2B5VA

Crystal structure of glucose dehydrogenase from haloferax mediterranei
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
357
structure length
355
Chain Sequence
MKAIAVKRGRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
molecule keywords glucose dehydrogenase
total genus 114
structure length 355
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2b5vA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2b5vA01
3GQVA 4YBZA 4EYEA 3K96A 4ZQBA 1MG5A 3JQFA 2RAFA 3F5SA 2DTXA 1VSVA 3MOIA 4FFLA 4Z9YA 4KDEA 2EWMA 4J7CA 5KJCA 2Y93A 3OEWA 2CMDA 2IXBA 4J91A 1JVSA 2Y1GA 5T6BA 2FOIA 1AHHA 3VDRA 4QFCA 3PHHA 1DXYA 2Q46A 3B1FA 4R3WA 4FSHA 4RVHA 1OC4A 2EV9A 3U3XA 4CODB 1HWYA 3GC6A 2WE7A 1TB4A 3PHLA 1NPTO 4Z0HO 4M87A 2J5KA 2P2SA 4HFMA 2X7HA 4M55A 2HAEA 5KWEA 1YVEI 3ETDA 4AFNA 5JCJD 4XZ3A 1P9LA 2O4UX 4OSPA 3V2GA 3GPIA 1K3TA 2WM3A 4J7XA 1DFIA 2Q2VA 2I76A 4AJJA 5JCJA 1TA4A 3ZHXA 1S6YA 4LRSB 2VHWA 3FBGA 5EIOA 1GYQA 5JDCC 1RM3A 3PQDA 3NUGA 3QA9A 4OJNA 3UH1A 1E5LA 1XQ1A 3D5TA 4RJTA 3LSYA 1VC2A 5K1SA 2PKQO 2ZQZA 4YXFA 3SVTA 4L0QA 1T4DA 3ZHYA 4F46A 4R9RA 1DAOA 1LBEA 1PL8A 2OZPA 1HF3A 2NU9A 3ADPA 3DC2A 3M6IA 3O4RA 4WE3A 1PR9A 4INAA 4ZQHA 1UH5A 2YFQA 2VQ3A 3LT4A 2VYNA 4XYMA 4E31A 4YAJA 4GLLA 4QQRA 1B3RA 2NADA 3O9ZA 4M89A 3ENNA 5FI5A 1GCUA 4E2XA 3ZWNA 4Q3CA 4JJFA 4BUCA 4R1SA 2XOXA 4F6CA 3KXDA 1HL3A 3TZHA 3AI2A 4MKXA 4CUKA 1GR0A 3WBBA 5LDGA 2J3JA 4IZHA 1V3UA 3BXXA 3ZWAA 1MFZA 3BHJA 2YY7A 2C59A 2AXQA 1UJMA 1JAYA 5L7YA 3SJ7A 3ULKA 1PIWA 2Z1NA 1R4NB 4CMGA 4XB1A 3UOGA 3OHSX 4PIVA 2PD4A 4CM9A 5JY1A 4IDDA 1CWUA 4JXKA 1UXGA 4J0EA 1U2GA 3EY4A 3K92A 4DQVA 1UP7A 2E49A 2VHZA 2OBYA 4GSLA 3GR6A 3BTVA 3OIFA 1QYXA 1LC0A 3C7CB 1QYCA 3I9MA 2WYWA 2NU7A 2B5WA 4IIUA 3GEGA 1R0SA 5EMHA 4CUJA 1EVIA 2D59A 2EIHA 1VE9A 3GGOA 1YQDA 4AJLA 4RVDA 3AUUA 4YPOA 4XQCA 3ONFA 4NG5A 2BH9A 3NJ4A 2VRBA 2PKQP 2HMTA 3PQFA 2OO5A 3DR3A 1HDZA 2E48A 3VC7A 3OETA 3DDNA 3PYXA 1DPGA 2GUGA 2DVMA 4DIBA 1C1XA 4GPD1 3WWZA 2A4KA 3MTGA 2ZYDA 3LT1A 3WNVA 1RM0A 3ROKA 2X9VA 3VTFA 2JHGA 2P9EA 1DJNA 1N92A 2Y0DA 1T25A 2DBZA 2Y1EA 1BXKA 1A4UA 3K9QO 1DLJA 1ZXLA 1VJ1A 1PU2A 1UAGA 4MKRA 1A9ZA 2QZZA 1HZJA 1KS9A 2RBEA 1MP0A 3H9EO 4IDAA 3AUSA 3HSKA 3AJRA 5EERA 1X7DA 2G82A 2Q2WA 4DIFA 4B4OA 2OOSA 3O8QA 4YVFA 3PGJA 4EGFA 3K2EA 3K2BA 4N7RA 4D79A 1J49A 4FB5A 2B4RO 3OFSA 3KBOA 1R4NA 2EKQA 2OP1A 4FJ1A 3FWZA 4RLHA 5C5IA 1GY8A 1PQWA 2JAHA 4WJZA 1P1HA 2AQIA 2Z1MA 2DTDA 2O23A 1IHXA 4IIVA 4WLUA 2YZ7A 4WNCA 3WYEA 4C7KA 1ZW1A 3IS3A 1T26A 3SC6A 4OHUA 4FDAA 3UKOA 4E13A 3S2GA 3ST7A 2NNLD 3PFFA 5HTOA 2GRAA 4Y6SA 2X8LA 1OBFO 4NBRA 5KNLA 3KLMX 4B4VA 2ZTVA 4E3ZA 1GL3A 4XQEA 5LDHA 1BG6A 3X2EA 2W98A 3GDOA 2P4QA 3C24A 4ZRMA 3PDUA 3I9JA 1EFLA 3WGTA 1EUCA 3VZSA 1PZEA 4CQLA 1LTHR 5JMPA 3WS7A 1IUKA 3SX2A 3JQEA 4XEHA 3TF5A 2CVZA 1TEHA 1I24A 3D4PA 1U28A 4CLRB 4PN3A 2RCYA 1QYWA 3PFWO 3NV9A 3GA0A 4J4BA 4ALLA 4J1TA 3LF1A 5AXDA 3RC9A 1Y8QB 1QYDA 4FC6A 3DBHA 4PLPA 3S2IA 3GVCA 3A06A 1I8TA 1UR5A 5BQFA 1TLTA 5IAAA 3U4IA 5IDWA 3TNLA 2AG8A 1WWKA 5JFOA 2BF7A 1WVGA 1TVEA 1E0DA 2I9PA 3BZUA 3W4KA 3PQEA 1BTOA 1HSOA 1LI4A 4LN1A 4N5NA 3AK4A 1E7QA 4GLOA 2IRWA 4YAKA 3IDSA 3IKTA 2Q1TA 4XDZA 1LEHA 3E9QA 4PCVA 5ICSA 3WIDA 3GNQA 2BD0A 4DLBA 2Y0CA 3DZJA 4K1LA 2YYYA 3KZVA 3NGXA 