2B5VA

Crystal structure of glucose dehydrogenase from haloferax mediterranei
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
357
structure length
355
Chain Sequence
MKAIAVKRGRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
molecule keywords glucose dehydrogenase
total genus 114
structure length 355
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2b5vA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2b5vA01
2GZ3A 2PTGA 1G0NA 2A35A 3NDIA 1NHWA 1KC1A 4DYDA 1B2LA 1O8CA 3OSUA 1XR3A 5CG1A 1E3WA 4HBGA 2HK9A 1ZZEA 4JP2A 3STHA 3QVSA 2PWZA 3SLGA 1Y6JA 2AG8A 2WD8A 4CMIB 3KYBA 2HU2A 2VHWA 1RKXA 5ENVA 5JFOA 4TWRA 3MCVA 2ZJ1A 4MINA 2BHLA 4J6FA 4J1QA 3JD1A 1J6UA 5B1YA 3FR8A 4OOEA 2UYYA 3P5SA 1PQPA 3E5MA 1HYHA 4Y9DA 5FEUA 1DC3A 3W4KA 4TKMA 3W8EA 4E2XA 4DUPA 1FF9A 1N5DA 2BKAA 1DHRA 4Z3DA 4AJHA 2JKVA 1BDMA 3DXFA 2I67A 5ER6A 4FC6A 4RCVA 4BS9A 2UVDA 2VYND 2O23A 2ZKLA 1NNUA 4PG6A 1SB8A 3F1LA 3INGA 3OIGA 4XYMA 3KYCA 4CM4A 2H6EA 4WECA 5BNIA 3Q9UA 3KM0A 4DIFA 3PLNA 1KOLA 3OJFA 3S1LA 4JK3A 2E48A 5CG2A 2QRKA 1KIFA 4LVCA 4PZCA 4KUHA 5C5IA 1LLUA 1NAHA 1FDWA 1TT5A 3AUSA 1B3RA 1ZK3A 3OA0A 4U5QA 2FP4A 4YBZA 3G3EA 1B15A 1V3TA 4HXYA 1U3VA 3KB6A 3RUIA 4EITA 2IYPA 1GR0A 4BO8A 1E3SA 3DAGA 4XEHA 5B4VA 1NPDA 1PS8A 4U7WA 4U0KA 4R1NA 1UDBA 4M87A 4G2NA 5L7YA 3AI3A 3PJFA 5FF9A 4TRNA 1W6UA 3JQ8A 5BSEA 1DLIA 5EMHA 1NASA 2Y0EA 4J49A 3VTFA 1X15A 3M1LA 1PZEA 2X5KO 3ITDA 3TZCA 1YOVB 1N9GB 2RBEA 2PKQP 2W98A 1ZSNA 1GV1A 5JE8A 3NGLA 1H9BA 3H2SA 2PKQO 1H0KA 4IIVA 1XKQA 2X7HA 3MTGA 4PGFA 1O0SA 1PGOA 1B26A 1DC4A 5BNTA 3DBRB 5T8KC 3FPLA 4CUZA 3QP9A 2HLPA 3KHUA 2AQIA 3PQFA 1TI7A 5F5NA 3F5SA 3E03A 4DBVO 2X8LA 2BRUA 4NQZA 4RLSA 1UXIA 1QORA 5I7VA 4XDYA 5DT9A 5J23A 2C20A 3AUAA 3DHEA 3FNHA 1GPDG 3ZWCA 5KJFA 5BT9A 4WLOA 1MC4A 3OICA 1U7TA 1ONOA 4GWKA 1VE9A 4MVJP 1EDZA 2W2KA 4DBZA 5LDGA 3LZ6A 4R1SA 4GSKA 2FPIA 2JD0A 2ZB3A 1K89A 2CF5A 3I9MA 4CMKA 2I99A 4MDHA 4INAA 4CLRB 4YR9A 3OQ1A 2OFPA 2YZ7A 4PFJA 5JCJA 3WFJA 1Y8RB 4TRMA 4KTTE 3BIOA 3RFXA 4WOJA 1KETA 1QRRA 5KVSA 3ADPA 3WYCA 4BO1A 3DZBA 3GUCA 1ZVMA 2IEBA 4HP8A 1HYGA 4XWYA 1R4NA 3RUDA 4D45A 3VVBA 1KERA 2Q99A 1ZSYA 1EQ2A 4J91A 3KZVA 3RBZA 2PZLA 1DHTA 1JVBA 3DZIA 2ZQYA 3GHYA 5KJ1A 2EGGA 4OXYA 3JYNA 2O50A 1U8FO 4ALLA 1X0XA 4PVDA 4Y6SA 2R2GA 4FFLA 2NUAA 1Z7EA 1BHSA 1LBEA 3LF1A 3OETA 3CXRA 3VAZA 1T2DA 3Q1LA 1YBAA 3L9WA 4BNWA 2ZYDA 3S2GA 3EVNA 3EC7A 4HV4A 1SOWA 3IP1A 4GGPA 4XGIA 3RFVA 4DQXA 1Q0HA 2UUOA 1SMKA 4FJ1A 1PWZA 1O5IA 2DBRA 4MKXA 4XZ3A 1A4IA 2FOIA 4YRBA 3WQSB 3EMKA 3TFOA 2Y99A 2Q46A 3OJLA 1B0AA 1JAYA 1OI7A 2PGDA 2VHVA 3AUUA 3B70A 4CMHA 4DLBA 3D64A 3TN7A 3EGOA 3ZCXA 4O0LA 1E0DA 4JJFA 3HHPA 3HDYA 1I10A 4U6SA 1ISJA 5JMWA 2RH8A 3WICA 3WTBA 3QRWA 1LDBA 1C0IA 5I7EA 3BXXA 5HS4A 2GDZA 1DFIA 3KV3O 1ISGA 1RM0A 3RKRA 5A3JA 2FSVA 3PZRA 2B5VA 2FSSA 2P2SA 3QA9A 1KVUA 5CDTA 3U9LA 4Z3KA 4D0SA 1EEHA 3GEGA 3FPCA 3HFGA 4UVIA 2B4QA 4GVXA 1NR7A 2GCGA 3ADOA 1V35A 2QRJA 1GYPA 4UUNA 1GZ6A 2C54A 3BTUA 3NT4A 5KIAA 4WUVA 3NDRA 4W4TA 1MGOA 4R41A 2Z1NA 3ULKA 3IKVA 3HJAA 3AY6A 1K5HA 1W4ZA 3ZU2A 3NUGA 5DN9A 1XIVA 4MPDA 3UCEA 3RUCA 4G5HA 1NFRA 4CV2A 3L6DA 1EDOA 3V1TC 2O3TA 2DAPA 5L40A 2VWPA 4ILKA 4M89A 3RU9A 1P1JA 5JCJD 5IDQA 1C1XA 2JD2A 2NNLD 1M75A 5KTKA 5KJ6A 2GASA 1NBOA 4H3VA 4UVDA 4UUMA 4BUCA 5GZ1A 2P4HX 3KEOA 1FDVA 2PZKA 5B37A 2O3SA 2WM3A 4DLAA 1V3UA 3GFBA 1ISHA 1MLDA 4M54A 1Z45A 3WNQA 5I9MA 4ZQGA 4YAJA 4RZIA 2G1UA 2V65A 1EK6A 4DPMA 3COSA 4M86A 3WGTA 3ZV6A 4ROSA 1PEDA 3AI2A 1I3MA 4IDEA 4ZD6A 5IDYA 1D7OA 3TFQA 5JAIA 4K1LA 1LI4A 2NTVA 3VH3A 3WNVA 5A9RA 2G17A 2ZB7A 4J9UE 1CQJA 4YXFA 4ND5A 3BTVA 4IXTA 1H2HA 1O9BA 4BGIA 3DTTA 4CM9D 1DRUA 1Q2XA 1JKIA 4NJMA 3DHNA 4WLFA 1DB3A 1KBZA 3UCXA 1WDLA 3ETDA 4QFDA 4TRJA 5DNAA 3U4HA 5HRUA 2JL1A 1K2WA 1PR9A 2G82A 4IDGA 3SBOA 1KEVA 5TF4A 4ND1A 3UUWA 3E6AA 1VKOA 3JSAA 4YCAA 3QWIA 5F3RA 5KOIA 2ZATA 2NSDA 1E6EA 3DZJA 1NYTA 5TT0A 1ZXLA 3PWKA 3ZGYA 4AJLA 4LW8A 2DBZA 2DT5A 3O03A 4WNIA 2WSBA 3AW9A 4XA8A 1YOVA 4IQGA 2O4UX 2LDXA 4DMLA 1Y9EA 5KVVA 2ZTUA 4HNGA 4XQCA 4ALJA 3GZNB 2VWQA 3LU1A 1PJSA 2ZJ0A 3VC7A 3SXPA 4MP6A 5IZCC 4CM7A 1LLQA 4WCFC 4WKGA 1DOHA 4D46A 4E4YA 1U9JA 3GEDA 1R15A 4TROA 2VYVA 4ZHSA 3WMWA 3OEYA 3SLKA 1MC5A 2CZCA 5B12A 4R3WA 1AXGA 4WE3A 4GMGA 3ANMA 2F1KA 3PWSA 1BSVA 4S3MA 2EW2A 5BSGA 1LU9A 1TB4A 2SCUA 3O8QA 3L4BA 4CM4B 5IG2A 4J1TA 2VZ0A 3N58A 4FGWA 4GH5A 1YBVA 1CERA 2P9EA 1GCUA 1PJLA 2PK3A 5JMPA 3OH8A 2EIHA 4ZQEA 5THQA 5B4TA 2ZYAA 2QRLA 3GN2A 3QE3A 2IXBA 1YS4A 2Y1CA 2HKIA 2E4AA 2YDYA 1M67A 3L9XA 3QVWA 5FFFA 2O7SA 3AJRA 1Q1NA 1LDYA 4KDFA 5A3VA 1V8BA 2XPCA 4J1SA 2C5AA 4R01A 2OL4A 3B1JA 1H93A 2EKPA 1YDWA 3I6IA 2EV9A 4FB5A 2DPHA 2H9IA 3BMQA 1TA4A 2Q4EA 3D4PA 4CM3A 7ADHA 1U3UA 1BRMA 4KUGA 4MIOA 4O1MA 4FFOA 4CM9A 3HE3A 3DZGA 1YDEA 1XU7A 2GUGA 1B8PA 4YRDA 1GAEO 2TMDA 4OYRA 5I7FA 4N5LA 4Q39A 3WDSA 3GVCA 4D3DA 5TS3A 5DBGA 2C2XA 2ZCUA 4TMFA 3PZBA 1JTVA 5AVOA 4MVJH 2NQ8A 4LGVA 4J1NA 4L75A 4JROA 4C4OA 1WZIA 4KP7A 3DAPA 2CVZA 4O63O 3G49A 1I36A 3KETA 4FGSA 1ZCJA 2J5KA 2X4GA 5L3ZA 3PHGA 2BGLA 4BNLA 1YB4A 