 4LSTH 3NSYA 2XBTA 4QT5B 4U1LB 5T1MB 4BXVA 2YMOA 4NSKB 2CGYA 2IANA 4OJYA 4ODUB 2YN5A 4YSDA 3FYEB 4A2GA 1I7RA 4PRDB 1QHPA 3X3GH 4RWHA 4IBLT 3TBSB 3ZE2E 4I5BA 4UDTA 1V55B 3HMWL 2VN3A 4GAGL 4CDHA 1XF4B 1WVZA 3VSQA 2H5UA 2YMXL 3BXNB 3JTBA 5KEZA 2GI7A 1BDYA 3QG7L 4G6JH 1LE5B 2X12A 2H6OA 3EDDA 3E1ZA 2J5LC 3VGAC 3F7YA 3U1QA 1F1DA 2FEEL 5CHNB 2WW8A 2E74C 3MGTB 4KDTA 4MVBC 3KBPA 3NZSA 3CFJA 1OB0A 3EJCA 4LCWB 4K5NA 5DUPH 1JPGA 5C1MB 4Z0BH 3A4DA 3CFKB 4LF3B 5KN5B 4HJIA 3UO1L 1DVSA 1CD1A 4F37F 4J4PA 2GJRA 4ZQKA 3X3GL 1B0IA 1RULL 4XN2A 5T5NG 4JM2B 1CL7H 1T1XB 1J8HE 1JZHA 4FFYA 4RDBA 3FU7A 5A2JH 2H32A 3FW6A 1B2WH 3SY0A 3DX6A 4FCHA 4PRAB 1K6QH 1Q1JH 2J43A 4M3JA 2R29L 4Y4HB 2HVKB 2B15A 1I53A 1SHWA 2GTZA 1HNGA 3PGCB 5IHHA 2P5WA 3WFDL 3BAWA 4UM9D 1QFWL 1QSEE 4Q74A 1XBRA 2F6AA 4XVOA 4BFEA 2VN6A 1W6WA 4W1TA 3NIFB 1HQRB 2PKDA 2NY7H 4P57A 1DEDA 3NK3A 3NP4A 4XBGA 2XV6B 4NNXB 2HMID 2I27N 1X6NA 5IB4A 3UIZA 1SXAA 2CWRA 3O2WH 1NPNA 4I2XB 3GLEA 5IBTH 2FBJH 3OMAB 2A4ZA 1CL7L 5EZJA 3EOAB 4QF1A 3MCLL 4X0KA 5IW6A 4GRMA 4NYLB 4DKFH 5HGBA 4UDUA 4RGOL 2NTFB 2E7LC 4WGKA 2CIKA 4HK3J 1SEBB 1RZKL 4KK5D 3Q1SH 4ZOAA 4E9SA 2OP4L 1TYRA 3MZGB 1I1AC 3L3IA 1FZJB 4OGZA 5F7KC 1VFBB 3MV7B 3R1GH 3PY9A 3GS4A 3CHQA 3TIDB 3VG0L 1DLFH 5I75C 2WXPA 3CDYA 3O2WL 1WEJL 4Y9BA 3L3DA 3EOBB 3RVVD 3NFNB 2OPCA 5CJ8A 5D7JA 2ICWI 1A7NH 1R34A 2KI6A 2ZYSA 4L23A 1CIUA 3VRLF 4AITA 3LOWA 2Z1PA 3IU4L 4P2OC 4U7KA 2VR9A 5EF2A 3O9WB 1G9NL 2ZXDA 1MHHA 4S0SD 2GCYB 1HZKA 4RDQF 3WJJC 2O5ZL 3ZRCC 3A4FA 2BY3A 3QDJA 1IAKA 5F70A 4E41D 1UD4A 3HG1D 3MJ8A 1I4FB 4NQSA 2RR3A 5DSCA 4ZAKB 3T4AB 3EJQA 4M00A 1QLEH 4UMGA 5C0FB 2ZUUA 1WEJH 4P59H 1YYML 3CK0H 1UKTA 1TG8A 3QPXH 5GGSY 4J28A 2QL1A 3GLAA 1E9QB 2W92A 3BOVA 2FT8A 3CVHA 4WJKB 3BRGC 1HTYA 4UU9B 1AMYA 4DPBX 3JUYA 1K2DA 4UINH 2QFPA 1MREL 3FT4B 1L6PA 5AW3B 3UBXG 1PLAA 5L2JB 1TMCB 2OMWB 1IQWL 2Y25A 1RMFL 2Q76B 4PRNB 2V2WB 4XMVA 2QV2A 1D5IL 3ILPA 1MN4A 1TZHB 1KJ2L 3GRWH 5KYWA 1C5DA 3LMJL 1NMCB 2UX7A 4QXUH 4WSKA 4Y9EA 4PMEA 4Q4IA 4RFEB 2HA1A 2JQMA 3TZVA 5LGJA 3MRCB 3T2OA 2W9DL 5EIIG 2PETA 1PEWA 4GP4B 4H0IA 3VA6A 3WTYA 1NBQA 5CSBA 1IM9B 4WI4A 4KK9C 4HCRL 4DESA 3ML8A 4PJ9A 3EYVA 3NOIA 2WBKA 4UDTB 5I1GL 1U93B 1NCHA 3V4PB 3OMZA 4M9PA 2NY5H 2AMUA 3B9KD 2GTWA 2R0KL 2J5WA 1WBZB 3E3QC 3WELA 4AXWA 2WQ8A 2VAJA 1QRNB 2AK4B 5CJXC 4GIOA 5JW4N 4I13B 3RHWF 5J12C 3BLPX 3A4AA 1S9VB 4IK6A 2VLJE 3R7QA 4GYBA 1VIWA 2APWA 3HS0B 4UOQA 2X4TA 4JFEE 1DCLA 3CH1A 2WUCL 4S1SH 1MFAH 2D7TH 2P80A 4WKXA 4BELD 1A2YB 4JRFA 3SDAC 2ZXBA 3F7LA 4KK6D 2Z91B 4Z7WF 1YC8A 2E9IA 4UQCA 5KW9L 3EKCA 4K3HA 5B3NA 4BZ1A 3O2DH 1HC1A 2X88A 1CWVA 4GLRI 2XIIA 4R4NC 