2B5NA

Crystal structure of the ddb1 bpb domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
316
structure length
312
Chain Sequence
NGIGIHEHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of DDB1 in complex with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
molecule keywords damage-specific DNA binding protein 1
total genus 52
structure length 312
sequence length 316
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b5nA00
4ERZA 4J8BA 2AGZA 3IKOA 1YFQA 4J81A 3RSEC 4IA9A 4A09B 2OVRB 4L9OA 5CXBB 2HESX 3I7LA 4J82A 5FLXg 4EWRA 4CZXA 2XU7A 5GMKn 2H68A 2HJ4A 3L4OD 3I2NA 5JWZA 1XHMA 3I89A 4ESGA 1NEXB 4XYIA 3RFGA 1OMWB 4FWWA 4FA9D 3N0DA 4ZOYA 4D6VA 5EMJB 3HFQA 2EBSA 4O1QD 4K3JB 2QC5A 4A0BB 5KDOB 3SCYA 3EG6A 4LGNA 2BCJB 2PM7B 3RFHA 5B4WA 2YBAA 2TRCB 4KFMB 4A11A 5AFU3 3DWLC 4N14A 5HYNB 2PM9A 3DXKC 2OK4A 5HE3B 4J84A 3J80g 4GGAA 3CIKB 1TBGA 3JZGA 2BBKH 2H47A 3F3PA 3BG1A 3I7PA 3SLED 1MG3A 2H13A 5A2Qg 2CO0A 1QNIA 5EM2A 2OVQB 2O9KA 2HYEA 2PM6B 2HXCA 3IIYA 1OLZA 4IMMA 4Y5RD 3PE7A 3OTTA 3PXSD 2AGXA 4O3UB 4E5ZA 2OIZA 5EAMA 2I3SA 1U2VC 5IC7A 4J79A 4GQ2P 5EMMB 5EM2B 5HE0B 5FKQA 4GMBA 3I7NA 4E54A 1N6DA 1PGUA 2UZXB 3IJ1A 3C9CA 3ODTA 3SN6B 3AH8B 5GSAA 4CI8A 2UZYB 4JSPC 1N6EA 4GQBB 1SQ9A 2J56H 4O3TB 5EARA 3AFCA 4UI9R 4J73A 4AOWA 2XYIA 3UVNA 2AQ5A 4PC0A 3IJ0A 3JRPA 4J0XA 4GM3A 4I79A 4JSXC 4A09A 5CXCB 4AEZA 5C9ZB 3SXTD 4J0WA 3ORVD 3MKSB 3NVXA 1RI6A 3VGZA 4GGDA 5TEFA 2P9UC 4K3ID 2Z2PA 3CFVA 2CN2A 5SXMA 5AJAA 3PXTD 1TYQC 4X3EA 2XL2A 2OK6A 3DM0A 2HKRA 3RN0D 5EALA 2IUQA 1K32A 2AGWA 4CY1A 4A0AA 2CNXA 3JPXA 4CY3A 4O9DA 3UVMA 4A2MA 2W18A 5TF2A 2YNPA 3PXWD 4QQEA 4TZ4A 3EI1A 5GXIA 1S4UX 3GREA 2CE9A 2CO0C 4JXMA 1NR0A 2Z2NA 5IGOA 3SHFA 4FB1D 3N0EA 5AMSA 3UKRC 1PEVA 3JROA 3ZWLB 5H17A 4GM8A 4J8GA 2PM9B 4X63B 2OVPB 2Z2OA 3V9FA 4J77A 2P9NC 5EMKB 1JOFA 3AL9A 3EI1B 3OL2B 1FWXA 3NVQA 5C2WB 3EI3B 3F3GA 4LG9A 3VH0A 4CZVA 1GP2B 4YVDA 5FXYA 1MDAH 2G9AA 2QXVA 4BL0A 4GQ1A 5H1MA 3I8EA 2GNQA 3OKTA 3IJCA 4QT8A 2HJBA 4E5ZB 2IWFA 3K26A 2AH0A 3F3FA 4CY5A 4CZYA 3GFCA 4ZOVA 3MXXA 4Y7RA 5EMLB 1R5MA 3SJLD 5GXHA 4PNKB 3K27A 4CI1A 1GOTB 5H14A 3EU7A 2I3TA 2YB8B 2H9MA 3SMRA 1MG2A 4FAND 4U1EI 4ES0A 4FA4D 2GC7A 3C99A 3IIWA 2YNNA 5HE1B 4D0KA 1XKSA 1Q47A 5FKTA 1XIPA 2OJYA 4BUJC 5FA5B 4Z8LA 2IUVA 4LG8A 4L1QD 4NSXA 5K1CC 4ERYA 4QL1A 1B9YA 1A0RB 1GXRA 4FHLA 3J81g 5CYKB 2YNOA 5EAPA 2I0SA 1GG2B 3U4YA 5IJ7E 1B9XA 3BG0A 2H6NA 3L4MD 2P9PC 2H6QA 3KRXB 3JZHA 4PBZA 4G56B 4R7AB 1N6FA 3V7DB 1JMZB 3VA6A 2B5MA 3PVWB 3DXMC 5TDHB 3MZKA 3I7KA 3MKQA 3EI4B 4ZN4A 4JT5C 2IWKA 3AL8A 2IUPA 2H9PA 5I5IA 4H5IA 3W15A 3RN1D 2B5NA 4ERQA 3B7FA 5IGQA 4A08B 5I5MA 3UVLA 2AGYA 4CC9A 3E0CA 3RLMD 3SBQA 3RMZD 3JAMg 5HQGA 3A0FA 3PSLA 4PSWB 5FKSA 3EI4A 5IJ8E 1PBYB 4MK0B 4L3GD 4U7AA 5FKRA 3ULEC 1K8KC 3BWSA 1JJUB 1U4CA 4FAVD 2H9NA 2P9KC 5C2VB 3EI2A 2XL3A 2J55H 4JT6C 5I5JA 5FQDA 2H3XA 2P9IC 3EMHA 4CY2A 4E54B 3I7HA 2J57G 3MMYA 4PXWA 3OKYA 4PBYA 3UVOA 3UR4A 4GZ8A 5HE2B 1ERJA 5K19A 2H6KA 5CYKA 3KRWB 4J86A 4X61B 2AGLA 1JMXB 3SBRA 4CI3A 2GC4A 3PSCB 5TEEA 4L3HD 4JSNC 3RRMC 3CFSB 3EWEA 4X60B 4JD2C 4QRJA 3PVUB 4A0BA 4XEIC 3OKYB 3FM0A 2IAAA 3C75H 4BH6A 3DSMA 4ZOXA 5CXCA 2MTAH 3JB9L 4FA5D 1P22A 4OWRA 5IT9g 3P4FA 1L0QA 1SHYB 4A0AB 2PBIB 4GGCA 3FGBA 2I0TA 3UVKA 4J87A 4OZUA 2CE8A 2H14A 2Q7QA 3MZLA 3OW8A 2P9LC 4A2LA 3SVWD 3V5WB 3FRXA 3OKWA 2I0RA 2CN3A 4A7JA 2B5LA 3SWSD 2YMUA 3UKUC 2G99A 3C5MA 3EI3A 4J78A 4A08A 2B4EA 2AH1A 3I8CA 2P9SC 1SQJA 1VYHC 1PI6A 3OL2A 3EI2B 3JZNA 4ZOZA 4GM9A 3AL8B 4H5JA 4HDJA 2HKMA 4O45A 3SBPA 3SFZA 4A11B 2H9LA 4XYHA 4PSXB 4JSVC 5CXBA 3NVNA 4CI2A 5THAA 3I7OA 4FA1D 2IURA
