2B5NA

Crystal structure of the ddb1 bpb domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
316
structure length
312
Chain Sequence
b'NGIGIHEHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords damage-specific DNA binding protein 1
molecule tags Dna binding protein/protein binding
source organism Homo sapiens
publication title Structure of DDB1 in complex with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase.
pubmed doi rcsb
total genus 52
structure length 312
sequence length 316
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b5nA00
5EAPA 5CXBA 3OKYB 1TYQC 2XL2A 3K26A 2IWFA 5EMKB 1YFQA 4GM3A 2OK6A 5H1MA 3VGZA 2P9NC 4Y7RA 3SBPA 2AGYA 4JXMA 5GSAA 2H9NA 3I7KA 3AL8B 4LGNA 3UVOA 3EU7A 2I0SA 3DXKC 4O1QD 5IC7A 3SN6B 3SBRA 3OTTA 4QT8A 3RFHA 4GM8A 5AFU3 3EI3A 2PM7B 3MXXA 4YVDA 3B7FA 3JZNA 3AFCA 4QQEA 3BWSA 5EMLB 3JZGA 3SCYA 5K19A 2P9UC 3SFZA 1N6EA 3DM0A 3FRXA 3IJCA 5FKRA 2Z2OA 3RSEC 5I5MA 4PXWA 3DXMC 3RN0D 3V5WB 4E5ZB 3J80g 5K1CC 2HXCA 1Q47A 3IIYA 1N6FA 2YNPA 2PM9A 3GFCA 4L1QD 3OW8A 4HDJA 4KFMB 5IJ7E 4L9OA 4E54B 2B4EA 3EWEA 2CNXA 3EI4B 4A0AA 1K8KC 2G9AA 3SMRA 4GGDA 4ESGA 4A09A 5EMJB 4FB1D 1A0RB 2OVPB 5GMKn 5AJAA 4PNKB 4JT5C 4O45A 3OKWA 4OWRA 3N0DA 3UR4A 3W15A 3AL8A 5FA5B 1MDAH 3AL9A 4AEZA 4A0BB 3I7NA 4FA5D 2HKRA 3CFVA 3C9CA 1K32A 2AH0A 2B5MA 5IT9g 3OL2B 4J8BA 3RMZD 3MMYA 3PE7A 4ES0A 3CFSB 3C75H 4FA9D 5HE0B 3U4YA 3JRPA 3PVWB 5B4WA 4BL0A 1U4CA 4FA4D 1OMWB 4CY5A 1QNIA 4PBYA 2GNQA 3PVUB 4ERQA 2AQ5A 1U2VC 4U1EI 3EI2B 1PEVA 3ULEC 4A08B 3EMHA 4GGAA 2AGZA 2YNNA 3IIWA 4A11B 4CI2A 4J78A 4IMMA 3AH8B 4R7AB 2P9KC 4O3UB 4JT6C 3EI4A 3SVWD 4LG9A 2QXVA 2Z2NA 4K3ID 5CXCB 3JPXA 1ERJA 1XIPA 4XEIC 5FQDA 1SQJA 1PI6A 4BUJC 5IJ8E 2CO0C 2IURA 1TBGA 4O3TB 4XYHA 5HQGA 5SXMA 4A2LA 1NEXB 5C2VB 4L3GD 4AOWA 4JSNC 4N14A 4NSXA 2YB8B 5TEFA 4OZUA 4A7JA 3F3FA 3PSCB 3VA6A 1JMXB 2G99A 4GQ1A 4UI9R 3I2NA 1B9YA 4QRJA 3I7HA 4L3HD 3RN1D 2P9SC 5HE2B 3PXSD 3EI1B 5CYKA 3ODTA 3J81g 4ZOXA 4A0BA 4CI1A 4H5JA 3E0CA 4EWRA 2H6KA 4CY1A 4CC9A 3JAMg 2H14A 4U7AA 4MK0B 3P4FA 3JROA 2AGWA 5FXYA 2H13A 2HKMA 5EM2A 5CXCA 1B9XA 4CZVA 5EM2B 4J79A 2I0TA 3KRXB 4JSPC 5EAMA 4J84A 2H9PA 4J82A 1P22A 2J57G 3UVNA 2GC4A 2H68A 2GC7A 3PXTD 5IGOA 5EALA 5KDOB 2J55H 3EI2A 4I79A 4A08A 2YNOA 4CZYA 3I7PA 3BG0A 2I3SA 3V9FA 4O9DA 5TDHB 4J0WA 5A2Qg 3IJ0A 2CE9A 1GP2B 2OVRB 5CYKB 3UVLA 3VH0A 3UKUC 5FKSA 5FLXg 2H9LA 2IUQA 1VYHC 1JMZB 4IA9A 1XHMA 3RFGA 4J73A 2MTAH 4J77A 3L4OD 3UVKA 2I3TA 2BBKH 2IAAA 4ERZA 2HESX 2IUPA 3K27A 4PSWB 5HE3B 2Z2PA 2OVQB 2H47A 3N0EA 2CN2A 2YMUA 4ZOYA 4FAVD 3SXTD 2I0RA 3BG1A 4GQ2P 3PXWD 4J87A 4FWWA 4ZOZA 5GXIA 5TF2A 4CY3A 5H17A 3FGBA 3KRWB 3A0FA 4J0XA 4JSXC 4E54A 3NVNA 4A0AB 3RRMC 3ZWLB 1R5MA 3MKSB 3OL2A 4BH6A 4J81A 5I5IA 2AGLA 2UZXB 2CE8A 3NVXA 4J86A 4GM9A 2TRCB 4JSVC 5EARA 2XU7A 3EG6A 2OK4A 5IGQA 5EMMB 1PGUA 2EBSA 4QL1A 2CN3A 4X63B 3MKQA 4PSXB 2HJ4A 4Y5RD 5C2WB 4X3EA 3UVMA 2XYIA 1JJUB 4CZXA 2H3XA 3FM0A 2IWKA 4LG8A 2HYEA 4CI8A 3C99A 2P9IC 2B5LA 3EI3B 3ORVD 2AH1A 1MG3A 5GXHA 3DWLC 1S4UX 2J56H 2OIZA 4A2MA 4GMBA 1XKSA 5H14A 4CI3A 2YBAA 4PC0A 1N6DA 3I7OA 3C5MA 1JOFA 5CXBB 2PM6B 5THAA 4A09B 3I8EA 4H5IA 1SHYB 4ZOVA 5TEEA 2W18A 5C9ZB 3MZKA 3F3GA 1NR0A 3RLMD 3DSMA 2HJBA 1GXRA 4TZ4A 4D0KA 2OJYA 3UKRC 3JZHA 3SBQA 2B5NA 5HYNB 3EI1A 4J8GA 3SWSD 3I89A 4A11A 4D6VA 4GQBB 1PBYB 5AMSA 4FA1D 2BCJB 1RI6A 3OKYA 1L0QA 4G56B 4GGCA 1GOTB 4X60B 2UZYB 4FAND 3L4MD 3IKOA 4PBZA 4K3JB 3JB9L 2O9KA 4Z8LA 5HE1B 1MG2A 2P9LC 4XYIA 2P9PC 2XL3A 3HFQA 2AGXA 1OLZA 3I8CA 2H9MA 2QC5A 2PBIB 3I7LA 5JWZA 3SHFA 2CO0A 5FKQA 3SJLD 1GG2B 1SQ9A 3F3PA 3SLED 3CIKB 3PSLA 5I5JA 3IJ1A 2H6NA 4FHLA 4JD2C 2PM9B 4GZ8A 4E5ZA 2H6QA 4X61B 4ZN4A 4ERYA 3OKTA 5FKTA 4CY2A 3V7DB 3MZLA 2IUVA 1FWXA 3NVQA 2Q7QA 3GREA