3B1JA 3PJFA 1YJQA 1PJQA 4EEZA 4NPCA 2C5EA 3GHYA 2V6GA 4L4RA 4RVSA 5KJFA 1XSEA 4BNMA 4NFSA 4MDHA 1GQYA 3F4LA 4LCEA 4W9NA 4E33A 1ZZEA 4RPHA 3DZIA 1E7SA 2RIRA 4YA6A 2ZTUA 1AN9A 5DT9A 2DPGA 1KVRA 5FWNA 1AXEA 3Q0EA 2EEZA 1Y5MA 3CKYA 3GDFA 1ZEJA 3ITDA 4DQUA 3GMDA 3IKVA 2NWQA 1E6UA 4PLCA 3T7CA 4BKOA 2IODA 3PEFA 1ZMTA 2O7SA 2V6BA 3MJCA 4IJWA 2JFGA 5T8KA 1E3SA 1F8GA 2W4QA 4GQAA 5LC1A 2O3QA 1E1MA 4I8XA 3OEYA 1YKFA 3DZKA 3HFSA 3LC2O 1QLJA 5DOZA 4E5KA 4FOOA 3NTOA 4WLEA 1NWHA 1WDLA 4WLFA 4CM3A 1ADGA 3FTNA 2AEJA 1XYGA 5L3ZA 1EVZA 5TJHA 1FMCA 3ZCXA 3QVOA 4XGIA 4D7AA 1E6EA 4DWVA 3DMYA 1LDMA 1BHSA 2YFHA 4OOEA 2SCUA 3AOEA 3EK2A 3X2FA 3ZWYA 2BFOA 1AUPA 1E1KA 4XCVA 2EG9A 1ZFNA 4D45A 4URFA 2YHIA 3PVZA 4Y67A 5EINA 5U4QA 2AW5A 4BL5A 4H16A 5KJ1A 3LDHA 4N54A 4IDBA 4BO4A 5U9CA 3GUCA 2VUTA 2H1SA 4DUPA 4FGWA 1KEPA 4LCJA 1ZK3A 4EUFA 1B8VA 1YJ8A 1DEHA 2IEBA 2B36A 1BRMA 3K31A 3GT0A 4G81A 1J6UA 3PK0A 4MO2A 2CF5A 2WD7B 2YDXA 3DAFA 1Y7TA 4AJHA 3GVHA 4PG7A 4IDFA 4PG4A 3FBTA 3K73O 3STHA 3JYOA 1DRWA 1EVJA 3D3EA 1I3NA 2YW9A 5A02A 3PHIA 1CJCA 4LK3A 1I32A 4I5FA 1ENOA 1GEGA 5ICMA 4GGOA 1EVYA 5DN9A 1HRDA 1EFKA 2VZ8A 3K30A 3NEPX 3HFGA 1I36A 4J0FA 2ZTMA 2PH5A 4DYVA 1LC3A 3JYNA 1VL0A 4DMMA 3TSCA 5L45A 4I9HA 3TRIA 3KETA 3FNHA 4XB2A 1ZK2A 4EEXA 1K2WA 1KEVA 1YONA 2P9CA 2C20A 2C2XA 1TT5B 5TC4A 1QG6A 3ZW9A 1OMOA 5A5FA 1IHYA 3F4BA 1JWBB 3NT2A 4TRRA 2J3IA 4HP8A 3ETGA 2O3RA 1QORA 2O2SA 3QY9A 3OQ6A 4BNGA 2WYVA 3VVCA 2C82A 1DFGA 3QVWA 4CMIA 3M1AA 1AGNA 1SMKA 3HG7A 5JMWA 2C0CA 4YCAA 5DBGA 4BGVA 1KEWA 3PJEA 1NBOA 3D5QA 1Z7BA 1EUZA 2GN8A 4MOWA 1NHGA 5HRUA 2J5QA 3DBLA 5I7VA 2OGUA 4MVJM 4RF5A 3WGOA 4CUZA 5B12A 1GYRA 3INRA 1VJ0A 5HS4A 1D3AA 3ZNPA 4IGEA 3JQAD 3KEOA 5F21A 3FR7A 3RUAA 1Z7EA 4Y98A 1PJCA 1GPJA 2DTEA 3JD2A 4J2OA 1I10A 1YS4A 1YQXA 3AM5A 4DVJA 4IJKA 4CQMA 2PGDA 3IUPA 3P19A 3GNSA 3ZV6A 3ZI0A 4CR7A 1GU7A 1HLDA 4KUHA 4BMVA 4PG8A 1JA9A 5K6AC 3KRTA 3GLQA 4IGFA 1SBYA 2UAGA 5IXYA 2VN8A 5TQVA 5CDTA 4P38A 3H65A 1O89A 3OA0A 3V1UA 1WLYA 1H6CA 1U5AA 1IL0A 1BSVA 4K6FA 1P44A 5AXAA 1JLLA 3CMCO 2R2GA 3Q1LA 4GH5A 3UHAA 3F9IA 3OQ1A 4FFNA 1P3DA 2JL1A 3OJEA 3HE3A 4XKJA 4O6VA 2DM6A 4Y8VA 4EITA 3E1KA 1YOVA 1KBZA 1HE4A 2RHRA 3KEQA 3L9XA 1SEPA 2FP4A 3TQHA 1Q7CA 2NVUB 4E5NA 4OXKA 4FFOA 5J23A 1ZXBA 5G0WA 1NAHA 2GZ2A 2VTEA 2Y1FA 3EUWA 4BGUA 1LQTA 1FXSA 4J49A 4WLVA 4D44A 3LYLA 2BFMA 4I9UA 4QXMA 3D0OA 2D1YA 2NVBA 4IQ8A 1P1IA 2C5AA 1IB6A 2O50A 5IZCC 2JHFA 3BMOB 2FZWA 4MIEA 3LZ6A 3TOZA 4B3JA 4DQXA 4BNHA 1T2AA 5HWSA 4F6LA 1EDOA 3KVOA 3OJLA 3HQ4O 3PDJA 3OF2A 3RC2A 4DIOA 4U6SA 3TDKA 2W90A 1A9YA 1GCOA 4UEKA 3RUEA 2EERA 4P4GA 3WICA 1N1EA 1SZJG 2P5YA 2Y66A 3PZRA 3R1IA 1YDEA 5AXCA 2JFHA 5TNXA 3JQBA 3E5RA 1ZEMA 2VWGA 3HN7A 2FPIA 4Z9XA 3B70A 4A7PA 5ITWA 3IQDB 1YH3A 1E7RA 4ALIA 3GY0A 3COSA 3LU1A 3S55A 4R51A 2NVUA 2NQ8A 3NTQA 3DHYA 3FNEA 1Z6ZA 1XLTA 3WQRA 3RD5A 5L40A 2DT5A 4NBTA 4IS2A 3QVTA 2X9GA 3M1LA 4DYDA 1D4FA 3KM0A 3NTRA 1HYGA 5IN4A 3DONA 3I23A 4J6FA 5DCYA 1U4OA 4RL6A 3RFVA 1CDOA 1XHLA 2Y1CA 4O5OA 3JQ6A 2FSVA 1GZ4A 2BFAA 1TXGA 4R5MA 4CQMD 4DA9A 1YO6A 3G79A 1A71A 3FHLA 5L95A 3C1OA 5ILOA 5BSFA 1SEVA 3QP9A 2CSUA 4KWHA 3VPFA 5JAMA 3NJ8A 1ZVMA 4HNGA 1GD1O 1A4IA 3RBXA 3ANMA 4DBZA 3H6KA 4D41A 5FI3A 4DTIA 4YR9A 2EXXA 1PJTA 3BHIA 4BNZA 9LDTA 