2B5UB

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
molecule keywords Colicin E3
molecule tags Ribosome inhibitor, hydrolase
source organism Escherichia coli
total genus 20
structure length 84
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 2b5uB00
1JCHB 3EIPA 1E44A 2B5UB 4UDMA
chains in the Genus database with same CATH superfamily
1GUVA 3KADA 3CHCA 1ZL1A 2JZVA 4ODLA 4N19A 1FD9A 5DITA 1LQ0A 2UZ5A 4ZS6A 2XPBA 1VF8A 2ZQSA 3CHFA 4W9QA 4MGVA 1E6NA 3VAWA 2LKNA 1WB0A 2XP5A 5GPRA 1IX5A 1JCHB 1X6NA 4ODQA 1EDQA 1J4IA 3KABA 3CGMA 2MPHA 3WD3A 3O5IA 3H9RB 3KAFA 3MDYB 4JYSA 3IKGA 2DSVA 3NTPA 3ARUA 4LAWA 1SYTA 3ARVA 4DWSB 3CH9A 4JFLA 4DZ3A 3O5DA 1W1PA 1E6ZA 2PN0A 4ITZA 2M08A 2PV1A 1P5QA 2DSZA 2DT2A 3KCEA 3WL0A 3TC5A 1WAWA 4DIPA 4ZPTR 2FDMA 1HJXA 4DRPA 1Q1CA 3B9DA 4TX0A 4ZPVR 2IF4A 4TW8A 4Z2LA 4P8XA 2PPPA 3ARRA 1UR8A 3G6MA 3WD4A 3O5EA 4ODKA 2WM0A 3KAIA 4HBOA 3GU0A 3WD0A 3WIJA 2ETNA 4GIVA 2FAPA 3GPKA 1FFQA 2KGJA 1NSGA 1BKFA 1LG1A 2ZR6A 2B5UB 2ZQUA 4Z2IA 1EHNA 1E9LA 1CTNA 4UDMA 2F23A 1NMVA 1FKDA 2KE0A 3BXWA 3AS1A 2D9FA 4DRNA 3O5QA 3O5GA 1SR0A 3O5FA 2A3CA 2FKEA 4IQCA 1Y0OA 4Q7NA 3UF8A 1W9UA 1JNSA 4P8WA 2WLZA 3FY1A 3UI5A 1GRJA 5I98A 1PINA 4DWSC 2PBCA 1EQ3A 1E6RA 4MSPA 1EYMA 1T11A 3JYJA 2AOSA 2F21A 2XP3A 4KR0B 2G41A 4QZVB 1Q6UA 1UR9A 3RFWA 4DRJA 3GTYX 2A3BA 3TCZA 1FKGA 2A3AA 1LJYA 1BL4A 3B9AA 4TW7A 1HKJA 4JFIA 1C9HA 2PPOA 1ZBWA 2KO7A 1YATA 1PBKA 1K9TA 1J4RA 1D7JA 4Z2KA 1ROUA 4FAPA 1F40A 2XP8A 3EIPA 3WH0A 4URIA 4QIBA 1GOIA 1GPFA 1B6CA 5DEZA 2MLXA 1FKHA 1OGGA 1OGBA 4W9OA 1WNOA 1XRVA 1R9HA 4DH0A 3WD1A 4WIWA 1KT0A 3IHZA 2VN1A 3QOKA 3ARWA 2MLYA 3O5OA 2XP4A 3WL1A 1Q6HA 1JNDA 3O5KA 3WQWA 1HXVA 3TDBA 1W9VA 3PA7A 4P8UA 4L3NA 4GGQA 1NWUA 4WKFA 1QZ2A 3O5JA 4FN2A 4IT4A 4TNSA 4WJXA 3KAHA 4DRQA 2RQSA 5HT1A 2ZQVA 3O5PA 3JYMA 2WK2A 4Z2JA 3AS0A 3KACA 5J6EA 2DG4A 3EY6A 4HARA 1FAPA 1FKFA 2EULA 4L72B 1N1AA 4ODMA 5HW6A 4U85A 3AQUA 4MNMA 1QPFA 1W1TA 3AS2A 3UQAA 2VCDA 3ARTA 4Z2GA 2F4EA 1L1PA 1HKKA 5HUAA 5DIUA 5DIVA 4P8VA 4DWSA 4DRKA 1LL6A 5HTGA 1LL7A 1A7XA 4DZ2A 1JNEA 1H0GA 3PRBA 4DRHA 4C02B 3PRDA 3JXVA 5HW8A 3PRAA 2ZR4A 4MNLA 2DSUA 2ZQTA 1ZBKA 2B31A 2PV2A 1W9PA 1FKSA 2KI3A 3CHEA 2RSEA 1E6PA 2RUDA 1OWQA 1ROTA 3WKZA 