2B5UB

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
b'GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E3
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
source organism Escherichia coli
molecule tags Ribosome inhibitor, hydrolase
total genus 20
structure length 84
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 2b5uB00
1JCHB 2B5UB 1E44A 4UDMA 3EIPA
chains in the Genus database with same CATH superfamily
4ZPTR 3PRDA 3RMEA 2XP8A 1FKBA 2RUCA 4TW7A 3B7XA 4NNRA 3ARZA 5HWBA 2VCDA 1OWQA 1NMVA 1HKKA 5HUAA 1ZU8A 1OGBA 1SYTA 4WIWA 4QZVB 5DEZA 3O5GA 5DIVA 2RQSA 5DF0A 4L72B 4MNMA 3WH0A 1QPFA 3PRAA 3ODKA 4JYSA 1Q6HA 1FAPA 2KR7A 3ARUA 1E6NA 4ODQA 4ODMA 1HJXA 1P5QA 1ROTA 3NRKA 4MTVA 4ODRA 4XAKA 2DT1A 1O6IA 3UI6A 4ODLA 1E6RA 1PINA 2PPPA 1FKGA 3ARXA 3ALFA 2M1IA 2KI3A 1PBKA 4LAYA 2RURA 5BXJA 3ALGA 4W9OA 3LUOA 2AOSA 5HTGA 3WD2A 3B9AA 4HARA 2F4EA 2XP9A 1W26A 3CHEA 3O5OA 2DSUA 4U85A 2XP6A 4DZ3A 4J4OA 2O92A 2WLYA 1FKJA 2IF4A 1HKJA 3B9EA 1JNEA 2EULA 1HKMA 3TDBA 3WIJA 1E44A 1X6NA 4KQZA 1NWSA 1D2KA 4IT4A 4IT6A 4HBOA 5DITA 3KCEA 1Q1CA 1EDQA 2KO7A 3WL0A 1SR0A 5GQBA 2DG4A 3EY6A 4IQ2A 2F21A 4ODOA 1W1PA 3ARSA 2G8ZA 1K9TA 2KFWA 1F8AB 3BXWA 1KFWA 2DSVA 2RUDA 1LL7A 2ZQSA 1ZBVA 1VF8A 2AWGA 2VN1A 4DRQA 1W1YA 4DRIA 1X6LA 3RGCA 5DIUA 3O5LA 2LKNA 4C02B 2A3CA 3WQVA 1D7IA 1ZK6A 1UR8A 4GGQA 3O5KA 4JFJA 1E6PA 1NWRA 3CGMA 4ZPVR 3FAPA 4AY1A 3AS1A 3AS2A 1NWTA 4DT4A 2XP3A 1HJWA 3BMBA 1D7JA 1HKIA 4MPKA 2DT2A 1EHNA 2DSWA 2PN0A 2A3BA 2MPHA 1B6CA 3CH9A 3W4RA 4DZ2A 4L3NA 1H0GA 3ARPA 1ZBWA 2P4VA 3WD0A 1HJVA 1ZB5A 4P8WA 2B5UB 4ODNA 2MF9A 3H9RB 1GRJA 1QZ2A 4IPXA 4ML4A 1BKFA 1GUVA 2DSZA 2G41A 4S3JA 1WAWA 1FKIA 4TNSA 4ODKA 2MLZA 1C9HA 3ARWA 4JFIA 4ODPA 4DRMA 3ARTA 4DH0A 3B8SA 1ITXA 4QIBA 3WKZA 1RD6A 1A7XA 4UDMA 2RSEA 1N1AA 5HWCA 1YW5A 2ZQUA 3FXYA 4P8XA 4DWSD 2F23A 5GPGA 1XHGA 2L2SA 3AS0A 5JH8A 3ARVA 1J6YA 3KZ7A 3O5RA 3PA7A 2IUZA 4DWSC 3GPKA 4R0XA 4WK9A 1CTNA 2Q5AA 4WJXA 1E9LA 4JFMA 3NTPA 2M2AA 3KABA 4QT2A 4JFLA 4WKFA 1WNOA 4G2PA 3WD4A 1FKTA 3MDYB 3UQAA 3KACA 1KT1A 1W1VA 2Y78A 1FKSA 1JNSA 1JCHB 2MLYA 4TX0A 2ETNA 3RM9A 5HW6A 4W9PA 1TCOC 3KAIA 4TW6A 4URIA 5D75A 2B31A 3RM8A 4MGVA 4FAPA 3PRBA 4Z2GA 3FY1A 3GTYX 2JZVA 2XP4A 3IKGA 1UR9A 1FKKA 