4DREA 5EESA 3GVXA 1LRJA 4PG5A 3ASUA 4E4YA 3HDJA 1R0LA 3W4IA 1R37A 3DO5A 3Q2KA 3O03A 4RQTA 2F1KA 1B3BA 3D64A 1YL5A 2W2LD 1MA0A 2O2YA 3GHHA 1SPXA 3DXFA 3EVTA 2BGKA 4CLOA 3DFUA 4H7PA 2PFGA 5T5QA 3PWSA 2C2YA 4GSKA 4UVGA 4B7CA 4L74A 2GO1A 1J4AA 4J1SA 4CMEA 5EN4A 1ADCA 2HMSA 4CQMB 3GAFA 3KSUA 1PZHA 3KYBA 1MLDA 1SOWA 1XCBA 2DBQA 4MVJG 3JTMA 4WOJA 1JKIA 2HCTA 5DULA 1O0SA 4R1TA 5CHEA 1I0ZA 3E9MA 1RPNA 3SJUA 5TRTA 4Q3DA 2F00A 2W8ZA 1BDMA 3ZGYA 4XJTA 1H2BA 4E32A 4CM4A 1R4MA 1YGYA 3JQAB 3W8EA 3A9WA 2BI8A 4IZIA 1T2EA 4NBWA 4LSWA 3GUYA 1LSJA 4JIGA 4NJMA 4AJ4A 4A10A 4Y6PA 4XYBA 4PLHA 3R0IA 4ROSA 1AE1A 1EBUA 2IZ1A 5ADHA 5L4LA 1GEEA 3AWDA 1XKQA 4ILKA 1ORRA 3GG2A 4R1UA 4BNVA 4BNXA 2O48X 3ZWXA 1PJ4A 1HDRA 4HBGA 2AE1A 2VHYA 1DDOA 2GASA 3F5QA 1E1LA 3RUDA 4OAQA 2R00A 5IJZA 3BMQB 1K5HA 1LLCA 3O26A 5G0TA 1H6BA 1NVTA 2TMGA 3ONEA 4EI2A 3K8ZA 2GYYA 2JCXA 3KB6A 3TWOA 4DLLA 3HDQA 1U1IA 4GX2A 3O8QB 3ZWWA 4EZBA 2PZLA 1PJBA 3ZV3A 2I3GA 3IC5A 4TSKA 5TX7A 1C0LA 3ZWCA 5BNIA 4QSMA 4BNYA 4H3VA 1OC2A 2EW2A 1NASA 3CSDA 1YL6A 3RCBA 4CM4B 3SEFA 2CVOA 1GQQA 3FNGA 3TZ6A 1BDBA 2ZTLA 1F12A 1L7EA 4FJ2A 5IDXA 5L7WA 4FFMA 1VRWA 2ZB4A 4TKLA 2HQ1A 4L73A 5DDIP 3LK7A 1XU7A 4J1QA 1PWZA 1QP8A 3R3JA 1PS9A 4H15A 5MGBA 1VSUA 1JKFA 4BV8A 4NR0A 5JY6A 2IEDA 1MUUA 5KKCA 3DBHB 1MV8A 3IJPA 1T2FA 5DF1A 1QSGA 4A2CA 2A35A 4RVGA 3F1KA 4CLDA 1LLQA 3F47A 4Q3AA 4XYEA 3U09A 4CM7A 2BELA 1HXHA 3GRPA 4CM8A 4NK5A 8LDHA 3GG9A 4M49A 2DPHA 3EDMA 4KTVE 1YB4A 4IQ0A 2AQHA 3ZDFA 2VZ9A 4ESOA 3L4BC 4XQGA 1GQ2A 3BAZA 3WSVA 3L07A 3LC7O 3ENKA 4IMRA 4FW8A 1DAPA 5EQDA 1Q7GA 4CL8A 2PD3A 2X0RA 3ZH2A 1ZK1A 5FEUA 3FN4A 4B3HA 2VT3A 4LGVA 1MXHA 4YJHB 2A92A 2VYVD 3RROA 3H5NA 5KTKA 5TLSA 4YTEA 4E2YA 3H3JA 5I8WA 3FPLA 1E1NA 5B4UA 1RM5A 2P4HX 1X15A 3PYLA 3JD3A 4KQXA 4ZD6A 4JROA 2ZYAA 3KYCA 3PLRA 2X86A 2PGJA 4TVOA 1DC6A 4ITUA 4NBVA 5CG2A 5CDUA 3DHEA 1PSDA 3H9UA 1F17A 2VWPA 3E6AA 4NI5A 1H0KA 3I6IA 4KP7A 3INGA 4II2A 3WSWA 4ALMA 1VLLA 4CJXA 3ROQA 1DBVO 1SB8A 3OSUA 5L53A 3HN2A 5DNAA 2BMAA 3HADA 4JBHA 3AM4A 2J5RA 4J4HA 4OIMA 3V5NA 3HHPA 3EC7A 1L7DA 3JQFC 3BTOA 4PG6A 4BO9A 4I1IA 1H93A 1PZFA 2Q49A 4GKVA 5T57A 3WLEA 2X5JO 3HZZA 4DL9A 3F3SA 1U3WA 4LVUA 3CZMA 4J3FA 3EAGA 1B2LA 2DLDA 3KYDB 4W7HA 3GGGA 5CEFA 2GN4A 4OKIA 1E92A 3QQPA 1Y81A 5HBRA 3PP8A 3PGXA 4K6CA 5L4NA 2GNAA 3ZHBA 3A28A 3AI3A 5FF9A 3VPXA 4MVJP 1KY4A 1JU9A 2GCGA 4CLEA 3IOYA 4RZIA 1PL7A 3RAJA 2PZMA 1I2CA 3WGQA 3BHMA 3GZNB 1XELA 2FR0A 2PWZA 3GMSA 5T64A 1DC5A 1ISGA 2W2KA 2IE0A 1ZO8A 1NM5A 2BHLA 3I5MA 3ON5A 5L9AA 1PS8A 1BVRA 2Q2QA 2Y0EA 4KMSA 4ZQGA 2HSDA 2HK7A 4EUEA 4WLNA 1EEHA 1N9GB 1PJSA 1YDWA 5DZSA 1YB1A 3NX4A 5TT0A 2QRKA 2VHXA 4ZGWA 4FR5A 3JYLA 3Q3CA 3UFXA 3WJ7A 4FBGA 5L4SA 1CERA 3DAPA 2VNSA 4E6PA 2JCYA 2UUOA 3V1TC 4FS3A 4S3MA 3IL2A 3IAHA 4BB5A 1EE2A 3WQSB 5C3MA 4Z0PA 2O3UA 3JQ9C 1KIFA 3DZGA 4YAIA 3L6OO 2I67A 1TT7A 4CR6A 2O7QA 3JQ8B 1W73A 3EHEA 5FFFA 2D8AA 2B69A 3ADOA 1O9BA 1VL8A 1Z73A 3I3OA 4HADA 4JX8A 2CDCA 4PLVA 4ZJUA 3H3FA 2X58A 3MJ4A 1GPDG 4KTTE 3RKUA 5JAIA 3LLSA 2FHSA 1KC3A 4PFJA 7ADHA 2QZ9A 3E03A 4YRDA 3C85A 4GX5A 3L4SO 1EK6A 1E3WB 4WCFA 1AHIA 3JD4A 1XQ6A 3VVBA 4NJMB 5HA5A 1H6DA 5H83A 4I9NA 4MVJE 4D3DA 3EW7A 3UXYA 3B6ZA 1ISMA 2X22A 2PD6A 4AJ2A 3PHJA 4KWIA 4CPDA 1UZLA 1N9GA 4XIYA 4GVLA 