2ZIZA 3C7AA 1PJQA 1E6UA 4WLNA 2CD9A 4WPGA 4WK6A 4QFCA 4YACA 5G4KB 1N7HA 4CLDA 2VUSA 1U2DA 1FJHA 4IGEA 2CY0A 2XF8A 5COBA 2FWMX 3GZNA 3LVFO 1U5CA 2AHRA 5EESA 3KLPX 3DMYA 3JQ9A 3TZQA 4BGEA 5KJEA 4BNXA 5FWNA 5LCXA 3HDQA 4XQGA 3GVPA 1XDWA 4NIMA 1LUAA 1P45A 1KVSA 4IZIA 1ONNA 2BFMA 2J5RA 1NQ5A 1DJNA 2Q2QA 3RBVA 5A9SA 2VRCD 3FNGA 4Y6PA 4Y98A 3HSKA 4CLRA 1A71A 3LF2A 4A03A 4FIZA 2UUPA 1BXGA 3H9EO 1Z75A 1CRWG 4PLVA 3H9QA 4PLPA 3DBRA 2I76A 2CF6A 1BTOA 4N18A 4B7XA 5I9LA 4BNMA 2P9GA 2PFGA 3GH3A 2W2LD 3BMCA 4G81A 4IQ8A 1QYVA 2X9NA 3L07A 2TMGA 4Q9NA 4IDDA 5L51A 3H9UA 1E3LA 4E2WA 4C7KA 1E1LA 2JAPA 1LSOA 5DULA 1I3KA 2I9PA 4GGOA 1M6WA 4W7IA 2VQ3A 4QO8A 1E7RA 1NXQA 4JBIA 4D3FA 4I9NA 3ZDFA 1XCBA 4ALNA 4BQPA 4Q3BA 4AJOA 4K26A 4L0QA 1N1GA 1JW9B 1H6DA 4Q3AA 4K28A 2C2YA 2EKQA 4CV1A 3HADA 3FTNA 4I08A 2FRDA 5LC1A 3WG9A 3PJEA 1XA0A 2Q1TA 4IDBA 4IZHA 4P22A 4DQUA 1EVIA 4DPLA 2Z5LA 4LMPA 3DZFA 3LC7O 1KVTA 3PYXA 3CMCO 3W1VA 3DHYA 5GZ6A 1IL0A 4OQZA 2B83A 2FY8A 1PJCA 1GY8A 1T2CA 1UP4A 4M55A 3PJDA 2DM6A 1LSJA 4P4NA 4XJSA 3BHIA 1BVRA 5KKCA 1GEGA 1PGPA 4GKVA 4GQAA 2E82A 2VHZA 3P2OA 2Q49A 1NFFA 2J3KA 3SJUA 3R0IA 3ZWWA 5L45A 2X86A 2Y68A 2WD7A 1NM5A 4PRLA 3C7CB 4GKBA 4UREA 3FNEA 4AFNA 4DXHA 3D0OA 3L77A 3RD5A 3DOCA 4RF5A 5JS6A 1DSSG 3JQBC 3JQGB 3MZ0A 1QLJA 3VZQA 5TJHA 1QG6A 3BMNB 4J3FA 3N74A 3WXBA 4YJFB 2EF1A 1R12A 1AE1A 4IJUA 4YJGB 3WSVA 1PGQA 1GUYA 2X5JO 4BNKA 1DIHA 3VHRA 3IJPA 3ONDA 3VPHA 1QP8A 2IZ0A 1UZMA 2HAEA 4Z9FA 2NVBA 1GD1O 4IS2A 2WJPA 1BXZA 2X22A 3ZWMA 1X7DA 2EJWA 2J6IA 3F46A 4D42A 1Y8QA 3EVTA 2BELA 3WLEA 4CLXA 2R00A 4JCOA 3ZWVA 3KSUA 2X9GA 1FK8A 1YGYA 2ILTA 3HFSA 3MTJA 3V1YA 4CUKA 1ADCA 4L4RA 3DBHB 3ON5A 4I5GA 3CPSA 4UVEA 3JQ7B 1S6YA 4OGWA 3R1IA 3T7CA 5MGBA 4ZQBA 2HDHA 1SC6A 4IBOA 4CV0A 2I65A 4GVLA 3S2IA 1C0LA 4CM1A 4D44A 3NDJA 4N7RA 4PVCA 3RASA 2X0NA 3BTOA 1ZNQO 1HZZA 3H9JA 3JD2A 1ONPA 3V5NA 3RBXA 4MIEA 3C24A 4H16A 4PLTA 3JQEA 1P44A 3PWZA 3S8MA 1PQWA 1WMBA 3U49A 1RM5A 1ZXBA 3PQEA 4PLWA 2C7GA 3IS3A 1HLPA 3PHJA 4BQRA 2YDXA 1YONA 1B8UA 1PGJA 1PIWA 1EK5A 3GK3A 3H4VA 3I6QA 4UAGA 1ENPA 5HA5A 3KUXA 3CUKA 4YQZA 1JLLA 4RF3A 4B7UA 5FI5A 2ZTLA 3C1AA 3K96A 4WASA 5CHEA 3VPGA 4BV8A 2ZQZA 5L53A 2O3JA 3MJTA 4IDFA 3H7AA 1OC2A 4PLYA 1XEAA 1KY5A 2FPPA 4IXWA 3UGKA 5EN4A 4LRSB 4LSMA 3V2UA 4GX1A 3KEQA 1HWYA 2VHXA 1I8TA 4NK4A 4GMFA 5DCUA 2IYOA 3EYWA 4NK5A 3WTCA 1C1DA 4R5MA 1O95A 5F1OA 3RIHA 3JYOA 3QQPA 2E6UX 4A10A 5JYDA 5EPOA 3WIDA 1IY8A 3D7LA 3NEPX 3L4BC 1PQUA 3FCOA 2I3AA 3GNSA 3CINA 2PGLA 2X0JA 4IJVA 1U1IA 3GNTA 3WWZA 4A7PA 1ML3A 4W9NC 3LT4A 3NJ8A 1EBUA 1R6DA 1X13A 2WYVA 3M6IA 4DWVA 4IS3A 4PLZA 5TGDA 4WEOA 4A2CA 2ZTMA 1I3NA 2VT3A 4Q3CA 4B79A 4II3A 2H63A 3I1JA 2P5YA 1U7HA 2XAAA 4MP8A 2GD1O 4F3YA 3L0DA 4EDFA 1ZO8A 1A5ZA 3GNQA 2DFDA 4FC7A 1DRVA 4WLVA 2EEZA 4II2A 4Z0TA 3W4IA 4BIIA 2CDCA 3MWDB 3D3WB 4R1TA 1Y9AA 2XOXA 4RPGA 3RUEA 3ZHXA 5F21A 4GBJA 1J49A 1PSDA 1PZFA 2OP0A 4GAEA 4Q3NA 1GYRA 3ZWNA 1YVEI 3DBHA 3FF4A 1KVQA 1ISMA 3WLFA 4B4UA 4XRRA 3MEQA 4YTEA 3FBGA 3G79A 4P4LA 1H9AA 1EUCA 3A9WA 4XJTA 3HG7A 2C07A 3PFWO 4L8VA 1YQDA 1CEQA 1CQIA 1SBYA 1TLTA 2VRCA 3DTYA 5LDHA 1YKFA 4BKUA 3A06A 2Q2VA 2Y1FA 2P5UA 4WOKA 4GLOA 3I4FA 3RCBA 2QYSA 3QWAA 2JCVA 1RYDA 4CMBA 4N54A 5JPIA 4E21A 1LLCA 5CP8A 2EP7A 4EJ6A 3Q3CA 5G4KA 3X2FA 2W2LA 3WGQA 3WX0A 1LRLA 2ZCVA 2YUTA 3I9LA 3NTQA 3V2GA 5U4QA 1PTJA 2BFPA 4NBWA 3QWFA 4NU5A 1QXSA 1VSUA 2ZTVA 3AI1A 3AM5A 4LRTB 3WS7A 1UDAA 2HJSA 3G1UA 4F45A 4UEJA 4ZJUA 4J4HA 3FR7A 3DOJA 2P91A 1P1HA 3DEYX 8ADHA 4AJPA 1ARZA 2HUNA 2DC1A 3ZI0A 3HWRA 3HN7A 3GEMA 4FOOA 3IC5A 1ZK2A 3M1AA 4YAEA 4AJ4A 3R3SA 4BNJA 3RSHA 3JQAD 1UXGA 1WLYA 3PXXA 5A03A 3UHAA 4ZQHA 1I32A 5L4SA 3PLRA 1NR1A 3NTRA 5IXSA 2PKRA 1GEEA 3EW7A 3TOXA 2AQ8A 3ZWOA 3GDOA 3GY0A 4EUHA 5BR7A 4XQ9A 2D4AA 2Y05A 3WBFA 4N5NA 3PYMA 5JDIA 2DPGA 3DB2A 2CFCA 1DAPA 1JQBA 4J0FA 3UW3A 3WGHA 2GR9A 3FHLA 2PH3A 3NGXA 2VRBA 5COAA 1HE2A 2HMTA 1HDRA 2BF7A 1RPNA 3PRJA 1XG5A 3AUTA 2YHIB 2HMVA 3VPSA 3JD0A 1P0FA 3O9ZA 1A72A 3P7MA 1U2GA 3CTMA 5F1KA 2YV2A 3K2BA 3RROA 3SC4A 3E48A 2CDBA 4IJWA 5ITVA 5GMOA 1EZ4A 2CNBA 4WCDA 3I23A 3MJSA 2FPGA 1I33A 2J3HA 5IJZA 4DMMA 3JQFA 4AICA 3I4CA 2X1HA 2AA3A 4AVYA 1E1NA 3EAGA 1BXGB 2IDZA 4LN1A 4ZQFA 5JDCA 1X7GA 2NQTA 1U8XX 2QZZA 4HNHA 1ZMTA 4GL4A 1EVJA 2JAHA 2HQ1A 3LT1A 3QWBA 4TZTA 4YJFA 1NP3A 3WBBA 2AE1A 2OGUA 5G0SA 1TEHA 3CMMA 4ALMA 1K6JA 4EJ0A 4NFHA 1GDHA 1SZJG 5CEEA 1O94A 1UP6A 2CVQA 1U3WA 4KWIA 3H65A 1I2BA 2BGKA 5TJ9A 4OHUA 3CE6A 5G0VA 1I30A 1P3DA 3VZSA 3NV9A 2GNAA 1NPTO 3DFZA 3ZW8A 4IJKA 1E5QA 4I9HA 5F5LA 1BGVA 2QZ9A 4YT5A 2D59A 3WGZA 1LEHA 1JN0A 4E5YA 2WDZA 3CSDA 3P19A 2BFAA 4MVJG 4RGBA 1R4MA 4J2HA 5EINA 1FDTA 3ANLA 1IB6A 1EQUA 4IQ0A 2VZ9A 5JDCC 5JO9A 2FR8A 3MWEB 3IP3A 4U6QA 3U09A 1HTBA 1IPEA 5TQVA 3HDHA 1ENOA 4LMRA 2IODA 2W2KB 3GGPA 1HLDA 1PL8A 4ND3A 4PZDA 4R9SA 4D79A 3BMOA 3W8DA 5C37A 2BI8A 3F4LA 5TNXA 1H6BA 2FR0A 4R3NA 1ZJYA 4FR5A 1E1MA 1ENYA 4AJ1A 3BMQB 1F17A 2B69A 4JX8A 1ZW1A 5KNLA 3HUDA 4RVFA 4NBRA 1VLLA 1WVGA 4WCFA 2C5EA 4YWJA 1ZEJA 5TC4A 3GLQA 4GX5A 4EBFA 2WE7A 4PLGA 4A0SA 4CPDA 