2B5NA

Crystal structure of the ddb1 bpb domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
316
structure length
312
Chain Sequence
NGIGIHEHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords damage-specific DNA binding protein 1
publication title Structure of DDB1 in complex with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 52
structure length 312
sequence length 316
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b5nA00
2IAAA 4X3EA 4OWRA 3EU7A 4QQEA 2G99A 2QC5A 4FB1D 2B5NA 3RN0D 5FKTA 5B4WA 4ZN4A 4CY2A 3VGZA 2Z2NA 5FKSA 4GZ8A 5EALA 3OTTA 2EBSA 4E54B 1U2VC 2H3XA 2B5MA 3JRPA 3JROA 4L1QD 1K32A 1N6FA 3PSCB 2UZXB 3OKTA 4J0XA 3MKSB 2P9KC 1B9XA 5SXMA 2CO0A 4JSPC 3MZKA 4A0BB 1SQJA 2H14A 1PI6A 5FLXg 2CE8A 3SJLD 1NEXB 4BL0A 4A09A 4GM3A 4TZ4A 3HFQA 1JMZB 4FAVD 4GGCA 1PBYB 3E0CA 4PXWA 2OK6A 3UKUC 3I7HA 2YNPA 3JB9L 5KDOB 2HJ4A 5A2Qg 2AH0A 3MZLA 4GGAA 5EM2A 4NSXA 2P9SC 2H6KA 5CXCB 3EI1B 2BBKH 3ZWLB 3MMYA 4A2LA 3SFZA 4J73A 3FGBA 2HKRA 4ZOZA 3IJ0A 3RLMD 3I7LA 4GMBA 4X61B 3IJCA 5THAA 4XYHA 4KFMB 3PXWD 3GFCA 2I0RA 4CI8A 3EI4A 2W18A 5AJAA 5I5MA 4IA9A 1JJUB 2IWKA 1FWXA 4D6VA 5IC7A 3UVKA 1B9YA 3VA6A 2YMUA 5C2VB 4HDJA 4MK0B 3EMHA 2IUVA 5C2WB 4JT5C 4IMMA 3A0FA 4GQ2P 2IUQA 4OZUA 2P9UC 5EAMA 5H17A 4U7AA 3JZNA 2OVPB 5EMMB 4E54A 3PE7A 2XL3A 5TDHB 4PBYA 1S4UX 5IGOA 3C75H 4ERYA 4L3HD 1MG3A 4CI3A 2CO0C 4J8GA 4A0BA 5CXBB 4ERQA 1Q47A 1NR0A 3BG0A 2P9IC 1N6DA 3CFSB 2CNXA 2OJYA 1SHYB 2GC4A 4J79A 2H9MA 4H5IA 3CIKB 5C9ZB 2AGWA 4Y7RA 5IJ7E 1ERJA 5AFU3 2YBAA 3SXTD 4FA1D 5HE1B 3IJ1A 3NVQA 4JD2C 2HKMA 3ULEC 2AQ5A 3K26A 1YFQA 3EI3B 5CXCA 1XKSA 3K27A 3EI1A 4ZOVA 2HYEA 5I5IA 1R5MA 5FKQA 2O9KA 3PXTD 4O3UB 4QRJA 3DXKC 4LG9A 2GNQA 2I3SA 4GQ1A 4Z8LA 4JSXC 4BUJC 4FWWA 4O3TB 1GP2B 3SCYA 5EMLB 5H14A 4A11B 5K19A 3N0EA 4J0WA 1XHMA 1PGUA 4R7AB 3PVWB 4ES0A 2AH1A 4GGDA 2TRCB 2P9PC 3I89A 3PSLA 2OIZA 4CZXA 3FRXA 2IWFA 2PM7B 4X63B 4LGNA 4U1EI 2H9LA 2Z2PA 3F3PA 1U4CA 2BCJB 2CE9A 2HXCA 2B5LA 3AH8B 5CXBA 3C99A 3U4YA 3EG6A 1GOTB 4CY3A 3I7PA 2HJBA 3IIWA 3RFGA 4CY1A 3V5WB 2I3TA 2AGLA 3C5MA 2UZYB 3SVWD 5I5JA 3MXXA 2YNOA 4H5JA 3EI2B 4QT8A 5GXHA 4E5ZB 3I8EA 2QXVA 4GM8A 5TF2A 2PM9B 3I7OA 1RI6A 3AL9A 3EI3A 2B4EA 4J84A 2H6NA 2G9AA 3KRWB 2Z2OA 5FQDA 5HQGA 4FA4D 4CZVA 1P22A 1MG2A 2YB8B 4ESGA 1PEVA 4JSNC 3EWEA 5GMKn 4A11A 3V9FA 2GC7A 3FM0A 4UI9R 2H9PA 1JMXB 5CYKB 4FAND 4A0AB 3KRXB 1GG2B 3RSEC 4J82A 3JZHA 3RFHA 4CY5A 4ZOYA 3AL8B 1TBGA 3UR4A 3I8CA 4J8BA 2IURA 2H13A 3N0DA 3OL2A 3W15A 1N6EA 1SQ9A 3DSMA 4CZYA 2OVRB 5GXIA 2IUPA 4D0KA 4FA9D 4K3JB 2I0SA 4O1QD 1VYHC 4AOWA 3DXMC 2CN2A 3ORVD 3DWLC 5FXYA 3V7DB 4FA5D 5HYNB 4CI2A 3VH0A 3OKYB 5IJ8E 3L4MD 1A0RB 3I7KA 2H6QA 3I2NA 2HESX 4LG8A 1OMWB 2Q7QA 1QNIA 3RMZD 3EI2A 5EMJB 3JAMg 3UVLA 4AEZA 4PSWB 4E5ZA 3SBQA 4CI1A 4J77A 2PM9A 2OVQB 4J78A 2OK4A 3SLED 4PSXB 4JSVC 4A08B 4QL1A 3ODTA 2I0TA 5HE3B 3L4OD 2MTAH 4XYIA 5IT9g 3OL2B 5FKRA 2H68A 3GREA 4EWRA 3BG1A 2AGZA 3RN1D 4PBZA 2J56H 2PM6B 3PVUB 5CYKA 3P4FA 4A0AA 3UKRC 3JZGA 5EMKB 2XYIA 1L0QA 3F3GA 5JWZA 4JT6C 5TEFA 3AL8A 3UVOA 3UVMA 3OW8A 3CFVA 4XEIC 4L3GD 4ZOXA 2J57G 5IGQA 5AMSA 3JPXA 4YVDA 3NVNA 3I7NA 3OKWA 4FHLA 2CN3A 1OLZA 4G56B 5HE2B 2PBIB 4O9DA 3SHFA 4L9OA 2AGXA 3SBPA 4A2MA 3DM0A 3MKQA 3OKYA 4JXMA 2J55H 3UVNA 5H1MA 5HE0B 4A7JA 4I79A 5EARA 2P9LC 2P9NC 4Y5RD 4J81A 4J87A 3C9CA 3F3FA 4GM9A 4ERZA 3NVXA 3SWSD 3J81g 2H9NA 4A09B 5K1CC 4O45A 3SMRA 4A08A 3IKOA 5EAPA 4N14A 2XU7A 4X60B 1TYQC 2YNNA 4J86A 2AGYA 5EM2B 5FA5B 3PXSD 4CC9A 3B7FA 4PC0A 3J80g 1JOFA 3SBRA 1MDAH 5TEEA 5GSAA 3AFCA 1XIPA 4BH6A 2H47A 1GXRA 3BWSA 3EI4B 3SN6B 2XL2A 3IIYA 4PNKB 1K8KC 4GQBB 3RRMC 4K3ID