2XXBA 4P4LA 3TPCA 4RO0A 2D0IA 2FPGA 1J5PA 4BKRA 2OORA 3NGLA 2Y05A 5IDQA 1CETA 2GN9A 1PQUA 2DC1A 1E6WA 4E0BA 5CAEA 4QEDA 4WLOA 3DBRB 4I5EA 3S2FA 4GX0A 4TQGA 5B37A 3PLNA 2HK9A 4IS3A 3PZBA 5TF4A 4AJKA 1GTMA 2Q99A 3D7LA 4OM8A 2AQ8A 4XRRA 5EJ2A 1M6WA 3C8MA 5BSHA 2LDBA 3CXRA 3GK3A 3P2OA 4CMBA 3RBVA 2JCVA 1N5DA 2PK3A 1B8PA 1ID1A 5TSDA 3TFQA 4ND4A 3KHUA 4RDIA 3WMWA 3U62A 3V2UA 5BSEA 2ZYGA 3H5RA 3T4EA 3EZYA 3MCVA 4LMPA 1D8AA 5DCUA 3SC4A 3VHRA 1KVUA 1P1FA 5JO9A 5A4DA 4Z3DA 1LDNA 1RWBA 4GKBA 5CPBA 2WWRA 4UUNA 3T7EA 3BTSA 4DPMA 4N5MA 2FR8A 1JTVA 4U7WA 4CM6A 1IYZA 1ISHA 2G76A 4WEOA 4ZQFA 5G0SA 5A9TA 4ALKA 5CG1A 2HKIA 3K6JA 4YJHA 4YT5A 3PRJA 3CUKA 3O38A 1Z74A 5JYEA 1C3VA 1JAXA 4YYZA 1NVGA 1UP6A 1YL7A 2O3TA 3RI3A 3FNFA 2CFCA 1QV6A 1HDXA 4CMAA 3QV1A 2CVQA 3VH4A 1PS0A 4BMSA 5F1KA 3RSHA 2HDHA 3CEAA 4Y6RA 2ZK7A 1NFFA 1R12A 1K0UA 4E2WA 1KEUA 4OXNA 1I01A 4NK4A 1U2DA 3ZWVA 1GDHA 1HEUA 2OL4A 3DHNA 1KY5A 1Y9EA 3AI1A 7MDHA 3E9NA 3KO8A 1ZUD1 4UVDA 5A06A 5KJ6A 1Q0HA 3K5PA 2FPPA 1LA2A 3H9JA 1VPDA 4R16A 4CM9D 3HNPA 1E7MA 4BNKA 1WMBA 3ROPA 4YJDA 4R1NA 3VH1A 1A7KA 5A03A 2YHIB 4RPJA 4TVBA 5JNLA 4CMKA 5G4LA 1LDYA 5CDGA 3HB5X 4YJFA 4RCVA 2WYUA 3D4NA 3DOCA 4Q3EA 1PJ3A 2P9GA 1PGNA 3OP4A 3H9GA 4J16A 5KOIA 1E7YA 1Z75A 2QYTA 3VPSA 5TT1A 3P2YA 3W6UA 4DRYA 4KZPA 3L0DA 1B0AA 4Q39A 2ZJ0A 3WFIA 1ARZA 4TWRA 3V8BA 1UAYA 1X7GA 5THKA 4BKQA 1XU9A 4D3SA 1NR7A 3ASVA 3L77A 4NZ9A 4JBIA 2HJRA 1DC3A 3F1LA 4CV0A 1LU9A 1VM6A 1W4ZA 1VKOA 3FR8A 1GFSA 4OYRA 4ND1A 1KYQA 3M2PA 2E6UX 3TZQA 1CQIA 1U3UA 2X9NA 3JQ7A 4QX6A 3WTBA 4A73A 4OGWA 2V65A 2D4AA 3WOHA 3BYZA 4UEOA 2XXJA 4WASA 2CZCA 2JFFA 3ORFA 4PVCA 4CV2A 2NACA 1ONOA 4OXYA 2BKAA 2NTJA 3KYDA 1T1SA 2VTDA 4ID9A 2B35A 4B7UA 1GZ3A 1TT5A 3WQQA 4RORA 2X4GA 4OSOA 4CM1A 1U3VA 3QVXA 1NPDA 2EKLA 3RIHA 3GFGA 3AOEC 1P74A 2QIOA 3U49A 4FC7A 1DIHA 3GVIA 4BO7A 4LISA 1ZK4A 2HMWA 2O4CA 2O3JA 3CE6A 4HY3A 2H5LA 5ILGA 1XEAA 5CPFA 1LXCA 4RV9A 1A5ZA 1P1KA 4D46A 5F5NA 1T1RA 2I99A 3OICA 4JP3A 1B15A 3PTZA 4NJOA 4NQZA 4OOFA 2H63A 4UVHA 1HDYA 1HE2A 1P77A 4OL9A 5T67A 3RFTA 1DIGA 2IXAA 4Z3KA 4BV9A 1Q2XA 3IIEA 2HLPA 4GBJA 5FYDA 2Y68A 1E3WA 2EJVA 4BO1A 4I5DA 1VKNA 4XD2A 5JS6A 3DMTA 3JD1A 4YAEA 5A04A 2BLLA 4RF3A 3WFJA 1GV0A 3NT4A 2G17A 4O63O 1PL6A 3JV7A 5B4VA 1UDCA 3VZRA 1OFGA 2CD9A 2V7PA 2NU8A 1O95A 1V9LA 1A7AA 4BNTA 2IZZA 4CLOB 2PZJA 3WGGA 1UDAA 4CLXA 3BMCA 1ZCJA 4PLTA 4M54A 2EW8A 3QIVA 1DOHA 1I2ZA 3CTMA 4BKPA 2AMFA 2ILTA 1WAMA 2PV7A 5BNFA 3R3SA 2I65A 4Q3BA 4N18A 3FI9A 1Y8QA 2ZATA 3PWKA 4AJEA 1P33A 4IUYA 2B37A 4O1MA 3SBOA 5F3RA 5TGDA 5KVCA 2OUIA 2DQ4A 5H81A 3KTDA 3B20A 4R68A 2WD7A 4A26A 4XYLA 4W6ZA 4N5LA 4R69A 5ES3A 5F1PA 1LRKA 3VOSA 2A94A 4FQ8A 4D0SA 1HETA 1QR6A 4PRKA 1DRVA 1HYHA 3NRCA 1I33A 4D43A 4IPTA 1F14A 1LNQA 1H9BA 2Q4EA 3WDSA 1YRLA 1M67A 1ULUA 1BW9A 1FDTA 2D5AA 3NYWA 3MJEA 3FF4A 2P5UA 3DBLB 1V3TA 3ZNOA 4J9UE 4NH4A 3JQGA 1X13A 4GI2A 2I6TA 3FSRA 3UW3A 4YRBA 4YRAA 1O6ZA 5A5EA 2ZB7A 3WYBA 3I9NA 3CMMA 1BXGA 3KOUA 3ZNNA 2ET6A 5A9RA 2NU6A 3VAZA 1G1AA 3WBFA 1LLUA 4G2NA 5CEEA 4PRLA 1N2SA 4PLFA 3TL3A 1NQOA 4NU6A 4BNIA 5IZ4A 4HXYA 3F6YA 1WDMA 4E30A 1V3VA 1PJLA 3RFXA 1MFPA 2HRZA 2EP7A 3DTTA 3GFBA 4W9NC 5COQA 4EDFA 4RGBA 3DFZA 1B16A 3GEMA 1IPEA 1QV7A 3UN1A 1EZ4A 4WNIA 2Q4BA 5H82A 1Z82A 1A72A 4XR4A 