4CL3A 5B4UA 4TRRA 2UAGA 3UFXA 1Y8QB 1NQOA 2HK8A 3DZHA 4PG7A 3AWDA 4ZU3A 2Z1MA 3ROQA 3VPFA 1ADFA 1VPDA 4E2ZA 3E9NA 1E7WA 2O4CA 3DOOA 2O48X 4QX6A 4ESOA 4DTIA 4FJ2A 4BNTA 4YAGA 2Y1OA 3RUFA 3WB9A 1Y5MA 2C29D 4AJIA 1WDMA 4BKPA 5HWSA 3WR5A 3JQAB 4Z9YA 5KVQA 1HDOA 3WGOA 2W8ZA 3AU8A 5MDHA 4BO4A 1QSGA 3GQVA 4NMHA 3DBLA 3DL2A 4BNNA 2O3RA 1HDGO 2Q45A 3GOHA 3M2PA 5DCYA 1TT5B 1RM4A 1E7QA 2D3TA 3IDSA 2O7QA 1HSOA 4WJZA 4Z0PA 3K73O 3PYLA 1HXHA 5C7LO 1P33A 1B16A 1WNTA 4XR4A 3UCFA 2B36A 3VZRA 4BO7A 4CUJA 1AHHA 2X23A 4MP3A 4B7CA 3QW2A 2GF2A 3I9OA 2V6GA 3D4OA 3PPIA 4BO3A 4FQ8A 2QX7A 1VC2A 3PHLA 4D43A 1ZKMA 4CLOB 5JNLA 1GUFA 5CEFA 2E37A 1D8AA 1E3JA 4PG4A 1PL6A 5JCXA 1H6AA 1KEWA 1KY4A 3PI7A 3UKOA 2X5OA 4KQXA 1PJ4A 4R69A 1VM6A 1VJTA 4J4TA 5DBIA 1MA0A 1VL0A 5AXCA 2VYNA 4HKTA 4WGGA 5BSFA 1MXHA 1Q7GA 1SPXA 4MVJF 3BTSA 1DFHA 1I3LA 2OORA 3BMCB 1U5AA 5TRTA 4CMIA 1YRLA 4CODB 1M76A 3GN1A 1VKNA 3HB4X 2EERA 1B8VA 2B5WA 4EJMA 1ULSA 3RU7A 1NTOA 5JSFA 3NT5A 3OJ0A 3LDHA 3FI9A 5L7TA 2EW8A 3OHSX 1LNQA 3OEWA 5DBFA 8LDHA 5A5EA 2BLLA 4PN3A 1YWGO 3MJVA 1XQ1A 3DMTA 4I5FA 4CV3A 1WMAA 1E92A 4CR6A 4BKQA 4RL6A 5IDXA 1MV8A 3VPXA 2RHCA 3AM3A 1IZ9A 1T1RA 2FMUA 2I5PO 3LQFA 4RQUA 3TOZA 1PS9A 3C85A 2I3GA 4K6CA 2A94A 3KRTA 4XIYA 3GDFA 5EERA 3VZPA 4E5MA 5L9AA 1ZMOA 4MKZA 4URFA 4EI2A 4J9VA 3G1TA 1D1TA 2VZ8A 2GPTA 1NHGA 4JJIA 1HE3A 3F47A 1A4UA 2JFHA 3E9MA 3KYDB 4FW8A 4B3HA 4E33A 1YBMA 4DPKA 5JC8A 3E5RA 4J16A 1Y8RA 1KEPA 3NJ4A 2NU9A 4ALIA 1I2CA 3FN4A 2YFHA 2GGSA 3GR6A 1LDEA 4Y8VA 4IM7A 4W99A 3RUHA 1E6WA 4TVOA 4BV9A 1QYDA 1DRWA 1I01A 3IOYA 1RWBA 1KVRA 2PR2A 1HDYA 5CDUA 5HBRA 1YJ8A 2Q3EA 3QVTA 4QO7A 1SO8A 1T2FA 4CMEA 2FZWA 1UUFA 3PHHA 3WGYA 5JO0A 1GTMA 1PJTA 1N2SA 4HADA 1HE4A 1Q7CA 4BB5A 4ZN6A 1CDOA 1UAYA 5ICMA 2Q50A 3VH1A 1T24A 5AXBA 1XLTA 1B7GO 2VHYA 3H9GA 5HTOA 2VOJA 3ROKA 1K0UA 4OM8A 3O26A 1X1TA 1I24A 2FHSA 2HMWA 1CETA 4XD2A 4E32A 4JNKA 2G5CA 4BNHA 1X1EA 5BSHA 4FPXA 1QYWA 3DDNA 1XGKA 1EVYA 3BZUA 4BGUA 1AN9A 1Z74A 2B37A 2VCYA 2PD3A 2EWMA 3LT2A 2VYVD 2VN8A 2GLXA 3Q9NA 4TVBA 3JTMA 3F3SA 3OQ6A 4JN6B 4JBGA 1LQUA 1MXFA 3O4RA 5ILOA 1B3BA 1LX6A 5AXDA 4TSKA 1A9YA 1ADGA 2P4QA 1K6XA 1ADBA 1PS0A 1PU2A 4CLOA 4FDAA 3EUWA 2Y67A 1GCOA 5IZ4A 2PZJA 3IKTA 1JKJA 1ZEMA 3CZRA 3QJ5A 5CDSA 3GT0A 3IUPA 2D5CA 1ISIA 3ETGA 5EQDA 3AY3A 3AOGA 2Q2WA 5ER9A 2NV6A 1K6IA 1Q0QA 5FYDA 3MJEA 2O3UA 4QQRA 2EHDA 4NBTA 4BNGA 1U3TA 4DQVA 2WWRA 4FCCA 4D41A 1A7KA 4KUEA 2DTDA 3ROPA 4M8SA 4BO6A 1DFGA 4YQYA 5ADHA 4PLHA 2J8ZA 5DZSA 3VOSA 2VTDA 1YL5A 4YB8A 5DOZA 1ZSVA 2OUIA 1LLDA 4BNIA 4W7HA 1VL6A 2W4QA 4OKIA 1QV6A 1J4AA 5THKA 1BXKA 1CIVA 1MG5A 3Q0EA 4JIGA 3INRA 4A27A 4E31A 4Z6KA 3RC2A 2WE8A 3GMSA 1OZAA 1QR6A 4LVUA 1E3EA 4PG8A 4YA6A 2GN8A 3V1UA 4FFMA 1ZIDA 1NWCA 5F1PA 5IN5A 3ZHZA 2Y1GA 4L73A 4BL5A 2HCTA 4CM8B 2YJZA 5I9NA 1IYZA 3ZNPA 4YAKA 3D3WA 5IN4A 2WYUA 4NJMB 4XGNA 2DLDA 4CJXA 4RO0A 3T4XA 1N92A 3E1KA 4FBGA 2OBYA 5G2OA 3VH4A 1JDJA 1UZLA 3D5TA 3UICA 4OOFA 1A9ZA 5H83A 1E7MA 4HUJA 4RVDA 3F6YA 3GZ4A 2V6FA 1UH5A 2GN6A 2HMSA 4I5EA 5U1PA 5JAMA 4NJOA 2B0JA 1PWXA 1E1KA 3B1KA 2NU8A 3ZHYA 4E13A 1UXHA 4DC0A 1DPGA 1O89A 4NH4A 3LYLA 1GPJA 3KYDA 2DU8A 1RYEA 3GC6A 4EW6A 1S7CA 1PGNA 1GQYA 5TX7A 2B4TO 3C1OA 1MG0A 3JQ8B 4PIVA 2ET6A 3Q2IA 1EVZA 3GAZA 3KVOA 1E5LA 3BYZA 3E8XA 4RDHA 1C14A 4MKRA 4R54A 3W6ZA 3AU9A 5K1SA 4HWKA 4JP3A 4BMVA 2A92A 4J90A 1L1FA 1D1SA 4FJ0A 2OZPA 4OH1A 3CKYA 4BNYA 4ZRMA 4D0RA 4E30A 2NVWA 3S55A 5EIOA 1R0KA 3DZKA 3I9JA 1Q0LA 5C7OO 1X14A 2X0RA 3D3EA 4LCJA 3UVEA 2HO5A 4IPTA 5JAZA 4CR7A 4RPJA 2WYWA 4CLEA 1P74A 2R6JA 4XGKA 2EP5A 2FZEA 2VUUA 4NHEA 1EE2A 1M6HA 1QYCA 1XELA 1WP4A 2YV1A 4YRAA 4A73A 4F46A 1BVUA 4OIMA 3A14A 3W8FA 3F5QA 3RI3A 2OOSA 2CMDA 5DDIP 4UVHA 2FN7A 4W82A 4R1UA 2DUUA 2QQ5A 3C1TA 1R0LA 4O5OA 3WGIA 2PZMA 4HFMA 3TJRA 2PY6A 4OO3A 4TKLA 3C7DB 1SAYA 1XHLA 1HDZA 1QMGA 4XB2A 1DXYA 4IDCA 3ZWXA 3AM4A 1BG6A 2A9FA 4IGFA 3OBBA 5K0ZA 1VI2A 4R16A 1NPYA 3MJ4A 1MFPA 2CUKA 5HS6A 3OFSA 4CM6A 1AGNA 3IQDB 4W9NA 1L7DA 3RAJA 1GU7A 1XWFA 4AJJA 3EK2A 4K6FA 4KMSA 3K8ZA 3ZN2A 1MUUA 4PZEA 5L95A 5JDIC 3ZV5A 3PGJA 4QEDA 2HSDA 5JY1A 2Y0CA 3NKLA 4U0JA 4UVGA 1WWKA 3BMNA 1GQQA 1GZ3A 3FRJA 4D7AA 3D5QA 3U0BA 3QY9A 4CMEC 1I5RA 1UXKA 3PFFA 5G0TA 1JAXA 4OL9A 4M49A 4Y6RA 2X0IA 2GZ2A 1UR5A 4E5NA 4NG5A 5JC1A 1XYGA 2C59A 4FFNA 4EZBA 4F6LA 3PQDA 5CFZA 3VDQA 4IMPA 4DA9A 3ONFA 3ZNQA 5KJCA 4EEZA 5IZCA 3ITKA 2AW5A 4XYEA 2D1YA 2PV7A 3B20A 4J7UA 3OJOA 3WJ7A 4YAIA 3K6JA 4DLLA 4XKJA 4NBVA 1U4OA 4MVJD 1LA2A 4GSLA 7MDHA 5T64A 3ZH2A 5C7IO 1F06A 3X2EA 3NAQA 3IJRA 1YB1A 4ZA2A 2P9CA 1YE3A 2QG4A 4NFYA 3B1FA 2RH4A 1YQGA 3QSGA 3WMXA 1IZ0A 1LDGA 1F8GA 3TDKA 2OHXA 1KS9A 4RVUA 2OBNA 1ZK1A 2OP1A 1RM3A 3E82A 3FWZA 3H6KA 1MB4A 3LC1O 4OXNA 4RVGA 3TSCA 4DGSA 1B14A 3SX2A 2Z95A 4WCFB 3U62A 3JD3A 4ZICA 3G0OA 3H8VA 4RF2A 4ND2A 1ZFNA 3BHJA 2DFVA 5CEJA 3I3OA 3ENNA 1PX0A 3Q2KA 1YB5A 5T6BA 3D1LA 4BNZA 3GG2A 3UOGA 1LSSA 3WYEA 1VSVA 3AFMA 1NVGA 4CR8A 2BH9A 3UF0A 4E12A 1DC6A 2NVUA 2H5LA 3FSRA 1P0CA 1F14A 3V8BA 4AJEA 2D0IA 5A9SB 4R9RA 2POQX 3E18A 5EL0A 4CQMA 3K92A 3ZWAA 4PCVA 3DO5A 