chains in the Genus database with same CATH superfamily
5E6UA 5EAPA 3KCIA 2VDLA 3OKYB 5CXBA 1TYQC 1VZ2A 2XL2A 3K26A 4AN0A 4D9SA 2IWFA 5EMKB 1YFQA 4GM3A 2OK6A 5H1MA 3VGZA 2P9NC 4Y7RA 3SBPA 2AGYA 4JXMA 1E8NA 1UOPA 5GSAA 2VDRA 2EICA 2H9NA 3I7KA 5FFGA 3GD1I 1C9LA 3AL8B 4LGNA 3UVOA 1C9IA 3EU7A 3ZDZA 2I0SA 3DXKC 4O1QD 5IC7A 3SN6B 1U8CA 3SBRA 1GOFA 3OTTA 5C92A 4QT8A 4Z7QA 3RFHA 4GM8A 5AFU3 3EI3A 2VDQA 3IUNA 2PM7B 4NENA 3MXXA 4YVDA 1T2XA 3B7FA 3ZDXA 3JZNA 3AFCA 4QQEA 4AX4A 3BWSA 3QI0A 5EMLB 3JZGA 3SCYA 5K19A 2P9UC 3SFZA 1N6EA 3DM0A 3FRXA 3IJCA 5FKRA 4G55A 2Z2OA 3RSEC 3IVMA 5I5MA 4PXWA 3DXMC 3RN0D 3V5WB 4E5ZB 3NIGA 3J80g 1QFSA 2EIBA 2WQ8A 5K1CC 1O6FA 1Q47A 2HXCA 3IIYA 1N6FA 2VDOA 2YNPA 1YR2A 2PM9A 4G1EA 3GFCA 4L1QD 3OW8A 3MUNA 1O6GA 4HDJA 4KFMB 5IJ7E 3GC3B 2VZ3A 4L9OA 4E54B 2B4EA 5E6SA 3EWEA 4O2WA 2CNXA 3EI4B 4A0AA 1K8KC 2G9AA 3SMRA 4GGDA 4ESGA 1VE7A 4A09A 3O4GA 5EMJB 1A0RB 2OVPB 4FB1D 3K6SA 5GMKn 5AJAA 4PNKB 3NIFA 3IUMA 1I2MB 4JT5C 4O45A 4DNUA 2QR5A 1H2XA 3OKWA 4OWRA 3N0DA 3T3PA 3UR4A 3W15A 3AL8A 5FA5B 1MDAH 1BPOA 3AL9A 4AEZA 4A0BB 4NAAA 3I7NA 4FA5D 2HKRA 3CFVA 3C9CA 3K72A 1K32A 2AH0A 2B5MA 5IT9g 3OL2B 4J8BA 4WK2A 3MMYA 3RMZD 3PE7A 4ES0A 3DDUA 3CFSB 3V4VA 3C75H 4FA9D 5HE0B 3U4YA 3JRPA 3PVWB 3ZDYA 5B4WA 2BKLA 1U4CA 4BL0A 4FA4D 1OMWB 4UM9A 4CY5A 1QNIA 4PBYA 2GNQA 3PVUB 4ERQA 2AQ5A 1U2VC 4U1EI 3EI2B 1PEVA 3ULEC 4A08B 3EMHA 2QZPA 4GGAA 2AGZA 2YNNA 3IIWA 4A11B 4CI2A 4J78A 4IMMA 3MVDK 3AH8B 4R7AB 2P9KC 4O3UB 4JT6C 3EI4A 3SVWD 4LG9A 2QXVA 4NBMA 2Z2NA 4K3ID 5CXCB 3JPXA 1VZ3A 1ERJA 1XIPA 3O4HA 4XEIC 5FQDA 1VE6A 1SQJA 1PI6A 4BUJC 5IJ8E 2CO0C 2IURA 1TBGA 4NC4A 4O3TB 4XYHA 5HQGA 5SXMA 4A2LA 2HU5A 1NEXB 5C2VB 4L3GD 4AOWA 4JSNC 2EIDA 4N14A 4NSXA 2YB8B 5TEFA 4OZUA 5C86A 1M1XA 4A7JA 4O02A 3F3FA 3PSCB 3VA6A 4JHPC 1JMXB 2G99A 4GQ1A 4UI9R 3T3MA 4BP8A 3I2NA 1B9YA 4QRJA 3I7HA 4L3HD 3RN1D 2P9SC 3OF7A 3PXSD 5HE2B 3EI1B 5CYKA 2VDMA 1L5GA 3ODTA 3J81g 4ZOXA 4A0BA 4CI1A 4H5JA 4WK4A 3E0CA 3VI3A 4EWRA 2H6KA 4CY1A 4CC9A 3JAMg 2H14A 4U7AA 4BCCA 4MK0B 3P4FA 3JROA 2AGWA 5FXYA 2H13A 2HKMA 4UM8A 5EM2A 5M5UA 4DNWA 5CXCA 1B9XA 4CZVA 5EM2B 4J79A 2I0TA 3KRXB 1GOGA 4JSPC 5EAMA 4J84A 4MMYA 2H9PA 4J82A 1P22A 2J57G 3UVNA 2GC4A 4IRZA 2H68A 2GC7A 3PXTD 1H2ZA 5IGOA 5EALA 1H2YA 5KDOB 2J55H 3EI2A 4I79A 4A08A 2YNOA 4BCBA 4CZYA 1TYEA 3I7PA 3BG0A 2I3SA 3V9FA 3FCUA 4O9DA 2JKXA 4BCDA 5TDHB 4J0WA 5A2Qg 3IJ0A 2CE9A 1GP2B 2OVRB 5CYKB 3UVLA 3VH0A 3UKUC 5FKSA 3IUQA 5FLXg 2H9LA 2IUQA 1VYHC 1JMZB 4IA9A 4Z7OA 1XHMA 3ZE2A 3RFGA 4J73A 2MTAH 4J77A 3L4OD 2XDWA 5M5RA 3UVKA 2I3TA 2BBKH 2IAAA 4ERZA 2HESX 2IUPA 3K27A 4PSWB 5HE3B 2Z2PA 2OVQB 2H47A 2XE4A 3N0EA 2CN2A 2YMUA 4ZOYA 2VDPA 4FAVD 3SXTD 5FFOA 4AMZA 2I0RA 4BP9A 3BG1A 3QHYB 4GQ2P 3PXWD 4J87A 4FWWA 4ZOZA 3FCSA 5GXIA 5TF2A 4CY3A 5H17A 3FGBA 4AMYA 3KRWB 2VDKA 3A0FA 4J0XA 4JSXC 4WJKA 4E54A 3NVNA 3IUJA 4A0AB 1H2WA 3RRMC 1JTDB 3ZWLB 1R5MA 2XZGA 3O4JA 3MKSB 3OL2A 4BH6A 4J81A 3IURA 4AN1A 5I5IA 2AGLA 2UZXB 1A12A 2CE8A 3NVXA 4J86A 4GM9A 4DNVA 2TRCB 4JSVC 5EARA 2XU7A 3EG6A 2OK4A 