2JD1A 2R00C 3PIDA 1I3KA 4ZQEA 1CYDA 1RKXA 1I3LA 3ZV5A 1LSUA 3AY7A 1ISIA 3DTYA 3QWIA 2GF2A 1NQ5A 3H5AA 4YJFB 4FFPA 3WIEA 5GMOA 1NQAO 4XX0A 5LCXA 1G0OA 2GGSA 3I4CA 4WPGA 3UVEA 4BQRA 2G1UA 3Q6IA 3HB4X 3U0BA 1GUFA 3DZBA 2B83A 3KV3O 2A9FA 4IMPA 4GMGA 4AL4A 2X23A 2WSBA 2Z5LA 4MP3A 1HYEA 2P91A 1I5RA 1XG5A 1QLHA 1F8FA 3OIDA 5KVVA 3QWBA 2FMUA 1NR1A 1EE9A 4CR8A 1HLPA 5JAQA 3F46A 3S8MA 4NFYA 2QRJA 3DWFA 3I9LA 2G5CA 4XJSA 1SB9A 4XWYA 4EW6A 2NTNA 2ZCUA 5A9SA 4HWKA 5CP8A 3AY3A 1LRLA 2GZ1A 4HFJA 4TZKA 4IXWA 1ML3A 2PZKA 1T2CA 4O59O 3S1LA 3EZLA 1U5CA 4J7UA 1IZ9A 4MVJD 3OMLA 1YBVA 5GZ6A 1Y1PA 5AVOA 1Y9AA 1GV1A 3MTJA 1V6AA 3LT0A 5JE8A 4L76A 1JN0A 2J3HA 3DQPA 3RUIA 3QHAA 3DZHA 1E3LA 2VRCD 1U8FO 1F0YA 3L9WA 1WZEA 3GN1A 2PH3A 3AY6A 2GSDA 5COBA 1I30A 4BS9A 3PHGA 1OOEA 4XDYA 4LW8A 2GZ3A 2VT2A 3UCEA 1ZK0A 3KYCB 2HU2A 1PGJA 5BSGA 1U3TA 3U4HA 4QT0A 4BVAA 4EBFA 2DUUA 1WNTA 4EJMA 4WECA 4NHEA 4WCDA 3JQ7B 3C7DB 3AOGA 3UF0A 3OBBA 5MDHA 4QUKA 3U9LA 3UCXA 1IY8A 4K28A 4WEQA 4B4UA 1YOVB 3WLFA 2OXIA 5I7FA 4E21A 5TJ9A 3E82A 3KSDO 5CFZA 2YHUA 3A1NA 2DU8A 2C07A 2GLXA 2AEMA 4JLWA 4NNJA 2YV3A 4CMCA 3NDJA 4E5MA 4HKTA 4WK6A 1U8XX 3RVDA 2WTBA 2RH4A 2QG4A 1JDJA 2Q3EA 4TZTA 4Z9FA 4CLRA 1ZKMA 3E8XA 1E5QA 2Q1UA 2NTVA 3EYWA 2YQ5A 1NNUA 3TN7A 4WGGA 4MVJA 1X14A 3JQCA 5ER6A 1R6DA 5I7SA 1Y6JA 1T2DA 1W8DA 3VH3A 3L6EA 2C29D 4L9RA 1JKJA 1BGVA 2HMVA 1NPYA 3ZWPA 1C0IA 2FWMX 1LDEA 1OI7A 3R6DA 1YB5A 4U0JA 1MC4A 1KERA 4UUMA 4BOYA 2QHXA 5IXSA 3C1TA 1ZSNA 2Q50A 3I6QA 1QKIA 2GPTA 1LJ8A 3OH8A 5A9SB 1M75A 1H9AA 1NFRA 4LMRA 2I5PO 4YAGA 4Y9DA 1FDVA 3DOOA 1DO8A 2WDZA 4RF4A 3MEQA 1WDKA 4KDFA 1HZZA 4J2HA 4TROA 4PLZA 3UAGA 5JCXA 3TFOA 1HT0A 1GUZA 4HNHA 2DFVA 1IZ0A 5A3VA 3TOXA 5K0ZA 3DL2A 1R15A 2PR2A 5JYDA 4FD3A 2OFPA 4YJGA 4PLWA 2VUUA 6LDHA 3ANNA 1SC6A 1S7CA 2WE8A 4Q9NA 1Q7BA 4TKMA 3FWNA 4YQYA 3QWFA 2X0IA 1CRWG 1LSSA 3IP3A 4J90A 1GAEO 3IUSA 4LVCA 4UUOA 5IG2A 1HKUA 4ZU3A 5HM8A 3UUWA 4J43A 1BXZA 1T4BA 1SO8A 3ZW8A 2D5CA 4B8ZA 4U0KA 3AW9A 3DOJA 4R9SA 2NQTA 3ZU2A 3ONDA 2DAPA 2VZ0A 5JLAA 1HDOA 4JP2A 4BO3A 1LDBA 3BMNA 2J8ZA 4BO0A 4RDHA 3ZNQA 2YV2A 4PGFA 1B26A 1P31A 2OMEA 4Z0TA 5JC8A 5DOVA 1BVUA 5L51A 2UYYA 4UVIA 3ZU5A 1DHRA 4IQGA 1B8UA 5EQFA 1H5QA 2OBNA 4BNFA 4J4TA 8ADHA 3RUCA 3AFMA 1KVSA 2D3TA 5ER9A 3TZCA 4BO5A 4BKUA 1ZSYA 1FF9A 5C7LO 3RKRA 1PQPA 4BO6A 2EKPA 1NYTA 1V35A 1X1TA 2UVDA 4U5QA 4NU5A 2X5KO 3QWHA 2JKVA 3SLGA 3UCFA 3OECA 3MJSA 1ZBQA 4M86A 4IDGA 4UREA 1P0FA 1P45A 5G0VA 3ZV4A 4BB6A 5A3JA 4CM5A 1WW8A 3G1UA 3S2EA 3JYPA 2VHVA 2BI7A 3H4VA 3U4DA 2AG5A 3A14A 4FIZA 4PLYA 3RC7A 3A4VA 1C1XB 1PGPA 3Q2IA 3QJ5A 5EPOA 2C7VA 5JPIA 5C7OO 4RPKA 1YXMA 4IJUA 3VDQA 3I9OA 5KKAA 4UAGA 3NDIA 4OQYA 1DC4A 5KVQA 1MXFA 1ZJYA 3HUDA 2RHCA 4BNLA 3DB2A 4Z6KA 5IZCA 3GVPA 3PJDA 4IINA 4BNJA 3QSGA 2D2IA 3PXXA 5HS6A 3W6ZA 1C0PA 5JDIC 3BIOA 3LVFO 4BNNA 4AG3A 4ZA2A 3RWBA 3EGOA 3H8VA 4YACA 5JBIA 5IN5A 4J9VA 1R66A 1SNYA 5AYVA 2GR9A 3EVNA 2AQKA 4DXHA 1F06A 5JAZA 2Y1DA 2V6MA 3NKLA 4QECA 3I52A 5ENVA 1R16A 2ZCVA 1MG0A 1CIVA 3G3EA 3GZ4A 2B4QA 2Q1SA 5A05A 2GDZA 2B5VA 1WPQA 2TMDA 2IZ0A 3I9KA 1CEQA 3N58A 1Q1NA 3H9QA 1ONNA 5THQA 3G49A 2ZJ1A 3PWZA 3Q11A 2G0TA 4UVEA 4AJOA 1UXHA 2VWHA 3GAZA 4FCCA 5G2OA 1ENPA 2VOJA 2DBVO 4XYGA 3MOGA 5JO0A 1NVMB 2AHRA 3GGPA 1YE3A 3AM3A 