2B5UB

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
source organism Escherichia coli
molecule tags Ribosome inhibitor, hydrolase
molecule keywords Colicin E3
total genus 20
structure length 84
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 2b5uB00
2B5UB 4UDMA 1E44A 1JCHB 3EIPA
chains in the Genus database with same CATH superfamily
1W26A 1EYMA 2XP8A 2VCDA 4BF8A 4QIBA 1E15A 1LG1A 4TNSA 2RSEA 1E44A 1LQ0A 1W9UA 1ZL1A 1WNOA 1LL6A 1PBKA 1OGGA 4ITZA 1IX5A 1J4RA 1ZB5A 3O5EA 2ZR6A 2UZ5A 3PRBA 4G2PA 2M2AA 2MPHA 1FKKA 1TCOC 5GPRA 1O6IA 4LAYA 3WL1A 2PPNA 2KE0A 4ODPA 1FKGA 1HKMA 1VF8A 4DRMA 3AS0A 2WLZA 2LPVA 4J4OA 3WD0A 1D6OA 5HW7A 4ODNA 4JFIA 3FXYA 4ML4A 3RM4A 2B31A 3IHZA 1SR0A 4IQCA 4LAXA 4GIVA 1TFVA 4AY1A 1NMWA 1J4HA 3IKDA 5DITA 1W9PA 3B9EA 2F4EA 1C9HA 1ZU8A 4ZS6A 3WH0A 1GPFA 3GU0A 4ZPWR 3KCEA 2PN0A 4S3JA 1B6CA 3WD2A 1HKIA 4DRJA 4Z2GA 2YBUA 3ARRA 4Z2KA 4MAVA 1FJDA 2OLHA 3BMBA 1J4IA 2DPEA 3O5LA 2PPPA 3WQVA 4JFLA 2RUDA 4DWSA 5D75A 3B8SA 1WAWA 2ETNA 2JZVA 2DT0A 3NRKA 3VAWA 4N19A 3WKZA 5J6EA 4ODRA 1LG2A 1FD9A 1T11A 4ODLA 1UR9A 2XPBA 3UI5A 3O5JA 4TW6A 3CGNA 1EHNA 4DIPA 4P8WA 4O2TA 4Z2IA 3GTYX 1OWQA 4URIA 1L1PA 3BXWA 1GUVA 1J6YA 2PV3A 2MLZA 1FKLA 5B8IC 2PI6A 4W5UA 1XHGA 5DIUA 2IUZA 4WJXA 4DWSB 3AS3A 1NWUA 2RURA 1CTNA 5HUAA 1ZCNA 4JFJA 1YATA 3ARQA 2M08A 1HXVA 4TYOA 1H0IA 3RFWA 4DZ2A 1ZK6A 2DT3A 1W1TA 1GRJA 1FKHA 2KR7A 4LAVA 4DZ3A 1JVWA 5HTGA 4WKHA 1W1PA 2FDMA 3ARZA 2ZQVA 1ZBCA 1FFRA 4MGVA 2LGOA 2ZQUA 3AS2A 3O5DA 3I6CA 1X6NA 3MDYB 1Q6IA 1R9HA 1HJXA 3ALFA 2O9OA 1A7XA 3CHDA 1NWRA 2F23A 1HJWA 4TX0A 1JNSA 2ZQSA 4G50A 4NNRA 3ARXA 4WKFA 3IKGA 1FKIA 3KABA 2RQSA 1BL4A 4ODMA 1ROTA 2G41A 2YBTA 4TW7A 1JNEA 5DIVA 2DT2A 3O5OA 3UF8A 3EIPA 4JFKA 4QZVB 1WB0A 4R0XA 4U86A 4TW8A 3ARPA 1Q6HA 2ITKA 3B7XA 3O5FA 4DRKA 5HT1A 3O5RA 2DT1A 2PPOA 4W9OA 4WK9A 3TC5A 4Z2HA 2Y78A 5HBFA 4KR0B 2DSZA 2VN1A 3O5QA 1FAPA 2L2SA 5DEZA 2ZR5A 1W9VA 4QT2A 3RMEA 1GOIA 1U79A 4NSBA 3JYMA 2N87A 3UQIA 2MNTA 3KAFA 2A3BA 1LL7A 1KT0A 4MNJA 3WIJA 2F2DA 4IT6A 2AOSA 2ZR4A 1FKSA 2PV2A 3UI4A 2FKEA 3CHFA 4L72B 2K8IA 1E9LA 1FKBA 1FKDA 2XP3A 1NWTA 3O5PA 3O5GA 4P8XA 2P4VA 1X6LA 2D9FA 3ARUA 3WD4A 3WQWA 4PTMA 2RUQA 5HW8A 1NH6A 1D2KA 4IPXA 4ODQA 2OFNA 