The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
156
|
structure length |
156
|
Chain Sequence |
GYKVSGYILPDFSFDATVAPLVKAGFKVEIVGTELYAVTDANGYFEITGVPANASGYTLKISRATYLDRVIANVVVTGDTSVSTSQAPIMMWVGDIVKDNSINLLDVAEVIRCFNATKGSANYVEELDINRNGAINMQDIMIVHKHFGATSSDYDA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb |
molecule tags |
Hydrolase/structural protein
|
source organism |
Clostridium thermocellum
|
molecule keywords |
COG1196: Chromosome segregation ATPases
|
total genus |
41
|
structure length |
156
|
sequence length |
156
|
ec nomenclature | |
pdb deposition date | 2005-09-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF00404 | Dockerin_1 | Dockerin type I domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Type 1 dockerin domain | Dockerin domain | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Carboxypeptidase-like, regulatory domain |