2YFQA 1BW9A 1IULA 4XB1A 4EYEA 3PVZA 4JLWA 4Q3EA 2HJRA 2XXJA 1KEUA 2D5AA 1YO6A 4RZHA 1OOEA 2ZB4A 4FFRA 4BMNA 3QLJA 1CWUA 2IZZA 3QHAA 3SC6A 5DOVA 3TZKA 2G76A 2C7VA 4JBHA 1DO8A 1XU9A 2PGJA 1HT0A 4AJNA 3ZU5A 3NT2A 1LC0A 2H1SA 1XQ6A 3GG9A 1HETA 4YT4A 3RWBA 5BNFA 1R0SA 3QIVA 5DF1A 3ENKA 3INTA 2AQHA 5JY6A 1C0PA 2YQ4A 1PJBA 3ZNNA 4E2YA 1M2WA 4E5PA 4HX5A 3DQPA 2GN4A 1NFQA 4B4OA 4CMGA 3HDJA 2I6TA 1QLHA 5KVCA 1J0XO 3BA1A 4A5OA 1HSZA 1R37A 2B35A 1JU9A 2V6MA 5JYEA 4J4BA 4RDIA 4NPCA 2GERA 2EGHA 3PGXA 1OFGA 4CL8A 1T2EA 3ICPA 2QIOA 3F4BA 3MJCA 3IAHA 1HKUA 2P68A 4NZ9A 4XX0A 1TT7A 3K5PA 3ZHBA 2NVUB 2IXAA 3AFNA 3PK0A 1YH3A 3JQ7A 3JQCA 5A02A 5H82A 2VUTA 4BMSA 1EE9A 4YDRA 5T57A 5KCZA 9LDTA 2VTEA 1EFLA 4DVJA 1PR3A 4RPLA 4ZRNA 4QECA 1DIGA 4FD3A 4ALKA 3F1KA 4YT2A 3DWFA 3I83A 3OECA 3ZV3A 4W6ZA 4XR9A 2YHIA 5JLAA 2FR1A 1Y7TA 2DQ4A 4OAQA 3NRCA 3OJEA 1UXJA 2DVMA 1Z7BA 4U8GA 4B3IA 2C82A 3FNFA 3PIDA 1L7EA 5A5FA 2J3JA 4OXKA 4RPHA 3LLVA 5U9CA 3ZU4A 4IMRA 1NQTA 1YXMA 2X6TA 4HFRA 5CPBA 4L4SA 2E49A 1UP7A 1CYDA 1W73A 1IPFA 1UJMA 4CQMD 1EUZA 1AUPA 3JQAA 1DC5A 1PL7A 3JQBA 4KOAA 4E0BA 5G0WA 2UDPA 3IIEA 2NU6A 1OAAA 1HDCA 4BHTA 4IUYA 4Z0HO 1R4NB 5A04A 4Z9XA 2OMEA 4RF4A 4GWGA 4OSPA 4CLHA 4LCEA 2PNFA 1IHYA 4YVFA 1GADO 5K6AC 2LDBA 3UH1A 2VWGA 4NBUA 3U5TA 4G65A 1TVEA 1FXSA 1LSUA 4JJGA 3CZMA 3GPIA 3H5RA 3TQHA 1VJ1A 1WPQA 3KSDO 3OA2A 3CH6A 1U4SA 3Q11A 3W6UA 4J7CA 1W8DA 2QW8A 3I9NA 2PD6A 4YPOA 2AMFA 3H3FA 4O59O 1WAMA 1YL6A 2GN9A 4OJNA 1NAIA 2DTXA 3T7EA 4CMCA 3OMLA 1D3AA 4H15A 3JQDA 2Q1WA 2O2YA 3QVXA 3JQ6A 4FOSA 4QSMA 5ITWA 4UEOA 2EG9A 5GZ3A 2Q4BA 3H2ZA 4QUKA 4BO9A 4GX2A 2Y0DA 3L4SO 5JW6A 4KTVE 3GF4A 4P4GA 1P1FA 3PP8A 4EEXA 3NTOA 5ES3A 2BI7A 4M1QA 4CQLA 4RVHA 2AXQA 5AOVA 1HEUA 3WFIA 4LK3A 1BMDA 2X9VA 5COQA 4BOYA 4R51A 3K31A 1YL7A 3HQ4O 3GAFA 4ID9A 3TWOA 1BDBA 1V3VA 4ZGWA 3BMOB 4FSHA 3S2EA 3WQRA 3VH2A 1YJQA 1VRWA 3UAGA 4ONEA 1F8FA 3FTPA 2J3IA 1N7GA 3I9KA 4I5DA 4I1IA 2QYTA 1C1DB 2F00A 1LQTA 3BHMA 1K3TA 3JYPA 1WDKA 2BFOA 3WGGA 3ZWPA 1C1XB 2JHGA 3VVCA 5DCWA 2Y93A 1KC3A 2VNSA 1W0CA 5GY7A 1MFZA 1P1RA 2R00C 2NLOA 3TL3A 4YYZA 1T4BA 1NVTA 2EXXA 3ZZNA 4JGBA 3TZ6A 4DRYA 1ID1A 3WOHA 1Z82A 1E77A 4QTZA 3GUYA 1CF2O 1T2AA 3E9QA 1EBFA 1E7YA 1RJWA 2JCXA 3C8MA 5G0UA 3ABIA 4HFJA 4RORA 3VDRA 3P2YA 1EMDA 1NWHA 4R5HA 4E3ZA 3JYLA 4RJTA 3AY7A 3FD8A 3DMTC 1LRJA 4HFNA 3JV7A 3GRKA 2DUWA 3MOIA 4IIUA 3TNLA 1MX3A 5BQFA 1ULUA 2GSDA 2QHXA 3JD4A 4GPD1 2PA3A 4QXMA 1MP0A 3H5NA 5CAEA 3O38A 2AE2A 1H6CA 3R6DA 1OBFO 3DC2A 3GHHA 3EHEA 3LLSA 2VWHA 1P31A 5K9ZA 2C0CA 4MJLA 4XCVA 5A4DA 2UV8A 1P1IA 3A28A 5I8ZA 4L76A 4X54A 4FN4A 2Y1EA 4CM8A 2PLAA 3FWNA 3TL2A 3A4VA 1E3WB 1DIRA 1JVSA 4OKNA 3U4DA 2JFFA 2RHRA 3O8QB 1SEVA 4GX0A 1DAOA 4KZPA 1A27A 3V2HA 2VNAA 3GVHA 3WQQA 1O6ZA 3RFTA 3JQGA 3ST7A 1LDNA 3GGGA 1PZHA 1GZ4A 3I52A 3AOEC 1P77A 4H7PA 1LC3A 4XRGA 2ZB8A 3GRPA 1HYEA 3RC1A 2O2SA 5A1TA 2V7PA 3U4IA 3SJ7A 4J2OA 2VT2A 4DIOA 4JQCA 5DP2A 1G6KA 4YJGA 3T4EA 4DL9A 2V6BA 2GZ1A 4IINA 1AHIA 4A26A 4MO2A 3TRIA 4WLUA 5HM8A 4S1VA 5JAQA 2NTJA 2NADA 3ETEA 3RC7A 2WD7B 3IL2A 3DBLB 1PJ2A 1QKIA 2Q1UA 4NDNE 3PDUA 2X58A 4CMJA 2VOEA 1HL3A 3KTDA 2NTNA 2YQ5A 4WEQA 4MVJI 2ZYGA 4NNJA 4XYGA 3GFGA 4WLEA 1F12A 3KXDA 1P9LA 3R3JA 1LRKA 1ZUD1 4BNFA 1XSEA 1V6AA 4BO2A 2BD0A 2NACA 3KLMX 4P8RA 4QT0A 5TSDA 3EZLA 4BGVA 1YQXA 4N5MA 2JFGA 4LSWA 4J7XA 1SB9A 4XIJA 4AG3A 2Q1SA 4PLCA 2AEFA 3RJ9A 4CM5A 5L7WA 3ASVA 2JCYA 4F6CA 1NX6A 4MVJA 4AJ2A 2YW9A 5AXAA 1SEPA 1V9LA 1PJ3A 4E6PA 1ZH8A 3OIFA 3GVXA 1T1SA 1DDOA 4NFSA 1QYXA 1Y1PA 5KKAA 4ND4A 4B8WA 3LSYA 4B3JA 1NVMB 4OSOA 5A05A 3RKUA 3CIFA 1GV0A 1N9GA 1R4MB 4HY3A 3KOUA 4OMUA 4AJKA 1SOVA 3ONEA 1DEHA 5ENDA 1Z73A 2AQKA 2HMUA 1TXGA 1FDSA 1SNYA 3DR3A 2EJVA 4RQTA 3JQ9C 4ITUA 4RVSA 2AEMA 1GFSA 3PJGA 4BB6A 5CDGA 1G0OA 5IF3A 1Z6ZA 3GMDA 2BMAA 2DBVO 1CJCA 5ILGA 4R68A 5K6AA 2WTBA 4DREA 2D2IA 4XYLA 3PEFA 4GLLA 3WYBA 1JA9A 4KDEA 2CVOA 4YEDA 3DBVO 2O3QA 4YT8A 3PDJA 3ZNOA 3IMFA 2EKLA 1PZGA 4EUEA 3LC2O 5C3MA 3EZYA 2B4RO 5ICSA 3DONA 1DIAA 2JHFA 5JXWA 2GO1A 4GI2A 3EDMA 3KYCB 1VL8A 3MOGA 3KO8A 2AG5A 4YJHA 1WW8A 4NR0A 3ZWBA 3GGOA 1UAGA 3EY4A 4UUOA 4Q3DA 4B4VA 3OF2A 2OXIA 3VKVA 1GUZA 5EJ2A 4PG5A 2YYYA 5G4LA 1HF3A 1HE5A 4TZKA 1R16A 2Y66A 3KBOA 4BO5A 3TZHA 4CQMB 1QV7A 2CDAA 3ZV4A 4FS3A 3UN1A 4BNUA 3W4JA 5DP1A 4RPKA 5EQFA 3F9IA 5T8KA 5TIIA 4CQLB 4J0EA 1E7SA 4OQYA 2G0TA 3RC9A 9LDBA 1DJQA 3ZWYA 5A06A 5L4NA 4IY1A 2D8AA 1T26A 2JJYA 3UXYA 3BAZA 5IXYA 4E5KA 3JYQA 4O6VA 1BWSA 3RQSA 1M66A 2HRZA 2GYYA 3K30A 3VKUA 6ADHA 1X7HA 3AK4A 4XQEA 4DIBA 3ZW9A 1DBVO 1I0ZA 3GA0A 3GDGA 4XYBA 1UDCA 4RLHA 3LK7A 5H81A 1EFKA 1G1AA 1ZBQA 3B6ZA 3RUAA 1ENZA 2NU7A 2DKNA 3WSWA 2HRBA 3GPDG 3M2TA 4MOWA 1ZJZA 4Y67A 3I5MA 4DYVA 1LXCA 3HN2A 1F0YA 2XXBA 3H5AA 3NYWA 2IZ1A 5FI3A 4DC1A 3K9QO 5A9TA 4EUFA 1GL3A 1JKFA 3A1NA 1GYQA 1T25A 3CEAA 5T67A 1U28A 3HB5X 1DLJA 2IE0A 2WMDA 1OC4A 1N8KA 4YJHB 4IDAA 3WWYA 2RCYA 3H3JA 1C3VA 5CDYA 3ASUA 1ISFA 1JWAB 3D4NA 4PLFA 5IFLA 2CSUA 2NM0A 4I8XA 5TLSA 4JXKA 1NQAO 1IHXA 1IOLA 3PIIA 3ZU3A 1LTHR 1Y5RA 1IUKA 2HK7A 4RV9A 4MVJE 4R4JA 1P1KA 1HZJA 