4A38A 4QRSB 3QEQB 1RK0B 4Q9RH 3JV6B 2PXYA 2WXJA 4JK0D 2CO6A 5JQ6L 2C9AA 1OE2A 2DB8A 4ZD3L 1IGYB 5SWQA 1KYFA 1Z0NA 1IAKB 1FZMA 1DUZA 1IIKA 1TJGH 2YA0A 3IE4A 5CLZA 3FB8B 5FCUL 4HF5L 1MLCB 1I3RB 1H8LA 5HJ3A 1TVHA 5I1KL 2VDOH 2ZNWA 3FB7B 1ZGLM 1EO7A 1KDIA 3QUYC 3O0LA 1XXDC 2XKUA 3VMPA 4I48B 1KGCD 5FA4A 3QDHA 2WUBH 5AD0B 5ADOH 2HX8A 1NC4D 2UWEB 3CC5A 3UEZA 1M7XA 3JYCA 4LCUA 1FSKC 4NO5A 5IJVA 4HIXH 3L81A 4C56A 4TLKA 4HV8B 1WCQA 4ALAL 4IRSC 4G1MA 3QR1A 4JLRB 2UYLB 1X5MA 2VGLM 4LVHC 2EVGA 3U36A 3JV4A 4JDZB 1XF5B 3FU0A 3TIDA 1KGXA 1N68A 4FXGB 2I85A 2YRZA 2XG4A 5IW3A 3V79C 3IJYB 4PJCB 1E3XA 3SKMB 5DRWA 1DDHA 5DK0B 4HLZG 4IHOA 1P6WA 2OR8A 2ZOKA 1A9BA 3MREB 4DN3L 4QJ5B 1B0GB 2KERA 2VXUH 4HAKA 4HCFA 2JCCA 5A2LH 2D7PA 3UDWA 3C5JA 1PZ2A 2APTA 5HYSB 2F19L 3X13A 3BUIA 1B3IA 4XVSL 2PW1A 4L9LB 5FPIA 3KXFB 2ZG1A 2OMXB 2G9HA 3NCFB 3FFDB 2Z93B 3I6KA 3UJJH 4AYBA 2IAAC 5C70A 4Y8AA 3O6FB 3KWWA 5D7HA 2BXYA 3IFLH 3BIKB 4I3SL 4NQDE 4I1PA 1GYVA 3QCVH 5AOLA 3ZGHA 5JPMC 1WCBA 3FUNA 5GGVY 2BSSA 2DM4A 2UY7A 3IJEB 4M5YL 4XMKH 4FNPA 3FH7A 3QJHA 2XTSA 4FABL 12E8H 4ADIA 2OM5A 1YMME 4FG2A 3UBGA 4Y16C 3DJ9A 4TVPH 5KOVC 2B0SH 2NW2B 2N01B 1ZS8B 2F8IA 2FSEA 4AQ1C 5DQDH 4DH2A 2HLAA 2JE8A 1YMHA 4ODHH 2YD0A 2X1XR 3IDUA 4PLNC 1PZSA 3T71A 3B9EA 2AJ3A 2OYMA 5D7EA 4O58L 5HY9B 5C0GA 4R0LC 3TT1H 2CJSA 3MPCA 2AEWA 2PR9A 2UWEF 4M5YH 2WLIB 3T08A 4Y1AD 3X17A 5LDUA 1VZIA 2OL3H 4D8PB 4M7JL 5ICXB 1XSOA 3EIFA 1EEQA 2EICA 2NNRA 5HHPA 1RHHA 2A9AA 4RFNB 5FYJU 4QY8B 3TXAA 3W3BA 4UB0H 3V7AE 5E23A 2C1OA 1D9KA 5DQDL 1ZHLB 2DWEB 2UZPA 2ICEC 3FUEA 5A3IC 1J1PH 5EFIA 4ZUSB 1QLEB 2ZSWA 2WANA 3QO0B 2ENQA 1UM4H 3HHSB 2NY3B 1OF2B 5AOKA 3OR6A 1BF8A 1MFCH 2VDNH 3O3DA 1K8DB 1DSWA 4ECNA 2NLJB 4XNYL 3CHRA 4U1MB 4UBDD 4MJ6A 3V4PL 3II1A 3N42F 4U3SA 2E59A 2B59B 2JCCE 4FS0A 1MRDH 1EGJH 3BAEH 2Q86B 5GZNC 3RAJL 1S7SB 1R5VB 1DBJH 2IXQA 1S7RB 3A6OA 1CPUA 2Q0ZX 3FU8A 5D5MB 5IW1B 4LAQH 2CLRA 1SOXA 1KUMA 4MKTA 4Q2ZB 5DD3L 4HGMA 2R0LL 5I1IL 1C12B 3FUIA 2E6QA 3STLB 1ZHNA 4Y4HD 4DUXA 1Y7VA 3S8GB 2W94A 3B4NA 1HEHC 1EFXA 1DL7L 5D7IA 3ZK0A 3EGDB 2BY0A 2OULB 1IZKA 3CDGB 1UACH 2G3MA 2GJZA 2A99A 3C09B 4RSVA 1C16A 4G7QB 4WO4C 4ELDA 1IILE 5EB9A 3F5WB 1JWUA 5KSAB 3WS3B 3IWVA 2VL5B 3QR0A 1JP5A 3QZOA 3TH2T 5I18L 3HG3A 4GKNA 3Q13A 5BVJB 2QQNH 3HUJF 5EO1A 1LDPH 4NS0A 2ADGB 3QXDA 3D4GA 1YUHB 2ZUYA 3PWVB 1DBKL 2DRUA 1BBDL 2KT6A 2PYEE 5F0MB 5CM1A 4PGDA 5AAMC 5ECJE 1NDTA 1TQUA 2GIYA 4Q6KA 4Z7UF 3BN9D 3RVXD 3HBPA 4K94H 4P5MB 2E76C 3IJSB 3BEWA 1J0HA 1HCVA 3L4CA 3ZY7A 1H19A 1BWWA 4H1LH 4Y5XC 3QYMA 1T7VA 5J9PB 3CCHB 4MNQA 32C2B 5EZPA 5FDWA 3MXWL 4H40A 4L4JA 2V5YA 2X89A 4N2LA 4R7VA 5ANHA 