chains in the Genus database with same CATH superfamily
2IAAA 4X3EA 4OWRA 3EU7A 4QQEA 2G99A 2QC5A 4FB1D 2B5NA 4RE6A 3RN0D 5FKTA 4UM8A 5B4WA 4ZN4A 4CY2A 3VGZA 5FFGA 2Z2NA 5FKSA 4GZ8A 5EALA 3OTTA 2EBSA 4E54B 5E6RA 1U2VC 2H3XA 2B5MA 3JRPA 3JROA 3IJEA 4L1QD 1K32A 1N6FA 3IUNA 3PSCB 2UZXB 3OKTA 4J0XA 4WK0A 3MKSB 2P9KC 3IUJA 1JTDB 1B9XA 5SXMA 2CO0A 4JSPC 3MZKA 4A0BB 2BKLA 1SQJA 3O4GA 2H14A 1K3IA 1PI6A 4DNUA 3NIFA 1VZ2A 4AMYA 5FLXg 2CE8A 3SJLD 1NEXB 1H2WA 4BL0A 4A09A 4GM3A 1E5TA 3HFQA 1JMZB 4TZ4A 4FAVD 4GGCA 4NBMA 1PBYB 5FFOA 2QR5A 3E0CA 4PXWA 2OK6A 3UKUC 3MUNA 3I7HA 2YNPA 3JB9L 5KDOB 2HJ4A 5A2Qg 4NC4A 2AH0A 3MZLA 4GGAA 5EM2A 4NSXA 2P9SC 3KCIA 2H6KA 5CXCB 3MUOA 3EI1B 2BBKH 3ZWLB 3MMYA 4A2LA 3SFZA 1UOOA 4J73A 3FGBA 2HKRA 2VDOA 4ZOZA 3IJ0A 3RLMD 3I7LA 4GMBA 4X61B 3IJCA 5THAA 3ZDYA 4XYHA 4KFMB 3PXWD 4D9SA 5M5RA 3GFCA 2I0RA 4CI8A 3EI4A 2W18A 5AJAA 5I5MA 4IA9A 1JJUB 2IWKA 1FWXA 3ZDZA 4D6VA 5IC7A 3ZE1A 3UVKA 1B9YA 3VA6A 1UOQA 2YMUA 5C2VB 4HDJA 4MK0B 3EMHA 2IUVA 5C2WB 4JT5C 4IMMA 3A0FA 4GQ2P 5M61A 2IUQA 3DDUA 4OZUA 2P9UC 5EAMA 5H17A 4U7AA 3JZNA 5M5VA 2OVPB 5EMMB 4E54A 3GD1I 3PE7A 2XL3A 5TDHB 4PBYA 2VDPA 3ZE2A 1S4UX 5IGOA 3C75H 4ERYA 4L3HD 2XZGA 1MG3A 1UTCA 4CI3A 2CO0C 3K71A 4J8GA 4A0BA 5CXBB 5E6SA 4ERQA 1Q47A 4WK4A 4UM9A 1NR0A 3BG0A 2P9IC 1N6DA 3CFSB 2CNXA 2EIBA 1I2MB 1O6FA 1SHYB 1YR2A 2OJYA 2GC4A 4J79A 2H9MA 4H5IA 3CIKB 5C9ZB 2AGWA 4Y7RA 5IJ7E 2VDKA 4IRZA 1ERJA 5AFU3 1L5GA 2YBAA 3SXTD 2QZPA 5HE1B 4FA1D 3IJ1A 3NVQA 4JD2C 2HKMA 4G1EA 3ULEC 2AQ5A 3K26A 1YFQA 3EI3B 5CXCA 1XKSA 3K27A 3EI1A 4ZOVA 2HYEA 5I5IA 1R5MA 5FKQA 4JHPC 2O9KA 5C86A 3PXTD 4O3UB 1GOHA 3DXKC 4LG9A 4QRJA 2GNQA 2I3SA 4GQ1A 4Z8LA 4JSXC 4BUJC 2XE4A 4FWWA 4O3TB 3O4JA 1GP2B 3SCYA 5EMLB 5H14A 4A11B 4Z7NA 5K19A 3N0EA 4J0WA 1XHMA 1PGUA 3OF7A 1M1XA 3K72A 4WK2A 4R7AB 5E6UA 3PVWB 1GOFA 4ES0A 2AH1A 4GGDA 2TRCB 2P9PC 3I89A 3PSLA 2OIZA 4JHNA 1JV2A 4CZXA 4MMXA 3FRXA 2IWFA 2PM7B 4X63B 4QAMA 4LGNA 4U1EI 2H9LA 2Z2PA 3F3PA 1U4CA 2BCJB 2CE9A 2HU7A 2HXCA 4Z7QA 2B5LA 4AMZA 3AH8B 5CXBA 5HDBA 4WJKA 3C99A 3U4YA 3EG6A 1GOTB 4G1MA 4CY3A 4O2WA 3I7PA 2HJBA 3IIWA 3RFGA 4CY1A 3V5WB 2I3TA 2VDQA 2AGLA 3C5MA 2UZYB 3SVWD 5I5JA 3MXXA 3QI0A 2YNOA 1H2ZA 4H5JA 3EI2B 4QT8A 5GXHA 4E5ZB 3I8EA 2QXVA 3IURA 4GM8A 5TF2A 2PM9B 3I7OA 1RI6A 4DNWA 3AL9A 3EI3A 2B4EA 5C92A 4J84A 2H6NA 2G9AA 4AN1A 3KRWB 2Z2OA 5FQDA 5HQGA 4DNVA 4FA4D 4CZVA 1P22A 1MG2A 2YB8B 4BCBA 1QFMA 1PEVA 4ESGA 1TYEA 3EWEA 4JSNC 3ZDXA 4A11A 5GMKn 3V9FA 5M5SA 3IULA 4RE5A 2GC7A 3FM0A 4UI9R 2H9PA 1JMXB 5CYKB 4FAND 3MVDK 4A0AB 3FCSA 3KRXB 4MMZA 1GG2B 3RSEC 2EIDA 4BCDA 4J82A 4G55A 3JZHA 3RFHA 4CY5A 4ZOYA 3AL8B 1TBGA 3UR4A 3I8CA 4J8BA 2IURA 3FCUA 1E8MA 2H13A 3QHYB 3N0DA 3OL2A 3W15A 4BP8A 1N6EA 5M5UA 1SQ9A 3DSMA 4CZYA 2OVRB 1H2XA 5GXIA 2IUPA 4D0KA 4FA9D 4K3JB 2I0SA 2EICA 4O1QD 5M5TA 1QFSA 1VYHC 1C9IA 4AOWA 3EQ7A 3DXMC 4BP9A 3V4PA 2CN2A 3ORVD 3DWLC 5FXYA 1UOPA 3V7DB 4FA5D 4CI2A 5HYNB 3VH0A 3OKYB 5IJ8E 3L4MD 1A0RB 4Z7OA 3I7KA 2H6QA 3I2NA 1VE6A 2HESX 4LG8A 1OMWB 2Q7QA 3V4VA 1QNIA 3RMZD 3EI2A 5EMJB 3JAMg 3UVLA 4AEZA 2WQ8A 4PSWB 4E5ZA 3SBQA 2JKXA 4CI1A 4J77A 2PM9A 2OVQB 4J78A 