5IGQA 4RE6A 5EMMB 1PGUA 3EQ8A 2EBSA 3EQ7A 4QL1A 2CN3A 4X63B 2HU8A 3MKQA 4PSXB 2HJ4A 4Y5RD 5C2WB 4X3EA 3UVMA 2XYIA 1JJUB 4CZXA 2H3XA 1JV2A 3FM0A 3K71A 2IWKA 3MUOA 4LG8A 2HYEA 4CI8A 3C99A 3IULA 2P9IC 2B5LA 3EI3B 3ORVD 4RE5A 2AH1A 1MG3A 2VDNA 3ZE0A 5GXHA 4L1MA 3DWLC 1S4UX 2J56H 2OIZA 4A2MA 4GMBA 4MMXA 3VI4A 3NIDA 1XKSA 5H14A 4CI3A 2YBAA 4PC0A 1N6DA 3I7OA 4Z7NA 3C5MA 1JOFA 5CXBB 3IJEA 2PM6B 5THAA 4A09B 3I8EA 4H5IA 1SHYB 4ZOVA 5TEEA 2W18A 5C9ZB 3MZKA 3F3GA 1NR0A 3RLMD 3DSMA 2HJBA 1GXRA 4TZ4A 4G1MA 4D0KA 2OJYA 1K3IA 2VC2A 3UKRC 3JZHA 3SBQA 2B5NA 5HYNB 3ZE1A 4J8GA 3EI1A 3SWSD 3I89A 4A11A 4D6VA 4GQBB 1PBYB 4MMZA 1E5TA 5AMSA 1UTCA 4FA1D 2BCJB 4WK0A 5HDBA 1RI6A 3OKYA 5E6RA 4G56B 1L0QA 4GGCA 1GOTB 4X60B 2UZYB 4FAND 3L4MD 3IKOA 4PBZA 4K3JB 3JB9L 2O9KA 4Z8LA 5HE1B 1MG2A 2EIEA 2VZ1A 2P9LC 4JHNA 4XYIA 3HFQA 2P9PC 2XL3A 1UOQA 1E8MA 2AGXA 1OLZA 3I8CA 1QFMA 5M5VA 2H9MA 2QC5A 1GOHA 2PBIB 3I7LA 5JWZA 3SHFA 2CO0A 5FKQA 3SJLD 5M5TA 1GG2B 1SQ9A 3F3PA 3SLED 3CIKB 3O4IA 3PSLA 5I5JA 1UOOA 3IJ1A 5M61A 2H6NA 4FHLA 4JD2C 2PM9B 4GZ8A 4E5ZA 2H6QA 5M5SA 4X61B 4ZN4A 4ERYA 3OKTA 5FKTA 4CY2A 3V7DB 3V4PA 2HU7A 3EQ9A 3MZLA 2IUVA 1FWXA 3NVQA 2Q7QA 3GREA 4QAMA
chains in the Genus database with same CATH topology
5EAPA 5CXBA 3OKYB 1TYQC 2XL2A 3K26A 2IWFA 5EMKB 1YFQA 4GM3A 2OK6A 5H1MA 3VGZA 2P9NC 4Y7RA 3SBPA 2AGYA 4JXMA 5GSAA 2H9NA 3I7KA 3AL8B 4LGNA 3UVOA 3EU7A 2I0SA 3DXKC 4O1QD 5IC7A 3SN6B 3SBRA 3OTTA 4QT8A 3RFHA 4GM8A 5AFU3 3EI3A 2PM7B 3MXXA 4YVDA 3B7FA 3JZNA 3AFCA 4QQEA 3BWSA 5EMLB 3JZGA 3SCYA 5K19A 2P9UC 3SFZA 1N6EA 3DM0A 3FRXA 3IJCA 5FKRA 2Z2OA 3RSEC 5I5MA 4PXWA 3DXMC 3RN0D 3V5WB 4E5ZB 3J80g 5K1CC 2HXCA 1Q47A 3IIYA 1N6FA 2YNPA 2PM9A 3GFCA 4L1QD 3OW8A 4HDJA 4KFMB 5IJ7E 4L9OA 4E54B 2B4EA 3EWEA 2CNXA 3EI4B 4A0AA 1K8KC 2G9AA 3SMRA 4GGDA 4ESGA 4A09A 5EMJB 4FB1D 1A0RB 2OVPB 5GMKn 5AJAA 4PNKB 4JT5C 4O45A 3OKWA 4OWRA 3N0DA 3UR4A 3W15A 3AL8A 5FA5B 1MDAH 3AL9A 4AEZA 4A0BB 3I7NA 4FA5D 2HKRA 3CFVA 3C9CA 1K32A 2AH0A 2B5MA 5IT9g 3OL2B 4J8BA 3RMZD 3MMYA 3PE7A 4ES0A 3CFSB 3C75H 4FA9D 5HE0B 3U4YA 3JRPA 3PVWB 5B4WA 4BL0A 1U4CA 4FA4D 1OMWB 4CY5A 1QNIA 4PBYA 2GNQA 3PVUB 4ERQA 2AQ5A 1U2VC 4U1EI 3EI2B 1PEVA 3ULEC 4A08B 3EMHA 4GGAA 2AGZA 2YNNA 3IIWA 4A11B 4CI2A 4J78A 4IMMA 3AH8B 4R7AB 2P9KC 4O3UB 4JT6C 3EI4A 3SVWD 4LG9A 2QXVA 2Z2NA 4K3ID 5CXCB 3JPXA 1ERJA 1XIPA 4XEIC 5FQDA 1SQJA 1PI6A 4BUJC 5IJ8E 2CO0C 2IURA 1TBGA 4O3TB 4XYHA 5HQGA 5SXMA 4A2LA 1NEXB 5C2VB 4L3GD 4AOWA 4JSNC 4N14A 4NSXA 2YB8B 5TEFA 4OZUA 4A7JA 3F3FA 3PSCB 3VA6A 1JMXB 2G99A 4GQ1A 4UI9R 3I2NA 1B9YA 4QRJA 3I7HA 4L3HD 3RN1D 2P9SC 5HE2B 3PXSD 3EI1B 5CYKA 3ODTA 3J81g 4ZOXA 4A0BA 4CI1A 4H5JA 3E0CA 4EWRA 2H6KA 4CY1A 4CC9A 3JAMg 2H14A 4U7AA 4MK0B 3P4FA 3JROA 2AGWA 5FXYA 2H13A 2HKMA 5EM2A 5CXCA 1B9XA 4CZVA 5EM2B 4J79A 2I0TA 3KRXB 4JSPC 5EAMA 4J84A 2H9PA 4J82A 1P22A 2J57G 3UVNA 2GC4A 2H68A 2GC7A 3PXTD 5IGOA 5EALA 5KDOB 2J55H 3EI2A 4I79A 4A08A 2YNOA 4CZYA 3I7PA 3BG0A 2I3SA 3V9FA 4O9DA 5TDHB 4J0WA 5A2Qg 3IJ0A 2CE9A 1GP2B 2OVRB 5CYKB 3UVLA 3VH0A 3UKUC 5FKSA 5FLXg 2H9LA 2IUQA 1VYHC 1JMZB 4IA9A 1XHMA 3RFGA 4J73A 2MTAH 4J77A 3L4OD 3UVKA 2I3TA 2BBKH 2IAAA 4ERZA 2HESX 2IUPA 3K27A 4PSWB 5HE3B 2Z2PA 2OVQB 2H47A 3N0EA 2CN2A 2YMUA 4ZOYA 4FAVD 3SXTD 2I0RA 3BG1A 4GQ2P 3PXWD 4J87A 4FWWA 4ZOZA 5GXIA 5TF2A 4CY3A 5H17A 3FGBA 3KRWB 3A0FA 4J0XA 4JSXC 4E54A 3NVNA 4A0AB 3RRMC 3ZWLB 1R5MA 3MKSB 3OL2A 