3WEMA 1HT6A 3IDYB 2A83B 2FBRA 4NBXB 5IB3B 5I74B 3VVVA 2NDFA 2V7HA 3K8MA 4NRYB 2WKOA 4R4FH 3MACL 3UERA 3OAZK 4PJFF 1JZ6A 2ESVA 2VDRB 1CLOL 1JTPA 2VDQL 1D5MA 1J9TA 3QJXA 5KBMA 1M3JA 2P48B 3SO3C 5E8NA 3LPPA 1CGVA 3V8OA 1KBPA 4ACTA 4NQQA 3EYSH 4HK0A 2VM4A 4MNQE 5MP6H 3T1FA 3WFDH 1EFQA 3DTDA 1CIDA 5B1AB 5JOPD 4R2GB 4W9JC 1MHPH 2KZKA 1XGQA 2XZAL 3FT9A 4YHIB 4AKPA 1AE6H 3RWDA 5K39B 4G72B 3VFTB 1A7QH 1HHKB 2UY6B 3HB3C 4M3KB 4BH8B 4U1MA 2OW7A 1PJ9A 4FFVC 5E5UB 4L5FE 5EU7E 3RUGF 3ILPB 4E41E 1CICC 4XCEB 5AKVA 4XP4L 3RPIA 4ABVA 2I24N 1N19A 4KC3B 1ZVSB 4QWWD 1B4JH 2KQMA 4TF4A 4P3WA 4PFEA 5BRQA 4G42B 3NGBB 2DQIL 3BFWA 4Z5RA 2YD8A 4PWFA 1KGWA 1NM4A 1OD7A 4PRHA 5DZ9A 4UAHA 5GRVL 4OD1L 2OP4H 5CD5D 2XNAB 5I6XC 2MOGA 2CCLA 1HL5A 1FGVH 1VKXB 1NAMB 4LGSB 4GQZA 4KZCA 1A2YA 3C08H 4NQTA 2JSFA 3QHZL 4UZGA 3WHXA 1IVLA 2VXSL 1K2DB 4N9OB 3I75B 4MNHA 4XP4H 3BIAX 1HL8A 5FGRA 4Y9GA 4G6AC 3WEBA 4D3CL 2IPTH 3F7PC 3CFIC 1FLRH 3RGVC 4R6UA 4OD2A 5F9JB 2PXYD 2QZQA 3R06A 4LCWD 3WFEH 2JIXB 1NDMB 3GGWA 3MU3A 4FZEH 4CMMB 3PWVA 2OR9H 1E6OH 3PDOB 3FQUA 1XZ0B 1J9CT 1FH2A 4NUQA 4W9DC 2FJHA 4FQIH 3Q8EA 4MMZA 4TL4A 1MELA 3EH5B 1W72L 2E7DA 4MJIE 2GJPA 3KEDA 4I48A 4E2OA 3L95A 4P9MH 4KV5E 1ZTXH 3UTTE 1MWAH 2OTUA 3IKCB 4Z3JA 3D3VB 4P2QE 4D3CH 1ITBB 2IPTL 4JN1L 3SDAD 1FVEB 1CD9B 4GIAA 2WXLA 1UZ6E 5FW8A 4U1IA 1DQTA 3SDXA 4DGVH 4B97A 1PG7W 4U6XA 3NQIA 1ZVYA 2AITA 4I18A 1J5CA 1ID2A 4RGND 4OW6A 2QGCA 3FQ2A 4XGZA 1AGBA 4P2OA 3S35L 2APVA 3M07A 4PI0A 4YAQB 4N6RB 2F61A 1N7MH 3CU7A 5ITFB 3ULVC 1ROWA 4YUEH 3V0WH 2Z31C 3CFCH 5HYJA 1G87A 2PYEA 1KWKA 4UQ3B 1D5IH 5C07A 4IJ3B 3VXTA 1W0YT 5EU4B 3W57A 1WZKA 1LD9A 4JFPA 4ZTPH 2A9CA 4I0PC 1DDHB 4ZFOA 2F68X 4NNXA 2ZAIA 3BP6A 4HP5A 4JN1H 2VDOB 2W91A 4NZUH 1ASQA 3QZNA 3ML9A 5FUZH 3MYZA 1R24B 1PYWB 3D0LB 2WZ0A 4JX0A 5EU7C 4X6DA 4B9GA 1C5BL 2NOYA 2XCMC 4K8RD 1KELL 3ULUE 3N0AA 4YDLB 5E00B 5GGRY 1SUJA 4NDMB 5CBAA 4OLZL 3HS8A 3LKSA 6TAAA 4ZOEA 3OKEB 3P30H 3TF4A 3UTOA 4K07A 4FFZL 3ZMEA 1G0XA 1P4BH 4A39A 3TGXA 5SWSB 4J27A 1FZOA 5F7YC 1PMYA 5L8JB 3QDME 3ARGB 1ILSA 3QYNA 2VDLB 2NUTB 2A6KA 4K9EL 1BVKB 1IBYA 5AAWC 1LO2H 1UZGA 5AKRA 3VB8A 2YGPA 2FYYA 3V4LA 2PYFA 1SEQH 4XOCA 3HFMH 1TPXC 1QEWB 4LOUC 1DE4B 4ONGL 5SWSD 5ETUA 3RUGE 3WNMA 3D52A 3K5SA 5K9QI 2AAVA 3F6IA 5B4MD 4ZMLA 1S78D 1T7WA 2VIRA 4LFHG 5ESAB 4YX2H 4TSCH 1P4IH 4WU5B 1UA6L 4G6KL 2OSWA 1DJSA 4FYSA 4JQXC 4LDCA 1KG0B 4L8SA 4PJ9B 1XCTA 3DI2B 5GHWL 3ZRFC 4NO5B 3S9DB 3L4TA 4LHQB 5TE4L 5FGCE 4AG4H 4K7PY 1PKOA 3TIEB 1DQQB 3ULVF 2PMZA 1HHJB 5F0PB 2XVKA 1CLYH 3FC8A 3T6VA 4H13C 4PJGF 2VR7A 2Q2LA 3JVGC 4L4TD 1SYSA 4ONGH 1AGFB 4AJWA 5IEHA 5T1MA 4H8HA 2ITCB 2ZXQA 