2OK4A 3SLED 4PSXB 4JSVC 4A08B 4QL1A 3ODTA 2I0TA 5HE3B 3L4OD 2MTAH 4XYIA 5IT9g 3OL2B 5FKRA 2H68A 3GREA 4EWRA 3BG1A 2AGZA 4L1MA 3RN1D 4PBZA 2J56H 2PM6B 3PVUB 3EQ9A 5CYKA 3P4FA 4A0AA 3ZE0A 3UKRC 3JZGA 2XDWA 5EMKB 2VDLA 2XYIA 1L0QA 3F3GA 1C9LA 5JWZA 4JT6C 5TEFA 3AL8A 3UVOA 3UVMA 3NIDA 3OW8A 3CFVA 4NENA 4XEIC 3GC3B 4L3GD 4ZOXA 2J57G 5IGQA 5AMSA 3JPXA 1E8NA 4YVDA 3NVNA 4O02A 3I7NA 3OKWA 4FHLA 2CN3A 1OLZA 3T3PA 4G56B 5HE2B 2PBIB 4O9DA 3SHFA 4L9OA 2AGXA 1VZ3A 1O6GA 2VZ3A 3SBPA 2VDNA 4A2MA 3DM0A 3MKQA 3OKYA 4JXMA 2J55H 3UVNA 5H1MA 2HU5A 2HU8A 1BPOA 5HE0B 4A7JA 1U8CA 4I79A 4BCCA 2VZ1A 5EARA 2P9LC 2VC2A 2P9NC 4Y5RD 4J81A 4J87A 3C9CA 4AN0A 3IUQA 4AX4A 1VE7A 3F3FA 4GM9A 4ERZA 3NVXA 3SWSD 3J81g 2H9NA 4A09B 3VI4A 5K1CC 4O45A 3SMRA 4A08A 3IKOA 5EAPA 3K6SA 2EIEA 4N14A 3IUMA 3NIGA 2XU7A 4X60B 4NAAA 3O4IA 1TYQC 2YNNA 4J86A 1GOGA 2AGYA 5EM2B 5FA5B 3PXSD 4CC9A 3T3MA 3B7FA 4PC0A 1T2XA 3J80g 2VDRA 3VI3A 1A12A 3IVMA 1JOFA 3SBRA 1MDAH 5TEEA 5GSAA 3AFCA 4MMYA 1XIPA 4BH6A 2H47A 1GXRA 3BWSA 3EI4B 3SN6B 3O4HA 2XL2A 3EQ8A 3IIYA 2VDMA 4PNKB 1K8KC 1H2YA 4GQBB 3RRMC 4K3ID
chains in the Genus database with same CATH topology
2IAAA 4X3EA 4OWRA 3EU7A 4QQEA 2G99A 2QC5A 4FB1D 2B5NA 3RN0D 5FKTA 5B4WA 4ZN4A 4CY2A 3VGZA 2Z2NA 5FKSA 4GZ8A 5EALA 3OTTA 2EBSA 4E54B 1U2VC 2H3XA 2B5MA 3JRPA 3JROA 4L1QD 1K32A 1N6FA 3PSCB 2UZXB 3OKTA 4J0XA 3MKSB 2P9KC 1B9XA 5SXMA 2CO0A 4JSPC 3MZKA 4A0BB 1SQJA 2H14A 1PI6A 5FLXg 2CE8A 3SJLD 1NEXB 4BL0A 4A09A 4GM3A 4TZ4A 3HFQA 1JMZB 4FAVD 4GGCA 1PBYB 3E0CA 4PXWA 2OK6A 3UKUC 3I7HA 2YNPA 3JB9L 5KDOB 2HJ4A 5A2Qg 2AH0A 3MZLA 4GGAA 5EM2A 4NSXA 2P9SC 2H6KA 5CXCB 3EI1B 2BBKH 3ZWLB 3MMYA 4A2LA 3SFZA 4J73A 3FGBA 2HKRA 4ZOZA 3IJ0A 3RLMD 3I7LA 4GMBA 4X61B 3IJCA 5THAA 4XYHA 4KFMB 3PXWD 3GFCA 2I0RA 4CI8A 3EI4A 2W18A 5AJAA 5I5MA 4IA9A 1JJUB 2IWKA 1FWXA 4D6VA 5IC7A 3UVKA 1B9YA 3VA6A 2YMUA 5C2VB 4HDJA 4MK0B 3EMHA 2IUVA 5C2WB 4JT5C 4IMMA 3A0FA 4GQ2P 2IUQA 4OZUA 2P9UC 5EAMA 5H17A 4U7AA 3JZNA 2OVPB 5EMMB 4E54A 3PE7A 2XL3A 5TDHB 4PBYA 1S4UX 5IGOA 3C75H 4ERYA 4L3HD 1MG3A 4CI3A 2CO0C 4J8GA 4A0BA 5CXBB 4ERQA 1Q47A 1NR0A 3BG0A 2P9IC 1N6DA 3CFSB 2CNXA 2OJYA 1SHYB 2GC4A 4J79A 2H9MA 4H5IA 3CIKB 5C9ZB 2AGWA 4Y7RA 5IJ7E 1ERJA 5AFU3 2YBAA 3SXTD 4FA1D 5HE1B 3IJ1A 3NVQA 4JD2C 2HKMA 3ULEC 2AQ5A 3K26A 1YFQA 3EI3B 5CXCA 1XKSA 3K27A 3EI1A 4ZOVA 2HYEA 5I5IA 1R5MA 5FKQA 2O9KA 3PXTD 4O3UB 4QRJA 3DXKC 4LG9A 2GNQA 2I3SA 4GQ1A 4Z8LA 4JSXC 4BUJC 4FWWA 4O3TB 1GP2B 3SCYA 5EMLB 5H14A 4A11B 5K19A 3N0EA 4J0WA 1XHMA 1PGUA 4R7AB 3PVWB 4ES0A 2AH1A 4GGDA 2TRCB 2P9PC 3I89A 3PSLA 2OIZA 4CZXA 3FRXA 2IWFA 2PM7B 4X63B 4LGNA 4U1EI 2H9LA 2Z2PA 3F3PA 1U4CA 2BCJB 2CE9A 2HXCA 2B5LA 3AH8B 5CXBA 3C99A 3U4YA 3EG6A 1GOTB 4CY3A 3I7PA 2HJBA 3IIWA 3RFGA 4CY1A 3V5WB 2I3TA 2AGLA 3C5MA 2UZYB 3SVWD 5I5JA 3MXXA 2YNOA 4H5JA 3EI2B 4QT8A 5GXHA 4E5ZB 3I8EA 2QXVA 4GM8A 5TF2A 2PM9B 3I7OA 1RI6A 3AL9A 3EI3A 2B4EA 4J84A 2H6NA 2G9AA 3KRWB 2Z2OA 5FQDA 5HQGA 4FA4D 4CZVA 1P22A 1MG2A 2YB8B 4ESGA 1PEVA 4JSNC 3EWEA 5GMKn 4A11A 3V9FA 2GC7A 3FM0A 4UI9R 2H9PA 1JMXB 5CYKB 4FAND 4A0AB 3KRXB 1GG2B 3RSEC 4J82A 3JZHA 3RFHA 4CY5A 4ZOYA 3AL8B 1TBGA 3UR4A 3I8CA 4J8BA 2IURA 2H13A 3N0DA 3OL2A 3W15A 1N6EA 1SQ9A 3DSMA 4CZYA 2OVRB 5GXIA 2IUPA 4D0KA 4FA9D 4K3JB 2I0SA 4O1QD 1VYHC 4AOWA 3DXMC 2CN2A 3ORVD 3DWLC 5FXYA 3V7DB 4FA5D 5HYNB 4CI2A 3VH0A 3OKYB 5IJ8E 3L4MD 1A0RB 3I7KA 2H6QA 3I2NA 