3JQDA 4QTZA 1LQUA 1HTBA 4AICA 1ULSA 3ABIA 4JCOA 4FJ0A 1G0NA 5BNTA 3QE3A 1ZNQO 5AQ1A 3KUXA 4RPLA 2NM0A 2OP0A 2VCYA 4MPDA 1PX0A 1RM4A 1T24A 3ETEA 4XGKA 3SXPA 4L4SA 4G5HA 1C14A 3MJTA 2Y67A 1FDUA 4HUJA 1H2HA 2DBRA 1FDWA 4IXTA 3H2ZA 2OHXA 2GD1O 4CQLB 2DFDA 5BR7A 4MP6A 3TL2A 4YT4A 1D1SA 3PI7A 4W7IA 4L8VA 5IF3A 2ZQYA 2Y1OA 4FPXA 5KVSA 4C4OA 1VI2A 2BGMA 1E3IA 2J3KA 2NLOA 4DLAA 4F3YA 4R01A 1JVBA 1YBAA 1XWFA 2POQX 3DEYX 3C7AA 1IULA 3DMTC 4UEJA 3PIIA 4W4TA 1ONPA 1LX6A 4CV1A 4ZVVA 4K26A 3AFNA 1UP4A 4BO8A 1H94A 4P22A 3ANLA 4UULA 1C0KA 4TRJA 4NDNE 3U5TA 4OQZA 3HWRA 3QRWA 5COAA 4QO7A 1D7OA 4QO8A 1K6XA 4JJIA 2ZIZA 1Q0LA 4GX1A 3DAGA 4RZHA 3FPCA 2QYSA 1M2WA 2PLAA 1O5IA 2UUPA 3E18A 1B14A 4ONEA 3WMXA 3QLJA 4WUVA 1VL6A 3L6DA 4CMIB 1BWSA 2X5OA 4OMUA 1KVQA 4YDRA 1M66A 4QFDA 5DP1A 4EJ6A 3MWDB 2VYND 3PYMA 1LDGA 2EP5A 3ZWOA 1EQUA 2CDBA 1EBFA 3IP1A 3U4CA 4BGEA 4NMHA 1I2BA 4II3A 1P1JA 2WMDA 4BGIA 2X6TA 4HV4A 3BTUA 3GDGA 5TS3A 2CY0A 4FOSA 3Q9NA 3CZRA 5DBFA 3ROMA 2Y99A 2E82A 4AJNA 2CDAA 3BMQA 1E7WA 3VKUA 3JSAA 4JJGA 2EF1A 2E4AA 1N1GA 1KETA 1ZSVA 4M8SA 4BO2A 2JD2A 1EUDA 1SCUA 1QXSA 3WNQA 1H6AA 5AXBA 3BMNB 2H6EA 4R3NA 4C7JA 2NVWA 4IDEA 2BGLA 3WWYA 4OKNA 2JAPA 1DLIA 4HFNA 3W8DA 3N74A 1U7HA 4YWJA 3WJAA 4YT2A 3VPGA 3M2TA 1YBMA 4HX5A 4PVDA 4S1VA 2EJWA 1JW9B 2R6JA 3ICPA 1UZMA 1W6UA 1LUAA 1G6KA 2XAAA 3JCZA 1UXIA 1NTOA 1M6HA 1BW9B 3JYQA 1OAAA 5I7EA 2Z95A 2WD8A 3KSZO 2DUWA 4RVFA 3IMFA 4J1NA 3G17A 1PGQA 3BA1A 4I5GA 4B7XA 1IPFA 3INTA 1DB3A 1TI7A 2W2KB 1X1EA 4Q3NA 4RF2A 1UDBA 2C54A 5A1TA 2YUTA 1DRUA 3N7UA 3NDRA 1IOLA 4P8RA 1ISJA 1EMDA 3UGKA 1PJ2A 1B7GO 1NP3A 1UXJA 1XIVA 3GRKA 5DBIA 3RJ9A 1N8KA 2P68A 3RU7A 4ZHSA 3WTCA 4KUGA 3D4OA 1D1TA 4TMFA 5TIIA 5JW6A 3ITKA 1HDCA 4WCFB 4R4JA 3CINA 3GNTA 1DHTA 5JDIA 4IJVA 1C1DB 4A27A 5JDCA 2CUKA 4XA8A 4YEDA 1P0CA 3VZPA 1EK5A 1EQ2A 3QVSA 4DGSA 4R5HA 2QW8A 4FFRA 1KC1A 3GH3A 1DIAA 4B79A 1HE5A 3I1JA 3LT2A 4GL4A 5I9NA 3VPHA 3AU9A 1MX3A 1DIRA 1KOLA 3H7AA 1DIBA 1XR3A 3RU9A 9LDBA 1AXGA 4GVXA 2I3AA 1NHWA 2RH8A 4YJGB 4E12A 1O94A 3H2SA 1Y8RB 2PGLA 3DBRA 1MC5A 2IYPA 2YQ4A 1MB4A 1RYEA 4XGNA 4BQPA 4YQZA 1HDGO 3LC1O 3WR5A 1CQJA 4I08A 3VTZA 3V1YA 2JJYA 1U7TA 4JNKA 1X0VA 2YJZA 3E48A 2X0NA 3L4BA 2AE2A 4FGSA 2HO5A 3OA2A 3RQSA 3D1LA 5F5LA 4RVUA 4L75A 2VUSA 4JK3A 5KJEA 4KQWA 4M1QA 2YDYA 1WMAA 1FDSA 1K6JA 2FZEA 2W2LA 2GERA 1WXDA 3JQBC 3QW2A 5DP2A 4CMJA 5B1YA 4AJPA 3ZU3A 3OM9A 3OJ0A 2HK8A 3W8FA 3RASA 2VRCA 1ENYA 5EL0A 2I66A 3GZNA 4F45A 1ZH8A 2V6FA 2EHDA 1HE3A 2VYVA 5I8ZA 3WYCA 2XPCA 5AOVA 2NSDA 4GMFA 5T8KC 4WKGA 2E37A 3VH2A 1ISFA 2QX7A 4A03A 5CDSA 5IFLA 4YB8A 3HJAA 2FY8A 3GPDG 4CV3A 4DC0A 4B4WA 2HUNA 1KVTA 3GF4A 4TRNA 3I4FA 4MINA 5CEJA 2BFPA 4D3FA 3EMKA 1UXKA 1FK8A 2EGGA 2IDZA 4MKZA 3GEDA 3RUHA 2LDXA 3WX0A 4BIIA 3IJRA 1V0JA 1K6IA 1EDZA 4PLGA 4BNWA 1FJHA 4O0LA 1NAIA 4X54A 4D42A 4JGBA 4DC1A 4MIOA 1IE3A 1O8CA 1QYVA 2FN7A 1SOVA 1SAYA 4MP8A 4NBUA 4TRMA 3KLPX 2B0JA 5BT9A 3I83A 3C1AA 3JQ8A 1ADBA 4JQCA 1UZNA 4OO3A 1DSSG 4MVJF 4IBOA 3SLKA 3OJFA 4BNUA 4DMLA 4JN6B 4RQUA 5G4KB 1Z45A 3RC1A 1R0KA 4E2ZA 2YV1A 4ALJA 4MVJI 2DKNA 3WG9A 2VNAA 4NIMA 3BMCB 1YWGO 4XR9A 1ZJZA 4ND3A 1NX6A 3ZWBA 1L1FA 3WB9A 1OZAA 4BMNA 5ENDA 4CLHA 5KCZA 4R41A 5CDYA 5B4TA 3ZWMA 1RJWA 4W82A 3T4XA 3RBZA 1NXQA 4RPGA 3AUAA 