4LLMB 2XI9A 3GIVA 3KPPB 5DS2A 4P3DB 2V3EA 2GHZA 4KXAA 1DVFA 1SJEA 2AV1B 1AHKA 4IEFB 2ZUTA 3IT8D 1BGXL 3T2PA 3IN2A 1BQKA 5CR8A 3SDCB 5HYJE 4NWTL 5JLZA 3ZL4L 2XUWA 5BQ7A 4KTGA 1JFQH 3WTSA 3W0WE 2X2YA 4JL2A 1J5OL 5F96L 1VKXA 4OQTL 3QCTH 1XGZA 1YLBB 4X6BA 2JJVA 4F7TA 2YLKA 4LL1A 5AVRB 4O2EA 3JUZA 4GUPA 4WEMB 5G4OA 4HT1H 3PV6B 3EGXA 3TZVB 4RFEA 5D7KE 4UT7H 1RPKA 5DURD 3F7YB 1NFDF 1YNTF 5J1AB 2I7OA 4JFVA 2D2OA 3MNZA 1F4XH 4WQOA 3MC0A 2X4OA 1JDCA 4DH2B 2R0WH 2XXGA 1MAKA 5HHQB 1XIWD 4HS6B 4XPTH 4DEWA 3FRPB 3UL4B 4DAGL 1OZUA 1U8PB 3HLAA 3QWOB 4QD2E 2DI8A 3TCLA 1XGPA 2C9QA 2V2XA 3PWUB 2D31A 4NN7B 5E95B 4GAJL 4YHIA 2OMVB 3PNRB 5B39G 5TE6L 1YJDH 2G0LA 3CFEA 2EECA 1RIVL 2V9RA 3FT3B 5AYQA 1QPKA 2XWCA 2BOCA 5I8EA 3UZVA 1U3ZA 1UOKA 4EI6A 1SFHA 1W2KT 1LHZA 4XBEL 4TSAL 2X6VA 3EO0A 5DQJB 3GB7A 3WMSA 4G5ZL 5IQOA 3Q9QA 4XPGL 2WXIA 4HG4K 4KJWC 2MOQA 4Y2DB 3UOAB 1NCAH 4A2MA 1FE8L 3FTZA 3HG5A 3VG9B 4Z7QE 3E0GA 1QI5A 4KROC 3GSRB 4JE4B 4QHKJ 5K59E 2JJWA 4UIKL 3SDCD 4JR9H 2VR6A 5E51A 4X4YB 3EJTA 5FKPA 4IRSB 3G5ZA 4NP9A 2FE0A 3O9WC 3AM8A 4X4ZA 3BDYH 4FLQA 1JGDB 1BZDA 1A7PL 4UQ3A 3GUTA 4TQEH 1EUUA 3KLHC 3GZQA 4B50A 3V6BR 4D9QD 2O5XL 2Y1AA 4OB5L 5KN5A 1LTXA 1NLBL 1Z5LB 3CDFA 1OSYA 4H20L 2H0JA 4J4PC 1QYGL 3BESR 3O2DL 3PREA 1YZZA 1DANU 3ILQC 3BC9A 5KYUB 5E1HB 4UM8A 2AQRA 5CGBA 1XCQB 2GT9A 2O6CA 1JG9A 4IIZA 4RAHA 2Q8AL 2EQDA 3NJFA 3UC0L 2ROXA 2UWEA 1PJWA 3CC5B 3W1ZA 5AD0A 1UTDA 4GBXD 3TFBA 1W9XA 2IGFL 4JR9L 3UPAA 4LVNB 3BLKA 3UYPB 1EFXD 3MRIA 3PDOA 3HKZA 4DKEL 1I1YB 2H9GB 3FHEA 3QORA 5IY5B 1UOLA 3VVWA 2VM3A 3VI4E 1C16B 3BDYL 4ZX5A 1MFVA 2JQZA 4GQ9L 3WYRA 2BRQA 1CYWA 1E27A 3CK0L 3IVKA 3EFDL 3CZFB 1BZOA 4OFYA 5C0RL 1HSBA 4OZFB 4Q6IA 1KCLA 4L5FL 4OBSA 3BJ91 3ATDA 3B34A 1EEYA 5C6WH 2OZNB 5FYLD 4G9FB 1NMCC 4EF3A 1XCXA 1MCOL 5F1NA 5CD3B 2B20A 2BOLA 5F6HJ 1U8KA 4LDOB 2ED6A 4PJDF 5JYLA 2V4LA 2XJLA 5MEND 1YNTB 2VDPL 3QA3A 5JXED 1JN6B 5JHLA 2I9TB 3ZDWA 4ATTA 2VW4A 7PAZA 3PP4H 5DZVA 5HGAA 3CGTA 4UOW0 3MQIA 4YBHA 2OTWA 3TN0B 5IQ7L 2NNCA 4KXZH 1S7TB 3AG4B 5EZJB 4GQ9H 4EJ1C 3WNLA 2QADD 3DDGA 4FHJA 5A1AA 2QSTA 1H15B 5DHEA 1WT5A 4JPKL 3D09A 5JW4R 3KZ8A 1AXTH 3FTGB 3QRLA 4R0LB 1EZLA 3E7JA 1SM3H 5EFIB 5EEZA 3CZKA 3VU2A 3ELAT 1DJIA 2DI7A 2R39A 5E1AB 1L9QA 5MEOA 4D9QE 1QZNA 2P7TB 4LK4A 5I73B 4PRPB 3ULSB 5FLUA 3QUZC 3VB9A 1VESA 4JPIB 3TWYA 1FFOB 1CDJA 3WIHL 3GIVB 3KPPA 3WXWH 2VOTA 4I3GA 3LKQB 1E4WL 1ZE3C 3QC5X 3RX8A 4APQC 5GZNA 3MNMA 1S4IA 3QS3A 3JWOH 2I5YH 2CGZA 1VEMA 1ZS8A 2HVJA 4Y2LA 2EADA 5FM8A 3T2LA 4ZZFA 5DVKA 2DICA 5I1HL 3E6FB 4N4YB 2B2XL 5E8NB 4W4OC 2ITFA 2WKLA 4NQVA 5I23A 1P84J 5T3ZE 1HH9B 3PQYE 5DHVA 3L54A 3CIAA 