1NMWA 4JFJA 4DT4A 2LGOA 1X6LA 3RMEA 5GPGA 1J6YA 1HJWA 2PPNA 4LAYA 3NRKA 5D75A 2L2SA 4WKHA 1M5YA 3ALFA 3CGNA 1ZU8A 2Y78A 2RURA 2XP9A 4LAVA 3OOBA 2P4VA 2DG3A 2G8ZA 4MAVA 4ODPA 3RM8A 3UI4A 1QPLA 3FAPA 3CZ8A 4KQZA 3ODKA 2A3EA 1FKLA 4ODRA 2DT3A 5HW7A 1NWTA 2OLHA 2RUQA 2XP7A 2YBUA 4TW6A 1FKTA 2AWGA 2YBTA 1LL4A 4G50A 2PV3A 1FKRA 3RM4A 4XAKA 4JFKA 5BXJA 4ODOA 3RM9A 1H0IA 2DT1A 1KFWA 3B9EA 3O5LA 1RD6A 3RGCA 2OFNA 1HJVA 4U86A 5HKGA 3UQBA 1ZB5A 2KFWA 2F2DA 4BF8A 3KZ7A 5DO2A 2XPAA 5B8IC 4DRMA 2O92A 1HKMA 1NWRA 1D6OA 1ZCNA 3OA5A 2O9OA 4G2PA 5HBFA 3IK8A 3IKDA 4AY1A 4DRIA 2QF8A 4S3JA 2PI6A 1D2KA 1HKIA 4IPXA 1EIBA 4DROA 1FKJA 2LPVA 3ARSA 1F8AB 4R0XA 2MNTA 1LG2A 2MLZA 1J4HA 3FXYA 3NI6A 4QT2A 4LGXA 4W9PA 4NNRA 4ML4A 1ZK6A 1U79A 3KAGA 1TCOC 4MPKA 4U84A 2ZR5A 5HWCA 1D7HA 1NWSA 1XHGA 1FFRA 3ARQA 4TYOA 4W5UA 4S3KA 2ITKA 2KR7A 3CHDA 1D7IA 3BMBA 3AROA 2WLYA 2DPEA 4IQ2A 1NH6A 2DT0A 2IUZA 5JH8A 2XP6A 1E44A 1KT1A 3G6LA 2Q5AA 3O5MA 2LJ4A 4NZCA 4HBEA 3I6CA 1TFVA 1FKIA 4J4NA 4JFMA 1ZBCA 2DSWA 4MNKA 4ODNA 3ARPA 1Q6IA 1ZBVA 2N87A 4Z2HA 3ALGA 2M1IA 1FKKA 2M2AA 4WKAA 1JNTA 4MNJA 4DWSD 2K8IA 1JVWA 4Q22A 5GQBA 1YW5A 4ZPWR 1ITXA 3WQVA 3W4RA 4IT6A 4R5EA 3UQIA 1W26A 3ARYA 1O6IA 2RUCA 5DF0A 2ESCA 4NSBA 4O2TA 4PTMA 2DG9A 4QT3A 4MTVA 3O5RA 3PR9A 5HWBA 3AS3A 4J4OA 3UI6A 3WD2A 1FKBA 3ARZA 4WK9A 3B8SA 1FJDA 3ARXA 1W1VA 3B7XA 3LUOA 1W1YA 2MF9A 1E15A 4LAXA
chains in the Genus database with same CATH topology
1JCHB 3EIPA 1E44A 2B5UB 4UDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCH B;  3EIP A;  1E44 A;  2B5U B;  4UDM A; 
#chains in the Genus database with same CATH topology
 1GUV A;  3KAD A;  3CHC A;  1ZL1 A;  2JZV A;  4ODL A;  4N19 A;  1FD9 A;  5DIT A;  1LQ0 A;  2UZ5 A;  4ZS6 A;  2XPB A;  1VF8 A;  2ZQS A;  3CHF A;  4W9Q A;  4MGV A;  1E6N A;  3VAW A;  2LKN A;  1WB0 A;  2XP5 A;  5GPR A;  1IX5 A;  1JCH B;  1X6N A;  4ODQ A;  1EDQ A;  1J4I A;  3KAB A;  3CGM A;  2MPH A;  3WD3 A;  3O5I A;  3H9R B;  3KAF A;  3MDY B;  4JYS A;  3IKG A;  2DSV A;  3NTP A;  3ARU A;  4LAW A;  1SYT A;  3ARV A;  4DWS B;  3CH9 A;  4JFL A;  4DZ3 A;  3O5D A;  1W1P A;  1E6Z A;  2PN0 A;  4ITZ A;  2M08 A;  2PV1 A;  1P5Q A;  2DSZ A;  2DT2 A;  3KCE A;  3WL0 A;  3TC5 