2DSWA 4P8VA 4XAKA 5HWCA 1HJVA 1W1VA 3W4RA 5I98A 2DG3A 4ZPTR 3UQBA 2WM0A 3ARVA 2XP4A 3IK8A 3QOKA 1ROUA 3PRAA 4GGQA 1HKKA 2LJ4A 2PV1A 4HBOA 1ZBVA 1SYTA 4QT3A 3PR9A 4LAWA 4IT4A 3B9DA 3OOBA 3O5KA 4Q7NA 3PA7A 2G8ZA 3KZ7A 4DT4A 4MNLA 4MTVA 2XP9A 2LKNA 1F8AB 1QZ2A 4Z2LA 3NTPA 2MF9A 2QF8A 1ITXA 3GPKA 2KI3A 3AROA 4FN2A 3H9RB 3RM8A 4Q22A 1FKJA 4LGXA 2DSVA 1PINA 4ODKA 2FAPA 5GPGA 5HWBA 3ARTA 1NSGA 2WK2A 2ZQTA 3WL0A 1NMVA 4Z2JA 2ESCA 3CH9A 1FFQA 3OA5A 1E6RA 4HARA 4WKAA 4U85A 3KAGA 1QPLA 3CGMA 1E6ZA 1W1YA 2MLYA 4MSPA 4P8UA 4W9PA 4FAPA 4R5EA 3O5MA 1RD6A 2PBCA 4DRNA 2A3EA 2KGJA 2O92A 3TCZA 1D7HA 1ZBWA 2DG9A 3ALGA 2B5UB 2F21A 4U84A 2XP7A 3B9AA 1FKTA 1QPFA 3RM9A 3LUOA 1EIBA 4IQ2A 1JNDA 1KFWA 1FKFA 3O5IA 1Q6UA 3PRDA 2A3CA 3ARSA 3NI6A 3CHEA 3WD1A 3UI6A 1LJYA 1KT1A 1H0GA 5HW6A 4W9QA 3TDBA 1HKJA 3RGCA 3UQAA 4ODOA 2XP5A 4C02B 4DRQA 1P5QA 1N1AA 4NZCA 3KACA 5GQBA 3CHCA 3ARWA 2A3AA 5JH8A 1M5YA 2MLXA 1D7JA 2M1IA 1K9TA 1UR8A 4KQZA 5DO2A 1Y0OA 3KAHA 4DROA 3FAPA 1NWSA 3JYJA 1XRVA 1EDQA 4L3NA 2KO7A 2WLYA 4JFMA 4S3KA 4DWSC 1JCHB 3FY1A 4DWSD 4UDMA 4JYSA 1OGBA 1E6PA 1JNTA 2XPAA 2EULA 5HKGA 1F40A 3KADA 4MPKA 1D7IA 5BXJA 4WIWA 4DRHA 2DG4A 2AWGA 4J4NA 3WD3A 4HBEA 4DRPA 1EQ3A 3AQUA 3G6MA 4MNKA 4MNMA 1BKFA 3ARYA 1ZBKA 4DH0A 1YW5A 2RUCA 1Q1CA 5DF0A 3ODKA 2XP6A 2DSUA 2Q5AA 1LL4A 2KFWA 3G6LA 2IF4A 1FKRA 3KAIA 1E6NA 3JXVA 3EY6A 4DRIA 4ZPVR 3CZ8A 3AS1A
chains in the Genus database with same CATH topology
2B5UB 4UDMA 1E44A 1JCHB 3EIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5U B;  4UDM A;  1E44 A;  1JCH B;  3EIP A; 
#chains in the Genus database with same CATH topology
 1W26 A;  1EYM A;  2XP8 A;  2VCD A;  4BF8 A;  4QIB A;  1E15 A;  1LG1 A;  4TNS A;  2RSE A;  1E44 A;  1LQ0 A;  1W9U A;  1ZL1 A;  1WNO A;  1LL6 A;  1PBK A;  1OGG A;  4ITZ A;  1IX5 A;  1J4R A;  1ZB5 A;  3O5E A;  2ZR6 A;  2UZ5 A;  3PRB A;  4G2P A;  2M2A A;  2MPH A;  1FKK A;  1TCO C;  5GPR A;  1O6I A;  4LAY A;  3WL1 A;  2PPN A;  2KE0 A;  4ODP A;  1FKG A;  1HKM A;  1VF8 A;  4DRM A;  3AS0 A;  2WLZ A;  2LPV A;  4J4O A;  3WD0 A;  1D6O A;  5HW7 A;  4ODN A;  4JFI A;  3FXY A;  4ML4 A;  3RM4 A;  2B31 A;  3IHZ A;  1SR0 A;  4IQC A;  4LAX A;  4GIV A;  1TFV A;  4AY1 A;  1NMW