chains in the Genus database with same CATH superfamily
4ERZA 5C92A 4RE6A 4J8BA 3O4JA 2AGZA 3IKOA 3IUNA 1YFQA 4J81A 3RSEC 4IA9A 4A09B 2OVRB 2XZGA 4L9OA 5CXBB 2HESX 3I7LA 4J82A 3ZE2A 4EWRA 5FLXg 2HU5A 4CZXA 2XU7A 5GMKn 2H68A 2HJ4A 3VI3A 1JTDB 5E6UA 3L4OD 3I2NA 4BP9A 5JWZA 1VE6A 1XHMA 3I89A 4ESGA 1NEXB 4XYIA 3RFGA 1OMWB 4FWWA 1VE7A 4FA9D 3N0DA 4ZOYA 4D6VA 2XE4A 5EMJB 3HFQA 2EBSA 4O1QD 4K3JB 2QC5A 4A0BB 2VZ1A 5KDOB 3SCYA 3EG6A 4LGNA 1T2XA 1E8NA 2BCJB 3FCUA 2PM7B 3RFHA 5B4WA 2YBAA 2TRCB 4KFMB 3T3MA 2VZ3A 3DDUA 3DWLC 4N14A 4A11A 4BCDA 2PM9A 3DXKC 5AFU3 5HYNB 2OK4A 5HE3B 4J84A 3J80g 4GGAA 3CIKB 4G55A 1VZ3A 2HU8A 1TBGA 3JZGA 2BBKH 2H47A 3F3PA 3BG1A 1GOGA 3I7PA 3SLED 1MG3A 2H13A 4WK0A 5A2Qg 2CO0A 5C86A 1QNIA 4NAAA 5EM2A 3QI0A 2OVQB 2O9KA 3MUNA 3K72A 2HYEA 2PM6B 2HXCA 2HU7A 3IIYA 1OLZA 4IMMA 4Y5RD 4BCCA 3PE7A 3OTTA 3PXSD 2AGXA 1A12A 4O3UB 4E5ZA 2OIZA 5EAMA 1UOPA 2I3SA 1U2VC 4MMYA 1UOQA 5IC7A 4J79A 4GQ2P 4AN0A 1TYEA 5EMMB 5EM2B 4L1MA 5FKQA 3FCSA 5HE0B 4GMBA 3I7NA 4E54A 1N6DA 1PGUA 2UZXB 3IJ1A 3C9CA 3ODTA 3SN6B 2VDRA 3AH8B 4JHNA 5GSAA 4CI8A 2UZYB 4JSPC 4O02A 1N6EA 4GQBB 1SQ9A 2J56H 4O3TB 5EARA 3AFCA 4UI9R 4J73A 3OF7A 4AOWA 2XYIA 3UVNA 2AQ5A 4PC0A 3IJ0A 3JRPA 3IJEA 3ZE1A 4J0XA 3MVDK 4GM3A 2EICA 4I79A 4JSXC 4A09A 5CXCB 4AEZA 5C9ZB 3SXTD 4J0WA 3ORVD 3MKSB 1YR2A 3NVXA 1RI6A 2VDMA 3T3PA 4BCBA 3VGZA 4GGDA 5TEFA 2P9UC 4K3ID 2Z2PA 3CFVA 2CN2A 5SXMA 5AJAA 3PXTD 1TYQC 4X3EA 1M1XA 2XL2A 2OK6A 3DM0A 2HKRA 3RN0D 5EALA 2IUQA 3EQ7A 1K32A 4NENA 2AGWA 1H2ZA 4CY1A 4A0AA 2CNXA 2WQ8A 2XDWA 2VDPA 3JPXA 4CY3A 4O9DA 3UVMA 4A2MA 2W18A 5TF2A 2YNPA 3PXWD 4QQEA 4TZ4A 4NBMA 3EI1A 5GXIA 1C9IA 1S4UX 3GREA 2CE9A 1BPOA 5M5VA 2CO0C 4JXMA 1NR0A 2Z2NA 5IGOA 3SHFA 4FB1D 3N0EA 5AMSA 3UKRC 1PEVA 1C9LA 3JROA 3ZWLB 2EIDA 5H17A 2VDKA 4GM8A 4J8GA 2PM9B 4X63B 2OVPB 2Z2OA 3V9FA 4J77A 2P9NC 5EMKB 1JOFA 3AL9A 3EI1B 3OL2B 1FWXA 2VDQA 3NVQA 5C2WB 3EI3B 3F3GA 4LG9A 3IUQA 3VH0A 4CZVA 1GP2B 1O6FA 1VZ2A 4YVDA 2EIEA 5FXYA 1MDAH 2VC2A 2G9AA 2QXVA 5M61A 4BL0A 4GQ1A 5H1MA 2QZPA 3I8EA 3OKTA 2GNQA 1E8MA 3IUJA 3IJCA 4QT8A 2HJBA 4E5ZB 2IWFA 1GOHA 3K26A 3IVMA 2AH0A 3F3FA 4CY5A 4CZYA 3GFCA 4ZOVA 3MXXA 4Y7RA 5EMLB 1R5MA 3SJLD 5GXHA 4PNKB 3K27A 4CI1A 1GOTB 5H14A 3EU7A 2I3TA 4BP8A 2YB8B 2H9MA 3SMRA 1MG2A 4UM9A 4D9SA 3IURA 4FAND 4U1EI 4MMZA 4ES0A 4FA4D 3NIDA 4AMZA 2GC7A 3C99A 1UTCA 1E5TA 3IIWA 2YNNA 5HE1B 4D0KA 1XKSA 1Q47A 5FKTA 1XIPA 2OJYA 4BUJC 5FA5B 4Z8LA 5M5SA 2IUVA 2QR5A 4LG8A 4L1QD 4NSXA 5K1CC 4ERYA 3NIGA 4QL1A 1UOOA 1B9YA 1A0RB 1GXRA 4FHLA 3J81g 5CYKB 4DNWA 2YNOA 5EAPA 4IRZA 3V4VA 3O4IA 2I0SA 1GG2B 3U4YA 3EQ9A 5IJ7E 1GOFA 1B9XA 3BG0A 3IUMA 3O4HA 2H6NA 4WJKA 5M5RA 3L4MD 2P9PC 2H6QA 3KRXB 3JZHA 4PBZA 4G56B 4R7AB 1N6FA 3V7DB 1JMZB 3VA6A 2B5MA 3PVWB 3DXMC 3V4PA 4WK4A 5TDHB 3MZKA 3I7KA 3MKQA 3K6SA 3ZDYA 3EI4B 3ZDXA 4ZN4A 4JT5C 2IWKA 3AL8A 2IUPA 2H9PA 5I5IA 4WK2A 4H5IA 3W15A 3EQ8A 5FFGA 3RN1D 2B5NA 4ERQA 3B7FA 5IGQA 4UM8A 4A08B 3ZDZA 5I5MA 3UVLA 2AGYA 4CC9A 3E0CA 3RLMD 4DNVA 3QHYB 4G1MA 3SBQA 3RMZD 4Z7OA 5M5UA 3JAMg 1H2XA 5HQGA 3PSLA 3A0FA 4JHPC 4Z7QA 4PSWB 5FKSA 3EI4A 5IJ8E 1PBYB 4MK0B 4L3GD 4U7AA 3KCIA 