2B5UB

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E3
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
source organism Escherichia coli
molecule tags Ribosome inhibitor, hydrolase
total genus 20
structure length 84
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 2b5uB00
2B5UB 3EIPA 1JCHB 4UDMA 1E44A
chains in the Genus database with same CATH superfamily
5HWCA 4O2TA 3B9EA 4URIA 3WKZA 2PI6A 2WLZA 3O5RA 4MNMA 3RGCA 3JYJA 1FKGA 4DRKA 3O5EA 2B31A 1KT1A 2AOSA 4MNLA 3ARTA 3AS3A 4Z2HA 3ARZA 3NI6A 2N87A 3ODKA 2ESCA 4DIPA 2RURA 4WJXA 1P5QA 4JFLA 1NSGA 4JFMA 3KAHA 1FKTA 2O92A 1M5YA 4Z2LA 1FKLA 1GRJA 3WD0A 2DG3A 2KFWA 2P4VA 1UR9A 4R5EA 1TCOC 4TW7A 2A3CA 2F2DA 4DZ3A 1PBKA 1QZ2A 4AY1A 3W4RA 1FJDA 3WQWA 2RUCA 4TNSA 5HBFA 4MNJA 2MF9A 4WK9A 2ZQTA 4DROA 1LL7A 2L2SA 3TCZA 1YW5A 1EYMA 2AWGA 3TC5A 3WH0A 4KR0B 1F40A 2DSVA 1SYTA 2PV1A 3FXYA 5BXJA 2RQSA 1KT0A 2K8IA 1NWRA 1ZCNA 4IPXA 3LUOA 2PV2A 1JCHB 1LL4A 4MPKA 4DRNA 4GGQA 4JFKA 3NRKA 3QOKA 4ODMA 4ITZA 1R9HA 3UQBA 3AQUA 3UF8A 1CTNA 5D75A 1YATA 1IX5A 1U79A 1NWTA 1O6IA 3WD4A 3UQAA 3B9AA 4Q22A 4TW8A 4G50A 4DWSB 1ZBKA 1J6YA 2MNTA 1J4IA 4Z2IA 4TX0A 1NWSA 1JNDA 1FKKA 3ARPA 3IKDA 2A3AA 4WIWA 3GU0A 1W1PA 1FKRA 4ODQA 5GPRA 2WK2A 1B6CA 1PINA 4ZPTR 3UQIA 2KE0A 4HARA 5HWBA 1D2KA 4W9PA 2KGJA 1A7XA 5B8IC 3WL0A 4GIVA 4U85A 2G41A 4XAKA 4HBEA 4UDMA 2LPVA 1E6ZA 1E9LA 1N1AA 1ZBVA 3NTPA 5DEZA 4J4NA 2ETNA 4J4OA 4NNRA 1W9VA 1FKSA 2XP3A 1NH6A 2YBTA 2DPEA 2ZQVA 3KADA 4TYOA 1JVWA 2MLYA 3GPKA 2LJ4A 3CHEA 3KAGA 2DT3A 4WKFA 1EQ3A 1SR0A 4MTVA 3KCEA 1FKHA 4QIBA 1W1YA 5DITA 1UR8A 3ALGA 1D6OA 3CH9A 1BKFA 5JH8A 3O5QA 4ODLA 4N19A 3ARYA 2D9FA 5GPGA 1HKKA 3RM8A 1FKFA 4L3NA 1Q6HA 3ARUA 3BXWA 3KACA 4BF8A 5J6EA 3WD3A 1FKBA 1FAPA 3PR9A 1ROTA 2RUDA 1HJWA 1OGGA 1VF8A 4FN2A 3UI4A 3ARSA 2MLZA 3O5FA 4DT4A 5HUAA 2MLXA 1LL6A 3RM4A 2XP7A 1H0IA 2M1IA 1HKMA 1JNTA 3KAFA 4P8XA 4W9QA 4ZS6A 1TFVA 3JXVA 1H0GA 2EULA 1HKJA 4DRIA 2PPNA 3WIJA 1OGBA 3G6LA 4TW6A 1Q6IA 4S3JA 3RMEA 3O5GA 4MNKA 1ZBWA 4U86A 3TDBA 3VAWA 3FAPA 1F8AB 4MGVA 2VCDA 1FFQA 1WAWA 5HW8A 2KR7A 2XP8A 2PBCA 1C9HA 2KI3A 5HKGA 1BL4A 1J4RA 1ZK6A 2DSUA 3ARXA 1Q6UA 1LG1A 4LAXA 3O5PA 1FKJA 3O5OA 2WLYA 4DZ2A 4W9OA 1WNOA 1W9PA 1ZBCA 3CGNA 5I98A 4W5UA 