5I98A 4Z2HA 2XP7A 4W5UA 3O5FA 4KR0B 1FFRA 1E15A 1GPFA 2FKEA 1FD9A 4DRKA 4LAVA 1J4IA 3ARQA 3WD1A 4MAVA 1FKDA 3G6LA 4MSPA 1W9UA 3EIPA 1YATA 1L1PA 1Q6IA 1ZL1A 2DG3A 3I6CA 4DWSB 1LG1A 1KT0A 4GIVA 1ZBCA 2D9FA 2DT3A 3AQUA 4W9QA 1FKHA 2MNTA 2FAPA 4DRHA 1W9PA 1R9HA 2KGJA 2ZR4A 1OGGA 2A3EA 3RM4A 2PPNA 3WL1A 3AROA 4LAWA 3IKDA 1WB0A 4TYOA 2WM0A 1H0IA 4U84A 2LJ4A 2YBTA 4Q7NA 4DIPA 4WKHA 3KAGA 1M5YA 3O5IA 3CHCA 3UQBA 3JYMA 1LJYA 4NZCA 4ZPWR 1FKFA 1FFQA 3NI6A 2WLZA 1EQ3A 3KAHA 3RFWA 1W9VA 3G6MA 4DWSA 1D6OA 3VAWA 1BL4A 2N87A 4U86A 3KAFA 3IHZA 1Q6UA 1J4RA 3CGNA 1FKLA 1ROUA 3B9DA 2XP5A 2XPAA 2DG9A 4Z2IA 4IQCA 1NMWA 1ZBKA 1QPLA 4ITZA 5HBFA 4DRNA 4NSBA 4N19A 3OOBA 1D7HA 2DPEA 3IK8A 2PV1A 2WK2A 1NWUA 1LQ0A 5DO2A 3WQWA 2FDMA 2LGOA 4MNKA 2PV2A 2OFNA 5HW8A 3UF8A 4R5EA 1NH6A 1FKRA 1T11A 3O5PA 4LAXA 2ITKA 4P8VA 4TW8A 2LPVA 2ZQVA 2UZ5A 2DT0A 1EIBA 3JXVA 4JFKA 3WD3A 1HXVA 4QT3A 1JNTA 1JVWA 1IX5A 3O5EA 2PV3A 2ZQTA 4HBEA 3JYJA 4MNJA 3UQIA 3UI5A 4DRPA 5GPRA 5HW7A 5HKGA 1E6ZA 2YBUA 3O5MA 4Z2JA 1Y0OA 1W1TA 2MLXA 2O9OA 1EYMA 1JNDA 1U79A 3GU0A 2OLHA 4O2TA 2K8IA 2RUQA 3UI4A 1LL6A 3O5JA 1ZCNA 4BF8A 3TCZA 3ARYA 1J4HA 1GOIA 4DROA 2QF8A 4LGXA 3OA5A 4PTMA 3CHFA 3O5DA 4S3KA 2ZR6A 2PPOA 4Q22A 2M08A 2XPBA 2ZR5A 2PI6A 2ESCA 5HT1A 3PR9A 1NSGA 3O5QA 4Z2KA 3CHDA 2KE0A 4MNLA 4WKAA 1TFVA 2A3AA 1LL4A 4J4NA 4Z2LA 1FJDA 3CZ8A 4ZS6A 4DRJA 3TC5A 4G50A 3ARRA 3AS3A 4P8UA 5J6EA 2F2DA 1F40A 2PBCA 1LG2A 4FN2A 1XRVA 5B8IC 3KADA 3QOKA
chains in the Genus database with same CATH topology
1JCHB 2B5UB 1E44A 4UDMA 3EIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCH B;  2B5U B;  1E44 A;  4UDM A;  3EIP A; 
#chains in the Genus database with same CATH topology
 4ZPT R;  3PRD A;  3RME A;  2XP8 A;  1FKB A;  2RUC A;  4TW7 A;  3B7X A;  4NNR A;  3ARZ A;  5HWB A;  2VCD A;  1OWQ A;  1NMV A;  1HKK A;  5HUA A;  1ZU8 A;  1OGB A;  1SYT A;  4WIW A;  4QZV B;  5DEZ A;  3O5G A;  5DIV A;  2RQS A;  5DF0 A;  4L72 B;  4MNM A;  3WH0 A;  1QPF A;  3PRA A;  3ODK A;  4JYS A;  1Q6H A;  1FAP A;  2KR7 A;  3ARU A;  1E6N A;  4ODQ A;  4ODM A;  1HJX A;  1P5Q A;  1ROT A;  3NRK A;  4MTV A;  4ODR A;  4XAK A;  2DT1 A;  1O6I A;  3UI6 A;  4ODL A;  1E6R A;  1PIN A;  2PPP A;  1FKG A;  3ARX A;  3ALF A;  2M1I