2HESX 4LG8A 1OMWB 2Q7QA 1QNIA 3RMZD 3EI2A 5EMJB 3JAMg 3UVLA 4AEZA 4PSWB 4E5ZA 3SBQA 4CI1A 4J77A 2PM9A 2OVQB 4J78A 2OK4A 3SLED 4PSXB 4JSVC 4A08B 4QL1A 3ODTA 2I0TA 5HE3B 3L4OD 2MTAH 4XYIA 5IT9g 3OL2B 5FKRA 2H68A 3GREA 4EWRA 3BG1A 2AGZA 3RN1D 4PBZA 2J56H 2PM6B 3PVUB 5CYKA 3P4FA 4A0AA 3UKRC 3JZGA 5EMKB 2XYIA 1L0QA 3F3GA 5JWZA 4JT6C 5TEFA 3AL8A 3UVOA 3UVMA 3OW8A 3CFVA 4XEIC 4L3GD 4ZOXA 2J57G 5IGQA 5AMSA 3JPXA 4YVDA 3NVNA 3I7NA 3OKWA 4FHLA 2CN3A 1OLZA 4G56B 5HE2B 2PBIB 4O9DA 3SHFA 4L9OA 2AGXA 3SBPA 4A2MA 3DM0A 3MKQA 3OKYA 4JXMA 2J55H 3UVNA 5H1MA 5HE0B 4A7JA 4I79A 5EARA 2P9LC 2P9NC 4Y5RD 4J81A 4J87A 3C9CA 3F3FA 4GM9A 4ERZA 3NVXA 3SWSD 3J81g 2H9NA 4A09B 5K1CC 4O45A 3SMRA 4A08A 3IKOA 5EAPA 4N14A 2XU7A 4X60B 1TYQC 2YNNA 4J86A 2AGYA 5EM2B 5FA5B 3PXSD 4CC9A 3B7FA 4PC0A 3J80g 1JOFA 3SBRA 1MDAH 5TEEA 5GSAA 3AFCA 1XIPA 4BH6A 2H47A 1GXRA 3BWSA 3EI4B 3SN6B 2XL2A 3IIYA 4PNKB 1K8KC 4GQBB 3RRMC 4K3ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAA A;  4X3E A;  4OWR A;  3EU7 A;  4QQE A;  2G99 A;  2QC5 A;  4FB1 D;  2B5N A;  3RN0 D;  5FKT A;  5B4W A;  4ZN4 A;  4CY2 A;  3VGZ A;  2Z2N A;  5FKS A;  4GZ8 A;  5EAL A;  3OTT A;  2EBS A;  4E54 B;  1U2V C;  2H3X A;  2B5M A;  3JRP A;  3JRO A;  4L1Q D;  1K32 A;  1N6F A;  3PSC B;  2UZX B;  3OKT A;  4J0X A;  3MKS B;  2P9K C;  1B9X A;  5SXM A;  2CO0 A;  4JSP C;  3MZK A;  4A0B B;  1SQJ A;  2H14 A;  1PI6 A;  5FLX g;  2CE8 A;  3SJL D;  1NEX B;  4BL0 A;  4A09 A;  4GM3 A;  4TZ4 A;  3HFQ A;  1JMZ B;  4FAV D;  4GGC A;  1PBY B;  3E0C A;  4PXW A;  2OK6 A;  3UKU C;  3I7H A;  2YNP A;  3JB9 L;  5KDO B;  2HJ4 A;  5A2Q g;  2AH0 A;  3MZL A;  4GGA A;  5EM2 A;  4NSX A;  2P9S C;  2H6K A;  5CXC B;  3EI1 B;  2BBK H;  3ZWL B;  3MMY A;  4A2L A;  3SFZ A;  4J73 A;  3FGB A;  2HKR A;  4ZOZ A;  3IJ0 A;  3RLM D;  3I7L A;  4GMB A;  4X61 B;  3IJC A;  5THA A;  4XYH A;  4KFM B;  3PXW D;  3GFC A;  2I0R A;  4CI8 A;  3EI4 A;  2W18 A;  5AJA A;  5I5M A;  4IA9 A;  1JJU B;  2IWK A;  1FWX A;  4D6V A;  5IC7 A;  3UVK A;  1B9Y A;  3VA6 A;  2YMU A;  5C2V B;  4HDJ A;  4MK0 B;  3EMH A;  2IUV A;  5C2W B;  4JT5 C;  4IMM A;  3A0F A;  4GQ2 P;  2IUQ A;  4OZU A;  2P9U C;  5EAM A;  5H17 A;  4U7A A;  3JZN A;  2OVP B;  5EMM B;  4E54 A;  3PE7 A;  2XL3 A;  5TDH B;  4PBY A;  1S4U X;  5IGO A;  3C75 H;  4ERY A;  4L3H D;  1MG3 A;  4CI3 A;  2CO0 C;  4J8G A;  4A0B A;  5CXB B;  4ERQ A;  1Q47 A;  1NR0 A;  3BG0 A;  2P9I C;  1N6D A;  3CFS B;  2CNX A;  2OJY A;  1SHY B;  2GC4 A;  4J79 A;  2H9M A;  4H5I A;  3CIK B;  5C9Z B;  2AGW A;  4Y7R A;  5IJ7 E;  1ERJ A;  5AFU 3;  2YBA A;  3SXT D;  4FA1 D;  5HE1 B;  3IJ1 A;  3NVQ A;  4JD2 C;  2HKM A;  3ULE C;  2AQ5 A;  3K26 A;  1YFQ A;  3EI3 B;  5CXC A;  1XKS A;  3K27 A;  3EI1 A;  4ZOV A;  2HYE A;  5I5I A;  1R5M A;  5FKQ A;  2O9K A;  3PXT D;  4O3U B;  4QRJ A;  3DXK C;  4LG9 A;  2GNQ A;  2I3S A;  4GQ1 A;  4Z8L A;  4JSX C;  4BUJ C;  4FWW A;  4O3T B;  1GP2 B;  3SCY A;  5EML B;  5H14 A;  4A11 B;  5K19 A;  3N0E A;  4J0W A;  1XHM A;  1PGU A;  4R7A B;  3PVW B;  4ES0 A;  2AH1 A;  4GGD A;  2TRC B;  2P9P C;  3I89 A;  3PSL A;  2OIZ A;  4CZX A;  3FRX A;  2IWF A;  2PM7 B;  4X63 B;  4LGN A;  4U1E I;  2H9L A;  2Z2P A;  3F3P A;  1U4C A;  2BCJ B;  2CE9 A;  2HXC A;  2B5L A;  3AH8 B;  5CXB A;  3C99 A;  3U4Y A;  3EG6 A;  1GOT B;  4CY3 A;  3I7P A;  2HJB A;  3IIW A;  3RFG A;  4CY1 A;  3V5W B;  