1H2BA 1OMOA 1ZK0A 1WXDA 3LT0A 4B4WA 4J43A 1R66A 1VJ0A 3NX4A 2GRAA 4L74A 4XDZA 3DFUA 2I66A 1IE3A 3L6OO 3N7UA 3PHIA 3HNPA 3S2FA 3KSZO 4EGFA 4KWHA 3JCZA 2YV3A 3ROMA 2OO5A 3WIEA 4UEKA 1Y81A 3SVTA 1LDMA 3C3XA 4BKRA 1GQ2A 4C7JA 3IUSA 2W90A 3U3XA 4UUPA 1KYQA 5TT1A 1X0VA 3JQFC 2J5QA 3Q6IA 3QV1A 4BO0A 2RAFA 1I2ZA 1AXEA 4L9RA 1D4FA 4I9UA 6LDHA 1H94A 1HRDA 3TPCA 3ANNA 5CPFA 4L4XA 1HDXA 3FBTA 4LISA 3WJAA 5AQ1A 2Y1DA 1DIBA 2PD4A 3OP4A 2DBQA 1T4DA 4YJDA 4BNVA 4NI5A 1N1EA 1UZNA 4ZVVA 3GVIA 3PTZA 4D3SA 1A7AA 1E3IA 2JD1A 3RVDA 4TQGA 1EUDA 1H5QA 3OQBA 1JWBB 3DAFA 3OM9A 1ZK4A 4WNCA 4AL4A 4P38A 2A4KA 3HZZA 3AOEA 4NU6A 1C0KA 5AYVA 3OIDA 4B8ZA 2IRWA 5T5QA 4BKOA 5IDWA 5KWEA 3TF5A 3K2EA 4K9DA 2YY7A 3RJ5A 5JBIA 3L6EA 3U4CA 3G17A 2AEJA 2PH5A 3QWHA 3ICCA 4MIYA 2YHUA 3SEFA 5L4LA 1FDUA 2RIRA 4FFPA 1LJ8A 3QVOA 1Q7BA 4BVAA 4MVJM 2DTEA 2IEDA 1WZEA 2BGMA 5IAAA 2ZK7A 4KQWA 1SCUA 1ORRA 3VTZA 3ORFA 5I8WA 5I7SA 4UULA 4CMAA 1BW9B 2WEKA 4PRKA 1V0JA 1J5PA 2NWQA 1FMCA
chains in the Genus database with same CATH superfamily
2XCTB 1Q12A 4B6SA 2PTGA 1G0NA 1NE7A 2HQRA 1AHNA 1N75A 2IZ5A 1G9XA 2Z4TA 1P2GA 1XQWA 2I6UA 3FNIA 4EHBA 4LBVA 1H2ZA 1XR3A 3NEAA 2EQBA 2L18A 4KMMA 4DEYA 4HGQA 2A1IA 2HK9A 5JS8A 4JP2A 3STHA 5CM9C 3QVSA 4QSHA 1Y6JA 1KEEA 2OFFA 2WD8A 2XE7A 1YULA 4U9HS 3GJXC 3DTVA 1ZMXA 2HU2A 5F2EA 3ZW7A 3TAXA 5IC4A 1VDZA 4LX8A 3GELA 4QAJA 1HMPA 1YVDA 2BOVA 3LBYA 1XJ5A 1GNQA 4I36A 4J6FA 1KDYA 4DIEA 5LU9A 4RNCA 2VF4X 2VNHA 2F48A 5FWXA 3WL5A 5ELXA 2JHAA 3D2AA 1D03A 4C5BA 3MSXA 1IM8A 2CFTA 2JIPA 2UYYA 2VYQA 3P5SA 5EXXA 1GPNA 4B43A 2BFBB 1U3FA 3Q3GE 1KSGA 4MCJA 1S9HA 2PGXA 4RMNA 3W4KA 2EHJA 4UM9B 1FF9A 1DHRA 3FNQA 3I1FA 2H48A 4B6JA 1SZPA 2WK1A 2HA7A 4BVFA 2JKVA 1T4CA 2JAUA 2X5XA 1CNFA 1IDN1 2NT4A 5ALXA 3B3FA 5DM1A 1LF0A 4FC6A 3WB2A 4RCVA 3TEMA 4BS9A 1ZD4A 2ZKLA 4KX3A 5B7QA 3V46A 4JLDA 2HR1A 4L2IB 4V38A 3RSQA 4KVGA 1FYEA 3OZ7A 3F1LA 4C0SA 3INGA 1YACA 4OLHA 4CM4A 3EVGA 1JA1A 3D6NB 4PXYA 1URPA 3DCNA 4C14A 1BEEA 3FZGA 1DTWA 1R0WA 3CZ4A 3FOBA 3WYNA 1NURA 1JG1A 1NNSA 5HIJA 4N8SA 5E0OA 3S1LA 2OHGA 4G9EA 3HA7A 5CG2A 3RF7A 1T5BA 1FSFA 4LVCA 4H1HA 1DP4A 3GB9A 5C5IA 4EGCB 4H0CA 1TT5A 1D2GA 4IYJA 3ZCTA 3KLNA 1V3TA 3UYLA 2MSCB 3JRNA 3KB6A 2IYPA 1GR0A 4FEGA 1E3SA 4BO8A 4XEHA 3DP9A 4GLJA 4G3XA 4JJIA 1C81A 4U0KA 4R1NA 4Y7CA 3HLTA 4WTOA 1MA3A 3UPDA 3FUCA 3M4YA 1WV0A 3GFFA 3R77A 4RV5A 4TRNA 5EMHA 1NASA 1JA0A 2Y0EA 2CNNA 3E0QA 4O02B 1N2ZA 4J49A 3VTFA 5JPDA 1Y33E 1P5FA 4HWPA 4KO8A 4RGVA 2G1KA 3NS7A 1SQ0A 1WB4A 2YZKA 2I2XB 4TXHA 1GV1A 4MK4A 4QNMA 5HKKD 1A96A 3U3JA 4POAA 3TR5A 5HK9A 1P3JA 5IYZA 3U19A 2GWRA 2WU4A 2F3UA 3GJ3A 1M2VA 3QNMA 4FEEA 4DUZB 1H0KA 4IIVA 4F8YA 3ABOB 1T9CA 1XKQA 1NW5A 1UMCA 2B8JA 3UWSA 3AESB 2X7HA 4RTMA 3BOSA 3MQ2A 4RHUA 4RS3A 5C52B 3X2SA 4FDUA 2BKEA 4IJQA 4S0XA 4DCJA 4FGJA 1A77A 3ZX4A 4ZZ3A 1B23P 2GARA 3AIMA 4YGXB 3I5UA 3DW3X 3QP9A 1HRKA 2H4WA 2DFTA 4UUBA 3KHUA 4I55F 5BYKA 4OAPA 1TI7A 3ZDDA 3E03A 5JFTA 1LW7A 1EXMA 1F60A 5K0TA 3RTAA 2BRUA 5AKZA 2J5BA 2PTHA 5I7VA 3G9TA 1A2KC 4XDYA 3RREA 3PV0A 4UHCA 1C0EA 4W1SA 3RRXA 1E4VA 1GPDG 3IIMA 4N6OA 5L6LB 2OBBA 3SDBA 4ZEWA 5ALPA 1N6HA 2ZJ5A 4KYIB 3S8EA 2P6UA 2GDJA 4FLFA 2WOJA 3LZ6A 4F38A 4DAOA 1CUBA 2ZB3A 1U2EA 1PL0A 1X9GA 2CF5A 4YJ3B 2I99A 4CMKA 2O1XA 2OQVA 4INAA 4CLRB 2JBHA 3UNXA 4F4IA 5JCJA 3IYLW 4E7PA 4KTTE 2FPLA 1ZVJA 3BIOA 4UFPA 4WOJA 3W0LB 4P0PB 2NX2A 1Q11A 1ZH2A 2FUG6 5KVSA 2FFBA 1UJ2A 3ADPA 1SHKA 4BO1A 4ZJZA 3GUCA 1R3DA 1ZVMA 2BFCB 3GJ7A 4P3OA 3UV3A 3I30X 5ALUA 4AY5A 4HP8A 4NNPA 1R4NA 2OECA 5BWMA 4F4FA 1ZSYA 3A1WA 1FNSA 9MHTA 4MV3A 1EQ2A 1DTWB 3C87A 1CZOA 2I33A 2QD3A 2H1OA 2MSLA 4PYNA 4A23A 5DNUA 1QUFA 4OLAA 5HCIA 1RJFA 1NVUQ 2EGGA 4OXYA 2O50A 3PTAA 3HBLA 4PVDA 4Y6SA 5GONB 1Z4PX 1Z7EA 1BHSA 1OLOA 2NUAA 4K6MA 3A3PA 3CXRA 3VAZA 1T2DA 1UK7A 5A2QA 4KKVA 2DJIA 3TLXA 4D5EA 1OX5A 4A8JC 3S2GA 4LJ5A 1S3SA 2YC2C 1T13A 5A71A 5H68A 3WNBA 2I6FA 3RARA 1T0JB 1SOWA 1IY0A 2QAGB 3DNFA 3IP1A 4GGPA 4M9SA 5IAOA 2NMVA 3RFVA 8OHMA 1TGYA 2X3FA 5C0OE 1V39A 1SMKA 1QG2A 4FJ1A 3BRQA 1H1TA 1WPXA 3FDFA 1E9VA 1BOFA 2V8BA 4L15A 1WHTA 3CR3C 4RY9A 5LZ7A 3STWA 3FB1A 1Y98A 4ETIA 5KYKA 3OQMA 1HK7A 1ZNXA 3HWWA 3QX8A 4KXNA 3TFOA 1AKWA 1QVAA 2J41A 2HUPA 1KO5A 1V9CA 2Q46A 2Y99A 3RFUA 3V4LA 1JAYA 3LKVA 3I09A 3CR7A 4MGIR 4UCXA 3B70A 4X44A 2RGDA 3K1TA 2DG2A 5H4GA 1JT9A 3TLZA 4GP7A 4O0LA 4WZZA 1EFUA 4MQUA 1N2OA 1N3IA 1V5GA 3NP9A 4RUKA 4XEUA 1AMOA 2QKYA 3FRIA 1WL8A 4M3NA 4QUHA 1H22A 5DO9A 3TIGA 2H4YA 2HIMA 1QE3A 5F52A 3RHFA 1X1BA 3FROA 3OD5A 4LOHA 5HS4A 1SUAA 4E5VA 5DYWA 1OFHA 1Q7RA 2E6KA 4HRXA 1WX1A 4KIWA 1LKZA 4X91A 2GDZA 3O8OB 5AVZA 3IILA 1ISGA 4I14A 3NHAA 4IHJF 4QYXA 5EEGA 1Z5PA 4DA8A 3PZRA 2FSSA 2DSNA 2P2SA 3G8AA 3T35A 1T3SA 2YXEA 4Z3KA 3KE9A 3Q41A 4HAWA 1M1ZA 3O0DA 3HFGA 4RM2A 3FPCA 4UVIA 4AKSA 4QOGA 1UWVA 5CM8B 5DGTA 3E7FA 2QRJA 1Z2EA 2AK3A 4R8KA 5JARA 1I9GA 3DWGA 1GZ6A 5EJGA 5CLIA 4WUVA 1UJ5A 3OTWA 4FB4A 4EY3A 4AUKA 2QTGA 3HJAA 1K5HA 3EC1A 3NUGA 3ZU2A 4RELA 5DN9A 1VGQA 3ZY3A 3ZQJA 1GG2A 3UCEA 1T8SA 1F6BA 1AUXA 5LQMA 4L5JA 1IJBA 4Q1AA 4QUBA 5CCEA 