5FKRA 3ULEC 1K8KC 3BWSA 1JJUB 1U4CA 3GD1I 1O6GA 4FAVD 2H9NA 2P9KC 5C2VB 3EI2A 2XL3A 2J55H 2EIBA 4JT6C 5I5JA 5FQDA 2H3XA 2P9IC 3EMHA 4CY2A 4E54B 3I7HA 2J57G 1H2YA 3GC3B 3MMYA 4PXWA 3OKYA 4PBYA 3UVOA 5FFOA 4GZ8A 5HE2B 3UR4A 1ERJA 5K19A 2H6KA 2VDLA 5CYKA 3KRWB 4J86A 4X61B 1JMXB 2AGLA 3SBRA 4CI3A 2GC4A 3PSCB 5TEEA 4NC4A 4L3HD 4JSNC 3RRMC 3CFSB 3EWEA 4X60B 1QFMA 4JD2C 4QRJA 2JKXA 3K71A 3PVUB 4A0BA 4XEIC 3OKYB 3FM0A 2IAAA 3C75H 4BH6A 3DSMA 4ZOXA 5CXCA 2MTAH 3JB9L 4FA5D 1P22A 4OWRA 4AMYA 5HDBA 3P4FA 5IT9g 1L0QA 4AX4A 1SHYB 4A0AB 2PBIB 4GGCA 3FGBA 4RE5A 2I0TA 3IULA 3UVKA 3VI4A 4AN1A 4J87A 4O2WA 1JV2A 2CE8A 2H14A 2Q7QA 3MZLA 4OZUA 3OW8A 2P9LC 4A2LA 3SVWD 3NIFA 3V5WB 1L5GA 3FRXA 3OKWA 4MMXA 4QAMA 2I0RA 2CN3A 4A7JA 2B5LA 3SWSD 2BKLA 2YMUA 3UKUC 2G99A 3C5MA 3EI3A 4J78A 1I2MB 5E6RA 3O4GA 2VDNA 4A08A 2B4EA 3I8CA 2AH1A 2P9SC 4DNUA 2VDOA 3MUOA 1SQJA 1VYHC 1PI6A 5E6SA 3OL2A 3EI2B 4Z7NA 3JZNA 4ZOZA 4GM9A 3AL8B 4H5JA 4HDJA 2HKMA 4O45A 1U8CA 3SBPA 3ZE0A 4G1EA 3SFZA 4A11B 2H9LA 4XYHA 4PSXB 1QFSA 4JSVC 5CXBA 3NVNA 5M5TA 4CI2A 1H2WA 5THAA 3I7OA 4FA1D 1K3IA 2IURA
chains in the Genus database with same CATH topology
4ERZA 4J8BA 2AGZA 3IKOA 1YFQA 4J81A 3RSEC 4IA9A 4A09B 2OVRB 4L9OA 5CXBB 2HESX 3I7LA 4J82A 5FLXg 4EWRA 4CZXA 2XU7A 5GMKn 2H68A 2HJ4A 3L4OD 3I2NA 5JWZA 1XHMA 3I89A 4ESGA 1NEXB 4XYIA 3RFGA 1OMWB 4FWWA 4FA9D 3N0DA 4ZOYA 4D6VA 5EMJB 3HFQA 2EBSA 4O1QD 4K3JB 2QC5A 4A0BB 5KDOB 3SCYA 3EG6A 4LGNA 2BCJB 2PM7B 3RFHA 5B4WA 2YBAA 2TRCB 4KFMB 4A11A 5AFU3 3DWLC 4N14A 5HYNB 2PM9A 3DXKC 2OK4A 5HE3B 4J84A 3J80g 4GGAA 3CIKB 1TBGA 3JZGA 2BBKH 2H47A 3F3PA 3BG1A 3I7PA 3SLED 1MG3A 2H13A 5A2Qg 2CO0A 1QNIA 5EM2A 2OVQB 2O9KA 2HYEA 2PM6B 2HXCA 3IIYA 1OLZA 4IMMA 4Y5RD 3PE7A 3OTTA 3PXSD 2AGXA 4O3UB 4E5ZA 2OIZA 5EAMA 2I3SA 1U2VC 5IC7A 4J79A 4GQ2P 5EMMB 5EM2B 5HE0B 5FKQA 4GMBA 3I7NA 4E54A 1N6DA 1PGUA 2UZXB 3IJ1A 3C9CA 3ODTA 3SN6B 3AH8B 5GSAA 4CI8A 2UZYB 4JSPC 1N6EA 4GQBB 1SQ9A 2J56H 4O3TB 5EARA 3AFCA 4UI9R 4J73A 4AOWA 2XYIA 3UVNA 2AQ5A 4PC0A 3IJ0A 3JRPA 4J0XA 4GM3A 4I79A 4JSXC 4A09A 5CXCB 4AEZA 5C9ZB 3SXTD 4J0WA 3ORVD 3MKSB 3NVXA 1RI6A 3VGZA 4GGDA 5TEFA 2P9UC 4K3ID 2Z2PA 3CFVA 2CN2A 5SXMA 5AJAA 3PXTD 1TYQC 4X3EA 2XL2A 2OK6A 3DM0A 2HKRA 3RN0D 5EALA 2IUQA 1K32A 2AGWA 4CY1A 4A0AA 2CNXA 3JPXA 4CY3A 4O9DA 3UVMA 4A2MA 2W18A 5TF2A 2YNPA 3PXWD 4QQEA 4TZ4A 3EI1A 5GXIA 1S4UX 3GREA 2CE9A 2CO0C 4JXMA 1NR0A 2Z2NA 5IGOA 3SHFA 4FB1D 3N0EA 5AMSA 3UKRC 1PEVA 3JROA 3ZWLB 5H17A 4GM8A 4J8GA 2PM9B 4X63B 2OVPB 2Z2OA 3V9FA 4J77A 2P9NC 5EMKB 1JOFA 3AL9A 3EI1B 3OL2B 1FWXA 3NVQA 5C2WB 3EI3B 3F3GA 4LG9A 3VH0A 4CZVA 1GP2B 4YVDA 5FXYA 1MDAH 2G9AA 2QXVA 4BL0A 4GQ1A 5H1MA 3I8EA 2GNQA 3OKTA 3IJCA 4QT8A 2HJBA 4E5ZB 2IWFA 3K26A 2AH0A 3F3FA 4CY5A 4CZYA 3GFCA 4ZOVA 3MXXA 4Y7RA 5EMLB 1R5MA 3SJLD 5GXHA 4PNKB 3K27A 4CI1A 1GOTB 5H14A 3EU7A 2I3TA 2YB8B 2H9MA 3SMRA 1MG2A 4FAND 4U1EI 4ES0A 4FA4D 2GC7A 3C99A 3IIWA 2YNNA 5HE1B 4D0KA 1XKSA 1Q47A 5FKTA 1XIPA 2OJYA 4BUJC 5FA5B 4Z8LA 2IUVA 4LG8A 4L1QD 4NSXA 5K1CC 4ERYA 4QL1A 1B9YA 1A0RB 1GXRA 4FHLA 3J81g 5CYKB 2YNOA 5EAPA 2I0SA 1GG2B 3U4YA 5IJ7E 1B9XA 3BG0A 2H6NA 3L4MD 2P9PC 2H6QA 3KRXB 3JZHA 4PBZA 4G56B 4R7AB 1N6FA 3V7DB 1JMZB 3VA6A 2B5MA 3PVWB 3DXMC 5TDHB 3MZKA 3I7KA 3MKQA 3EI4B 4ZN4A 4JT5C 2IWKA 3AL8A 2IUPA 2H9PA 5I5IA 4H5IA 3W15A 3RN1D 2B5NA 4ERQA 3B7FA 5IGQA 4A08B 5I5MA 3UVLA 2AGYA 4CC9A 3E0CA 3RLMD 