2I3T A;  2AGL A;  3C5M A;  2UZY B;  3SVW D;  5I5J A;  3MXX A;  2YNO A;  4H5J A;  3EI2 B;  4QT8 A;  5GXH A;  4E5Z B;  3I8E A;  2QXV A;  4GM8 A;  5TF2 A;  2PM9 B;  3I7O A;  1RI6 A;  3AL9 A;  3EI3 A;  2B4E A;  4J84 A;  2H6N A;  2G9A A;  3KRW B;  2Z2O A;  5FQD A;  5HQG A;  4FA4 D;  4CZV A;  1P22 A;  1MG2 A;  2YB8 B;  4ESG A;  1PEV A;  4JSN C;  3EWE A;  5GMK n;  4A11 A;  3V9F A;  2GC7 A;  3FM0 A;  4UI9 R;  2H9P A;  1JMX B;  5CYK B;  4FAN D;  4A0A B;  3KRX B;  1GG2 B;  3RSE C;  4J82 A;  3JZH A;  3RFH A;  4CY5 A;  4ZOY A;  3AL8 B;  1TBG A;  3UR4 A;  3I8C A;  4J8B A;  2IUR A;  2H13 A;  3N0D A;  3OL2 A;  3W15 A;  1N6E A;  1SQ9 A;  3DSM A;  4CZY A;  2OVR B;  5GXI A;  2IUP A;  4D0K A;  4FA9 D;  4K3J B;  2I0S A;  4O1Q D;  1VYH C;  4AOW A;  3DXM C;  2CN2 A;  3ORV D;  3DWL C;  5FXY A;  3V7D B;  4FA5 D;  5HYN B;  4CI2 A;  3VH0 A;  3OKY B;  5IJ8 E;  3L4M D;  1A0R B;  3I7K A;  2H6Q A;  3I2N A;  2HES X;  4LG8 A;  1OMW B;  2Q7Q A;  1QNI A;  3RMZ D;  3EI2 A;  5EMJ B;  3JAM g;  3UVL A;  4AEZ A;  4PSW B;  4E5Z A;  3SBQ A;  4CI1 A;  4J77 A;  2PM9 A;  2OVQ B;  4J78 A;  2OK4 A;  3SLE D;  4PSX B;  4JSV C;  4A08 B;  4QL1 A;  3ODT A;  2I0T A;  5HE3 B;  3L4O D;  2MTA H;  4XYI A;  5IT9 g;  3OL2 B;  5FKR A;  2H68 A;  3GRE A;  4EWR A;  3BG1 A;  2AGZ A;  3RN1 D;  4PBZ A;  2J56 H;  2PM6 B;  3PVU B;  5CYK A;  3P4F A;  4A0A A;  3UKR C;  3JZG A;  5EMK B;  2XYI A;  1L0Q A;  3F3G A;  5JWZ A;  4JT6 C;  5TEF A;  3AL8 A;  3UVO A;  3UVM A;  3OW8 A;  3CFV A;  4XEI C;  4L3G D;  4ZOX A;  2J57 G;  5IGQ A;  5AMS A;  3JPX A;  4YVD A;  3NVN A;  3I7N A;  3OKW A;  4FHL A;  2CN3 A;  1OLZ A;  4G56 B;  5HE2 B;  2PBI B;  4O9D A;  3SHF A;  4L9O A;  2AGX A;  3SBP A;  4A2M A;  3DM0 A;  3MKQ A;  3OKY A;  4JXM A;  2J55 H;  3UVN A;  5H1M A;  5HE0 B;  4A7J A;  4I79 A;  5EAR A;  2P9L C;  2P9N C;  4Y5R D;  4J81 A;  4J87 A;  3C9C A;  3F3F A;  4GM9 A;  4ERZ A;  3NVX A;  3SWS D;  3J81 g;  2H9N A;  4A09 B;  5K1C C;  4O45 A;  3SMR A;  4A08 A;  3IKO A;  5EAP A;  4N14 A;  2XU7 A;  4X60 B;  1TYQ C;  2YNN A;  4J86 A;  2AGY A;  5EM2 B;  5FA5 B;  3PXS D;  4CC9 A;  3B7F A;  4PC0 A;  3J80 g;  1JOF A;  3SBR A;  1MDA H;  5TEE A;  5GSA A;  3AFC A;  1XIP A;  4BH6 A;  2H47 A;  1GXR A;  3BWS A;  3EI4 B;  3SN6 B;  2XL2 A;  3IIY A;  4PNK B;  1K8K C;  4GQB B;  3RRM C;  4K3I D; 
#chains in the Genus database with same CATH topology
 2IAA A;  4X3E A;  4OWR A;  3EU7 A;  4QQE A;  2G99 A;  2QC5 A;  4FB1 D;  2B5N A;  4RE6 A;  3RN0 D;  5FKT A;  4UM8 A;  5B4W A;  4ZN4 A;  4CY2 A;  3VGZ A;  5FFG A;  2Z2N A;  5FKS A;  4GZ8 A;  5EAL A;  3OTT A;  2EBS A;  4E54 B;  5E6R A;  1U2V C;  2H3X A;  2B5M A;  3JRP A;  3JRO A;  3IJE A;  4L1Q D;  1K32 A;  1N6F A;  3IUN A;  3PSC B;  2UZX B;  3OKT A;  4J0X A;  4WK0 A;  3MKS B;  2P9K C;  3IUJ A;  1JTD B;  1B9X A;  5SXM A;  2CO0 A;  4JSP C;  3MZK A;  4A0B B;  2BKL A;  1SQJ A;  3O4G A;  2H14 A;  1K3I A;  1PI6 A;  4DNU A;  3NIF A;  1VZ2 A;  4AMY A;  5FLX g;  2CE8 A;  3SJL D;  1NEX B;  1H2W A;  4BL0 A;  4A09 A;  4GM3 A;  1E5T A;  3HFQ A;  1JMZ B;  4TZ4 A;  4FAV D;  4GGC A;  4NBM A;  1PBY B;  5FFO A;  2QR5 A;  3E0C A;  4PXW A;  2OK6 A;  3UKU C;  3MUN A;  3I7H A;  2YNP A;  3JB9 L;  5KDO B;  2HJ4 A;  5A2Q g;  4NC4 A;  2AH0 A;  3MZL A;  4GGA A;  5EM2 A;  4NSX A;  2P9S C;  3KCI A;  2H6K A;  5CXC B;  3MUO A;  3EI1 B;  2BBK H;  3ZWL