A;  1J4H A;  3IKD A;  5DIT A;  1W9P A;  3B9E A;  2F4E A;  1C9H A;  1ZU8 A;  4ZS6 A;  3WH0 A;  1GPF A;  3GU0 A;  4ZPW R;  3KCE A;  2PN0 A;  4S3J A;  1B6C A;  3WD2 A;  1HKI A;  4DRJ A;  4Z2G A;  2YBU A;  3ARR A;  4Z2K A;  4MAV A;  1FJD A;  2OLH A;  3BMB A;  1J4I A;  2DPE A;  3O5L A;  2PPP A;  3WQV A;  4JFL A;  2RUD A;  4DWS A;  5D75 A;  3B8S A;  1WAW A;  2ETN A;  2JZV A;  2DT0 A;  3NRK A;  3VAW A;  4N19 A;  3WKZ A;  5J6E A;  4ODR A;  1LG2 A;  1FD9 A;  1T11 A;  4ODL A;  1UR9 A;  2XPB A;  3UI5 A;  3O5J A;  4TW6 A;  3CGN A;  1EHN A;  4DIP A;  4P8W A;  4O2T A;  4Z2I A;  3GTY X;  1OWQ A;  4URI A;  1L1P A;  3BXW A;  1GUV A;  1J6Y A;  2PV3 A;  2MLZ A;  1FKL A;  5B8I C;  2PI6 A;  4W5U A;  1XHG A;  5DIU A;  2IUZ A;  4WJX A;  4DWS B;  3AS3 A;  1NWU A;  2RUR A;  1CTN A;  5HUA A;  1ZCN A;  4JFJ A;  1YAT A;  3ARQ A;  2M08 A;  1HXV A;  4TYO A;  1H0I A;  3RFW A;  4DZ2 A;  1ZK6 A;  2DT3 A;  1W1T A;  1GRJ A;  1FKH A;  2KR7 A;  4LAV A;  4DZ3 A;  1JVW A;  5HTG A;  4WKH A;  1W1P A;  2FDM A;  3ARZ A;  2ZQV A;  1ZBC A;  1FFR A;  4MGV A;  2LGO A;  2ZQU A;  3AS2 A;  3O5D A;  3I6C A;  1X6N A;  3MDY B;  1Q6I A;  1R9H A;  1HJX A;  3ALF A;  2O9O A;  1A7X A;  3CHD A;  1NWR A;  2F23 A;  1HJW A;  4TX0 A;  1JNS A;  2ZQS A;  4G50 A;  4NNR A;  3ARX A;  4WKF A;  3IKG A;  1FKI A;  3KAB A;  2RQS A;  1BL4 A;  4ODM A;  1ROT A;  2G41 A;  2YBT A;  4TW7 A;  1JNE A;  5DIV A;  2DT2 A;  3O5O A;  3UF8 A;  3EIP A;  4JFK A;  4QZV B;  1WB0 A;  4R0X A;  4U86 A;  4TW8 A;  3ARP A;  1Q6H A;  2ITK A;  3B7X A;  3O5F A;  4DRK A;  5HT1 A;  3O5R A;  2DT1 A;  2PPO A;  4W9O A;  4WK9 A;  3TC5 A;  4Z2H A;  2Y78 A;  5HBF A;  4KR0 B;  2DSZ A;  2VN1 A;  3O5Q A;  1FAP A;  2L2S A;  5DEZ A;  2ZR5 A;  1W9V A;  4QT2 A;  3RME A;  1GOI A;  1U79 A;  4NSB A;  3JYM A;  2N87 A;  3UQI A;  2MNT A;  3KAF A;  2A3B A;  1LL7 A;  1KT0 A;  4MNJ A;  3WIJ A;  2F2D A;  4IT6 A;  2AOS A;  2ZR4 A;  1FKS A;  2PV2 A;  3UI4 A;  2FKE A;  3CHF A;  4L72 B;  2K8I A;  1E9L A;  1FKB A;  1FKD A;  2XP3 A;  1NWT A;  3O5P A;  3O5G A;  4P8X A;  2P4V A;  1X6L A;  2D9F A;  3ARU A;  3WD4 A;  3WQW A;  4PTM A;  2RUQ A;  5HW8 A;  1NH6 A;  1D2K A;  4IPX A;  4ODQ A;  2OFN A;  2DSW A;  4P8V A;  4XAK