3SBQA 3RMZD 3JAMg 5HQGA 3A0FA 3PSLA 4PSWB 5FKSA 3EI4A 5IJ8E 1PBYB 4MK0B 4L3GD 4U7AA 5FKRA 3ULEC 1K8KC 3BWSA 1JJUB 1U4CA 4FAVD 2H9NA 2P9KC 5C2VB 3EI2A 2XL3A 2J55H 4JT6C 5I5JA 5FQDA 2H3XA 2P9IC 3EMHA 4CY2A 4E54B 3I7HA 2J57G 3MMYA 4PXWA 3OKYA 4PBYA 3UVOA 3UR4A 4GZ8A 5HE2B 1ERJA 5K19A 2H6KA 5CYKA 3KRWB 4J86A 4X61B 2AGLA 1JMXB 3SBRA 4CI3A 2GC4A 3PSCB 5TEEA 4L3HD 4JSNC 3RRMC 3CFSB 3EWEA 4X60B 4JD2C 4QRJA 3PVUB 4A0BA 4XEIC 3OKYB 3FM0A 2IAAA 3C75H 4BH6A 3DSMA 4ZOXA 5CXCA 2MTAH 3JB9L 4FA5D 1P22A 4OWRA 5IT9g 3P4FA 1L0QA 1SHYB 4A0AB 2PBIB 4GGCA 3FGBA 2I0TA 3UVKA 4J87A 4OZUA 2CE8A 2H14A 2Q7QA 3MZLA 3OW8A 2P9LC 4A2LA 3SVWD 3V5WB 3FRXA 3OKWA 2I0RA 2CN3A 4A7JA 2B5LA 3SWSD 2YMUA 3UKUC 2G99A 3C5MA 3EI3A 4J78A 4A08A 2B4EA 2AH1A 3I8CA 2P9SC 1SQJA 1VYHC 1PI6A 3OL2A 3EI2B 3JZNA 4ZOZA 4GM9A 3AL8B 4H5JA 4HDJA 2HKMA 4O45A 3SBPA 3SFZA 4A11B 2H9LA 4XYHA 4PSXB 4JSVC 5CXBA 3NVNA 4CI2A 5THAA 3I7OA 4FA1D 2IURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERZ A;  4J8B A;  2AGZ A;  3IKO A;  1YFQ A;  4J81 A;  3RSE C;  4IA9 A;  4A09 B;  2OVR B;  4L9O A;  5CXB B;  2HES X;  3I7L A;  4J82 A;  5FLX g;  4EWR A;  4CZX A;  2XU7 A;  5GMK n;  2H68 A;  2HJ4 A;  3L4O D;  3I2N A;  5JWZ A;  1XHM A;  3I89 A;  4ESG A;  1NEX B;  4XYI A;  3RFG A;  1OMW B;  4FWW A;  4FA9 D;  3N0D A;  4ZOY A;  4D6V A;  5EMJ B;  3HFQ A;  2EBS A;  4O1Q D;  4K3J B;  2QC5 A;  4A0B B;  5KDO B;  3SCY A;  3EG6 A;  4LGN A;  2BCJ B;  2PM7 B;  3RFH A;  5B4W A;  2YBA A;  2TRC B;  4KFM B;  4A11 A;  5AFU 3;  3DWL C;  4N14 A;  5HYN B;  2PM9 A;  3DXK C;  2OK4 A;  5HE3 B;  4J84 A;  3J80 g;  4GGA A;  3CIK B;  1TBG A;  3JZG A;  2BBK H;  2H47 A;  3F3P A;  3BG1 A;  3I7P A;  3SLE D;  1MG3 A;  2H13 A;  5A2Q g;  2CO0 A;  1QNI A;  5EM2 A;  2OVQ B;  2O9K A;  2HYE A;  2PM6 B;  2HXC A;  3IIY A;  1OLZ A;  4IMM A;  4Y5R D;  3PE7 A;  3OTT A;  3PXS D;  2AGX A;  4O3U B;  4E5Z A;  2OIZ A;  5EAM A;  2I3S A;  1U2V C;  5IC7 A;  4J79 A;  4GQ2 P;  5EMM B;  5EM2 B;  5HE0 B;  5FKQ A;  4GMB A;  3I7N A;  4E54 A;  1N6D A;  1PGU A;  2UZX B;  3IJ1 A;  3C9C A;  3ODT A;  3SN6 B;  3AH8 B;  5GSA A;  4CI8 A;  2UZY B;  4JSP C;  1N6E A;  4GQB B;  1SQ9 A;  2J56 H;  4O3T B;  5EAR A;  3AFC A;  4UI9 R;  4J73 A;  4AOW A;  2XYI A;  3UVN A;  2AQ5 A;  4PC0 A;  3IJ0 A;  3JRP A;  4J0X A;  4GM3 A;  4I79 A;  4JSX C;  4A09 A;  5CXC B;  4AEZ A;  5C9Z B;  3SXT D;  4J0W A;  3ORV D;  3MKS B;  3NVX A;  1RI6 A;  3VGZ A;  4GGD A;  5TEF A;  2P9U C;  4K3I D;  2Z2P A;  3CFV A;  2CN2 A;  5SXM A;  5AJA A;  3PXT D;  1TYQ C;  4X3E A;  2XL2 A;  2OK6 A;  3DM0 A;  2HKR A;  3RN0 D;  5EAL A;  2IUQ A;  1K32 A;  2AGW A;  4CY1 A;  4A0A A;  2CNX A;  3JPX A;  4CY3 A;  4O9D A;  3UVM A;  4A2M A;  2W18 A;  5TF2 A;  2YNP A;  3PXW D;  4QQE A;  4TZ4 A;  3EI1 A;  5GXI A;  1S4U X;  3GRE A;  2CE9 A;  2CO0 C;  4JXM A;  1NR0 A;  2Z2N A;  5IGO A;  3SHF A;  4FB1 D;  3N0E A;  5AMS A;  3UKR C;  1PEV A;  3JRO A;  3ZWL B;  5H17 A;  4GM8 A;  4J8G A;  2PM9 B;  4X63 B;  2OVP B;  2Z2O A;  3V9F A;  4J77 A;  2P9N C;  5EMK B;  1JOF A;  3AL9 A;  3EI1 B;  3OL2 B;  1FWX A;  3NVQ A;  5C2W B;  3EI3 B;  3F3G A;  4LG9 A;  3VH0 A;  4CZV A;  1GP2 B;  4YVD A;  5FXY A;  1MDA H;  2G9A A;  2QXV A;  4BL0 A;  4GQ1 A;  5H1M A;  3I8E A;  2GNQ A;  3OKT A;  3IJC A;  4QT8 A;  2HJB A;  4E5Z B;  2IWF A;  3K26 A;  2AH0 A;  3F3F A;  4CY5 A;  4CZY A;  3GFC A;  