A;  2KI3 A;  1PBK A;  4LAY A;  2RUR A;  5BXJ A;  3ALG A;  4W9O A;  3LUO A;  2AOS A;  5HTG A;  3WD2 A;  3B9A A;  4HAR A;  2F4E A;  2XP9 A;  1W26 A;  3CHE A;  3O5O A;  2DSU A;  4U85 A;  2XP6 A;  4DZ3 A;  4J4O A;  2O92 A;  2WLY A;  1FKJ A;  2IF4 A;  1HKJ A;  3B9E A;  1JNE A;  2EUL A;  1HKM A;  3TDB A;  3WIJ A;  1E44 A;  1X6N A;  4KQZ A;  1NWS A;  1D2K A;  4IT4 A;  4IT6 A;  4HBO A;  5DIT A;  3KCE A;  1Q1C A;  1EDQ A;  2KO7 A;  3WL0 A;  1SR0 A;  5GQB A;  2DG4 A;  3EY6 A;  4IQ2 A;  2F21 A;  4ODO A;  1W1P A;  3ARS A;  2G8Z A;  1K9T A;  2KFW A;  1F8A B;  3BXW A;  1KFW A;  2DSV A;  2RUD A;  1LL7 A;  2ZQS A;  1ZBV A;  1VF8 A;  2AWG A;  2VN1 A;  4DRQ A;  1W1Y A;  4DRI A;  1X6L A;  3RGC A;  5DIU A;  3O5L A;  2LKN A;  4C02 B;  2A3C A;  3WQV A;  1D7I A;  1ZK6 A;  1UR8 A;  4GGQ A;  3O5K A;  4JFJ A;  1E6P A;  1NWR A;  3CGM A;  4ZPV R;  3FAP A;  4AY1 A;  3AS1 A;  3AS2 A;  1NWT A;  4DT4 A;  2XP3 A;  1HJW A;  3BMB A;  1D7J A;  1HKI A;  4MPK A;  2DT2 A;  1EHN A;  2DSW A;  2PN0 A;  2A3B A;  2MPH A;  1B6C A;  3CH9 A;  3W4R A;  4DZ2 A;  4L3N A;  1H0G A;  3ARP A;  1ZBW A;  2P4V A;  3WD0 A;  1HJV A;  1ZB5 A;  4P8W A;  2B5U B;  4ODN A;  2MF9 A;  3H9R B;  1GRJ A;  1QZ2 A;  4IPX A;  4ML4 A;  1BKF A;  1GUV A;  2DSZ A;  2G41 A;  4S3J A;  1WAW A;  1FKI A;  4TNS A;  4ODK A;  2MLZ A;  1C9H A;  3ARW A;  4JFI A;  4ODP A;  4DRM A;  3ART A;  4DH0 A;  3B8S A;  1ITX A;  4QIB A;  3WKZ A;  1RD6 A;  1A7X A;  4UDM A;  2RSE A;  1N1A A;  5HWC A;  1YW5 A;  2ZQU A;  3FXY A;  4P8X A;  4DWS D;  2F23 A;  5GPG A;  1XHG A;  2L2S A;  3AS0 A;  5JH8 A;  3ARV A;  1J6Y A;  3KZ7 A;  3O5R A;  3PA7 A;  2IUZ A;  4DWS C;  3GPK A;  4R0X A;  4WK9 A;  1CTN A;  2Q5A A;  4WJX A;  1E9L A;  4JFM A;  3NTP A;  2M2A A;  3KAB A;  4QT2 A;  4JFL A;  4WKF A;  1WNO A;  4G2P A;  3WD4 A;  1FKT A;  3MDY B;  3UQA A;  3KAC A;  1KT1 A;  1W1V A;  2Y78 A;  1FKS A;  1JNS A;  1JCH B;  2MLY A;  4TX0 A;  2ETN A;  3RM9 A;  5HW6 A;  4W9P A;  1TCO C;  3KAI A;  4TW6 A;  4URI A;  5D75 A;  2B31 A;  3RM8 A;  4MGV A;  4FAP A;  3PRB A;  4Z2G A;  3FY1 A;  3GTY X;  2JZV A;  2XP4 A;  3IKG A;  1UR9 A;  1FKK A;  5I98 A;  4Z2H A;  2XP7 A;  4W5U A;  3O5F A;  4KR0 B;  1FFR A;  1E15 A;  1GPF A;  2FKE A;  1FD9 A;  