A;  1WAW A;  4DIP A;  4ZPT R;  2FDM A;  1HJX A;  4DRP A;  1Q1C A;  3B9D A;  4TX0 A;  4ZPV R;  2IF4 A;  4TW8 A;  4Z2L A;  4P8X A;  2PPP A;  3ARR A;  1UR8 A;  3G6M A;  3WD4 A;  3O5E A;  4ODK A;  2WM0 A;  3KAI A;  4HBO A;  3GU0 A;  3WD0 A;  3WIJ A;  2ETN A;  4GIV A;  2FAP A;  3GPK A;  1FFQ A;  2KGJ A;  1NSG A;  1BKF A;  1LG1 A;  2ZR6 A;  2B5U B;  2ZQU A;  4Z2I A;  1EHN A;  1E9L A;  1CTN A;  4UDM A;  2F23 A;  1NMV A;  1FKD A;  2KE0 A;  3BXW A;  3AS1 A;  2D9F A;  4DRN A;  3O5Q A;  3O5G A;  1SR0 A;  3O5F A;  2A3C A;  2FKE A;  4IQC A;  1Y0O A;  4Q7N A;  3UF8 A;  1W9U A;  1JNS A;  4P8W A;  2WLZ A;  3FY1 A;  3UI5 A;  1GRJ A;  5I98 A;  1PIN A;  4DWS C;  2PBC A;  1EQ3 A;  1E6R A;  4MSP A;  1EYM A;  1T11 A;  3JYJ A;  2AOS A;  2F21 A;  2XP3 A;  4KR0 B;  2G41 A;  4QZV B;  1Q6U A;  1UR9 A;  3RFW A;  4DRJ A;  3GTY X;  2A3B A;  3TCZ A;  1FKG A;  2A3A A;  1LJY A;  1BL4 A;  3B9A A;  4TW7 A;  1HKJ A;  4JFI A;  1C9H A;  2PPO A;  1ZBW A;  2KO7 A;  1YAT A;  1PBK A;  1K9T A;  1J4R A;  1D7J A;  4Z2K A;  1ROU A;  4FAP A;  1F40 A;  2XP8 A;  3EIP A;  3WH0 A;  4URI A;  4QIB A;  1GOI A;  1GPF A;  1B6C A;  5DEZ A;  2MLX A;  1FKH A;  1OGG A;  1OGB A;  4W9O A;  1WNO A;  1XRV A;  1R9H A;  4DH0 A;  3WD1 A;  4WIW A;  1KT0 A;  3IHZ A;  2VN1 A;  3QOK A;  3ARW A;  2MLY A;  3O5O A;  2XP4 A;  3WL1 A;  1Q6H A;  1JND A;  3O5K A;  3WQW A;  1HXV A;  3TDB A;  1W9V A;  3PA7 A;  4P8U A;  4L3N A;  4GGQ A;  1NWU A;  4WKF A;  1QZ2 A;  3O5J A;  4FN2 A;  4IT4 A;  4TNS A;  4WJX A;  3KAH A;  4DRQ A;  2RQS A;  5HT1 A;  2ZQV A;  3O5P A;  3JYM A;  2WK2 A;  4Z2J A;  3AS0 A;  3KAC A;  5J6E A;  2DG4 A;  3EY6 A;  4HAR A;  1FAP A;  1FKF A;  2EUL A;  4L72 B;  1N1A A;  4ODM A;  5HW6 A;  4U85 A;  3AQU A;  4MNM A;  1QPF A;  1W1T A;  3AS2 A;  3UQA A;  2VCD A;  3ART A;  4Z2G A;  2F4E A;  1L1P A;  1HKK A;  5HUA A;  5DIU A;  5DIV A;  4P8V A;  4DWS A;  4DRK A;  1LL6 A;  5HTG A;  1LL7 A;  1A7X A;  4DZ2 A;  1JNE A;  1H0G A;  3PRB A;  4DRH A;  4C02 B;  3PRD A;  3JXV A;  5HW8 A;  3PRA A;  2ZR4 A;  4MNL A;  2DSU A;  2ZQT A;  1ZBK A;  2B31 A;  2PV2 A;  1W9P A;  1FKS A;  2KI3 A;  3CHE A;  2RSE A;  1E6P A;  2RUD A;  1OWQ A;  1ROT A;  3WKZ A;  1NMW A;  4JFJ A;  4DT4 