4ZOV A;  3MXX A;  4Y7R A;  5EML B;  1R5M A;  3SJL D;  5GXH A;  4PNK B;  3K27 A;  4CI1 A;  1GOT B;  5H14 A;  3EU7 A;  2I3T A;  2YB8 B;  2H9M A;  3SMR A;  1MG2 A;  4FAN D;  4U1E I;  4ES0 A;  4FA4 D;  2GC7 A;  3C99 A;  3IIW A;  2YNN A;  5HE1 B;  4D0K A;  1XKS A;  1Q47 A;  5FKT A;  1XIP A;  2OJY A;  4BUJ C;  5FA5 B;  4Z8L A;  2IUV A;  4LG8 A;  4L1Q D;  4NSX A;  5K1C C;  4ERY A;  4QL1 A;  1B9Y A;  1A0R B;  1GXR A;  4FHL A;  3J81 g;  5CYK B;  2YNO A;  5EAP A;  2I0S A;  1GG2 B;  3U4Y A;  5IJ7 E;  1B9X A;  3BG0 A;  2H6N A;  3L4M D;  2P9P C;  2H6Q A;  3KRX B;  3JZH A;  4PBZ A;  4G56 B;  4R7A B;  1N6F A;  3V7D B;  1JMZ B;  3VA6 A;  2B5M A;  3PVW B;  3DXM C;  5TDH B;  3MZK A;  3I7K A;  3MKQ A;  3EI4 B;  4ZN4 A;  4JT5 C;  2IWK A;  3AL8 A;  2IUP A;  2H9P A;  5I5I A;  4H5I A;  3W15 A;  3RN1 D;  2B5N A;  4ERQ A;  3B7F A;  5IGQ A;  4A08 B;  5I5M A;  3UVL A;  2AGY A;  4CC9 A;  3E0C A;  3RLM D;  3SBQ A;  3RMZ D;  3JAM g;  5HQG A;  3A0F A;  3PSL A;  4PSW B;  5FKS A;  3EI4 A;  5IJ8 E;  1PBY B;  4MK0 B;  4L3G D;  4U7A A;  5FKR A;  3ULE C;  1K8K C;  3BWS A;  1JJU B;  1U4C A;  4FAV D;  2H9N A;  2P9K C;  5C2V B;  3EI2 A;  2XL3 A;  2J55 H;  4JT6 C;  5I5J A;  5FQD A;  2H3X A;  2P9I C;  3EMH A;  4CY2 A;  4E54 B;  3I7H A;  2J57 G;  3MMY A;  4PXW A;  3OKY A;  4PBY A;  3UVO A;  3UR4 A;  4GZ8 A;  5HE2 B;  1ERJ A;  5K19 A;  2H6K A;  5CYK A;  3KRW B;  4J86 A;  4X61 B;  2AGL A;  1JMX B;  3SBR A;  4CI3 A;  2GC4 A;  3PSC B;  5TEE A;  4L3H D;  4JSN C;  3RRM C;  3CFS B;  3EWE A;  4X60 B;  4JD2 C;  4QRJ A;  3PVU B;  4A0B A;  4XEI C;  3OKY B;  3FM0 A;  2IAA A;  3C75 H;  4BH6 A;  3DSM A;  4ZOX A;  5CXC A;  2MTA H;  3JB9 L;  4FA5 D;  1P22 A;  4OWR A;  5IT9 g;  3P4F A;  1L0Q A;  1SHY B;  4A0A B;  2PBI B;  4GGC A;  3FGB A;  2I0T A;  3UVK A;  4J87 A;  4OZU A;  2CE8 A;  2H14 A;  2Q7Q A;  3MZL A;  3OW8 A;  2P9L C;  4A2L A;  3SVW D;  3V5W B;  3FRX A;  3OKW A;  2I0R A;  2CN3 A;  4A7J A;  2B5L A;  3SWS D;  2YMU A;  3UKU C;  2G99 A;  3C5M A;  3EI3 A;  4J78 A;  4A08 A;  2B4E A;  2AH1 A;  3I8C A;  2P9S C;  1SQJ A;  1VYH C;  1PI6 A;  3OL2 A;  3EI2 B;  3JZN A;  4ZOZ A;  4GM9 A;  3AL8 B;  4H5J A;  4HDJ A;  2HKM A;  4O45 A;  3SBP A;  3SFZ A;  4A11 B;  2H9L A;  4XYH A;  4PSX B;  4JSV C;  5CXB A;  3NVN A;  4CI2 A;  5THA A;  3I7O A;  4FA1 D;  2IUR A; 
#chains in the Genus database with same CATH topology
 4ERZ A;  5C92 A;  4RE6 A;  4J8B A;  3O4J A;  2AGZ A;  3IKO A;  3IUN A;  1YFQ A;  4J81 A;  3RSE C;  4IA9 A;  4A09 B;  2OVR B;  2XZG A;  4L9O A;  5CXB B;  2HES X;  3I7L A;  4J82 A;  3ZE2 A;  4EWR A;  5FLX g;  2HU5 A;  4CZX A;  2XU7 A;  5GMK n;  2H68 A;  2HJ4 A;  3VI3 A;  1JTD B;  5E6U A;  3L4O D;  3I2N A;  4BP9 A;  5JWZ A;  1VE6 A;  1XHM A;  3I89 A;  4ESG A;  1NEX B;  4XYI A;  3RFG A;  1OMW B;  4FWW A;  1VE7 A;  4FA9 D;  3N0D A;  4ZOY A;  4D6V A;  2XE4 A;  5EMJ B;  3HFQ A;  2EBS A;  4O1Q D;  4K3J B;  2QC5 A;  4A0B B;  2VZ1 A;  5KDO B;  3SCY A;  3EG6 A;  4LGN A;  1T2X A;  1E8N A;  2BCJ B;  3FCU A;  2PM7 B;  3RFH A;  5B4W A;  2YBA A;  2TRC B;  4KFM B;  3T3M A;  2VZ3 A;  3DDU A;  3DWL C;  4N14 A;  4A11 A;  4BCD A;  2PM9 A;  3DXK C;  5AFU 3;  5HYN B;  2OK4 A;  5HE3 B;  4J84 A;  3J80 g;  4GGA A;  3CIK B;  4G55 A;  1VZ3 A;  2HU8 A;  1TBG A;  3JZG A;  2BBK H;  2H47 A;  3F3P A;  3BG1 A;  1GOG A;  3I7P A;  3SLE D;  1MG3 A;  2H13 