A;  5HWC A;  1HJV A;  1W1V A;  3W4R A;  5I98 A;  2DG3 A;  4ZPT R;  3UQB A;  2WM0 A;  3ARV A;  2XP4 A;  3IK8 A;  3QOK A;  1ROU A;  3PRA A;  4GGQ A;  1HKK A;  2LJ4 A;  2PV1 A;  4HBO A;  1ZBV A;  1SYT A;  4QT3 A;  3PR9 A;  4LAW A;  4IT4 A;  3B9D A;  3OOB A;  3O5K A;  4Q7N A;  3PA7 A;  2G8Z A;  3KZ7 A;  4DT4 A;  4MNL A;  4MTV A;  2XP9 A;  2LKN A;  1F8A B;  1QZ2 A;  4Z2L A;  3NTP A;  2MF9 A;  2QF8 A;  1ITX A;  3GPK A;  2KI3 A;  3ARO A;  4FN2 A;  3H9R B;  3RM8 A;  4Q22 A;  1FKJ A;  4LGX A;  2DSV A;  1PIN A;  4ODK A;  2FAP A;  5GPG A;  5HWB A;  3ART A;  1NSG A;  2WK2 A;  2ZQT A;  3WL0 A;  1NMV A;  4Z2J A;  2ESC A;  3CH9 A;  1FFQ A;  3OA5 A;  1E6R A;  4HAR A;  4WKA A;  4U85 A;  3KAG A;  1QPL A;  3CGM A;  1E6Z A;  1W1Y A;  2MLY A;  4MSP A;  4P8U A;  4W9P A;  4FAP A;  4R5E A;  3O5M A;  1RD6 A;  2PBC A;  4DRN A;  2A3E A;  2KGJ A;  2O92 A;  3TCZ A;  1D7H A;  1ZBW A;  2DG9 A;  3ALG A;  2B5U B;  2F21 A;  4U84 A;  2XP7 A;  3B9A A;  1FKT A;  1QPF A;  3RM9 A;  3LUO A;  1EIB A;  4IQ2 A;  1JND A;  1KFW A;  1FKF A;  3O5I A;  1Q6U A;  3PRD A;  2A3C A;  3ARS A;  3NI6 A;  3CHE A;  3WD1 A;  3UI6 A;  1LJY A;  1KT1 A;  1H0G A;  5HW6 A;  4W9Q A;  3TDB A;  1HKJ A;  3RGC A;  3UQA A;  4ODO A;  2XP5 A;  4C02 B;  4DRQ A;  1P5Q A;  1N1A A;  4NZC A;  3KAC A;  5GQB A;  3CHC A;  3ARW A;  2A3A A;  5JH8 A;  1M5Y A;  2MLX A;  1D7J A;  2M1I A;  1K9T A;  1UR8 A;  4KQZ A;  5DO2 A;  1Y0O A;  3KAH A;  4DRO A;  3FAP A;  1NWS A;  3JYJ A;  1XRV A;  1EDQ A;  4L3N A;  2KO7 A;  2WLY A;  4JFM A;  4S3K A;  4DWS C;  1JCH B;  3FY1 A;  4DWS D;  4UDM A;  4JYS A;  1OGB A;  1E6P A;  1JNT A;  2XPA A;  2EUL A;  5HKG A;  1F40 A;  3KAD A;  4MPK A;  1D7I A;  5BXJ A;  4WIW A;  4DRH A;  2DG4 A;  2AWG A;  4J4N A;  3WD3 A;  4HBE A;  4DRP A;  1EQ3 A;  3AQU A;  3G6M A;  4MNK A;  4MNM A;  1BKF A;  3ARY A;  1ZBK A;  4DH0 A;  1YW5 A;  2RUC A;  1Q1C A;  5DF0 A;  3ODK A;  2XP6 A;  2DSU A;  2Q5A A;  1LL4 A;  2KFW A;  3G6L A;  2IF4 A;  1FKR A;  3KAI A;  1E6N A;  3JXV A;  3EY6 A;  4DRI A;  4ZPV R;  3CZ8 A;  3AS1 A; 
#chains in the Genus database with same CATH homology
 2B5U B;  4UDM A;  1E44 A;  1JCH B;  3EIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...