1I9JL 3KPRB 2Z7UA 1X7SA 2QKSA 4E41A 4S1RH 3VFVB 2B1AL 2CQVA 4GLRH 1HNYA 5L2KD 3NCJH 5MENB 3QH3B 1JPEA 4XNAA 1OAUL 3CFQA 5T3XH 3ZZSA 1MFNA 5B3JE 3G6JA 4ZAKD 3KDMA 4PJDE 4AEHL 1SDDA 1GY2A 4K9JA 1I3UA 5J13C 2BS71 2MEJB 2XIDA 3TBSA 5HYSA 3U6RB 2ADJB 2ZX8A 5J6SA 4MCNA 1SZNA 5JHLH 5HP5A 4J39A 3RZCC 3GXMA 3WKNA 4FNSA 5JUEH 5D55A 2LU7A 1QKZH 2H3NA 4G9DB 1RFDL 4ZBJA 1A4AA 4TTDC 3ZT6A 1WZMA 2C3VA 4AV4A 2Q6WB 3NDZE 4YXKL 1HHIA 3OAUL 1JGUH 4IS6B 2VLKB 3SE9L 1HXYB 1EWHA 4LQ1A 4DP5X 1BF2A 2XQYK 3U0WH 1QG3A 4OJEH 4Y5VA 3APNA 3ULUC 4Y9CA 2X4SA 1T7YA 3LYRA 1XEUA 2BP8B 1BMWA 3CDCA 1SLWA 3FQRB 2UWEE 3TVMA 5T3ZD 1UM4L 5ITBH 3ATBA 3APCA 2DMCA 4PJ8D 1J1XL 1ORQA 3CVHL 4Q7DA 4HIEB 4N26A 1WBYB 1CGWA 4WFGE 4HAFA 5T5FA 1CXHA 5F8QC 5L2KA 5IZ7A 1FNHA 4MA3A 3HJEA 1RXLA 4RMQA 1DN0B 4MD5B 3P4NA 2Z64C 4OTXL 2NCMA 2YUXA 2NTSP 1GGCL 2WSKA 4K23H 4MX7A 4PJEA 2BIOA 5DJZA 5KBDA 2OMUA 2A6JB 2CDFB 3QQ3B 3B2PA 4A7QA 3W5NA 2L7EA 4ZMTA 3O6LL 1E6JL 3K6NA 4U1GC 2CBPA 5BZDA 4MQTB 1HZHL 1OOWA 2XN0A 4ONFH 5IJKC 1M05B 4Z3GA 3U7YH 1MFMA 3HC4H 3LH8A 4KVCH 5HI4C 1A6TA 5TF0A 3P0VL 3DO4A 3S3JA 2EDKA 3H1ZA 3WNOA 4LRNH 4OLWL 5B1BB 1U91A 5KYXB 1WTGT 3QNXB 1J1OL 2H7WA 4R7LA 2P45B 4RCAA 1W72H 2IAMD 5C0EA 1OSPH 1PZCA 4X0NA 3V9EA 4LHUG 4CVUA 5H37H 2QSVA 3LNHA 2X7LA 5CGYC 3TBVA 3QIWA 4IRJB 2IH8A 2OV0A 4JFED 1G6RB 4JRLA 1L9RA 4NUMA 4XODA 4NFDA 4AL8L 5EU3B 4OF7A 2HFTA 3CMGA 3P9LA 3ARFB 1SBSL 3F62A 2DQCH 4ZQKB 1S7XB 5LBSL 2ZCKL 1HYSC 3MRJB 4Z76B 3RGVA 3RWJA 3NSJA 4PUBL 5C2BH 4N1HB 2D03L 2VCOA 3C6LC 4C56E 5F3BB 3BKCL 3AT9A 3B5HA 4XWOD 2DQMA 1N67A 4YHNA 2GHWB 1JZ5A 4LL4A 2VQ1A 1GGIL 1Q9LA 2WC7A 2G3NA 2UZYA 3CSYA 4LEEA 4OZIA 2JIXD 4DK5A 4AXWB 3EXLA 3ARDB 5C0ND 3KYNA 1YC7A 5CUSH 2AJXH 1E67A 4MB4A 4NAJA 3U1PA 4UOZA 5BJTA 5FGBC 1FG2B 1ETJA 4DVBB 1HOCB 2V9QA 5EU6A 1BAGA 4X6DF 3S6CA 3C60C 5A2KH 3QNZB 1GSKA 3QI9C 1S9YA 4MCZB 2N3JA 1J5HA 3MA7B 1GY1A 4NQXB 5EHFA 4HKXA 3RL2B 2Q8BL 1MH5A 1IAIM 2PNDA 5ETUB 3HAEB 1GGBL 4YHLL 3LZNA 1MG3C 2LT9A 1F1AA 3HBGA 1DJXA 1E5AA 3KXFA 4RLDA 2IANE 5KBLA 3QUXD 3D2UA 3ZL1A 5CMAA 2HJFA 4PGZA 1TQBB 2OYPA 1E4HA 1U3YA 3K2MC 5CLTA 2YEVB 3KR3L 1YY9C 4FI6A 1D3CA 1JTTA 2BSRA 3T77B 1ORQB 1VENA 5CJQH 4FA8A 5EEWA 1HKFA 3BFOA 3QUMA 1NAMA 1K8IA 2XZCH 4UM9B 3WDJA 1EBAA 2YJLA 3FFCE 4YJZL 2BMKA 3HRZB 4PRIB 3HRZC 1FN4A 2XN2A 3VYPA 3O6FA 4WEEA 1YY9D 2HSIA 3EH4B 2EIJB 4HFUH 2Y6TE 3ILDA 3DYOA 4TSBH 1RU9H 2HN7A 3QJVB 4PV9B 3TPUB 1F2QA 1BZEA 1BF5A 3BPOB 2JJTA 3LX9A 4J3OH 4LASH 1NGXA 1RPUA 3B3BA 1CF8H 1CGUA 4XHJC 2JXMB 1U6AL 3EYQD 3SCMC 1QZ1A 1IIIA 2JNKA 3V7AG 5CILH 2P9RA 4IJ3C 1KBGH 1YAZA 4MMXC 1TDQA 2YSTA 5KYXA 1IM3A 1WUZA 2D73A 2X4PA 2C9VA 