4CDRA 4GZLA 2Q0HA 4KBYA 3EMBA 1N2BA 4ILKA 1D07A 4BVGA 1GGMA 1UPBA 3ICVA 1RP1A 2XKBA 2NOAA 3NFYA 5IDQA 4JS0A 2Q7OE 1K75A 4ZEOA 5KTKA 4JU9A 3DMGA 2IEZA 3NH6A 3UC5A 2NNWB 2CFIA 3KEOA 4RXTA 2O3SA 4TT8A 4C5AA 5GPBA 4FHGA 4TN5A 3ODPA 1GWNA 2IA5A 2FV8A 5D5PA 1J1ZA 3Q72A 3TBHA 4M1ZA 1OWLA 1VDMA 4BCCA 4ZYUA 1P4SA 5DEIA 5JCPA 2ZBDA 1EK6A 5KYXA 4GZ3A 4OQEA 4XM1A 3F8SA 4LZLA 1HX7A 3WGTA 1FRVA 3CGGA 2NXJA 5KEIA 4FN5A 4YRRA 4ZARA 2XTJA 3R7WB 3T9AA 2FHPA 2O2GA 1EUDB 2Q2NA 4IDEA 2BM0A 3DCYA 5IDYA 4I1PA 2A2ZA 5JAIA 1WKVA 1E1QD 5AKYA 2G17A 1GG5A 2D74A 4ZU6X 1X7WA 3TNDA 1O9BA 1QDLB 3DLCA 5AK4A 4B3DA 1Y6RA 4BGIA 2XXAB 3HY4A 4CM9D 1AUQA 4M2LA 4YV2A 3IAEA 3O3NB 1JWLA 1XF9A 3O6VA 3OFNA 1RJ9A 4CCAA 2FZLA 3EVCA 1AQIA 1WDLA 2FNAA 3ETDA 8AT1A 3SD7A 1X7WB 3U4HA 3TIVA 2YCBA 4EFNA 5HRUA 2JL1A 1SU7A 3SBOA 4OK5A 3CNHA 2PRZA 3O47A 4MUJA 3NXKA 2P9JA 4FT4A 3E6AA 3I42A 4FNGA 1E79A 1O5TA 4OQQA 5KOIA 2QV0A 5D7BA 1E2LA 2ZATA 3HO1A 1RI4A 1A9TA 2GK3A 4H3SA 5DX0A 2J3QA 1HM5A 3DZJA 5TT0A 2QTWB 2FW7A 4JC5A 3VV2A 3ZGYA 4AJLA 1G21B 4LW8A 4X8LA 3G23A 4WQMA 3EWSA 5C4GB 2DT5A 4Y6GB 1TTTA 3UTCA 2YXPX 4WNIA 1SKUA 4BJ3A 3AW9A 1M5RA 2O4UX 2P27A 4WBXC 4EY7A 4DMLA 2XE4A 3OCVA 4ALJA 5L3QB 5IKPA 4LWOA 1G7RA 3ND6A 5J1SB 3G5LA 4C4AA 4OX9B 3ZV7A 2LUOA 4CG3A 3UGTA 1FVFA 1LLQA 3KZNA 3V7YA 2JA1A 1DOHA 2HYDA 4D46A 4UCWA 5ESXA 2W70A 1SXHA 4E4YA 1JYEA 1SCQA 3WGLA 4A0FA 3W1EA 3BRSA 3DV0B 4DLTA 4U5XA 1NUUA 4LI3X 1WUHS 1ZM3A 3T4UA 2HDWA 5KPDA 1MC5A 2VQFB 2CZCA 1U2SA 3S7ZA 3L8EA 4KWEA 1AXGA 1M33A 1VFNA 3C6QA 3HA5A 2IUEA 3KOMA 4FHZA 4I4CA 4QXRA 4BX9A 3ANMA 4LHYA 4PQEA 1PKEA 2E4UA 1VHQA 4PSDA 3V8EA 5KYWA 5J4LA 1AJEA 3Q3IA 3DPIA 2SCUA 1JYSA 2C3OA 3FGZA 4PGMA 5BW6B 5CYFA 3D7NA 1W1UA 3BUSA 3DUFA 4J1TA 4PAWA 4BWGA 2J08A 4ON9A 2P9EA 3O2JA 3PNBA 1WZ2A 1GQOA 2VYCA 1J25A 1QO7A 4KQGA 4B40A 2R8EA 1TZKA 5FAXA 2QRLA 3OD1A 4YPFA 1G5RA 1YS4A 5KX5A 5F76A 2HKIA 1CW2B 4H0NA 3L6BA 3L9XA 2Q2OA 1VMKA 5HQ3A 4M1OA 1RSZA 4ENVA 5A3VA 2B1JA 2FFJA 2VSFA 3I05A 1GPWB 3LY5A 3AO0B 4J1SA 2C5AA 4NKRA 4E5SA 1MO4A 4ZI7B 1M2JA 1QVRA 4BAGA 1KI1A 2WKRA 1ZESA 1OT3A 2OAGA 4CFYA 4B0OA 4X90A 3M5DA 2DPHA 1NONA 1ZR4A 2Q4EA 5CCDA 4TV9B 2AEEA 3T34A 3RWMB 1N2CB 4B1FA 1GL7A 4G1BA 3FPHA 1GRRA 1V16B 2A4MA 3I45A 4L85A 1JFFB 3L05A 1EDEA 3HE3A 4CM9A 3R6TA 2GUGA 1B8PA 2QLLA 3ESRA 5DYTA 1GAEO 2TMDA 4G5SA 3FIUA 4OYRA 1L5HA 3LUBA 3GEIA 2VC2B 4D3DA 1SOMA 1FTSA 1CZKA 2VDLB 2C2XA 2ZCUA 4TMFA 1ZA1A 2VJYA 1XQYA 1U8ZA 4IGAA 1KAEA 1K6MA 1FZQA 2NQ8A 4EG8A 4CEIA 2C8JA 4N3AA 5EZYA 2REQB 4Q7KA 1NV9A 3AJDA 2GILA 4PYQA 4C22A 4JROA 1YKGA 4V0NA 4M8IA 4O63O 2IHYA 2CVZA 1Y3FE 2HHAA 5FB3A 5TMDA 2HJWA 2OXFA 1YUNA 2I78A 3DE2X 3DL7A 3PNLA 1NBIA 3P9SA 1I36A 2ZWPA 3QW4B 2NUAB 3WAJA 4FGSA 4FWTA 5L3ZA 2O6LA 3PHGA 5C5DA 621PA 1QG4A 1R4ZA 1YB4A 3CLRC 1JX6A 1O87A 1Q57A 1W5SA 3EUFA 3F71A 5AJYA 3RK1A 4L5IA 3ZHOA 4WBNA 4WPGA 5LQDA 1UBGA 4UTXA 4EX7A 4HD8A 1S9DA 4QFCA 2XB9A 4YACA 2VUSA 1LJUA 1GITA 1U2DA 1BEUB 1OLXA 3N3AC 2PSFA 5FPTA 2CY0A 3HM9A 3GZNA 2F8TA 4GMDA 1P2UA 1Z0AA 1IG0A 2BMWA 2RG1A 3HDQA 4IKEA 1XDWA 4I55A 4EMTA 4YCMA 3KWMA 1H8HD 2DR0A 4IZIA 4NWIA 2BFMA 5F9MA 4C08A 4D3YA 4YJ2A 2IBTA 4HBZA 1NQ5A 3F9CA 2Q2QA 4LOLA 3FNGA 1EG7A 2VJPA 3AFGA 3DMFA 3LDFA 3HSKA 4CLRA 2WI8A 2DUMA 2D2FA 3LF2A 3P2JA 2G83A 1QRSA 1LVHA 1XZEA 1SVKA 1BXGA 1JDZA 3C15C 4PLVA 2MCFA 3SHFA 3VR2A 2VDPB 2I76A 2P35A 3E1SA 4DG8A 3LVRE 1CG6A 4B7XA 5HUHA 5I9LA 4BNMA 2I1LA 1IK6A 3BMCA 1Q3TA 4RD6A 2BSXA 2VPZA 1W9HA 4R6WA 3TTTA 2YMPA 3W5HA 4AYXA 4F1KA 1N6KA 2ZP1A 1E1LA 1MAAA 1YVUA 5IPFA 1O8BA 4IIEA 1M2FA 4ZI3A 2CD7A 1M6WA 4US2R 3OE5A 5ECWA 4LTDA 4JBIA 2V59A 4D9GA 2H1IA 3H6HA 1T6ZA 1XCBA 3ZDFA 2ZBGA 3L8DA 4FUTA 2K7FA 4OHBA 1IEVA 4K26A 2QMOA 2GCEA 1N1GA 4L0QA 5JLJA 5FUQA 3O7MA 1H6DA 1Z6GA 4DJ5X 4RK4A 1X7XA 1N36B 1CLEA 3QX7A 5B1EA 2FZ4A 3L7KA 3ZE9A 4NJEA 4CV1A 4IH9A 3H8JA 1DE0A 3HADA 4O4IA 4TV8F 3BBPA 3WG9A 1AN0A 1QYRA 4L9SA 1Q22A 1U0EA 1UK8A 1YTLA 2IFTA 1K7YA 2A33A 4HJRA 3MAJA 1VTKA 1XZBA 4K9OA 4P22A 5ED0A 3U56A 1EVIA 3BGWA 4C0LA 2Z5LA 3U2QA 3LC7O 1G19A 2R1TA 1KVTA 4C21A 4FCTA 3CMCO 2ID4A 1IL0A 1FS4A 5FL7D 4WINA 1UKBA 2Q0QA 4EA7A 2V54A 5A4KA 1UP4A 2UZIR 2CXNA 3KVNA 1YJCA 5F78A 4XJSA 2XNDD 1XXHB 1WXHA 1UCFA 2ZR0A 1NVWQ 5C18A 1FA9A 4GKVA 2E82A 4AW9A 2XMBA 4KO1S 4X7MA 2IHKA 4H17A 4LA4A 4N3BA 2CLFB 1NM5A 3L1HA 3UG6A 3TMAA 4AZ0A 5J2UF 1Z5UA 2I0FA 3E2IA 1J0EA 3RD5A 3MTBA 1KYXA 4YREA 3TTVA 3V4ZA 5IT9A 3KKPA 4MPJA 4BCDA 2YNMD 1RWOA 3JQBC 3JQGB 2UZ1A 1QG6A 3BMNB 4J3FA 1U28C 4PIMA 2EF1A 3LCUA 2IU4A 4EQZA 1BC5A 1BE8A 1OFVA 2X5JO 3U4MA 1WXXA 1IBCA 4PO9A 1SQFA 3VHRA 3JVEA 1GKLA 2XSZA 2EW1A 2CUNA 4NATA 3RIMA 2PSDA 3OEHD 2A1UA 2DLNA 5FPQA 1OAOA 2WJPA 1XRNA 2X22A 5REQA 4OI1A 1X7DA 3Q9LA 3ORQA 1R9JA 3UT5B 3MPOA 3QUTA 4KPFC 3F46A 4EPTA 2CKDA 3NLLA 3PQ5A 4ZDJA 2WRZA 4R2LA 2IT1A 4E51A 2F9MA 3DTVB 3BL5A 2ZR9A 3W5DA 2R00A 3ESYA 3KQHA 3RAPR 1A8PA 4JZKA 4C7OB 1FK8A 5BY2A 3CT6A 2ZZNA 3V1YA 1ESMA 5JSZB 2Y4OA 3JQ7B 1S6YA 1XKTA 1DCTA 3K09C 4DJFC 1SIOA 1NDHA 2AUNA 1DT5A 1SC6A 1Q21A 2VRNA 4FCWA 4OK6A 4ZEVA 4UHHA 1JU3A 4YASA 5DLDA 5YASA 