3HDHA 4HFRA 1R4MB 2QRLA 2GN6A 1U4SA 5JC1A 4IY1A 4PZEA 1BXGB 1JQBA 1GYPA 3WGHA 4D0RA 1E3JA 4XIJA 4K9DA 1V8BA 1ZIDA 4DPLA 4CM8B 3WGIA 1RYDA 3WGYA 1NQTA 2ZB8A 1PGOA 4WOKA 1WZIA 3G0OA 3BMOA 1Y5RA 2FR1A 5G0UA 1QMGA 3JD0A 5K6AA 2C7GA 4ZN6A 2UDPA 3E5MA 2EGHA 2AEFA 3GN2A 3P5SA 4W99A 5GZ3A 1I3MA 3ZZNA 2WEKA 5ITVA 4LRTB 4YT8A 3AU8A 4ND2A 1NFQA 5I9LA 2NUAA 3HDYA 4MIYA 4P4NA 2VWQA 3OJOA 3P7MA 4PZDA 4A0SA 4UUPA 1PTJA 5DCWA 2O3SA 5L7TA 2AA3A 4DPKA 3MWEB 2PTGA 1GUYA 3VZQA 1XDWA 1JWAB 1ADFA 4E5PA 4G65A 1C1DA 4EJ0A 4ZICA 3CIFA 2PNFA 4CL3A 2PY6A 2WJPA 2ZB3A 4MVJH 2VOEA 4GWGA 5IDYA 3DBVO 1U9JA 1XA0A 1X0XA 4XQ9A 4ALNA 5JSFA 3ICCA 1ENZA 2BRUA 4WCFC 3D3WB 3PJGA 4B8WA 1XGKA 1X7HA 3LLVA 3CPSA 2HMUA 5C37A 1WP4A 2J6IA 4XRGA 1PR3A 2PA3A 1Y8RA 1PWXA 4AJ1A 4CMEC 4ZRNA 1A27A 4R54A 5G4KA 3FTPA 6ADHA 2ZKLA 3WXBA 3LQFA 1UUFA 2QQ5A 4GWKA 1CF2O 3ZU4A 1DJQA 2FSSA 2X1HA 4LSMA 4PZCA 3WGZA 4GGPA 2IYOA 2Q1WA 4JBGA 4CMHA 3FD8A 5GZ1A 4KUEA 1N7GA 2B4TO 3RUFA 1LSOA 3NT5A 3QWAA 1K89A 1E77A 1BMDA 2HRBA 3PPIA 1GADO 3Q9UA 4MJLA 5U1PA 3V2HA 2Q45A 3B1KA 4OH1A 1PZGA 3MJVA 2UV8A 1M76A 3VKVA 3JQ9A 5C7IO 3UICA 1HSZA 1J0XO 1PEDA 3OQBA 1P1RA 4GAEA 3G1TA 4NFHA 5K9ZA 1NWCA 2JD0A 1MGOA 1Q0QA 4KOAA 1LLDA 3D3WA 4EUHA 3W4JA 1W0CA 3MZ0A 3OIGA 2XF8A 1GZ6A 3CH6A 2H9IA 4ND5A 4FN4A 2NV6A 2HJSA 4BHTA 4IM7A 1N7HA 1DFHA 4B3IA 3TZKA 5KIAA 3FRJA 1ZMOA 4U6QA 4L4XA 4RLSA 2FRDA 2PKRA 4DBVO 5I9MA 2CF6A 3RJ5A 3ZHZA 5JXWA 3ZN2A 5F1OA 4A5OA 3C3XA 3DZFA 4U8GA 1E3EA 4IDCA 1QRRA 3NAQA 1YQGA 3GOHA 2X0JA 5GY7A 3W1VA 4AVYA 3TJRA 4E5YA 3AUTA 3LF2A 3JQGB 4AJIA 3JQAA 2CNBA 1VJTA 3FCOA
chains in the Genus database with same CATH superfamily
2H5EA 4DMGA 2G25A 2NYVA 3AR3A 4YBZA 4BATA 3H4MA 1EINA 1PT9A 3K96A 4ZQBA 1XVIA 3FE2A 1MG5A 1KYTA 3DCYA 4DEVA 2RAFA 5CA0F 2PQ0A 2VCEA 1IAVA 1QPGA 1VSVA 3CVXA 3T3EA 4DV1B 2EWMA 4DXAA 2W58A 1JEQA 3KZ1E 4P81A 2CMDA 2IXBA 4MH0R 4KIUA 2BGWA 4QLOA 1AHHA 4OHRA 5FEMA 3GX1A 3I2GA 3VDRA 3ZGXA 3PEYA 1DL5A 1EP3B 1Y5LA 1PEAA 2TRSB 3SHFA 3VQTA 4EABA 2QEQA 3B1FA 5FBLB 1AKEA 4EUSA 4F97A 1KQFA 1DMSA 1RQ2A 1JEOA 3FTEA 3EVZA 3B6JA 4JB3A 3CNBA 421PA 1HWYA 2OXCA 4MRNA 2G06A 3NNSA 2ZITA 4Z0HO 2J0EA 4C04A 1R9NA 4U7GA 1JHAA 2J5KA 4G26A 4OQNA 4GNRA 4M55A 5ARCA 1JBQA 2FWIA 2F1RA 3GPIA 1XJCA 1DAFA 1NVAA 3O4IA 4W1RA 4J7XA 3Q6NA 4FGUA 1N2CE 1UOPA 3UIEA 2V1XA 3UKJA 4Z1OA 5KYKA 3VNVA 1MOSA 4FUQA 1PV1A 5F2KA 1F3OA 1II8A 1T4GA 2WZCA 3FBGA 5EIOA 1G3IA 1GYQA 2QKYA 2CL6X 1V5GA 3AHJA 5G3YA 3SF8A 3SIWA 3MCUA 4K9PA 1LPPA 5JDCC 3SJAA 3P9PA 4TTQA 3KDAA 3PQDA 5CCXA 4MKFA 4OJNA 2RHGB 1DI0A 1M1YA 4UXJA 3ZOZA 1E5LA 1ZR2A 1N1DA 3KSMA 1DBSA 3OHMA 4O2BB 2VKQA 3HRIA 2XCIA 5K1SA 4XTRA 1PSWA 5JCOA 1E1CB 1X7XA 4B3CA 3ZHYA 3DWIA 1S8AA 4JLVA 4OQMA 1KU6A 1ZUWA 3ADPA 4FNGA 3OWXA 4WE3A 1VPWA 1NNSA 1PR9A 2X2PA 4ZQHA 4ZIRB 4Z4HA 2QRPA 2CUTA 4HDRB 3AV3A 2YFQA 5I4IA 2RBGA 1IY2A 3L41A 3TDMA 1POXA 5LPNA 1EWQA 5ILQA 1QH1B 2YN2A 5E2BA 1MNQA 1EI9A 3DXYA 2IEZA 1G4HA 3RARA 5B57C 5E9JA 4M76B 4XGQA 5EJ2A 4QQRA 2ZJYA 3K70C 3O9ZA 5FI5A 3ESZA 1E3TA 2WSIA 2Z5FA 3KOZA 4M89A 5HJ7A 3RAEC 2CEKA 5MHTA 2XOXA 3BJEA 4WD3A 1BO6A 2OSBA 2Q1YA 1GR0A 2WA2A 4U6NA 2J3JA 3C3YA 1V3UA 3ZWAA 2QP3A 3RRJA 4QICA 4NCXA 4UKDA 1MFZA 2REOA 3DDUA 3OZGA 4IF6A 1DQRA 1Z9BA 4G6ZA 5L7YA 3ULKA 4M7OA 4F9TA 