A;  2LGO A;  1X6L A;  3RME A;  5GPG A;  1J6Y A;  1HJW A;  2PPN A;  4LAY A;  3NRK A;  5D75 A;  2L2S A;  4WKH A;  1M5Y A;  3ALF A;  3CGN A;  1ZU8 A;  2Y78 A;  2RUR A;  2XP9 A;  4LAV A;  3OOB A;  2P4V A;  2DG3 A;  2G8Z A;  4MAV A;  4ODP A;  3RM8 A;  3UI4 A;  1QPL A;  3FAP A;  3CZ8 A;  4KQZ A;  3ODK A;  2A3E A;  1FKL A;  4ODR A;  2DT3 A;  5HW7 A;  1NWT A;  2OLH A;  2RUQ A;  2XP7 A;  2YBU A;  4TW6 A;  1FKT A;  2AWG A;  2YBT A;  1LL4 A;  4G50 A;  2PV3 A;  1FKR A;  3RM4 A;  4XAK A;  4JFK A;  5BXJ A;  4ODO A;  3RM9 A;  1H0I A;  2DT1 A;  1KFW A;  3B9E A;  3O5L A;  1RD6 A;  3RGC A;  2OFN A;  1HJV A;  4U86 A;  5HKG A;  3UQB A;  1ZB5 A;  2KFW A;  2F2D A;  4BF8 A;  3KZ7 A;  5DO2 A;  2XPA A;  5B8I C;  4DRM A;  2O92 A;  1HKM A;  1NWR A;  1D6O A;  1ZCN A;  3OA5 A;  2O9O A;  4G2P A;  5HBF A;  3IK8 A;  3IKD A;  4AY1 A;  4DRI A;  2QF8 A;  4S3J A;  2PI6 A;  1D2K A;  1HKI A;  4IPX A;  1EIB A;  4DRO A;  1FKJ A;  2LPV A;  3ARS A;  1F8A B;  4R0X A;  2MNT A;  1LG2 A;  2MLZ A;  1J4H A;  3FXY A;  3NI6 A;  4QT2 A;  4LGX A;  4W9P A;  4NNR A;  4ML4 A;  1ZK6 A;  1U79 A;  3KAG A;  1TCO C;  4MPK A;  4U84 A;  2ZR5 A;  5HWC A;  1D7H A;  1NWS A;  1XHG A;  1FFR A;  3ARQ A;  4TYO A;  4W5U A;  4S3K A;  2ITK A;  2KR7 A;  3CHD A;  1D7I A;  3BMB A;  3ARO A;  2WLY A;  2DPE A;  4IQ2 A;  1NH6 A;  2DT0 A;  2IUZ A;  5JH8 A;  2XP6 A;  1E44 A;  1KT1 A;  3G6L A;  2Q5A A;  3O5M A;  2LJ4 A;  4NZC A;  4HBE A;  3I6C A;  1TFV A;  1FKI A;  4J4N A;  4JFM A;  1ZBC A;  2DSW A;  4MNK A;  4ODN A;  3ARP A;  1Q6I A;  1ZBV A;  2N87 A;  4Z2H A;  3ALG A;  2M1I A;  1FKK A;  2M2A A;  4WKA A;  1JNT A;  4MNJ A;  4DWS D;  2K8I A;  1JVW A;  4Q22 A;  5GQB A;  1YW5 A;  4ZPW R;  1ITX A;  3WQV A;  3W4R A;  4IT6 A;  4R5E A;  3UQI A;  1W26 A;  3ARY A;  1O6I A;  2RUC A;  5DF0 A;  2ESC A;  4NSB A;  4O2T A;  4PTM A;  2DG9 A;  4QT3 A;  4MTV A;  3O5R A;  3PR9 A;  5HWB A;  3AS3 A;  4J4O A;  3UI6 A;  3WD2 A;  1FKB A;  3ARZ A;  4WK9 A;  3B8S A;  1FJD A;  3ARX A;  1W1V A;  3B7X A;  3LUO A;  1W1Y A;  2MF9 A;  1E15 A;  4LAX A; 
#chains in the Genus database with same CATH homology
 1JCH B;  3EIP A;  1E44 A;  2B5U B;  4UDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...