4AF8A 2KQUA 1A8IA 1C0LA 2AF3C 3KG2A 3L3BA 3LG2A 1V8PA 3BQNB 3Q5GA 1ZGBA 1EK2A 3IPRA 1HNWB 1GP2A 3EIXA 1U3CA 3P71T 3DKIA 2Q6KA 3CNOA 5DE3A 1CEXA 2B1GA 2C5FA 2IPMA 2J9XB 4KLRA 3SYLA 2D3WA 2VPTA 1JEYA 4PBTA 4H16A 3JATA 4CKEA 4KVAA 4UXHA 4F04A 3JQEA 1U0GA 4EFLA 1J97A 1RM5A 1WQ3A 3TE7A 1F9EA 1ZD5A 2ISSD 3PRKE 4MKFA 4J3NA 1C4KA 3AJ9A 4AULA 1WO8A 4YUWA 1Z8NA 4ER7A 1B8UA 4UAGA 1W87A 1YR3A 3QVKA 1AKEA 4UDYX 4P5PA 1M34A 2HSWA 4UU1A 1SC4A 3GX1A 2B4AA 3KUXA 3PRHA 1U0LA 2Q4RA 4F84A 1AQUA 5FOQA 2AL7A 2RGWA 3K96A 5CHEA 4ZVKA 1R6UA 3ABRB 4QYTA 3RGGA 2XAUA 3MJTA 3GYGA 2B94A 1J1IA 2GM9A 4WY8A 4Y2PA 2RI6A 5IABA 3I01M 3UGKA 2VAPA 2ALJA 3A3YA 4GX1A 4WVLA 3V2UA 4ETNA 5HF6A 4JQOA 3BPSA 2ZZMA 4NK4A 2GBLC 5EKDA 2F3TA 2G9VA 4REQA 2OESA 3TUJC 3WTCA 4QJBA 1ZC4A 4R5MA 3RIHA 1FFGA 2QM7A 3IAAA 5EPOA 1S2GA 3VPAA 1IY8A 5AO9A 4BEVA 4HQLA 1SUCA 3ESAA 1VLZA 4MV1A 2FPKA 2CV2A 3QKSA 4ESEA 1U1IA 4L8YA 4A7PA 1ML3A 1FS5A 3LT4A 2YZMA 1R6DA 2NO4A 1CX9B 2X7JA 2FPWA 3LM8A 2Q0XA 4LYHA 4UTZA 2YWXA 4HMPA 4PLZA 3SX0A 4WEOA 1JJVA 1FVOA 3EE6A 1A8HA 1E2UA 2UXBB 3B1VA 4NS1A 3HUEA 1G20E 2BAGA 2H63A 4II3A 3I1JA 3IUJA 4I66A 1SBCA 3U80A 4EDFA 2IPXA 5DMXA 4EHLA 3OLWA 1GPLA 2P2ZA 2ZWAA 4V1CI 2Z5FA 1KYZA 4RE6A 3IKJA 4WLVA 4II2A 1Z0IA 2H85A 4OJMX 2YVLA 4Q7QA 4JEHA 4R1TA 2XOXA 5FBRB 5K0BA 1GU0A 5SZHB 4GAEA 3CLUC 1YVEI 2ZLBA 3FF4A 3ERCA 1KVQA 3OM1A 1BGWA 2QSJA 3O95A 4M8KA 2HEIA 4F12A 3SJAA 4YTEA 1TM1E 3G79A 4GKAA 3GT3A 2F4VB 3QIAA 3M3PA 1YQDA 1CEQA 2GN0A 2Q6IA 1CQIA 5EEHA 4F9TA 1FFXB 2EFYA 4KB5A 4QQFA 1IVSA 2HXGA 1TKRA 3SQWA 4P36A 2P5UA 5NULA 4DDHA 3NIBA 1HR0B 5ELMA 4JL6A 1GLGA 1UJBA 3BRWA 1YS2X 3SEZA 2ZGVA 1X9IA 2MMGA 4ROTA 4E21A 1O6GA 1JECA 1PJAA 2EP7A 3V7WA 2OBLA 3Q3CA 4TLEA 5BNZA 3BXFA 2IQ5A 4CXMA 1IIBA 5A5GA 1NW7A 4ZZ1A 4H7FA 1X1AA 3PUJA 4QBKA 4JUFA 3AYXB 3FKQA 1LRLA 1KRXA 1NT4A 3I9LA 3QUCA 5TMBA 3AHFA 3S28A 3RE1A 3V2GA 5I4CA 4B44A 2H7CA 3IQZA 2QX4A 3FVQA 1ZOSA 3ZCQA 2ZTVA 5E7JA 2BMVA 3AI1A 4MS3B 5FADA 5FYQA 1Z06A 1P6XA 1K5GA 4JLVA 2EBUA 3WP0A 3K9NA 4F45A 2ECPA 2X1MA 1CUJA 2IHTA 3OCWA 1XPRA 3U7HB 2P91A 1NN0A 1XZLA 1FFWA 3DEYX 2ACEA 1EXWA 5H02A 2ZSDA 2DC1A 1XMSA 3ZI0A 4PYRA 3WYGA 2I54A 5E6SA 2CB0A 1MQ9A 3H3XA 4FMDB 5TQ2B 4S35A 4W7SA 5JH7A 3B7WA 2PKWA 1P91A 1KQNA 5B3AA 3J7AC 2DYKA 4M83A 4BRZA 1E99A 5FA8A 4TMYA 1NR1A 4G5OA 4PS1A 3ZVNA 2VPWA 3TOXA 2ZBUA 1GRQA 2PGAA 3R5XA 4QOHA 3GDOA 4EUHA 4Z8XA 2OLEA 3WGKA 2Y05A 1AV6A 1FDOA 2ZT7A 4N5NA 1I6LA 5L3SA 2DPGA 4D8XA 1I0LA 3OCJA 4Q1DA 3WGHA 1F6DA 3TGLA 1QGUA 2R6AA 2CYCA 2VRBA 4BBJA 5HKAA 2ZSKA 1HE2A 2BFBA 2G0NA 5DGCA 1IBLB 1I4DD 2J9RA 2PLRA 2C92A 3P0IA 1QAOA 5LB2A 4KFTA 1HDRA 4QXQA 1JR3D 1J70A 1Q1ZA 1HOXA 2CMHA 4HDKB 5FP0A 2CBXA 5FUWA 5T3YA 3ROGA 3DMPA 2JIDA 3AKZA 3A2KA 1SUPA 4C7OA 1RWMA 3VPSA 4MA0A 3MBKA 1IY9A 1XDGA 3H11A 3JD0A 1P0FA 3O9ZA 1SWVA 2A1TS 4HVAA 1KDRA 4BVHA 2YV2A 3SC4A 1U9IA 5AHOA 3EXAA 5ICEA 2CDBA 3I58A 1CIPA 5C1DA 5GMOA 2O9JA 5BW8A 2QB5A 1F2UB 2BCJQ 5JASA 3MJSA 1HG1A 2FPGA 2GYUA 1X74A 4D4IA 4CCYA 4DMMA 2H08A 3ASZA 4AICA 5KTPA 3NAGA 4R05A 4AVYA 1E1NA 1HLGA 2MSNA 2RGXA 1TM5E 4RIHA 4ZQFA 1YUBA 4ZOLB 1EVJA 2HQ1A 2ZRLA 3RHZA 2PS0A 3EQ7A 1PNOA 1FMLA 2AE1A 1KQ3A 2GA8A 1QCZA 2DHDA 1G5QA 4EARA 1BYIA 1MORA 1N4AA 4ALMA 5FLKA 3LA6A 4CF7A 5JHGB 3PFBA 3V8NA 1SZJG 5CEEA 5B6PA 1L5ZA 4KWIA 5EE3A 1U7XA 3VHXA 4BJ1A 2ZSFA 1AKTA 3H65A 3OC0A 3T3NA 5ARBA 1OHHD 1C41A 2PR7A 1YRQA 1I30A 5A4IS 3CQ9A 3IFSA 3MRXA 5AJXA 1VQ1A 4P7GA 5KYUA 2ZBFA 3BRWD 3V3TA 3ZW8A 3QFHA 2DWUA 4W5RA 1E5QA 1Q0RA 4IVRA 3HJTA 3UKDA 4RTRA 2P0YA 1PHRA 3DOEA 1TAHA 1QX3A 4P2GA 3WGZA 5JC8A 3B2EA 1U94A 3C7TA 1UOEA 2R6DA 2B0CA 4HLUA 5K20A 1O96A 4F6RB 4MVJG 4NESA 4RGBA 1LPNA 2OQIA 2RK6A 2YVKA 4LWQA 2TS1A 1EQUA 3WZMA 4IQ0A 2M1XA 2VZ9A 1RMTA 4FHDA 5JDCC 4EVRA 3IP3A 4LYDA 1P7PA 4ZVLA 3AEXA 2FRDC 2W2KB 4RENA 1YAHA 3GLTA 1I6MA 1PL8A 4DB2A 4XQ0A 3K8OE 1PVVA 2F7SA 4TL8A 2O20A 3DEKA 2BI8A 2JATA 2VBGA 1BN6A 3HC7A 1QZZA 2B6NA 3CVJA 4D8VA 2FR0A 3DE6X 1ZJYA 2QQEA 4FR5A 1UBTS 5G1OA 3ZD6A 1SQ6A 3S2ZA 4DLSA 4JX8A 4MS4B 3T7SA 4ZDIA 2Q7XA 2OILA 5DTJA 4RVFA 4OHOA 4RMHA 1VLLA 3HZHA 1MB3A 3UB4A 1CZRA 3GLQA 3K15A 4B6RA 1S2LA 1KDVA 2WE7A 1N2XA 2OZVA 3O4IA 4PLGA 3SHQA 3IO5A 4QM7A 3M1IA 3NKVA 3PE3A 4NSNA 2ZITA 3KHSA 3IDQA 4AS3A 3PUVA 1FJGB 1G60A 2AB0A 2GX6A 2HK8A 4WIAA 3WAKA 4HNTA 3DZHA 2MSKA 3AZPA 2O1WA 2ZYSA 4GI1A 5C34B 2Z6AA 2CLDX 2J33A 3ROQA 3O5AA 3MM4A 4K9NA 4L28A 1W5BA 2Z2ZA 3VU9B 1E3QA 2MSDB 5ALRA 3ZGLA 4FFSA 2O4CA 4UOEA 3DOOA 5DB4A 3E8SA 3P9KA 4XVCA 3DUFB 4QX6A 4Y2YA 4YN3A 2NN3C 4ESOA 2G67A 5JUWA 1INLA 2UZ3A 1T9KA 2B20A 4MQFA 4WV3A 1OBVA 1GTSA 2ODTX 2GEUA 4O4IF 4TV8A 3RUFA 1GKIA 3F0TA 3IEIA 5AUNB 1Y5MA 1WDMA 1TEVA 3ZQ6A 1N5MA 1B6GA 3ESXA 4P7FA 4D8WA 4Z9YA 4LZJA 1HDOA 3WGOA 2W8ZA 4MUHA 4XW2A 4Y18A 1K4KA 1QSGA 3A6EA 3GQVA 3DL2A 1WHSA 3M3HA 4EW1A 4F9FA 3M2PA 2Z9CA 2ES4A 1NGSA 3NW9A 1JBQA 2XLCA 2BFEA 3LQ1A 3DOUA 2D3TA 2V7QD 2JGLA 3FJYA 2XTMA 4H1TA 1NBWB 2WJZB 1KSJA 3PYLA 1HXHA 3Q7IA 1DPFA 3C16C 3AYZB 3E9RA 2QR3A 1P33A 4BE4A 4EHFA 4Q9JA 5GWXA 3DR5A 4R31A 2HHJA 2GJSA 2AW3A 4BO7A 4KNYA 2AG1A 1O1YA 