4DRK A;  4LAV A;  1J4I A;  3ARQ A;  3WD1 A;  4MAV A;  1FKD A;  3G6L A;  4MSP A;  1W9U A;  3EIP A;  1YAT A;  1L1P A;  1Q6I A;  1ZL1 A;  2DG3 A;  3I6C A;  4DWS B;  1LG1 A;  1KT0 A;  4GIV A;  1ZBC A;  2D9F A;  2DT3 A;  3AQU A;  4W9Q A;  1FKH A;  2MNT A;  2FAP A;  4DRH A;  1W9P A;  1R9H A;  2KGJ A;  2ZR4 A;  1OGG A;  2A3E A;  3RM4 A;  2PPN A;  3WL1 A;  3ARO A;  4LAW A;  3IKD A;  1WB0 A;  4TYO A;  2WM0 A;  1H0I A;  4U84 A;  2LJ4 A;  2YBT A;  4Q7N A;  4DIP A;  4WKH A;  3KAG A;  1M5Y A;  3O5I A;  3CHC A;  3UQB A;  3JYM A;  1LJY A;  4NZC A;  4ZPW R;  1FKF A;  1FFQ A;  3NI6 A;  2WLZ A;  1EQ3 A;  3KAH A;  3RFW A;  1W9V A;  3G6M A;  4DWS A;  1D6O A;  3VAW A;  1BL4 A;  2N87 A;  4U86 A;  3KAF A;  3IHZ A;  1Q6U A;  1J4R A;  3CGN A;  1FKL A;  1ROU A;  3B9D A;  2XP5 A;  2XPA A;  2DG9 A;  4Z2I A;  4IQC A;  1NMW A;  1ZBK A;  1QPL A;  4ITZ A;  5HBF A;  4DRN A;  4NSB A;  4N19 A;  3OOB A;  1D7H A;  2DPE A;  3IK8 A;  2PV1 A;  2WK2 A;  1NWU A;  1LQ0 A;  5DO2 A;  3WQW A;  2FDM A;  2LGO A;  4MNK A;  2PV2 A;  2OFN A;  5HW8 A;  3UF8 A;  4R5E A;  1NH6 A;  1FKR A;  1T11 A;  3O5P A;  4LAX A;  2ITK A;  4P8V A;  4TW8 A;  2LPV A;  2ZQV A;  2UZ5 A;  2DT0 A;  1EIB A;  3JXV A;  4JFK A;  3WD3 A;  1HXV A;  4QT3 A;  1JNT A;  1JVW A;  1IX5 A;  3O5E A;  2PV3 A;  2ZQT A;  4HBE A;  3JYJ A;  4MNJ A;  3UQI A;  3UI5 A;  4DRP A;  5GPR A;  5HW7 A;  5HKG A;  1E6Z A;  2YBU A;  3O5M A;  4Z2J A;  1Y0O A;  1W1T A;  2MLX A;  2O9O A;  1EYM A;  1JND A;  1U79 A;  3GU0 A;  2OLH A;  4O2T A;  2K8I A;  2RUQ A;  3UI4 A;  1LL6 A;  3O5J A;  1ZCN A;  4BF8 A;  3TCZ A;  3ARY A;  1J4H A;  1GOI A;  4DRO A;  2QF8 A;  4LGX A;  3OA5 A;  4PTM A;  3CHF A;  3O5D A;  4S3K A;  2ZR6 A;  2PPO A;  4Q22 A;  2M08 A;  2XPB A;  2ZR5 A;  2PI6 A;  2ESC A;  5HT1 A;  3PR9 A;  1NSG A;  3O5Q A;  4Z2K A;  3CHD A;  2KE0 A;  4MNL A;  4WKA A;  1TFV A;  2A3A A;  1LL4 A;  4J4N A;  4Z2L A;  1FJD A;  3CZ8 A;  4ZS6 A;  4DRJ A;  3TC5 A;  4G50 A;  3ARR A;  3AS3 A;  4P8U A;  5J6E A;  2F2D A;  1F40 A;  2PBC A;  1LG2 A;  4FN2 A;  1XRV A;  5B8I C;  3KAD A;  3QOK A; 
#chains in the Genus database with same CATH homology
 1JCH B;  2B5U B;  1E44 A;  4UDM A;  3EIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...