4BH6A 4J81A 5I5IA 2AGLA 2UZXB 2CE8A 3NVXA 4J86A 4GM9A 2TRCB 4JSVC 5EARA 2XU7A 3EG6A 2OK4A 5IGQA 5EMMB 1PGUA 2EBSA 4QL1A 2CN3A 4X63B 3MKQA 4PSXB 2HJ4A 4Y5RD 5C2WB 4X3EA 3UVMA 2XYIA 1JJUB 4CZXA 2H3XA 3FM0A 2IWKA 4LG8A 2HYEA 4CI8A 3C99A 2P9IC 2B5LA 3EI3B 3ORVD 2AH1A 1MG3A 5GXHA 3DWLC 1S4UX 2J56H 2OIZA 4A2MA 4GMBA 1XKSA 5H14A 4CI3A 2YBAA 4PC0A 1N6DA 3I7OA 3C5MA 1JOFA 5CXBB 2PM6B 5THAA 4A09B 3I8EA 4H5IA 1SHYB 4ZOVA 5TEEA 2W18A 5C9ZB 3MZKA 3F3GA 1NR0A 3RLMD 3DSMA 2HJBA 1GXRA 4TZ4A 4D0KA 2OJYA 3UKRC 3JZHA 3SBQA 2B5NA 5HYNB 3EI1A 4J8GA 3SWSD 3I89A 4A11A 4D6VA 4GQBB 1PBYB 5AMSA 4FA1D 2BCJB 1RI6A 3OKYA 1L0QA 4G56B 4GGCA 1GOTB 4X60B 2UZYB 4FAND 3L4MD 3IKOA 4PBZA 4K3JB 3JB9L 2O9KA 4Z8LA 5HE1B 1MG2A 2P9LC 4XYIA 2P9PC 2XL3A 3HFQA 2AGXA 1OLZA 3I8CA 2H9MA 2QC5A 2PBIB 3I7LA 5JWZA 3SHFA 2CO0A 5FKQA 3SJLD 1GG2B 1SQ9A 3F3PA 3SLED 3CIKB 3PSLA 5I5JA 3IJ1A 2H6NA 4FHLA 4JD2C 2PM9B 4GZ8A 4E5ZA 2H6QA 4X61B 4ZN4A 4ERYA 3OKTA 5FKTA 4CY2A 3V7DB 3MZLA 2IUVA 1FWXA 3NVQA 2Q7QA 3GREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAP A;  5CXB A;  3OKY B;  1TYQ C;  2XL2 A;  3K26 A;  2IWF A;  5EMK B;  1YFQ A;  4GM3 A;  2OK6 A;  5H1M A;  3VGZ A;  2P9N C;  4Y7R A;  3SBP A;  2AGY A;  4JXM A;  5GSA A;  2H9N A;  3I7K A;  3AL8 B;  4LGN A;  3UVO A;  3EU7 A;  2I0S A;  3DXK C;  4O1Q D;  5IC7 A;  3SN6 B;  3SBR A;  3OTT A;  4QT8 A;  3RFH A;  4GM8 A;  5AFU 3;  3EI3 A;  2PM7 B;  3MXX A;  4YVD A;  3B7F A;  3JZN A;  3AFC A;  4QQE A;  3BWS A;  5EML B;  3JZG A;  3SCY A;  5K19 A;  2P9U C;  3SFZ A;  1N6E A;  3DM0 A;  3FRX A;  3IJC A;  5FKR A;  2Z2O A;  3RSE C;  5I5M A;  4PXW A;  3DXM C;  3RN0 D;  3V5W B;  4E5Z B;  3J80 g;  5K1C C;  2HXC A;  1Q47 A;  3IIY A;  1N6F A;  2YNP A;  2PM9 A;  3GFC A;  4L1Q D;  3OW8 A;  4HDJ A;  4KFM B;  5IJ7 E;  4L9O A;  4E54 B;  2B4E A;  3EWE A;  2CNX A;  3EI4 B;  4A0A A;  1K8K C;  2G9A A;  3SMR A;  4GGD A;  4ESG A;  4A09 A;  5EMJ B;  4FB1 D;  1A0R B;  2OVP B;  5GMK n;  5AJA A;  4PNK B;  4JT5 C;  4O45 A;  3OKW A;  4OWR A;  3N0D A;  3UR4 A;  3W15 A;  3AL8 A;  5FA5 B;  1MDA H;  3AL9 A;  4AEZ A;  4A0B B;  3I7N A;  4FA5 D;  2HKR A;  3CFV A;  3C9C A;  1K32 A;  2AH0 A;  2B5M A;  5IT9 g;  3OL2 B;  4J8B A;  3RMZ D;  3MMY A;  3PE7 A;  4ES0 A;  3CFS B;  3C75 H;  4FA9 D;  5HE0 B;  3U4Y A;  3JRP A;  3PVW B;  5B4W A;  4BL0 A;  1U4C A;  4FA4 D;  1OMW B;  4CY5 A;  1QNI A;  4PBY A;  2GNQ A;  3PVU B;  4ERQ A;  2AQ5 A;  1U2V C;  4U1E I;  3EI2 B;  1PEV A;  3ULE C;  4A08 B;  3EMH A;  4GGA A;  2AGZ A;  2YNN A;  3IIW A;  4A11 B;  4CI2 A;  4J78 A;  4IMM A;  3AH8 B;  4R7A B;  2P9K C;  4O3U B;  4JT6 C;  3EI4 A;  3SVW D;  4LG9 A;  2QXV A;  2Z2N A;  4K3I D;  5CXC B;  3JPX A;  1ERJ A;  1XIP A;  4XEI C;  5FQD A;  1SQJ A;  1PI6 A;  4BUJ C;  5IJ8 E;  2CO0 C;  2IUR A;  1TBG A;  4O3T B;  4XYH A;  5HQG A;  5SXM A;  4A2L A;  1NEX B;  5C2V B;  4L3G D;  4AOW A;  4JSN C;  4N14 A;  4NSX A;  2YB8 B;  5TEF A;  4OZU A;  4A7J A;  3F3F A;  3PSC B;  3VA6 A;  1JMX B;  2G99 A;  4GQ1 A;  4UI9 R;  3I2N A;  1B9Y A;  4QRJ A;  3I7H A;  4L3H D;  3RN1 D;  2P9S C;  5HE2 B;  3PXS D;  3EI1 B;  5CYK A;  3ODT A;  3J81 g;  4ZOX A;  4A0B A;  4CI1 A;  4H5J A;  3E0C A;  4EWR A;  2H6K A;  4CY1 A;  4CC9 A;  3JAM g;  2H14 A;  4U7A A;  4MK0 B;  3P4F A;  3JRO A;  2AGW A;  5FXY A;  2H13 A;  2HKM A;  5EM2 A;  5CXC A;  1B9X A;  4CZV A;  5EM2 B;  4J79 A;  2I0T A;  3KRX