B;  3MMY A;  4A2L A;  3SFZ A;  1UOO A;  4J73 A;  3FGB A;  2HKR A;  2VDO A;  4ZOZ A;  3IJ0 A;  3RLM D;  3I7L A;  4GMB A;  4X61 B;  3IJC A;  5THA A;  3ZDY A;  4XYH A;  4KFM B;  3PXW D;  4D9S A;  5M5R A;  3GFC A;  2I0R A;  4CI8 A;  3EI4 A;  2W18 A;  5AJA A;  5I5M A;  4IA9 A;  1JJU B;  2IWK A;  1FWX A;  3ZDZ A;  4D6V A;  5IC7 A;  3ZE1 A;  3UVK A;  1B9Y A;  3VA6 A;  1UOQ A;  2YMU A;  5C2V B;  4HDJ A;  4MK0 B;  3EMH A;  2IUV A;  5C2W B;  4JT5 C;  4IMM A;  3A0F A;  4GQ2 P;  5M61 A;  2IUQ A;  3DDU A;  4OZU A;  2P9U C;  5EAM A;  5H17 A;  4U7A A;  3JZN A;  5M5V A;  2OVP B;  5EMM B;  4E54 A;  3GD1 I;  3PE7 A;  2XL3 A;  5TDH B;  4PBY A;  2VDP A;  3ZE2 A;  1S4U X;  5IGO A;  3C75 H;  4ERY A;  4L3H D;  2XZG A;  1MG3 A;  1UTC A;  4CI3 A;  2CO0 C;  3K71 A;  4J8G A;  4A0B A;  5CXB B;  5E6S A;  4ERQ A;  1Q47 A;  4WK4 A;  4UM9 A;  1NR0 A;  3BG0 A;  2P9I C;  1N6D A;  3CFS B;  2CNX A;  2EIB A;  1I2M B;  1O6F A;  1SHY B;  1YR2 A;  2OJY A;  2GC4 A;  4J79 A;  2H9M A;  4H5I A;  3CIK B;  5C9Z B;  2AGW A;  4Y7R A;  5IJ7 E;  2VDK A;  4IRZ A;  1ERJ A;  5AFU 3;  1L5G A;  2YBA A;  3SXT D;  2QZP A;  5HE1 B;  4FA1 D;  3IJ1 A;  3NVQ A;  4JD2 C;  2HKM A;  4G1E A;  3ULE C;  2AQ5 A;  3K26 A;  1YFQ A;  3EI3 B;  5CXC A;  1XKS A;  3K27 A;  3EI1 A;  4ZOV A;  2HYE A;  5I5I A;  1R5M A;  5FKQ A;  4JHP C;  2O9K A;  5C86 A;  3PXT D;  4O3U B;  1GOH A;  3DXK C;  4LG9 A;  4QRJ A;  2GNQ A;  2I3S A;  4GQ1 A;  4Z8L A;  4JSX C;  4BUJ C;  2XE4 A;  4FWW A;  4O3T B;  3O4J A;  1GP2 B;  3SCY A;  5EML B;  5H14 A;  4A11 B;  4Z7N A;  5K19 A;  3N0E A;  4J0W A;  1XHM A;  1PGU A;  3OF7 A;  1M1X A;  3K72 A;  4WK2 A;  4R7A B;  5E6U A;  3PVW B;  1GOF A;  4ES0 A;  2AH1 A;  4GGD A;  2TRC B;  2P9P C;  3I89 A;  3PSL A;  2OIZ A;  4JHN A;  1JV2 A;  4CZX A;  4MMX A;  3FRX A;  2IWF A;  2PM7 B;  4X63 B;  4QAM A;  4LGN A;  4U1E I;  2H9L A;  2Z2P A;  3F3P A;  1U4C A;  2BCJ B;  2CE9 A;  2HU7 A;  2HXC A;  4Z7Q A;  2B5L A;  4AMZ A;  3AH8 B;  5CXB A;  5HDB A;  4WJK A;  3C99 A;  3U4Y A;  3EG6 A;  1GOT B;  4G1M A;  4CY3 A;  4O2W A;  3I7P A;  2HJB A;  3IIW A;  3RFG A;  4CY1 A;  3V5W B;  2I3T A;  2VDQ A;  2AGL A;  3C5M A;  2UZY B;  3SVW D;  5I5J A;  3MXX A;  3QI0 A;  2YNO A;  1H2Z A;  4H5J A;  3EI2 B;  4QT8 A;  5GXH A;  4E5Z B;  3I8E A;  2QXV A;  3IUR A;  4GM8 A;  5TF2 A;  2PM9 B;  3I7O A;  1RI6 A;  4DNW A;  3AL9 A;  3EI3 A;  2B4E A;  5C92 A;  4J84 A;  2H6N A;  2G9A A;  4AN1 A;  3KRW B;  2Z2O A;  5FQD A;  5HQG A;  4DNV A;  4FA4 D;  4CZV A;  1P22 A;  1MG2 A;  2YB8 B;  4BCB A;  1QFM A;  1PEV A;  4ESG A;  1TYE A;  3EWE A;  4JSN C;  3ZDX A;  4A11 A;  5GMK n;  3V9F A;  5M5S A;  3IUL A;  4RE5 A;  2GC7 A;  3FM0 A;  4UI9 R;  2H9P A;  1JMX B;  5CYK B;  4FAN D;  3MVD K;  4A0A B;  3FCS A;  3KRX B;  4MMZ A;  1GG2 B;  3RSE C;  2EID A;  4BCD A;  4J82 A;  4G55 A;  3JZH A;  3RFH A;  4CY5 A;  4ZOY A;  3AL8 B;  1TBG A;  3UR4 A;  3I8C A;  4J8B A;  2IUR A;  3FCU A;  1E8M A;  2H13 A;  3QHY B;  3N0D A;  3OL2 A;  3W15 A;  4BP8 A;  1N6E A;  5M5U A;  1SQ9 A;  3DSM A;  4CZY A;  2OVR B;  1H2X A;  5GXI A;  2IUP A;  4D0K A;  4FA9 D;  4K3J B;  2I0S A;  2EIC A;  4O1Q D;  5M5T A;  1QFS A;  1VYH C;  1C9I A;  4AOW A;  3EQ7 A;  3DXM C;  4BP9 A;  3V4P A;  2CN2 A;  3ORV D;  3DWL C;  5FXY A;  1UOP A;  3V7D B;  4FA5 D;  4CI2 A;  5HYN B;  3VH0 A;  3OKY B;  5IJ8 E;  3L4M D;  1A0R B;  