2UZ5A 1Q1CA 2Y78A 3PA7A 4WKAA 3O5IA 1XRVA 2DT2A 4WKHA 1W1VA 2RUQA 3I6CA 2ZR4A 2B5UB 1JNSA 1K9TA 4ODOA 4Q7NA 3CHDA 3ARVA 4ODRA 5HT1A 5GQBA 1RD6A 3O5JA 2LGOA 2JZVA 2PPOA 1LG2A 3O5LA 4NSBA 1WB0A 4JFIA 5DF0A 3IHZA 4DRMA 2VN1A 2ZR5A 1T11A 4S3KA 1EHNA 3O5MA 2DSZA 1E15A 1GUVA 4DRPA 3GTYX 2O9OA 2KO7A 1X6NA 4ML4A 4ODPA 4C02B 2G8ZA 3PRDA 2YBUA 1HJXA 3RM9A 2IUZA 3WD1A 1GOIA 2FAPA 1W26A 3EY6A 1HXVA 1ZB5A 3CGMA 2M08A 3B8SA 4DWSC 3IK8A 1ROUA 4Z2KA 2Q5AA 1FD9A 4LGXA 4FAPA 4U84A 2PPPA 4PTMA 3IKGA 5HW7A 2WM0A 1E6NA 4G2PA 2QF8A 2PN0A 1HKIA 2IF4A 1ZL1A 4DWSD 4QT2A 1E6PA 2A3EA 3CHCA 3ALFA 4JYSA 4HBOA 1E6RA 2MPHA 1KFWA 1D7JA 1OWQA 2A3BA 4LAVA 1FFRA 1ITXA 3JYMA 1JNEA 1QPFA 3OA5A 1W1TA 1X6LA 3H9RB 4QZVB 4DRHA 2LKNA 2DG4A 3AS1A 1LJYA 3FY1A 3OOBA 3PRBA 3WL1A 3WD2A 1NMWA 2M2AA 4DH0A 3KAIA 4LAWA 3AS2A 4NZCA 4IT4A 1E44A 1GPFA 2XP9A 3BMBA 5DIVA 4Z2GA 1FKIA 1LQ0A 2ITKA 4MSPA 2PV3A 2RSEA 2F4EA 2ZQSA 2XPBA 3CZ8A 3AS0A 1D7HA 1EIBA 2XPAA 2XP5A 3KABA 2DSWA 1NMVA 2XP4A 4DWSA 1Y0OA 3UI5A 4DRQA 4Z2JA 2DT1A 3B9DA 4ODNA 3KZ7A 3CHFA 4JFJA 5DO2A 1ZU8A 2F21A 2OLHA 1QPLA 1NWUA 4DRJA 3G6MA 2FKEA 2FDMA 1D7IA 1L1PA 4MAVA 5HW6A 3RFWA 2ZQUA 3PRAA 4P8UA 2F23A 1EDQA 5HTGA 2ZR6A 4IT6A 4P8VA 4L72B 3ARWA 2DG9A 1W9UA 1FKDA 4QT3A 2OFNA 3O5KA 1J4HA 1HJVA 3MDYB 4LAYA 3ARQA 4P8WA 4ZPWR 3AROA 3UI6A 4R0XA 4ODKA 1XHGA 4ZPVR 3EIPA 5DIUA 3ARRA 4KQZA 2XP6A 3B7XA 4IQCA 3WQVA 3O5DA 2DT0A 4IQ2A
chains in the Genus database with same CATH topology
2B5UB 3EIPA 1JCHB 4UDMA 1E44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5U B;  3EIP A;  1JCH B;  4UDM A;  1E44 A; 
#chains in the Genus database with same CATH topology
 5HWC A;  4O2T A;  3B9E A;  4URI A;  3WKZ A;  2PI6 A;  2WLZ A;  3O5R A;  4MNM A;  3RGC A;  3JYJ A;  1FKG A;  4DRK A;  3O5E A;  2B31 A;  1KT1 A;  2AOS A;  4MNL A;  3ART A;  3AS3 A;  4Z2H A;  3ARZ A;  3NI6 A;  2N87 A;  3ODK A;  2ESC A;  4DIP A;  2RUR A;  4WJX A;  1P5Q A;  4JFL A;  1NSG A;  4JFM A;  3KAH A;  1FKT A;  2O92 A;  1M5Y A;  4Z2L A;  1FKL A;  1GRJ A;  3WD0 A;  2DG3 A;  2KFW A;  2P4V A;  1UR9 A;  4R5E A;  1TCO C;  4TW7 A;  2A3C A;  2F2D A;  4DZ3 A;  1PBK A;  1QZ2 A;  4AY1 A;  3W4R A;  1FJD A;  3WQW A;  2RUC A;  4TNS A;  5HBF A;  4MNJ A;  