A;  4WK0 A;  5A2Q g;  2CO0 A;  5C86 A;  1QNI A;  4NAA A;  5EM2 A;  3QI0 A;  2OVQ B;  2O9K A;  3MUN A;  3K72 A;  2HYE A;  2PM6 B;  2HXC A;  2HU7 A;  3IIY A;  1OLZ A;  4IMM A;  4Y5R D;  4BCC A;  3PE7 A;  3OTT A;  3PXS D;  2AGX A;  1A12 A;  4O3U B;  4E5Z A;  2OIZ A;  5EAM A;  1UOP A;  2I3S A;  1U2V C;  4MMY A;  1UOQ A;  5IC7 A;  4J79 A;  4GQ2 P;  4AN0 A;  1TYE A;  5EMM B;  5EM2 B;  4L1M A;  5FKQ A;  3FCS A;  5HE0 B;  4GMB A;  3I7N A;  4E54 A;  1N6D A;  1PGU A;  2UZX B;  3IJ1 A;  3C9C A;  3ODT A;  3SN6 B;  2VDR A;  3AH8 B;  4JHN A;  5GSA A;  4CI8 A;  2UZY B;  4JSP C;  4O02 A;  1N6E A;  4GQB B;  1SQ9 A;  2J56 H;  4O3T B;  5EAR A;  3AFC A;  4UI9 R;  4J73 A;  3OF7 A;  4AOW A;  2XYI A;  3UVN A;  2AQ5 A;  4PC0 A;  3IJ0 A;  3JRP A;  3IJE A;  3ZE1 A;  4J0X A;  3MVD K;  4GM3 A;  2EIC A;  4I79 A;  4JSX C;  4A09 A;  5CXC B;  4AEZ A;  5C9Z B;  3SXT D;  4J0W A;  3ORV D;  3MKS B;  1YR2 A;  3NVX A;  1RI6 A;  2VDM A;  3T3P A;  4BCB A;  3VGZ A;  4GGD A;  5TEF A;  2P9U C;  4K3I D;  2Z2P A;  3CFV A;  2CN2 A;  5SXM A;  5AJA A;  3PXT D;  1TYQ C;  4X3E A;  1M1X A;  2XL2 A;  2OK6 A;  3DM0 A;  2HKR A;  3RN0 D;  5EAL A;  2IUQ A;  3EQ7 A;  1K32 A;  4NEN A;  2AGW A;  1H2Z A;  4CY1 A;  4A0A A;  2CNX A;  2WQ8 A;  2XDW A;  2VDP A;  3JPX A;  4CY3 A;  4O9D A;  3UVM A;  4A2M A;  2W18 A;  5TF2 A;  2YNP A;  3PXW D;  4QQE A;  4TZ4 A;  4NBM A;  3EI1 A;  5GXI A;  1C9I A;  1S4U X;  3GRE A;  2CE9 A;  1BPO A;  5M5V A;  2CO0 C;  4JXM A;  1NR0 A;  2Z2N A;  5IGO A;  3SHF A;  4FB1 D;  3N0E A;  5AMS A;  3UKR C;  1PEV A;  1C9L A;  3JRO A;  3ZWL B;  2EID A;  5H17 A;  2VDK A;  4GM8 A;  4J8G A;  2PM9 B;  4X63 B;  2OVP B;  2Z2O A;  3V9F A;  4J77 A;  2P9N C;  5EMK B;  1JOF A;  3AL9 A;  3EI1 B;  3OL2 B;  1FWX A;  2VDQ A;  3NVQ A;  5C2W B;  3EI3 B;  3F3G A;  4LG9 A;  3IUQ A;  3VH0 A;  4CZV A;  1GP2 B;  1O6F A;  1VZ2 A;  4YVD A;  2EIE A;  5FXY A;  1MDA H;  2VC2 A;  2G9A A;  2QXV A;  5M61 A;  4BL0 A;  4GQ1 A;  5H1M A;  2QZP A;  3I8E A;  3OKT A;  2GNQ A;  1E8M A;  3IUJ A;  3IJC A;  4QT8 A;  2HJB A;  4E5Z B;  2IWF A;  1GOH A;  3K26 A;  3IVM A;  2AH0 A;  3F3F A;  4CY5 A;  4CZY A;  3GFC A;  4ZOV A;  3MXX A;  4Y7R A;  5EML B;  1R5M A;  3SJL D;  5GXH A;  4PNK B;  3K27 A;  4CI1 A;  1GOT B;  5H14 A;  3EU7 A;  2I3T A;  4BP8 A;  2YB8 B;  2H9M A;  3SMR A;  1MG2 A;  4UM9 A;  4D9S A;  3IUR A;  4FAN D;  4U1E I;  4MMZ A;  4ES0 A;  4FA4 D;  3NID A;  4AMZ A;  2GC7 A;  3C99 A;  1UTC A;  1E5T A;  3IIW A;  2YNN A;  5HE1 B;  4D0K A;  1XKS A;  1Q47 A;  5FKT A;  1XIP A;  2OJY A;  4BUJ C;  5FA5 B;  4Z8L A;  5M5S A;  2IUV A;  2QR5 A;  4LG8 A;  4L1Q D;  4NSX A;  5K1C C;  4ERY A;  3NIG A;  4QL1 A;  1UOO A;  1B9Y A;  1A0R B;  1GXR A;  4FHL A;  3J81 g;  5CYK B;  4DNW A;  2YNO A;  5EAP A;  4IRZ A;  3V4V A;  3O4I A;  2I0S A;  1GG2 B;  3U4Y A;  3EQ9 A;  5IJ7 E;  1GOF A;  1B9X A;  3BG0 A;  3IUM A;  3O4H A;  2H6N A;  4WJK A;  5M5R A;  3L4M D;  2P9P C;  2H6Q A;  3KRX B;  3JZH A;  4PBZ A;  4G56 B;  4R7A B;  1N6F A;  3V7D B;  1JMZ B;  3VA6 A;  2B5M A;  3PVW B;  3DXM C;  3V4P A;  4WK4 A;  5TDH B;  3MZK A;  3I7K A;  3MKQ A;  3K6S A;  3ZDY A;  3EI4 B;  3ZDX A;  4ZN4 A;  4JT5 C;  2IWK A;  3AL8 A;  2IUP A;  2H9P A;  5I5I A;  4WK2 A;  4H5I A;  3W15 A;  3EQ8 A;  5FFG A;  3RN1 D;  2B5N A;  4ERQ A;  3B7F A;  5IGQ A;  4UM8 A;  4A08 B;  3ZDZ A;  5I5M A;  3UVL A;  