4Z7O A;  3I7K A;  2H6Q A;  3I2N A;  1VE6 A;  2HES X;  4LG8 A;  1OMW B;  2Q7Q A;  3V4V A;  1QNI A;  3RMZ D;  3EI2 A;  5EMJ B;  3JAM g;  3UVL A;  4AEZ A;  2WQ8 A;  4PSW B;  4E5Z A;  3SBQ A;  2JKX A;  4CI1 A;  4J77 A;  2PM9 A;  2OVQ B;  4J78 A;  2OK4 A;  3SLE D;  4PSX B;  4JSV C;  4A08 B;  4QL1 A;  3ODT A;  2I0T A;  5HE3 B;  3L4O D;  2MTA H;  4XYI A;  5IT9 g;  3OL2 B;  5FKR A;  2H68 A;  3GRE A;  4EWR A;  3BG1 A;  2AGZ A;  4L1M A;  3RN1 D;  4PBZ A;  2J56 H;  2PM6 B;  3PVU B;  3EQ9 A;  5CYK A;  3P4F A;  4A0A A;  3ZE0 A;  3UKR C;  3JZG A;  2XDW A;  5EMK B;  2VDL A;  2XYI A;  1L0Q A;  3F3G A;  1C9L A;  5JWZ A;  4JT6 C;  5TEF A;  3AL8 A;  3UVO A;  3UVM A;  3NID A;  3OW8 A;  3CFV A;  4NEN A;  4XEI C;  3GC3 B;  4L3G D;  4ZOX A;  2J57 G;  5IGQ A;  5AMS A;  3JPX A;  1E8N A;  4YVD A;  3NVN A;  4O02 A;  3I7N A;  3OKW A;  4FHL A;  2CN3 A;  1OLZ A;  3T3P A;  4G56 B;  5HE2 B;  2PBI B;  4O9D A;  3SHF A;  4L9O A;  2AGX A;  1VZ3 A;  1O6G A;  2VZ3 A;  3SBP A;  2VDN A;  4A2M A;  3DM0 A;  3MKQ A;  3OKY A;  4JXM A;  2J55 H;  3UVN A;  5H1M A;  2HU5 A;  2HU8 A;  1BPO A;  5HE0 B;  4A7J A;  1U8C A;  4I79 A;  4BCC A;  2VZ1 A;  5EAR A;  2P9L C;  2VC2 A;  2P9N C;  4Y5R D;  4J81 A;  4J87 A;  3C9C A;  4AN0 A;  3IUQ A;  4AX4 A;  1VE7 A;  3F3F A;  4GM9 A;  4ERZ A;  3NVX A;  3SWS D;  3J81 g;  2H9N A;  4A09 B;  3VI4 A;  5K1C C;  4O45 A;  3SMR A;  4A08 A;  3IKO A;  5EAP A;  3K6S A;  2EIE A;  4N14 A;  3IUM A;  3NIG A;  2XU7 A;  4X60 B;  4NAA A;  3O4I A;  1TYQ C;  2YNN A;  4J86 A;  1GOG A;  2AGY A;  5EM2 B;  5FA5 B;  3PXS D;  4CC9 A;  3T3M A;  3B7F A;  4PC0 A;  1T2X A;  3J80 g;  2VDR A;  3VI3 A;  1A12 A;  3IVM A;  1JOF A;  3SBR A;  1MDA H;  5TEE A;  5GSA A;  3AFC A;  4MMY A;  1XIP A;  4BH6 A;  2H47 A;  1GXR A;  3BWS A;  3EI4 B;  3SN6 B;  3O4H A;  2XL2 A;  3EQ8 A;  3IIY A;  2VDM A;  4PNK B;  1K8K C;  1H2Y A;  4GQB B;  3RRM C;  4K3I D; 
#chains in the Genus database with same CATH homology
 2IAA A;  4X3E A;  4OWR A;  3EU7 A;  4QQE A;  2G99 A;  2QC5 A;  4FB1 D;  2B5N A;  3RN0 D;  5FKT A;  5B4W A;  4ZN4 A;  4CY2 A;  3VGZ A;  2Z2N A;  5FKS A;  4GZ8 A;  5EAL A;  3OTT A;  2EBS A;  4E54 B;  1U2V C;  2H3X A;  2B5M A;  3JRP A;  3JRO A;  4L1Q D;  1K32 A;  1N6F A;  3PSC B;  2UZX B;  3OKT A;  4J0X A;  3MKS B;  2P9K C;  1B9X A;  5SXM A;  2CO0 A;  4JSP C;  3MZK A;  4A0B B;  1SQJ A;  2H14 A;  1PI6 A;  5FLX g;  2CE8 A;  3SJL D;  1NEX B;  4BL0 A;  4A09 A;  4GM3 A;  4TZ4 A;  3HFQ A;  1JMZ B;  4FAV D;  4GGC A;  1PBY B;  3E0C A;  4PXW A;  2OK6 A;  3UKU C;  3I7H A;  2YNP A;  3JB9 L;  5KDO B;  2HJ4 A;  5A2Q g;  2AH0 A;  3MZL A;  4GGA A;  5EM2 A;  4NSX A;  2P9S C;  2H6K A;  5CXC B;  3EI1 B;  2BBK H;  3ZWL B;  3MMY A;  4A2L A;  3SFZ A;  4J73 A;  3FGB A;  2HKR A;  4ZOZ A;  3IJ0 A;  3RLM D;  3I7L A;  4GMB A;  4X61 B;  3IJC A;  5THA A;  4XYH A;  4KFM B;  3PXW D;  3GFC A;  2I0R A;  4CI8 A;  3EI4 A;  2W18 A;  5AJA A;  5I5M A;  4IA9 A;  1JJU B;  2IWK A;  1FWX A;  4D6V A;  5IC7 A;  3UVK A;  1B9Y A;  3VA6 A;  2YMU A;  5C2V B;  4HDJ A;  4MK0 B;  3EMH A;  2IUV A;  5C2W B;  4JT5 C;  4IMM A;  3A0F A;  4GQ2 P;  2IUQ A;  4OZU A;  2P9U C;  5EAM A;  5H17 A;  4U7A A;  3JZN A;  2OVP B;  5EMM B;  4E54 A;  3PE7 A;  2XL3 A;  5TDH B;  4PBY A;  1S4U X;  5IGO A;  3C75 H;  4ERY A;  4L3H D;  1MG3 A;  4CI3 A;  2CO0 C;  4J8G A;  4A0B A;  5CXB B;  4ERQ A;  