B;  4JSP C;  5EAM A;  4J84 A;  2H9P A;  4J82 A;  1P22 A;  2J57 G;  3UVN A;  2GC4 A;  2H68 A;  2GC7 A;  3PXT D;  5IGO A;  5EAL A;  5KDO B;  2J55 H;  3EI2 A;  4I79 A;  4A08 A;  2YNO A;  4CZY A;  3I7P A;  3BG0 A;  2I3S A;  3V9F A;  4O9D A;  5TDH B;  4J0W A;  5A2Q g;  3IJ0 A;  2CE9 A;  1GP2 B;  2OVR B;  5CYK B;  3UVL A;  3VH0 A;  3UKU C;  5FKS A;  5FLX g;  2H9L A;  2IUQ A;  1VYH C;  1JMZ B;  4IA9 A;  1XHM A;  3RFG A;  4J73 A;  2MTA H;  4J77 A;  3L4O D;  3UVK A;  2I3T A;  2BBK H;  2IAA A;  4ERZ A;  2HES X;  2IUP A;  3K27 A;  4PSW B;  5HE3 B;  2Z2P A;  2OVQ B;  2H47 A;  3N0E A;  2CN2 A;  2YMU A;  4ZOY A;  4FAV D;  3SXT D;  2I0R A;  3BG1 A;  4GQ2 P;  3PXW D;  4J87 A;  4FWW A;  4ZOZ A;  5GXI A;  5TF2 A;  4CY3 A;  5H17 A;  3FGB A;  3KRW B;  3A0F A;  4J0X A;  4JSX C;  4E54 A;  3NVN A;  4A0A B;  3RRM C;  3ZWL B;  1R5M A;  3MKS B;  3OL2 A;  4BH6 A;  4J81 A;  5I5I A;  2AGL A;  2UZX B;  2CE8 A;  3NVX A;  4J86 A;  4GM9 A;  2TRC B;  4JSV C;  5EAR A;  2XU7 A;  3EG6 A;  2OK4 A;  5IGQ A;  5EMM B;  1PGU A;  2EBS A;  4QL1 A;  2CN3 A;  4X63 B;  3MKQ A;  4PSX B;  2HJ4 A;  4Y5R D;  5C2W B;  4X3E A;  3UVM A;  2XYI A;  1JJU B;  4CZX A;  2H3X A;  3FM0 A;  2IWK A;  4LG8 A;  2HYE A;  4CI8 A;  3C99 A;  2P9I C;  2B5L A;  3EI3 B;  3ORV D;  2AH1 A;  1MG3 A;  5GXH A;  3DWL C;  1S4U X;  2J56 H;  2OIZ A;  4A2M A;  4GMB A;  1XKS A;  5H14 A;  4CI3 A;  2YBA A;  4PC0 A;  1N6D A;  3I7O A;  3C5M A;  1JOF A;  5CXB B;  2PM6 B;  5THA A;  4A09 B;  3I8E A;  4H5I A;  1SHY B;  4ZOV A;  5TEE A;  2W18 A;  5C9Z B;  3MZK A;  3F3G A;  1NR0 A;  3RLM D;  3DSM A;  2HJB A;  1GXR A;  4TZ4 A;  4D0K A;  2OJY A;  3UKR C;  3JZH A;  3SBQ A;  2B5N A;  5HYN B;  3EI1 A;  4J8G A;  3SWS D;  3I89 A;  4A11 A;  4D6V A;  4GQB B;  1PBY B;  5AMS A;  4FA1 D;  2BCJ B;  1RI6 A;  3OKY A;  1L0Q A;  4G56 B;  4GGC A;  1GOT B;  4X60 B;  2UZY B;  4FAN D;  3L4M D;  3IKO A;  4PBZ A;  4K3J B;  3JB9 L;  2O9K A;  4Z8L A;  5HE1 B;  1MG2 A;  2P9L C;  4XYI A;  2P9P C;  2XL3 A;  3HFQ A;  2AGX A;  1OLZ A;  3I8C A;  2H9M A;  2QC5 A;  2PBI B;  3I7L A;  5JWZ A;  3SHF A;  2CO0 A;  5FKQ A;  3SJL D;  1GG2 B;  1SQ9 A;  3F3P A;  3SLE D;  3CIK B;  3PSL A;  5I5J A;  3IJ1 A;  2H6N A;  4FHL A;  4JD2 C;  2PM9 B;  4GZ8 A;  4E5Z A;  2H6Q A;  4X61 B;  4ZN4 A;  4ERY A;  3OKT A;  5FKT A;  4CY2 A;  3V7D B;  3MZL A;  2IUV A;  1FWX A;  3NVQ A;  2Q7Q A;  3GRE A; 
#chains in the Genus database with same CATH topology
 5E6U A;  5EAP A;  3KCI A;  2VDL A;  3OKY B;  5CXB A;  1TYQ C;  1VZ2 A;  2XL2 A;  3K26 A;  4AN0 A;  4D9S A;  2IWF A;  5EMK B;  1YFQ A;  4GM3 A;  2OK6 A;  5H1M A;  3VGZ A;  2P9N C;  4Y7R A;  3SBP A;  2AGY A;  4JXM A;  1E8N A;  1UOP A;  5GSA A;  2VDR A;  2EIC A;  2H9N A;  3I7K A;  5FFG A;  3GD1 I;  1C9L A;  3AL8 B;  4LGN A;  3UVO A;  1C9I A;  3EU7 A;  3ZDZ A;  2I0S A;  3DXK C;  4O1Q D;  5IC7 A;  3SN6 B;  1U8C A;  3SBR A;  1GOF A;  3OTT A;  5C92 A;  4QT8 A;  4Z7Q A;  3RFH A;  4GM8 A;  5AFU 3;  3EI3 A;  2VDQ A;  3IUN A;  2PM7 B;  4NEN A;  3MXX A;  4YVD A;  1T2X A;  3B7F A;  3ZDX A;  3JZN A;  3AFC A;  4QQE A;  4AX4 A;  3BWS A;  3QI0 A;  5EML B;  3JZG A;  3SCY A;  5K19 A;  2P9U C;  3SFZ A;  1N6E A;  3DM0 A;  3FRX A;  3IJC A;  5FKR A;  4G55 A;  2Z2O A;  3RSE C;  3IVM A;  5I5M A;  4PXW A;  3DXM C;  3RN0 D;  3V5W B;  4E5Z B;  3NIG A;  3J80 g;  1QFS A;  2EIB A;  2WQ8 A;  5K1C C;  1O6F