2MF9 A;  4WK9 A;  2ZQT A;  4DRO A;  1LL7 A;  2L2S A;  3TCZ A;  1YW5 A;  1EYM A;  2AWG A;  3TC5 A;  3WH0 A;  4KR0 B;  1F40 A;  2DSV A;  1SYT A;  2PV1 A;  3FXY A;  5BXJ A;  2RQS A;  1KT0 A;  2K8I A;  1NWR A;  1ZCN A;  4IPX A;  3LUO A;  2PV2 A;  1JCH B;  1LL4 A;  4MPK A;  4DRN A;  4GGQ A;  4JFK A;  3NRK A;  3QOK A;  4ODM A;  4ITZ A;  1R9H A;  3UQB A;  3AQU A;  3UF8 A;  1CTN A;  5D75 A;  1YAT A;  1IX5 A;  1U79 A;  1NWT A;  1O6I A;  3WD4 A;  3UQA A;  3B9A A;  4Q22 A;  4TW8 A;  4G50 A;  4DWS B;  1ZBK A;  1J6Y A;  2MNT A;  1J4I A;  4Z2I A;  4TX0 A;  1NWS A;  1JND A;  1FKK A;  3ARP A;  3IKD A;  2A3A A;  4WIW A;  3GU0 A;  1W1P A;  1FKR A;  4ODQ A;  5GPR A;  2WK2 A;  1B6C A;  1PIN A;  4ZPT R;  3UQI A;  2KE0 A;  4HAR A;  5HWB A;  1D2K A;  4W9P A;  2KGJ A;  1A7X A;  5B8I C;  3WL0 A;  4GIV A;  4U85 A;  2G41 A;  4XAK A;  4HBE A;  4UDM A;  2LPV A;  1E6Z A;  1E9L A;  1N1A A;  1ZBV A;  3NTP A;  5DEZ A;  4J4N A;  2ETN A;  4J4O A;  4NNR A;  1W9V A;  1FKS A;  2XP3 A;  1NH6 A;  2YBT A;  2DPE A;  2ZQV A;  3KAD A;  4TYO A;  1JVW A;  2MLY A;  3GPK A;  2LJ4 A;  3CHE A;  3KAG A;  2DT3 A;  4WKF A;  1EQ3 A;  1SR0 A;  4MTV A;  3KCE A;  1FKH A;  4QIB A;  1W1Y A;  5DIT A;  1UR8 A;  3ALG A;  1D6O A;  3CH9 A;  1BKF A;  5JH8 A;  3O5Q A;  4ODL A;  4N19 A;  3ARY A;  2D9F A;  5GPG A;  1HKK A;  3RM8 A;  1FKF A;  4L3N A;  1Q6H A;  3ARU A;  3BXW A;  3KAC A;  4BF8 A;  5J6E A;  3WD3 A;  1FKB A;  1FAP A;  3PR9 A;  1ROT A;  2RUD A;  1HJW A;  1OGG A;  1VF8 A;  4FN2 A;  3UI4 A;  3ARS A;  2MLZ A;  3O5F A;  4DT4 A;  5HUA A;  2MLX A;  1LL6 A;  3RM4 A;  2XP7 A;  1H0I A;  2M1I A;  1HKM A;  1JNT A;  3KAF A;  4P8X A;  4W9Q A;  4ZS6 A;  1TFV A;  3JXV A;  1H0G A;  2EUL A;  1HKJ A;  4DRI A;  2PPN A;  3WIJ A;  1OGB A;  3G6L A;  4TW6 A;  1Q6I A;  4S3J A;  3RME A;  3O5G A;  4MNK A;  1ZBW A;  4U86 A;  3TDB A;  3VAW A;  3FAP A;  1F8A B;  4MGV A;  2VCD A;  1FFQ A;  1WAW A;  5HW8 A;  2KR7 A;  2XP8 A;  2PBC A;  1C9H A;  2KI3 A;  5HKG A;  1BL4 A;  1J4R A;  1ZK6 A;  2DSU A;  3ARX A;  1Q6U A;  1LG1 A;  4LAX A;  3O5P A;  1FKJ A;  3O5O A;  2WLY A;  4DZ2 A;  4W9O A;  1WNO A;  1W9P A;  1ZBC A;  3CGN A;  5I98 A;  4W5U A;  2UZ5 A;  1Q1C A;  2Y78 A;  3PA7 A;  4WKA A;  