1Q47 A;  1NR0 A;  3BG0 A;  2P9I C;  1N6D A;  3CFS B;  2CNX A;  2OJY A;  1SHY B;  2GC4 A;  4J79 A;  2H9M A;  4H5I A;  3CIK B;  5C9Z B;  2AGW A;  4Y7R A;  5IJ7 E;  1ERJ A;  5AFU 3;  2YBA A;  3SXT D;  4FA1 D;  5HE1 B;  3IJ1 A;  3NVQ A;  4JD2 C;  2HKM A;  3ULE C;  2AQ5 A;  3K26 A;  1YFQ A;  3EI3 B;  5CXC A;  1XKS A;  3K27 A;  3EI1 A;  4ZOV A;  2HYE A;  5I5I A;  1R5M A;  5FKQ A;  2O9K A;  3PXT D;  4O3U B;  4QRJ A;  3DXK C;  4LG9 A;  2GNQ A;  2I3S A;  4GQ1 A;  4Z8L A;  4JSX C;  4BUJ C;  4FWW A;  4O3T B;  1GP2 B;  3SCY A;  5EML B;  5H14 A;  4A11 B;  5K19 A;  3N0E A;  4J0W A;  1XHM A;  1PGU A;  4R7A B;  3PVW B;  4ES0 A;  2AH1 A;  4GGD A;  2TRC B;  2P9P C;  3I89 A;  3PSL A;  2OIZ A;  4CZX A;  3FRX A;  2IWF A;  2PM7 B;  4X63 B;  4LGN A;  4U1E I;  2H9L A;  2Z2P A;  3F3P A;  1U4C A;  2BCJ B;  2CE9 A;  2HXC A;  2B5L A;  3AH8 B;  5CXB A;  3C99 A;  3U4Y A;  3EG6 A;  1GOT B;  4CY3 A;  3I7P A;  2HJB A;  3IIW A;  3RFG A;  4CY1 A;  3V5W B;  2I3T A;  2AGL A;  3C5M A;  2UZY B;  3SVW D;  5I5J A;  3MXX A;  2YNO A;  4H5J A;  3EI2 B;  4QT8 A;  5GXH A;  4E5Z B;  3I8E A;  2QXV A;  4GM8 A;  5TF2 A;  2PM9 B;  3I7O A;  1RI6 A;  3AL9 A;  3EI3 A;  2B4E A;  4J84 A;  2H6N A;  2G9A A;  3KRW B;  2Z2O A;  5FQD A;  5HQG A;  4FA4 D;  4CZV A;  1P22 A;  1MG2 A;  2YB8 B;  4ESG A;  1PEV A;  4JSN C;  3EWE A;  5GMK n;  4A11 A;  3V9F A;  2GC7 A;  3FM0 A;  4UI9 R;  2H9P A;  1JMX B;  5CYK B;  4FAN D;  4A0A B;  3KRX B;  1GG2 B;  3RSE C;  4J82 A;  3JZH A;  3RFH A;  4CY5 A;  4ZOY A;  3AL8 B;  1TBG A;  3UR4 A;  3I8C A;  4J8B A;  2IUR A;  2H13 A;  3N0D A;  3OL2 A;  3W15 A;  1N6E A;  1SQ9 A;  3DSM A;  4CZY A;  2OVR B;  5GXI A;  2IUP A;  4D0K A;  4FA9 D;  4K3J B;  2I0S A;  4O1Q D;  1VYH C;  4AOW A;  3DXM C;  2CN2 A;  3ORV D;  3DWL C;  5FXY A;  3V7D B;  4FA5 D;  5HYN B;  4CI2 A;  3VH0 A;  3OKY B;  5IJ8 E;  3L4M D;  1A0R B;  3I7K A;  2H6Q A;  3I2N A;  2HES X;  4LG8 A;  1OMW B;  2Q7Q A;  1QNI A;  3RMZ D;  3EI2 A;  5EMJ B;  3JAM g;  3UVL A;  4AEZ A;  4PSW B;  4E5Z A;  3SBQ A;  4CI1 A;  4J77 A;  2PM9 A;  2OVQ B;  4J78 A;  2OK4 A;  3SLE D;  4PSX B;  4JSV C;  4A08 B;  4QL1 A;  3ODT A;  2I0T A;  5HE3 B;  3L4O D;  2MTA H;  4XYI A;  5IT9 g;  3OL2 B;  5FKR A;  2H68 A;  3GRE A;  4EWR A;  3BG1 A;  2AGZ A;  3RN1 D;  4PBZ A;  2J56 H;  2PM6 B;  3PVU B;  5CYK A;  3P4F A;  4A0A A;  3UKR C;  3JZG A;  5EMK B;  2XYI A;  1L0Q A;  3F3G A;  5JWZ A;  4JT6 C;  5TEF A;  3AL8 A;  3UVO A;  3UVM A;  3OW8 A;  3CFV A;  4XEI C;  4L3G D;  4ZOX A;  2J57 G;  5IGQ A;  5AMS A;  3JPX A;  4YVD A;  3NVN A;  3I7N A;  3OKW A;  4FHL A;  2CN3 A;  1OLZ A;  4G56 B;  5HE2 B;  2PBI B;  4O9D A;  3SHF A;  4L9O A;  2AGX A;  3SBP A;  4A2M A;  3DM0 A;  3MKQ A;  3OKY A;  4JXM A;  2J55 H;  3UVN A;  5H1M A;  5HE0 B;  4A7J A;  4I79 A;  5EAR A;  2P9L C;  2P9N C;  4Y5R D;  4J81 A;  4J87 A;  3C9C A;  3F3F A;  4GM9 A;  4ERZ A;  3NVX A;  3SWS D;  3J81 g;  2H9N A;  4A09 B;  5K1C C;  4O45 A;  3SMR A;  4A08 A;  3IKO A;  5EAP A;  4N14 A;  2XU7 A;  4X60 B;  1TYQ C;  2YNN A;  4J86 A;  2AGY A;  5EM2 B;  5FA5 B;  3PXS D;  4CC9 A;  3B7F A;  4PC0 A;  3J80 g;  1JOF A;  3SBR A;  1MDA H;  5TEE A;  5GSA A;  3AFC A;  1XIP A;  4BH6 A;  2H47 A;  1GXR A;  3BWS A;  3EI4 B;  3SN6 B;  2XL2 A;  3IIY A;  4PNK B;  1K8K C;  4GQB B;  3RRM C;  4K3I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...