A;  1Q47 A;  2HXC A;  3IIY A;  1N6F A;  2VDO A;  2YNP A;  1YR2 A;  2PM9 A;  4G1E A;  3GFC A;  4L1Q D;  3OW8 A;  3MUN A;  1O6G A;  4HDJ A;  4KFM B;  5IJ7 E;  3GC3 B;  2VZ3 A;  4L9O A;  4E54 B;  2B4E A;  5E6S A;  3EWE A;  4O2W A;  2CNX A;  3EI4 B;  4A0A A;  1K8K C;  2G9A A;  3SMR A;  4GGD A;  4ESG A;  1VE7 A;  4A09 A;  3O4G A;  5EMJ B;  1A0R B;  2OVP B;  4FB1 D;  3K6S A;  5GMK n;  5AJA A;  4PNK B;  3NIF A;  3IUM A;  1I2M B;  4JT5 C;  4O45 A;  4DNU A;  2QR5 A;  1H2X A;  3OKW A;  4OWR A;  3N0D A;  3T3P A;  3UR4 A;  3W15 A;  3AL8 A;  5FA5 B;  1MDA H;  1BPO A;  3AL9 A;  4AEZ A;  4A0B B;  4NAA A;  3I7N A;  4FA5 D;  2HKR A;  3CFV A;  3C9C A;  3K72 A;  1K32 A;  2AH0 A;  2B5M A;  5IT9 g;  3OL2 B;  4J8B A;  4WK2 A;  3MMY A;  3RMZ D;  3PE7 A;  4ES0 A;  3DDU A;  3CFS B;  3V4V A;  3C75 H;  4FA9 D;  5HE0 B;  3U4Y A;  3JRP A;  3PVW B;  3ZDY A;  5B4W A;  2BKL A;  1U4C A;  4BL0 A;  4FA4 D;  1OMW B;  4UM9 A;  4CY5 A;  1QNI A;  4PBY A;  2GNQ A;  3PVU B;  4ERQ A;  2AQ5 A;  1U2V C;  4U1E I;  3EI2 B;  1PEV A;  3ULE C;  4A08 B;  3EMH A;  2QZP A;  4GGA A;  2AGZ A;  2YNN A;  3IIW A;  4A11 B;  4CI2 A;  4J78 A;  4IMM A;  3MVD K;  3AH8 B;  4R7A B;  2P9K C;  4O3U B;  4JT6 C;  3EI4 A;  3SVW D;  4LG9 A;  2QXV A;  4NBM A;  2Z2N A;  4K3I D;  5CXC B;  3JPX A;  1VZ3 A;  1ERJ A;  1XIP A;  3O4H A;  4XEI C;  5FQD A;  1VE6 A;  1SQJ A;  1PI6 A;  4BUJ C;  5IJ8 E;  2CO0 C;  2IUR A;  1TBG A;  4NC4 A;  4O3T B;  4XYH A;  5HQG A;  5SXM A;  4A2L A;  2HU5 A;  1NEX B;  5C2V B;  4L3G D;  4AOW A;  4JSN C;  2EID A;  4N14 A;  4NSX A;  2YB8 B;  5TEF A;  4OZU A;  5C86 A;  1M1X A;  4A7J A;  4O02 A;  3F3F A;  3PSC B;  3VA6 A;  4JHP C;  1JMX B;  2G99 A;  4GQ1 A;  4UI9 R;  3T3M A;  4BP8 A;  3I2N A;  1B9Y A;  4QRJ A;  3I7H A;  4L3H D;  3RN1 D;  2P9S C;  3OF7 A;  3PXS D;  5HE2 B;  3EI1 B;  5CYK A;  2VDM A;  1L5G A;  3ODT A;  3J81 g;  4ZOX A;  4A0B A;  4CI1 A;  4H5J A;  4WK4 A;  3E0C A;  3VI3 A;  4EWR A;  2H6K A;  4CY1 A;  4CC9 A;  3JAM g;  2H14 A;  4U7A A;  4BCC A;  4MK0 B;  3P4F A;  3JRO A;  2AGW A;  5FXY A;  2H13 A;  2HKM A;  4UM8 A;  5EM2 A;  5M5U A;  4DNW A;  5CXC A;  1B9X A;  4CZV A;  5EM2 B;  4J79 A;  2I0T A;  3KRX B;  1GOG A;  4JSP C;  5EAM A;  4J84 A;  4MMY A;  2H9P A;  4J82 A;  1P22 A;  2J57 G;  3UVN A;  2GC4 A;  4IRZ A;  2H68 A;  2GC7 A;  3PXT D;  1H2Z A;  5IGO A;  5EAL A;  1H2Y A;  5KDO B;  2J55 H;  3EI2 A;  4I79 A;  4A08 A;  2YNO A;  4BCB A;  4CZY A;  1TYE A;  3I7P A;  3BG0 A;  2I3S A;  3V9F A;  3FCU A;  4O9D A;  2JKX A;  4BCD A;  5TDH B;  4J0W A;  5A2Q g;  3IJ0 A;  2CE9 A;  1GP2 B;  2OVR B;  5CYK B;  3UVL A;  3VH0 A;  3UKU C;  5FKS A;  3IUQ A;  5FLX g;  2H9L A;  2IUQ A;  1VYH C;  1JMZ B;  4IA9 A;  4Z7O A;  1XHM A;  3ZE2 A;  3RFG A;  4J73 A;  2MTA H;  4J77 A;  3L4O D;  2XDW A;  5M5R A;  3UVK A;  2I3T A;  2BBK H;  2IAA A;  4ERZ A;  2HES X;  2IUP A;  3K27 A;  4PSW B;  5HE3 B;  2Z2P A;  2OVQ B;  2H47 A;  2XE4 A;  3N0E A;  2CN2 A;  2YMU A;  4ZOY A;  2VDP A;  4FAV D;  3SXT D;  5FFO A;  4AMZ A;  2I0R A;  4BP9 A;  3BG1 A;  3QHY B;  4GQ2 P;  3PXW D;  4J87 A;  4FWW A;  4ZOZ A;  3FCS A;  5GXI A;  5TF2 A;  4CY3 A;  5H17 A;  3FGB A;  4AMY A;  3KRW B;  2VDK A;  3A0F A;  4J0X A;  4JSX C;  4WJK A;  4E54 A;  3NVN A;  3IUJ A;  4A0A B;  1H2W A;  3RRM C;  1JTD B;  3ZWL B;  1R5M A;  2XZG A;  3O4J A;  3MKS B;  3OL2 A;  4BH6 A;  4J81 A;  3IUR A;  