2AGY A;  4CC9 A;  3E0C A;  3RLM D;  4DNV A;  3QHY B;  4G1M A;  3SBQ A;  3RMZ D;  4Z7O A;  5M5U A;  3JAM g;  1H2X A;  5HQG A;  3PSL A;  3A0F A;  4JHP C;  4Z7Q A;  4PSW B;  5FKS A;  3EI4 A;  5IJ8 E;  1PBY B;  4MK0 B;  4L3G D;  4U7A A;  3KCI A;  5FKR A;  3ULE C;  1K8K C;  3BWS A;  1JJU B;  1U4C A;  3GD1 I;  1O6G A;  4FAV D;  2H9N A;  2P9K C;  5C2V B;  3EI2 A;  2XL3 A;  2J55 H;  2EIB A;  4JT6 C;  5I5J A;  5FQD A;  2H3X A;  2P9I C;  3EMH A;  4CY2 A;  4E54 B;  3I7H A;  2J57 G;  1H2Y A;  3GC3 B;  3MMY A;  4PXW A;  3OKY A;  4PBY A;  3UVO A;  5FFO A;  4GZ8 A;  5HE2 B;  3UR4 A;  1ERJ A;  5K19 A;  2H6K A;  2VDL A;  5CYK A;  3KRW B;  4J86 A;  4X61 B;  1JMX B;  2AGL A;  3SBR A;  4CI3 A;  2GC4 A;  3PSC B;  5TEE A;  4NC4 A;  4L3H D;  4JSN C;  3RRM C;  3CFS B;  3EWE A;  4X60 B;  1QFM A;  4JD2 C;  4QRJ A;  2JKX A;  3K71 A;  3PVU B;  4A0B A;  4XEI C;  3OKY B;  3FM0 A;  2IAA A;  3C75 H;  4BH6 A;  3DSM A;  4ZOX A;  5CXC A;  2MTA H;  3JB9 L;  4FA5 D;  1P22 A;  4OWR A;  4AMY A;  5HDB A;  3P4F A;  5IT9 g;  1L0Q A;  4AX4 A;  1SHY B;  4A0A B;  2PBI B;  4GGC A;  3FGB A;  4RE5 A;  2I0T A;  3IUL A;  3UVK A;  3VI4 A;  4AN1 A;  4J87 A;  4O2W A;  1JV2 A;  2CE8 A;  2H14 A;  2Q7Q A;  3MZL A;  4OZU A;  3OW8 A;  2P9L C;  4A2L A;  3SVW D;  3NIF A;  3V5W B;  1L5G A;  3FRX A;  3OKW A;  4MMX A;  4QAM A;  2I0R A;  2CN3 A;  4A7J A;  2B5L A;  3SWS D;  2BKL A;  2YMU A;  3UKU C;  2G99 A;  3C5M A;  3EI3 A;  4J78 A;  1I2M B;  5E6R A;  3O4G A;  2VDN A;  4A08 A;  2B4E A;  3I8C A;  2AH1 A;  2P9S C;  4DNU A;  2VDO A;  3MUO A;  1SQJ A;  1VYH C;  1PI6 A;  5E6S A;  3OL2 A;  3EI2 B;  4Z7N A;  3JZN A;  4ZOZ A;  4GM9 A;  3AL8 B;  4H5J A;  4HDJ A;  2HKM A;  4O45 A;  1U8C A;  3SBP A;  3ZE0 A;  4G1E A;  3SFZ A;  4A11 B;  2H9L A;  4XYH A;  4PSX B;  1QFS A;  4JSV C;  5CXB A;  3NVN A;  5M5T A;  4CI2 A;  1H2W A;  5THA A;  3I7O A;  4FA1 D;  1K3I A;  2IUR A; 
#chains in the Genus database with same CATH homology
 4ERZ A;  4J8B A;  2AGZ A;  3IKO A;  1YFQ A;  4J81 A;  3RSE C;  4IA9 A;  4A09 B;  2OVR B;  4L9O A;  5CXB B;  2HES X;  3I7L A;  4J82 A;  5FLX g;  4EWR A;  4CZX A;  2XU7 A;  5GMK n;  2H68 A;  2HJ4 A;  3L4O D;  3I2N A;  5JWZ A;  1XHM A;  3I89 A;  4ESG A;  1NEX B;  4XYI A;  3RFG A;  1OMW B;  4FWW A;  4FA9 D;  3N0D A;  4ZOY A;  4D6V A;  5EMJ B;  3HFQ A;  2EBS A;  4O1Q D;  4K3J B;  2QC5 A;  4A0B B;  5KDO B;  3SCY A;  3EG6 A;  4LGN A;  2BCJ B;  2PM7 B;  3RFH A;  5B4W A;  2YBA A;  2TRC B;  4KFM B;  4A11 A;  5AFU 3;  3DWL C;  4N14 A;  5HYN B;  2PM9 A;  3DXK C;  2OK4 A;  5HE3 B;  4J84 A;  3J80 g;  4GGA A;  3CIK B;  1TBG A;  3JZG A;  2BBK H;  2H47 A;  3F3P A;  3BG1 A;  3I7P A;  3SLE D;  1MG3 A;  2H13 A;  5A2Q g;  2CO0 A;  1QNI A;  5EM2 A;  2OVQ B;  2O9K A;  2HYE A;  2PM6 B;  2HXC A;  3IIY A;  1OLZ A;  4IMM A;  4Y5R D;  3PE7 A;  3OTT A;  3PXS D;  2AGX A;  4O3U B;  4E5Z A;  2OIZ A;  5EAM A;  2I3S A;  1U2V C;  5IC7 A;  4J79 A;  4GQ2 P;  5EMM B;  5EM2 B;  5HE0 B;  5FKQ A;  4GMB A;  3I7N A;  4E54 A;  1N6D A;  1PGU A;  2UZX B;  3IJ1 A;  3C9C A;  3ODT A;  3SN6 B;  3AH8 B;  5GSA A;  4CI8 A;  2UZY B;  4JSP C;  1N6E A;  4GQB B;  1SQ9 A;  2J56 H;  4O3T B;  5EAR A;  3AFC A;  4UI9 R;  4J73 A;  4AOW A;  2XYI A;  3UVN A;  2AQ5 A;  4PC0 A;  3IJ0 A;  3JRP A;  4J0X A;  4GM3 A;  4I79 A;  4JSX C;  4A09 A;  5CXC B;  4AEZ A;  5C9Z B;  3SXT D;  4J0W A;  