3O5I A;  1XRV A;  2DT2 A;  4WKH A;  1W1V A;  2RUQ A;  3I6C A;  2ZR4 A;  2B5U B;  1JNS A;  1K9T A;  4ODO A;  4Q7N A;  3CHD A;  3ARV A;  4ODR A;  5HT1 A;  5GQB A;  1RD6 A;  3O5J A;  2LGO A;  2JZV A;  2PPO A;  1LG2 A;  3O5L A;  4NSB A;  1WB0 A;  4JFI A;  5DF0 A;  3IHZ A;  4DRM A;  2VN1 A;  2ZR5 A;  1T11 A;  4S3K A;  1EHN A;  3O5M A;  2DSZ A;  1E15 A;  1GUV A;  4DRP A;  3GTY X;  2O9O A;  2KO7 A;  1X6N A;  4ML4 A;  4ODP A;  4C02 B;  2G8Z A;  3PRD A;  2YBU A;  1HJX A;  3RM9 A;  2IUZ A;  3WD1 A;  1GOI A;  2FAP A;  1W26 A;  3EY6 A;  1HXV A;  1ZB5 A;  3CGM A;  2M08 A;  3B8S A;  4DWS C;  3IK8 A;  1ROU A;  4Z2K A;  2Q5A A;  1FD9 A;  4LGX A;  4FAP A;  4U84 A;  2PPP A;  4PTM A;  3IKG A;  5HW7 A;  2WM0 A;  1E6N A;  4G2P A;  2QF8 A;  2PN0 A;  1HKI A;  2IF4 A;  1ZL1 A;  4DWS D;  4QT2 A;  1E6P A;  2A3E A;  3CHC A;  3ALF A;  4JYS A;  4HBO A;  1E6R A;  2MPH A;  1KFW A;  1D7J A;  1OWQ A;  2A3B A;  4LAV A;  1FFR A;  1ITX A;  3JYM A;  1JNE A;  1QPF A;  3OA5 A;  1W1T A;  1X6L A;  3H9R B;  4QZV B;  4DRH A;  2LKN A;  2DG4 A;  3AS1 A;  1LJY A;  3FY1 A;  3OOB A;  3PRB A;  3WL1 A;  3WD2 A;  1NMW A;  2M2A A;  4DH0 A;  3KAI A;  4LAW A;  3AS2 A;  4NZC A;  4IT4 A;  1E44 A;  1GPF A;  2XP9 A;  3BMB A;  5DIV A;  4Z2G A;  1FKI A;  1LQ0 A;  2ITK A;  4MSP A;  2PV3 A;  2RSE A;  2F4E A;  2ZQS A;  2XPB A;  3CZ8 A;  3AS0 A;  1D7H A;  1EIB A;  2XPA A;  2XP5 A;  3KAB A;  2DSW A;  1NMV A;  2XP4 A;  4DWS A;  1Y0O A;  3UI5 A;  4DRQ A;  4Z2J A;  2DT1 A;  3B9D A;  4ODN A;  3KZ7 A;  3CHF A;  4JFJ A;  5DO2 A;  1ZU8 A;  2F21 A;  2OLH A;  1QPL A;  1NWU A;  4DRJ A;  3G6M A;  2FKE A;  2FDM A;  1D7I A;  1L1P A;  4MAV A;  5HW6 A;  3RFW A;  2ZQU A;  3PRA A;  4P8U A;  2F23 A;  1EDQ A;  5HTG A;  2ZR6 A;  4IT6 A;  4P8V A;  4L72 B;  3ARW A;  2DG9 A;  1W9U A;  1FKD A;  4QT3 A;  2OFN A;  3O5K A;  1J4H A;  1HJV A;  3MDY B;  4LAY A;  3ARQ A;  4P8W A;  4ZPW R;  3ARO A;  3UI6 A;  4R0X A;  4ODK A;  1XHG A;  4ZPV R;  3EIP A;  5DIU A;  3ARR A;  4KQZ A;  2XP6 A;  3B7X A;  4IQC A;  3WQV A;  3O5D A;  2DT0 A;  4IQ2 A; 
#chains in the Genus database with same CATH homology
 2B5U B;  3EIP A;  1JCH B;  4UDM A;  1E44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...