3AFLA 1LK3H 4JLRA 3I6GA 4KZEL 3HE6A 5KSAA 5DRXA 1FLRL 3UADA 3HI1A 3JZYA 1WZ1L 1CBVL 1G7MB 3ZR5A 4HS6A 1Y1UA 4XB7A 1YPZF 3WENA 8FABA 1KIUA 3LY6A 1V10A 3UJIL 1RZ8B 2KHAA 4FXLA 3F5WA 1Z9PA 1WE5A 4LSSH 4UM8B 3K0YA 2RCSL 4PJAF 4HJEA 3P11H 2VSMB 3HA0A 5FO7A 3V0JA 4IRZA 3C2SA 4JVWA 4QRSA 4UAOC 2YK1L 3NG5A 1QFWI 2VYRE 3CFBA 5DHVB 1ZTXL 4NO3A 4S2SB 3KLSA 3E8VA 2V7NB 2EVHA 3GXDA 4W9FC 1JHKH 2LLLA 5I6PA 1WTLA 4M93B 4BD4A 4JGJA 3RTQD 2MCPH 3V4VL 5D71L 2ZKWA 3O2VH 3QUMH 3T3PE 1S7RA 3OR6B 4QTIL 4X4YA 4OV5B 1LEGA 5B38G 1IV8A 2WGNB 4J2QA 1ZAGA 3HZMB 5KG9A 2A73B 5DEFB 4ZQTA 1PW3A 1AS8A 1R24A 1TJHL 1E90A 2EDJA 1LE9B 1NC2A 3A4EA 3MR9B 3UACA 4Q9CA 4LLAA 1PY4A 3N2JA 3SDXE 4D0CB 3S5LG 1CLZH 2TSBA 2XY2A 3O3AB 5EZLA 5I0VA 4AMWA 3T0EE 4HOWA 2GUOA 4H8WH 2X4QB 3ZKNC 4YNYB 1OTSD 4XVTL 4ISVB 2PP8A 3NFSL 3CVDA 2BMKB 4W9KC 3Q44A 4PJAE 4EZMA 3FO1A 5HI5D 2N4IA 3D12B 2WKOF 3CHSA 4NRZA 1E4XH 5F6IC 3SDXB 3W9EA 3FXIC 4B96A 4WHDA 4RGNE 3CLFH 4S1QL 1FL5B 3JWDC 4KFMA 3RPKA 1SUHA 2NY7L 3D51A 1G4RA 1MJ7H 1D7CA 1FFOA 1I1CA 4NC1E 4OFYD 4OFQA 5AB2A 3WJMB 2MNUA 4PJGE 2CG9X 3IDJA 2QADC 3DUUB 3BCFA 3PWJA 5CD5C 3GIZH 3G08B 3SJVB 3GK8L 4MYWB 4X6FA 1L6ZA 3GZPA 4PY8I 1LE5A 3GSOA 2HRHA 4Y4KD 3QFJE 1S9XA 5T1KA 3VXNA 3MLYL 3MUY1 1JHTA 2WXRA 3HB3D 1C8QA 3HUJE 4PJHF 4UTBH 5I19L 1RZKH 3RUGA 5I0DA 3DC0A 4NJAL 3VRLE 5I1GH 4FE9A 1MCKA 1SDAB 1Z3GL 2J20A 5HYFA 3QRBA 4GPVA 4JHUA 1DUYB 4HWEH 3F83A 4XNXH 1KBKA 1TTAA 2H1LM 4J3OD 2XJKA 4NN7C 3GXUB 1GZHC 4WFED 2BWIA 3A47A 4O2FA 3TBTB 1IBGL 3H9ZA 3R8BB 3WN5C 3IMWA 3JT2A 3OKMB 2A77H 4OCYL 1K5WA 1M1SA 5D5ME 4GSRA 4L1BA 1QUNB 4YHOH 5LVEA 3ZHNA 3ARXA 2DQDH 4NKIL 1N0XL 2C9UA 3OC8A 4DPCX 1H5BA 2HRPL 4XNQB 4ZSOB 1Z3GH 4YDIH 1BFOA 5E5MB 3F85A 5DZNA 5JQ6H 3F64A 5ABZA 3MNDA 3UABA 2HG0A 3NYKA 1RP8A 5J6HB 2DOCA 2IQAA 3G6AA 5DMGD 4IKIA 5ID0A 5GQBA 4XNXL 2XWRA 2GW5A 3EO9H 5FYKE 3X3FL 3NSXA 1KFAL 2NY2D 4HF5H 3ISWA 4ZTPL 5KTEH 4WNSA 2WTRB 2AEOA 2N1KA 2C8NA 4MA3B 5EO9A 3ULUL 1QLRB 4N8VB 1IC1A 3B7SA 5CIPH 3MJ9L 1E27B 3IVKB 4JHWL 1MCBA 3L3IB 4XPAL 2VDRL 3WTXA 3PL6D 3CX5J 4MX7B 3V6OE 8CGTA 2N0MA 1AGEA 3QUXA 4U6HA 4N2DA 3SYCA 1MUJB 1WSST 3BZ4B 3NZUA 5GGUA 2G0KA 3WIHH 3WNIA 3AVEA 3IJ7A 4PYHA 2EUWA 1JRHL 1OALA 4HZLB 5FFGA 1BYOA 3FL7A 3SDXF 3VFUB 4BE5A 5C0CD 5LCVH 5IFAL 5E6YA 5IB3A 2KUTA 5IOPB 2XKNA 4HMDA 1WP6A 3GRWL 3VE0B 3TWCH 1E43A 2K6WA 2CXKA 3EAKA 3LD8C 3QQ9C 1ZT7A 3UO1H 1LO2L 4H26B 1G7PA 4AH2B 4ODVH 3G5ZB 3VFRA 4PRAA 3RYMA 4B3EA 2L7QA 3ULUH 1BZ7A 2ED8A 3HEIB 4LKXA 3U1SH 4OLXH 3QFJA 3KLLA 4IDLA 3L9BA 2E46A 5EV7A 5KANG 3LQMA 3DJZA 4XMTA 4WK2B 1T1ZB 1BM3H 1JTOA 2ZJSL 1F90L 3F12B 5TK4A 1GC1C 2SEBA 4U2ZA 1IC5H 4KO6A 