3ORV D;  3MKS B;  3NVX A;  1RI6 A;  3VGZ A;  4GGD A;  5TEF A;  2P9U C;  4K3I D;  2Z2P A;  3CFV A;  2CN2 A;  5SXM A;  5AJA A;  3PXT D;  1TYQ C;  4X3E A;  2XL2 A;  2OK6 A;  3DM0 A;  2HKR A;  3RN0 D;  5EAL A;  2IUQ A;  1K32 A;  2AGW A;  4CY1 A;  4A0A A;  2CNX A;  3JPX A;  4CY3 A;  4O9D A;  3UVM A;  4A2M A;  2W18 A;  5TF2 A;  2YNP A;  3PXW D;  4QQE A;  4TZ4 A;  3EI1 A;  5GXI A;  1S4U X;  3GRE A;  2CE9 A;  2CO0 C;  4JXM A;  1NR0 A;  2Z2N A;  5IGO A;  3SHF A;  4FB1 D;  3N0E A;  5AMS A;  3UKR C;  1PEV A;  3JRO A;  3ZWL B;  5H17 A;  4GM8 A;  4J8G A;  2PM9 B;  4X63 B;  2OVP B;  2Z2O A;  3V9F A;  4J77 A;  2P9N C;  5EMK B;  1JOF A;  3AL9 A;  3EI1 B;  3OL2 B;  1FWX A;  3NVQ A;  5C2W B;  3EI3 B;  3F3G A;  4LG9 A;  3VH0 A;  4CZV A;  1GP2 B;  4YVD A;  5FXY A;  1MDA H;  2G9A A;  2QXV A;  4BL0 A;  4GQ1 A;  5H1M A;  3I8E A;  2GNQ A;  3OKT A;  3IJC A;  4QT8 A;  2HJB A;  4E5Z B;  2IWF A;  3K26 A;  2AH0 A;  3F3F A;  4CY5 A;  4CZY A;  3GFC A;  4ZOV A;  3MXX A;  4Y7R A;  5EML B;  1R5M A;  3SJL D;  5GXH A;  4PNK B;  3K27 A;  4CI1 A;  1GOT B;  5H14 A;  3EU7 A;  2I3T A;  2YB8 B;  2H9M A;  3SMR A;  1MG2 A;  4FAN D;  4U1E I;  4ES0 A;  4FA4 D;  2GC7 A;  3C99 A;  3IIW A;  2YNN A;  5HE1 B;  4D0K A;  1XKS A;  1Q47 A;  5FKT A;  1XIP A;  2OJY A;  4BUJ C;  5FA5 B;  4Z8L A;  2IUV A;  4LG8 A;  4L1Q D;  4NSX A;  5K1C C;  4ERY A;  4QL1 A;  1B9Y A;  1A0R B;  1GXR A;  4FHL A;  3J81 g;  5CYK B;  2YNO A;  5EAP A;  2I0S A;  1GG2 B;  3U4Y A;  5IJ7 E;  1B9X A;  3BG0 A;  2H6N A;  3L4M D;  2P9P C;  2H6Q A;  3KRX B;  3JZH A;  4PBZ A;  4G56 B;  4R7A B;  1N6F A;  3V7D B;  1JMZ B;  3VA6 A;  2B5M A;  3PVW B;  3DXM C;  5TDH B;  3MZK A;  3I7K A;  3MKQ A;  3EI4 B;  4ZN4 A;  4JT5 C;  2IWK A;  3AL8 A;  2IUP A;  2H9P A;  5I5I A;  4H5I A;  3W15 A;  3RN1 D;  2B5N A;  4ERQ A;  3B7F A;  5IGQ A;  4A08 B;  5I5M A;  3UVL A;  2AGY A;  4CC9 A;  3E0C A;  3RLM D;  3SBQ A;  3RMZ D;  3JAM g;  5HQG A;  3A0F A;  3PSL A;  4PSW B;  5FKS A;  3EI4 A;  5IJ8 E;  1PBY B;  4MK0 B;  4L3G D;  4U7A A;  5FKR A;  3ULE C;  1K8K C;  3BWS A;  1JJU B;  1U4C A;  4FAV D;  2H9N A;  2P9K C;  5C2V B;  3EI2 A;  2XL3 A;  2J55 H;  4JT6 C;  5I5J A;  5FQD A;  2H3X A;  2P9I C;  3EMH A;  4CY2 A;  4E54 B;  3I7H A;  2J57 G;  3MMY A;  4PXW A;  3OKY A;  4PBY A;  3UVO A;  3UR4 A;  4GZ8 A;  5HE2 B;  1ERJ A;  5K19 A;  2H6K A;  5CYK A;  3KRW B;  4J86 A;  4X61 B;  2AGL A;  1JMX B;  3SBR A;  4CI3 A;  2GC4 A;  3PSC B;  5TEE A;  4L3H D;  4JSN C;  3RRM C;  3CFS B;  3EWE A;  4X60 B;  4JD2 C;  4QRJ A;  3PVU B;  4A0B A;  4XEI C;  3OKY B;  3FM0 A;  2IAA A;  3C75 H;  4BH6 A;  3DSM A;  4ZOX A;  5CXC A;  2MTA H;  3JB9 L;  4FA5 D;  1P22 A;  4OWR A;  5IT9 g;  3P4F A;  1L0Q A;  1SHY B;  4A0A B;  2PBI B;  4GGC A;  3FGB A;  2I0T A;  3UVK A;  4J87 A;  4OZU A;  2CE8 A;  2H14 A;  2Q7Q A;  3MZL A;  3OW8 A;  2P9L C;  4A2L A;  3SVW D;  3V5W B;  3FRX A;  3OKW A;  2I0R A;  2CN3 A;  4A7J A;  2B5L A;  3SWS D;  2YMU A;  3UKU C;  2G99 A;  3C5M A;  3EI3 A;  4J78 A;  4A08 A;  2B4E A;  2AH1 A;  3I8C A;  2P9S C;  1SQJ A;  1VYH C;  1PI6 A;  3OL2 A;  3EI2 B;  3JZN A;  4ZOZ A;  4GM9 A;  3AL8 B;  4H5J A;  4HDJ A;  2HKM A;  4O45 A;  3SBP A;  3SFZ A;  4A11 B;  2H9L A;  4XYH A;  4PSX B;  4JSV C;  5CXB A;  3NVN A;  4CI2 A;  5THA A;  3I7O A;  4FA1 D;  2IUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...