4AN1 A;  5I5I A;  2AGL A;  2UZX B;  1A12 A;  2CE8 A;  3NVX A;  4J86 A;  4GM9 A;  4DNV A;  2TRC B;  4JSV C;  5EAR A;  2XU7 A;  3EG6 A;  2OK4 A;  5IGQ A;  4RE6 A;  5EMM B;  1PGU A;  3EQ8 A;  2EBS A;  3EQ7 A;  4QL1 A;  2CN3 A;  4X63 B;  2HU8 A;  3MKQ A;  4PSX B;  2HJ4 A;  4Y5R D;  5C2W B;  4X3E A;  3UVM A;  2XYI A;  1JJU B;  4CZX A;  2H3X A;  1JV2 A;  3FM0 A;  3K71 A;  2IWK A;  3MUO A;  4LG8 A;  2HYE A;  4CI8 A;  3C99 A;  3IUL A;  2P9I C;  2B5L A;  3EI3 B;  3ORV D;  4RE5 A;  2AH1 A;  1MG3 A;  2VDN A;  3ZE0 A;  5GXH A;  4L1M A;  3DWL C;  1S4U X;  2J56 H;  2OIZ A;  4A2M A;  4GMB A;  4MMX A;  3VI4 A;  3NID A;  1XKS A;  5H14 A;  4CI3 A;  2YBA A;  4PC0 A;  1N6D A;  3I7O A;  4Z7N A;  3C5M A;  1JOF A;  5CXB B;  3IJE A;  2PM6 B;  5THA A;  4A09 B;  3I8E A;  4H5I A;  1SHY B;  4ZOV A;  5TEE A;  2W18 A;  5C9Z B;  3MZK A;  3F3G A;  1NR0 A;  3RLM D;  3DSM A;  2HJB A;  1GXR A;  4TZ4 A;  4G1M A;  4D0K A;  2OJY A;  1K3I A;  2VC2 A;  3UKR C;  3JZH A;  3SBQ A;  2B5N A;  5HYN B;  3ZE1 A;  4J8G A;  3EI1 A;  3SWS D;  3I89 A;  4A11 A;  4D6V A;  4GQB B;  1PBY B;  4MMZ A;  1E5T A;  5AMS A;  1UTC A;  4FA1 D;  2BCJ B;  4WK0 A;  5HDB A;  1RI6 A;  3OKY A;  5E6R A;  4G56 B;  1L0Q A;  4GGC A;  1GOT B;  4X60 B;  2UZY B;  4FAN D;  3L4M D;  3IKO A;  4PBZ A;  4K3J B;  3JB9 L;  2O9K A;  4Z8L A;  5HE1 B;  1MG2 A;  2EIE A;  2VZ1 A;  2P9L C;  4JHN A;  4XYI A;  3HFQ A;  2P9P C;  2XL3 A;  1UOQ A;  1E8M A;  2AGX A;  1OLZ A;  3I8C A;  1QFM A;  5M5V A;  2H9M A;  2QC5 A;  1GOH A;  2PBI B;  3I7L A;  5JWZ A;  3SHF A;  2CO0 A;  5FKQ A;  3SJL D;  5M5T A;  1GG2 B;  1SQ9 A;  3F3P A;  3SLE D;  3CIK B;  3O4I A;  3PSL A;  5I5J A;  1UOO A;  3IJ1 A;  5M61 A;  2H6N A;  4FHL A;  4JD2 C;  2PM9 B;  4GZ8 A;  4E5Z A;  2H6Q A;  5M5S A;  4X61 B;  4ZN4 A;  4ERY A;  3OKT A;  5FKT A;  4CY2 A;  3V7D B;  3V4P A;  2HU7 A;  3EQ9 A;  3MZL A;  2IUV A;  1FWX A;  3NVQ A;  2Q7Q A;  3GRE A;  4QAM A; 
#chains in the Genus database with same CATH homology
 5EAP A;  5CXB A;  3OKY B;  1TYQ C;  2XL2 A;  3K26 A;  2IWF A;  5EMK B;  1YFQ A;  4GM3 A;  2OK6 A;  5H1M A;  3VGZ A;  2P9N C;  4Y7R A;  3SBP A;  2AGY A;  4JXM A;  5GSA A;  2H9N A;  3I7K A;  3AL8 B;  4LGN A;  3UVO A;  3EU7 A;  2I0S A;  3DXK C;  4O1Q D;  5IC7 A;  3SN6 B;  3SBR A;  3OTT A;  4QT8 A;  3RFH A;  4GM8 A;  5AFU 3;  3EI3 A;  2PM7 B;  3MXX A;  4YVD A;  3B7F A;  3JZN A;  3AFC A;  4QQE A;  3BWS A;  5EML B;  3JZG A;  3SCY A;  5K19 A;  2P9U C;  3SFZ A;  1N6E A;  3DM0 A;  3FRX A;  3IJC A;  5FKR A;  2Z2O A;  3RSE C;  5I5M A;  4PXW A;  3DXM C;  3RN0 D;  3V5W B;  4E5Z B;  3J80 g;  5K1C C;  2HXC A;  1Q47 A;  3IIY A;  1N6F A;  2YNP A;  2PM9 A;  3GFC A;  4L1Q D;  3OW8 A;  4HDJ A;  4KFM B;  5IJ7 E;  4L9O A;  4E54 B;  2B4E A;  3EWE A;  2CNX A;  3EI4 B;  4A0A A;  1K8K C;  2G9A A;  3SMR A;  4GGD A;  4ESG A;  4A09 A;  5EMJ B;  4FB1 D;  1A0R B;  2OVP B;  5GMK n;  5AJA A;  4PNK B;  4JT5 C;  4O45 A;  3OKW A;  4OWR A;  3N0D A;  3UR4 A;  3W15 A;  3AL8 A;  5FA5 B;  1MDA H;  3AL9 A;  4AEZ A;  4A0B B;  3I7N A;  4FA5 D;  2HKR A;  3CFV A;  3C9C A;  1K32 A;  2AH0 A;  2B5M A;  5IT9 g;  3OL2 B;  4J8B A;  3RMZ D;  3MMY A;  3PE7 A;  4ES0 A;  3CFS B;  3C75 H;  4FA9 D;  5HE0 B;  3U4Y A;  3JRP A;  3PVW B;  5B4W A;  4BL0 A;  1U4C A;  4FA4 D;  1OMW B;  4CY5 A;  1QNI A;  4PBY A;  2GNQ A;  3PVU B;  4ERQ A;  2AQ5 A;  1U2V C;  4U1E I;  