3EBAA 1GGUA 1MLBB 1F6LL 4XC1H 5EC2B 3WN5B 4I18C 3C5ZD 4I18B 3UMNA 5TDOA 3PGFL 3QUZA 4ODTL 4NQDB 3BPNC 4RMRA 2X3CA 3BAXA 2WQWA 2ZF9A 2ICWJ 4BINA 1XT5A 2E47A 4ELMF 4FL4B 5ESQB 35C8H 4Z78A 1NGZA 4UOJA 1XGPB 4CN6A 2FBJL 4JFFD 2F7PA 3O3UN 2XX1A 5DGQA 4HHAA 4RBPK 3N9GH 4E68A 1TCRA 1XCWA 5BRZA 3CFEB 4DO4A 3BZDA 4KNUA 4U1SB 3L1GA 4KITB 3COOA 3LEXB 1BV8A 2ZXEB 4G8FA 3H3PL 4FP8L 4HMCA 4V11A 3CFJB 4J3OF 3IGFA 1UURA 4GW1B 5DMJB 3SDYH 1RZJL 3DIFB 5FUOH 4KY2A 1TVBB 4ZXBA 3FO1B 1GJWA 1URLA 4TUJB 4DOHB 3I9PA 3QZWG 3FCTB 5HVHC 5ELIA 4JGUA 3O3EB 3CJJA 4PG9A 2WOYA 3QDGB 2VLME 5DJCB 5CCKH 2X70B 2Y06L 3H54A 4F9PC 2YXFA 3OC5A 4L37A 1CLVA 1PZ3A 4MS6A 4QOKE 2DWYA 1M53A 2ZOLB 4PD4K 4QHLB 4JRXA 2F7IA 4RIRB 2MWCA 2WXOA 3I6LD 3N9GL 2NUTA 2EH7H 2WXMA 3FTUA 1EHKB 4X6BB 4L8BA 2H6PA 4XOAA 1MEXL 4IIQA 4QXTA 1BSIA 4NQSB 3SGJC 4F7PA 2EDFA 3OLGA 5DHMC 2ZWSA 4FX5A 5IVXB 5DEZA 2P7TA 2AEQH 4JN2A 1DVZA 4AVKA 1EQWA 5HJDA 4KQ3H 3D9AH 5F7WC 4G7VL 2ODHA 4W93A 3V9FA 4LCYA 4X6CB 2V8MA 1QPPA 4WI9A 3KD4A 5HSFA 3FCUB 5CP3A 5DJYB 2ZD0A 3SE8L 1EK3A 1DQMH 4NQEE 3NRPA 4FG4A 5CN2A 2KLTA 4OCMC 1AXTL 1AKJB 4X8JB 5D1QC 1HILA 4HWBL 2Z4TA 3MCKB 3TVMC 4YO0B 1RZPA 4PWGA 2YA1A 4P06A 2X53A 5CSZA 3MV7A 2RMNA 4R5XA 1VACA 1AS7A 4FQXD 1G7QB 3NA9H 4X98B 3ME0B 1QFUL 3FQNB 3MRLA 1ID5I 2E56A 2GIXA 1I1AA 1IC7L 2XX0A 1OT1A 4K7PL 4TS6A 1AIFB 5IM7A 2IPUG 4OD3H 3MLZL 5FECB 4PUBH 4U3CA 2FJFB 3D0LA 1RP9A 4JM4L 1L7IH 1A3RL 1YAIA 3BP5A 3MMEB 3C6LD 4U05A 4P99A 4I3RH 2AJUL 2BS8A 3SGDH 3CBKB 1D5XA 2VN6B 3WMQA 3T4AA 2Y6SC 4HUWB 2HN7B 4Z3HA 3NA9L 3TONA 2FEDC 3ZO0A 4IS6A 1T5WA 1KV7A 2J4WH 4KI5F 5GGUB 3VM5A 5E2UH 3VSVA 1P5VB 4GG8B 1VJSA 4G6FB 3P54A 5D2LF 3FDWA 4ZMWA 5IB4B 2DKSA 1E28A 2FEDD 1AR1C 2DKUA 1AQDB 1KN2L 4U6VL 1G7PB 2HT3C 3SY6A 4YMPA 3EYUL 4NPYA 2CIIB 3BUBA 1N64H 2BCMA 4WDIB 3RVUD 3X12B 2OYKA 1HYRC 3ARBC 3ETBJ 5B38A 3AXLA 1AR1D 2D31B 4ZMAT 3U9PH 3WD5L 4RAVA 4FQLH 2V2TA 1W6LA 2VL4A 1AO7D 3GLZA 2IGLA 4PN6A 1QO3B 2VWEE 4GKZB 2G2PA 2BOCB 2R59A 4XH2B 5E8PA 3FZUC 1ZJAA 2F7QA 1MCPH 2F2HA 3H42L 3KPMB 3PQYD 5KSUA 2Z8WC 3GFUA 5A7BA 3Q8CA 4PB9H 5TQ2L 3CFKA 4NZFA 5CEYA 4U6VH 3X1NA 4RQQA 2WTRA 5LGJB 3SZKC 5TQ0H 2ESVE 2JKTM 5I0XA 1EXGA 1D2OA 2WXFA 5ESVA 1O6TA 1OOAA 2BDNH 3NABL 5DVMA 1EX0A 3NEOA 5TTRA 4HS8H 4KVPA 3B3IB 3ARQA 1XZWA 4ENZA 4X4KA 1F8TL 1NBZA 1GRWA 1VFMA 3IU3B 2Y69B 2P5WB 1VFOA 4ZUWA 2ZIDA 2WTOA 3HG4A 2FWOB 1JWSA 5FYJE 5EWIH 4GQPH 3VI3A 3QJFB 3KGRA 3H42H 2ZKMX 4Z1PA 1FGNL 5J56B 2B2XH 3ARFA 3BVUA 3KPNA 2C3GA 2VDLH 4AEIH 4EI5B 4UQDA 2YSSA 4O2FB 2JJTC 4UV4L 3BKYL 3WNNA 4UQ2B 3LNGA 3EJJX 1DANT 4HJSA 5I6OA 2LU5A 3EJRA 4PJ7F 3THML 1E5BA 2NR6D 3MRHA 1J0ZA 