1OGYA 2ORYA 4G37A 5LJIA 3R41A 2XUOA 1GRVA 3PPIA 3D4OA 5CFRA 3Q3EA 1SBTA 2FPUA 3HI4A 5IEJA 3VBEA 4FQ8A 3V4FA 4PBSA 4XWGA 4D43A 1PR0A 3KXKA 4EI7A 3VISA 4DT1A 1TZJA 2FCAA 1E3JA 1DAGA 1NF9A 3HXTA 4PG4A 1DIOB 2R1ZA 4IJMA 1U8UA 3F7MA 1PL6A 5B1HA 1NRWA 1ZG3A 2I3BA 3GW8A 1NZDA 4PICA 3SFZA 2IEYA 4C87A 4HT3B 4TVSA 3NAMA 2I91A 3N2LA 5DNEA 3NXSA 5CVDA 5HRCA 3JASA 2AJ8A 1QKKA 5B64A 4TMTA 3GGCA 3ZD8A 3K5WA 1H23A 1HL7A 4J4TA 1UBFA 5AXCA 1YS7A 1GFWA 4HKTA 4WGGA 1JAIA 2PLNA 4MVXA 3HFJA 1XK6A 1JNXX 1UC9A 2AX4A 5T4BA 4HQRA 3LX5A 3E23A 1JIJA 2W58A 2GCOB 4NYJR 4Q7JB 1NC3A 4MDEA 4CODB 3MGAA 2I1QA 4NV0A 1AV7A 3UAVA 1JDTA 2D54A 2SHKA 4JBWA 2BCEA 4OU4A 3ZCRA 4EJMA 5AHWA 2UVPA 3T6KA 2WB2A 4PZ9A 3VR4D 4BRSA 3QXSA 5BRNA 5C31A 3UJNA 2SCUB 5DHUA 3H1GA 3HA2A 3NPAA 5JSFA 1NXVA 3DKKA 4QELA 2NXNA 4PNEA 3LUFA 1CUIA 1Z8DA 2GPSA 2K2WA 5FKJA 3BIWA 2I6GA 3OEWA 4HN2A 5DBFA 5HEKA 2FSVC 3CLHA 5A5EA 1Z4OA 4I55B 4Q21A 2QJOA 1EVQA 1U9CA 1Y42X 2FLVA 2PJUA 2VBIA 3MJVA 3DMTA 3T7JA 4UHEA 1PG0A 4HQFA 2AYYA 4CV3A 1LBIA 4RWZA 1WMAA 4E08A 3RSGA 1DOAA 1E92A 2R8XA 1JR3A 4RL6A 1MV8A 1NIJA 4WOCA 3LV8A 3IV7A 2RHCA 5HPYB 1IZ9A 1EAYA 1T1RA 4L07A 3ER9A 1P5JA 1YS1X 3E3NA 3QVJA 4GYJA 2BEVA 2JGNA 4K6CA 4PYOA 1HE8B 4EMBA 2C7PA 2H7XA 5K8JB 1FQOA 1ZD8A 3KX2A 4HSGA 4UHDA 3VO9A 1EFRD 2H2AA 4P4SB 4A2QA 3KQKA 3TOCA 2D1RA 2GPNA 1TUEA 3WKCA 2QMYA 1Z0KA 4CHGA 2GPTA 4JLNA 2I2FA 3F47A 1A4UA 1XJQA 4R1MA 3EJWA 3MWFA 1Y8RA 3JZMA 3NJ4A 2NU9A 3QHPA 2YFYA 4GZ6A 4OCZA 4ALIA 4JT4A 1I2CA 2IIPA 1NY6A 1RJDA 4U1RA 1QIDA 3A0UA 3I34X 4IM7A 4QOIA 3K0KA 4RH3A 2FQ1A 3KR0A 2Y4NA 5J1TB 3EPKA 4D82A 3TX2A 5IT4A 1I01A 3IOYA 2HM7A 2SKCA 1PD1A 1TM7E 4UMFA 4AKEA 2XGJA 2G9RA 2X13A 3PXAA 4V02A 3HSSA 4QPDA 2ZS7A 5HBRA 1KDTA 2PFKA 2Q3MA 3R8XA 3QVTA 1SC1A 3VYSB 5IU6A 4NAVA 2W48A 4XGQA 3BC1A 4OY3A 3H11B 5KDLA 3TGWA 3GLIB 4I99A 4ZKEA 2WB4A 5AK0A 4ZN6A 1UAYA 5I9TA 1ZJ6A 4Y1EA 2LKCA 2J3LA 1W5TA 2KBEA 4ZQIA 4IV8A 5DWVA 1KJ9A 1ZX1A 3RJZA 1ES9A 1B7GO 1XZKA 2QPOA 2ZE7A 1G8GA 3BWVA 3H9GA 1WUIS 4M38A 4YLGA 5I5EA 5CFLA 5AOAA 5BQOA 2AF4C 2WAOA 3KTOA 1X1TA 5EHNA 1FP4A 3DLAA 5ALNA 1LF5A 4YRJA 1DWOA 3ZWQA 1CTQA 1MO2A 2FJUA 4R8VA 3X1WA 5JAHA 4N12A 4V0QA 4BBPA 1BHJA 4IWNA 3IOCA 3ZE6A 4JSTA 1NLYA 1XGKA 1THMA 2HHCA 2I62A 2WIDA 3BZUA 1AN9A 1Z74A 3MMNA 5G53C 4MR7A 3OPVA 1YU6A 4MYDA 3LXUX 1IZZA 2EWMA 4QGHA 1RRPA 2VYVD 5IBCA 4RZ2A 2FUCA 2IPNA 3IRVA 4MJ3A 4RD0A 1G2OA 3F3SA 4JN6B 2OD2A 3A3KA 4PGGA 3LGXA 3O4RA 3BFPA 3TE6A 1D2AA 1M0SA 5DLYA 1VGVA 1ABBA 4F1WA 1K6XA 1PU2A 5DI3B 5AW0A 4FDAA 1RCTE 3P0JA 1PSWA 1NJSA 1JKJA 3IKTA 3CUEF 1T35A 3ZK8A 3I2JA 3GO4A 4TXJA 1POXA 1NBAA 3QFCA 4WAUA 2RAVA 1SK9A 1SQSA 1AURA 3L7IA 1KMQA 5JYCA 3AQIA 4FEYA 3AY3A 1J33A 4IHJB 4EGSA 4PZYA 4EWLA 3HCCA 1SBNE 2GN1A 3AOGA 3KYJB 1EINA 2NV6A 1K6IA 1Q0QA 3LP8A 1PTKA 4Q9LA 1ZUIA 5FYDA 3WLIA 3PFGA 4J0HA 1VIMA 2QU7A 2ETXA 5EJAA 4D41A 2PE5A 2RGYA 4BO6A 1GPBA 1IJKA 2ZT6A 4HLUC 3N0RA 1QH0A 3PS9A 2VTDA 5CA1B 2OUIA 3G0CA 2IL1A 3E5HA 1KOJA 4GDFA 2XYVA 2W4QA 4OKIA 3EULA 1YB7A 4QDZA 1ZAKA 4BTLA 1MG5A 3Q0EA 4NJEB 4A27A 4X65B 3WNCA 3OE4A 2RMKA 1W48A 2IF0A 3GMSA 1Z0SA 5CK4A 3V00A 4Z6KA 4NEGA 3TRDA 1SHLA 1JEQA 1RRVA 2DH5A 4FFMA 4D74A 2BDEA 1H5UA 1T5HX 1ZIDA 3QXGA 5IN5A 5TQ0A 1IEWA 4L73A 4HGOA 4CM8B 3DS8A 4CVNA 1YNSA 5I9NA 3G1WA 3K09A 4OHWA 1RJ9B 4U2CA 4YAKA 2NP7A 2FZGA 2A3NA 4RO0A 3HB1A 1MJHA 2F9LA 4DUGD 3DXYA 4JSYA 5KWJA 1FSZA 5G2OA 2PUWA 3ABQB 1UZLA 4L7VA 5CT5A 4EUSA 3D5TA 5FXMA 1A9ZA 5H83A 4ZOCA 3RAEC 3KL2A 2P69A 1M10A 2V1UA 3QZUA 3S5UA 3GZ4A 4TYPA 3SP1A 1U7UA 3P2KA 1YSCA 1YGPA 5AVKA 2X2PA 2XODA 2X0KA 4I5EA 3ZXIA 4EG1A 2JDID 1QONA 1JV2B 4OXQA 1XAHA 4EGAA 4V0LA 1G5IA 2Z83A 5FT9A 3QPUA 1E1KA 1TAGA 3RT9A 2NU8A 2VRWA 3AUKA 4PHGA 3SBDA 2CEKA 2FW9A 2Q6OA 3QV2A 4DC0A 3OEED 4Y1GA 4OTZA 5GGXA 2IV2X 1GPJA 4MTLA 2NGRA 1S7CA 5JI2E 3L0CA 2PQ2A 1WMEA 1QGZA 4L8FA 4XVHA 4J16C 4X1IA 1II8B 4YAWA 3SNKA 5TX7A 4BFLA 2PRKA 1YCGA 2B4TO 3C1OA 4NOLA 1MG0A 3ROXA 3MJHA 1D09A 4HNQA 1NW3A 3OESA 3MLEA 3JQ8B 4Q93A 2DKOA 1WSDA 2W9XA 3BYZA 3FYSA 4FE4A 4OATA 5F4BA 3LTNC 2NO7A 1ODTC 3FWHA 3U17A 4CKXA 5K1SA 4AQDA 1SELA 2O8EB 3ZZMA 3VYTB 4DB4A 2WJAA 3CIOA 3Q7TA 4RTQA 3L6CA 4JP3A 2FMKA 3QBEA 5A0FA 2A92A 1FUIA 2OZLA 4FJ0A 4KG7A 4OH1A 3CKYA 2BFFA 5LOVF 4JLJA 3EZFA 1XQVA 2A57A 3DZKA 2QRQA 1YQQA 3G2MA 3I9JA 5AK3A 4ZVQA 3UAYA 3UVEA 2CXQA 4LCJA 1ZQ9A 4FTWA 3FGPA 5JAZA 2WYWA 4CLEA 1Q1QA 1Z0ZA 1P74A 4P1ZA 1EDDA 2IP2A 3M70A 4MAMA 4ZVUA 5AW7A 2ZIAA 1R3UA 3NBYC 4AMVA 1LFAA 3UH0A 4DS3A 1OASA 1X8JA 2VP9A 1E5VA 1AB6A 2VUUA 2HT6A 3FPSA 2OM6A 4J94A 2BJVA 5F9HA 3OFND 5BPHA 1IMJA 1SVUA 5DK6A 3IDZA 4M0LA 5I9IA 4MHTA 3N5KA 1DAHA 2R6FA 4X1IB 4BX3A 2NAFA 2A14A 3W8FA 4UPVA 3WISA 1P4JA 2CMDA 1P7ZA 3I9V6 2A6PA 4GEGA 4KQFA 2ACWA 4P54A 1JFRA 2DY1A 4TWJA 1OGJA 4EKEA 4R2MA 4NH0A 1ZVQA 2QLNA 5JPCA 1ZUNB 1EIZA 1R4AA 2PZMA 3TUIC 3C7DB 5BQ3A 2WHPB 4XFKA 3H2KA 2VLBA 1JHMA 4N3CA 1Q1EA 2IZ6A 4NTZA 4A2WA 2ZVDA 5LD2C 1BG6A 3K16A 4RK0A 3F9RA 4ZCIA 4CNQA 3A2LA 2VLIA 1OTXA 2V03A 3D3QA 3CF6R 1NPYA 2Z0MA 1GA4A 1N9KA 1E6LA 3BFVA 4CM6A 3ZVKA 2H2WA 2ZJFA 3P2MA 4M1YA