3EI2 B;  1PEV A;  3ULE C;  4A08 B;  3EMH A;  4GGA A;  2AGZ A;  2YNN A;  3IIW A;  4A11 B;  4CI2 A;  4J78 A;  4IMM A;  3AH8 B;  4R7A B;  2P9K C;  4O3U B;  4JT6 C;  3EI4 A;  3SVW D;  4LG9 A;  2QXV A;  2Z2N A;  4K3I D;  5CXC B;  3JPX A;  1ERJ A;  1XIP A;  4XEI C;  5FQD A;  1SQJ A;  1PI6 A;  4BUJ C;  5IJ8 E;  2CO0 C;  2IUR A;  1TBG A;  4O3T B;  4XYH A;  5HQG A;  5SXM A;  4A2L A;  1NEX B;  5C2V B;  4L3G D;  4AOW A;  4JSN C;  4N14 A;  4NSX A;  2YB8 B;  5TEF A;  4OZU A;  4A7J A;  3F3F A;  3PSC B;  3VA6 A;  1JMX B;  2G99 A;  4GQ1 A;  4UI9 R;  3I2N A;  1B9Y A;  4QRJ A;  3I7H A;  4L3H D;  3RN1 D;  2P9S C;  5HE2 B;  3PXS D;  3EI1 B;  5CYK A;  3ODT A;  3J81 g;  4ZOX A;  4A0B A;  4CI1 A;  4H5J A;  3E0C A;  4EWR A;  2H6K A;  4CY1 A;  4CC9 A;  3JAM g;  2H14 A;  4U7A A;  4MK0 B;  3P4F A;  3JRO A;  2AGW A;  5FXY A;  2H13 A;  2HKM A;  5EM2 A;  5CXC A;  1B9X A;  4CZV A;  5EM2 B;  4J79 A;  2I0T A;  3KRX B;  4JSP C;  5EAM A;  4J84 A;  2H9P A;  4J82 A;  1P22 A;  2J57 G;  3UVN A;  2GC4 A;  2H68 A;  2GC7 A;  3PXT D;  5IGO A;  5EAL A;  5KDO B;  2J55 H;  3EI2 A;  4I79 A;  4A08 A;  2YNO A;  4CZY A;  3I7P A;  3BG0 A;  2I3S A;  3V9F A;  4O9D A;  5TDH B;  4J0W A;  5A2Q g;  3IJ0 A;  2CE9 A;  1GP2 B;  2OVR B;  5CYK B;  3UVL A;  3VH0 A;  3UKU C;  5FKS A;  5FLX g;  2H9L A;  2IUQ A;  1VYH C;  1JMZ B;  4IA9 A;  1XHM A;  3RFG A;  4J73 A;  2MTA H;  4J77 A;  3L4O D;  3UVK A;  2I3T A;  2BBK H;  2IAA A;  4ERZ A;  2HES X;  2IUP A;  3K27 A;  4PSW B;  5HE3 B;  2Z2P A;  2OVQ B;  2H47 A;  3N0E A;  2CN2 A;  2YMU A;  4ZOY A;  4FAV D;  3SXT D;  2I0R A;  3BG1 A;  4GQ2 P;  3PXW D;  4J87 A;  4FWW A;  4ZOZ A;  5GXI A;  5TF2 A;  4CY3 A;  5H17 A;  3FGB A;  3KRW B;  3A0F A;  4J0X A;  4JSX C;  4E54 A;  3NVN A;  4A0A B;  3RRM C;  3ZWL B;  1R5M A;  3MKS B;  3OL2 A;  4BH6 A;  4J81 A;  5I5I A;  2AGL A;  2UZX B;  2CE8 A;  3NVX A;  4J86 A;  4GM9 A;  2TRC B;  4JSV C;  5EAR A;  2XU7 A;  3EG6 A;  2OK4 A;  5IGQ A;  5EMM B;  1PGU A;  2EBS A;  4QL1 A;  2CN3 A;  4X63 B;  3MKQ A;  4PSX B;  2HJ4 A;  4Y5R D;  5C2W B;  4X3E A;  3UVM A;  2XYI A;  1JJU B;  4CZX A;  2H3X A;  3FM0 A;  2IWK A;  4LG8 A;  2HYE A;  4CI8 A;  3C99 A;  2P9I C;  2B5L A;  3EI3 B;  3ORV D;  2AH1 A;  1MG3 A;  5GXH A;  3DWL C;  1S4U X;  2J56 H;  2OIZ A;  4A2M A;  4GMB A;  1XKS A;  5H14 A;  4CI3 A;  2YBA A;  4PC0 A;  1N6D A;  3I7O A;  3C5M A;  1JOF A;  5CXB B;  2PM6 B;  5THA A;  4A09 B;  3I8E A;  4H5I A;  1SHY B;  4ZOV A;  5TEE A;  2W18 A;  5C9Z B;  3MZK A;  3F3G A;  1NR0 A;  3RLM D;  3DSM A;  2HJB A;  1GXR A;  4TZ4 A;  4D0K A;  2OJY A;  3UKR C;  3JZH A;  3SBQ A;  2B5N A;  5HYN B;  3EI1 A;  4J8G A;  3SWS D;  3I89 A;  4A11 A;  4D6V A;  4GQB B;  1PBY B;  5AMS A;  4FA1 D;  2BCJ B;  1RI6 A;  3OKY A;  1L0Q A;  4G56 B;  4GGC A;  1GOT B;  4X60 B;  2UZY B;  4FAN D;  3L4M D;  3IKO A;  4PBZ A;  4K3J B;  3JB9 L;  2O9K A;  4Z8L A;  5HE1 B;  1MG2 A;  2P9L C;  4XYI A;  2P9P C;  2XL3 A;  3HFQ A;  2AGX A;  1OLZ A;  3I8C A;  2H9M A;  2QC5 A;  2PBI B;  3I7L A;  5JWZ A;  3SHF A;  2CO0 A;  5FKQ A;  3SJL D;  1GG2 B;  1SQ9 A;  3F3P A;  3SLE D;  3CIK B;  3PSL A;  5I5J A;  3IJ1 A;  2H6N A;  4FHL A;  4JD2 C;  2PM9 B;  4GZ8 A;  4E5Z A;  2H6Q A;  4X61 B;  4ZN4 A;  4ERY A;  3OKT A;  5FKT A;  4CY2 A;  3V7D B;  3MZL A;  2IUV A;  1FWX A;  3NVQ A;  2Q7Q A;  3GRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...