1Y1DA 4MMXA 3TA3A 1AD9A 4F5CA 4AEHH 5LBGA 2VUYA 1OAYL 4HIPA 3ATFA 1FGNH 2WB1A 4N8CL 5J3HC 2ZXGA 2HX7A 9CGTA 1WYJA 4JJHA 3L3KB 3U0PA 2VDLL 9PCYA 3C6EA 1IAMA 1KTKE 4N0UB 4KTEH 3QCVL 1MJUH 3DUUA 3G5WA 3PWJB 4TLTA 3RNKB 2CA4A 3D85B 5IHLB 3FFCB 4JPWH 3DK2A 4PP2A 1MCHA 2YOAA 5LCVA 4X6CF 2EILB 4ODXA 3SDDA 1BVLA 2NZ9D 1XAKA 2EZ0D 5FWQA 4IGBD 1JPSL 5IUCA 4UNUA 1PDKB 4MA8L 1CDYA 3ZYJA 4YHPB 2W60B 3OV6A 3UAJD 2G4GA 1HEJC 1ZY9A 2PYFB 2FX7H 3ECWA 1RUQL 2AQ2A 1SDYA 5EU6E 3RNQA 1KCSH 3P77B 3CNKA 5JW5A 3AG1B 1GGBH 5TH2A 1E4KA 1ZXQA 3DVNA 3KPQA 1UXSB 2WZ6A 3SPCA 3O4LA 1TSHA 1YNLH 2DBLL 1JXJA 3M46A 2EXWD 5FFOA 4DNLA 4QHUB 1WC7A 2NQCA 3DX1A 3HUJB 4ZS6C 2DQGL 5DO8A 5I8CB 4CADA 5FUCC 1EVTC 1Y6MR 1TZIA 4HZLA 2ID5A 2JXMA 2IJ0C 2CJUH 1NGYA 3MNVA 4LO9A 3VFOB 4CSZA 3V0IA 1EDHA 3BEVB 3UZQB 4AJ0A 4HIJA 4PJBE 5HJBA 1OCOB 2RAMA 1KEGL 2Z4QA 3MSPA 4TM9A 4YBQC 5E0QA 2CK0L 1XBDA 5E9DA 4M7KL 3WTTA 2VB5A 2XTLA 3LIZL 3FOMB 4LSQL 2VAAB 4ZW6A 1G7MA 3U0TA 3VTMA 3QUKA 4P23D 4XVJL 2V9TA 4JFFB 3MRKB 4IRJC 4YFEA 4L3CB 3U4AA 1CCZA 1U6AH 1NAKL 3D25A 3MFFB 3HFFA 1R5VA 2DQGH 1VDGA 2IV9A 2YMTA 1QLRA 5EG6C 2XFXA 2CUAA 3TTYA 5ENWA 1ZWIA 5CLXA 1BYNA 3PRZA 3KAAA 4X9FA 3MN8A 4G43B 4ICXA 4KK8C 4XVUD 1SQMA 2A5UA 3FU3A 1BBJB 1XGUA 2KC0A 2AJ3B 1I8LA 5IQLA 2AJZB 5DWPA 2GEQA 1FFPB 1N6QL 2BHZA 2J8UB 4MQ7B 2AI0L 2F18A 3M7OA 2LABA 1H3VA 3FQYA 4Q52A 3GMOA 1T3FA 3B5GA 2YEZB 1UA6H 4G6KH 2BERA 1KBBA 4WI5A 4DP7X 4PGBA 2VWEC 4N2NA 1OGAD 4CBPA 3BKCH 3ES6B 3L7FB 4IOIA 3ZSTA 4U1LA 5MHSE 2XZQL 2J56A 3KXFD 4I2XA 3L4YA 1F4WH 2IWEA 5AZ2H 3WNPA 2OZ4L 1ITCA 3MRGB 4YK4B 5F3BA 4KQ4L 4O02H 4PGCB 4BZ2L 3SPJA 1AY1H 4NIYE 3DI3B 5CAYB 2CBQA 1TQBC 3U4EA 1KOAA 1RUPL 3VDCA 3V5DA 1G0DA 4G82A 3LV3B 4URKA 3EJYD 1JXFA 2GSGA 1BA9A 2APBA 1MXDA 1OP3K 3IS0X 1QSFA 4E9XA 2LHAA 1MIML 4MWFA 1OTUD 3K2UH 4JVPA 4KRPD 4KY1H 5CN3A 3A5VA 1JRHH 3ATEA 3DARA 3K1KC 1HWHB 2P26A 2WV3A 5LBVA 4A7TA 3ZHFA 5F7BA 3FBQA 5D7JB 3NFPA 2CNYA 2OSLA 2O6FA 4J8RB 3WEXB 4HS3B 4RMBA 1NOAA 4L18A 1T2QL 1F6AB 1AG6A 4JDZA 4V1DB 2FGWH 3JWOC 2VXVH 1MH5B 2XN1A 4OY9A 4YDKL 5KVGH 1U8HB 3L13A 4HKJA 5IR1A 2G3XA 4Z7OB 5BRZB 1F90H 2B4CL 4XRCB 2UY6A 3FQWA 5F9OH 1R5IA 1MFBH 4JHZA 2VC2L 1ZA3B 1MVYA 1ZVNA 2F74B 1OW0C 5DHYB 4U3XA 2P5EA 2QSCH 4LCCC 5CBEB 4LCCB 4B9YA 5I28A 2Y1YA 4WHCA 3W2DH 3V52L 3GHBL 2OK0L 1OLLA 3PXJA 3T0WA 1U8IA 4C58B 35C8L 4LP5A 3LS4H 2ZOKB 2CO2A 3G04B 5GGRA 2K45A 5JR1L 4KZEH 3CLWA 1D5XB 1RULH 1T0PB 2Y7LA 2RGSA 3W37A 2GQHA 1NEZA 1B4JL 3D2TA 4GBXB 3KWWB 5EOCJ 2XA3A 4KHXH 4XPBL 3RGVB 2DAVA 3EHBB 5I2IB 4U31A 4UAOB 3ASNB 1QI3A 2AMGA 1BX2A 1JI1A 1UVQA 1FV1B 3OB8A 1IL1B 3KYMA 4G3YH 3BD4A 4N0CD 4NENB 4PG2C</