3X1ZA 4IH4A 4F5EA 2IOYA 4HH0A 2C2GA 3FCUB 1JDSA 2PD4A 3E7WA 2D7DA 4LYAA 4RD1A 3C8HA 4YMTA 3W7BA 2CKDA 1T10A 1TK3A 2PRKA 3EY4A 4ZJYA 2J0QA 2H2IA 4R1PA 3ZQ4A 3RRMA 1DBWA 1KJWA 1WKVA 1EFHA 4C05A 4YUXA 5CT5A 4MGIR 1QVWA 3R24A 5K0NA 2J32A 5IKEA 1DEOA 1QCDA 1S2LA 2PGAA 2RHLA 3AR7A 5CYOA 5K4GA 3FUWA 4JMPA 2HA5A 5C8ZA 1QYCA 2OBLA 3I9MA 1F5SA 4DM7A 5IASA 1O08A 3Q7EA 3GEGA 3D2LA 4H59A 4KQKA 5EMHA 3TZEA 4EGCB 1VGRA 1E3QA 3QXSA 1BD4A 1EVIA 1QR2A 2ZSEA 2PUEA 2ID4A 1DQSA 2OV1A 3SHVA 3T7JA 4YPOA 4OQXA 1FTGA 4MW0A 4QTYA 1RFGE 3LWBA 2AG0A 2AW3A 2FW8A 3NJ4A 4FKZA 4DLVA 4XUEA 3PQFA 2VXBA 2ZS8A 1UBKS 3II6X 4M1YA 1SKMA 3QVMA 3QU5A 1WKCA 3TAHA 1ICEA 1UJNA 1IWBB 221PA 1FJ2A 2XX3A 3NHPA 1BQEA 4GPD1 3WWZA 5HJ5A 2ZYDA 3LT1A 3WNVA 2D0DA 4Y9RA 3NV7A 5CX1A 3ROKA 3D81A 1S01A 3T7KA 4BP1A 3VTFA 2O8DA 4DCJA 1IZ7A 1J20A 2JHGA 1QF6A 2P9EA 3AHDA 1ZAYA 2Y0DA 1NQWA 3I0NA 4D3ZA 1UEIA 5EMLA 1IVYA 1TRHA 2Y1EA 5B6JA 1NLMA 3K9QO 1Z6PA 1DLJA 3R3ZA 1A9QA 1J2EA 4PV7A 1VJ1A 4LWPA 1SA0A 1PE0A 2W6IA 1F0PA 1V6CA 3H9EO 3ZGNA 4IDAA 1DC7A 1X7DA 2CV2A 4W1SA 1P6QA 1WS6A 3NR2A 5HJ2A 2VQSA 4BTLA 3PX3A 3O8QA 4B4OA 2IPMA 2Q6KA 1C30A 3PGKA 4Q4HA 2Z3ZA 5DM2A 1AQLA 4E11A 4F2WA 1RHUA 3K2BA 4IV5A 3WSTA 1PK7A 4AWXA 1WU8A 1F4LA 3AHGA 3NWJA 2JZCA 2HY7A 4UDXX 1C80A 3TBFA 4D79A 4FB5A 2V7EA 4OHWA 2W6OA 3QYJA 1YK0A 3ETHA 3CNEA 2ZIEA 3N8KA 1BAPA 3HPRA 1GY8A 2H7XA 2JAHA 4KB5A 3RHZA 4ECEA 3GWZA 1NI4B 2HRRA 1KMNA 2O23A 3MYRA 2NGRA 4IIVA 3PCXA 4UUQA 5EMMA 3BWEA 1BDHA 4G4JA 4ZVSA 1XA4A 3AYXB 3U31A 2XQJA 1B8NA 2ZTSA 1BNCA 3E4DA 3PFFA 2BEKA 2Z57A 3JPYA 1NNI1 2X42A 3C5VA 4KPEC 5KWIA 3BIJA 3JARA 1MJGA 3WDSA 1RBQA 4Q7KA 3ILYA 2VPXA 4NBRA 1XQYA 4FHZA 4ZANA 3UQZA 5KNLA 1W5BA 2IIPA 1PNVA 4R7GA 2ZTVA 4B4VA 1PR6A 3O95A 5F51A 4XQEA 1FP7A 4LPKA 4NXNB 2ZRKA 5LDHA 3FCSB 3GDOA 2P4QA 5EY5B 3O1LA 1TC1A 1B6TA 1TTQB 1Z5GA 1H3NA 1YOBA 3I9JA 1EUCA 3VZSA 1O4WA 1EX9A 1P0QA 2BZ0A 3GRZA 5EP1A 4KPUB 5JMPA 4WBNB 2WWTA 2GD0A 4J3JA 3SOPA 5H5JA 4OLFA 1IUKA 1JFSA 5JYCA 1UOOA 3BSSA 2RGUA 3AEXA 2VP5A 1S4QA 2CVZA 4AWAA 5I4BA 4CLRB 3LWDA 5C4MA 5KQSA 4HXFB 2RCYA 3NWPA 1GQFA 2OAP1 2QA5A 1H65A 3QMWA 4P7GA 3FETA 3RS8A 1EHYA 1YKGA 3NV9A 4FYHA 4D96A 4ALLA 2O8BB 4HS9A 4EX6A 4FGLA 1FNNA 2JB9A 1O58A 3A06A 2XBLA 4XWKA 1JQEA 1A2QA 2EKZA 1EVKA 4QIHA 1TLTA 5FFNA 3ZZMA 4D6XA 3H5IA 4LJ6A 4OATA 4YPFA 5AW6A 1JDNA 3M4NA 5E8RA 1I7SB 2J1LA 3ZLBA 3AETA 3CH5A 1TVEA 3BZUA 4XI9A 4WMLA 3OCXA 2HCFA 3DJFA 3T34A 3VC2A 3S40A 4CIBA 3ER6A 4LA4A 4GLOA 4I1UA 2CMFA 2R5NA 3E9ZA 3IDSA 1LEHA 1OLXA 1H1TA 2GXUA 3MNFA 4FDLA 2GJAA 2BD0A 2Q27A 2FEOA 3ZS8A 7ABPA 2AL7A 2OZLA 1E9EA 2QTWB 4K1LA 5BPHA 3T5MA 4F12A 1KXZA 1R6TA 3UV7A 1E6LA 4GVPA 5ALTA 3TFWA 3W3ZB 4EEZA 4I1PA 3GHYA 4D8VA 2GF9A 1GHTA 1THGA 4RVSA 1XSEA 4C7MA 4CKEA 1RLOA 4W9NA 4XJVA 4E33A 3S28A 4YO8A 1CY6A 4QBIA 5C8VA 4H7EA 2V9PA 2YOGA 3DZIA 4QQFA 2RGRA 4GKJB 4GP9A 4AP5A 4HH3C 3MTQA 3L49A 3Q3VA 1K4MA 3TXYA 1G291 4HLNA 3OT1A 2DPGA 1KVRA 4X45A 2RAUA 3CKYA 1SFRA 5BN5A 4M1WA 3CNLA 4KR3A 1HFKA 3X1DA 2E1PA 3AYZB 5KNBH 3IKVA 2NWQA 3K1ZA 1TVCA 3EY9A 1EM8B 3LVRE 3GB9A 4P84A 4PLCA 2DF8A 3CLSC 2JJ1A 1ZMTA 1JDZA 4GXRA 2P9YA 2V6BA 4FW9A 4GMHA 1GN8A 2JFGA 4LC1A 5EKUA 2AF4C 3OQMA 1GOTA 2GOYA 2W4QA 1LBSA 4O5AA 2Q3HA 5LC1A 3NQ41 1W48A 4I8XA 1A69A 3OEYA 3CT4A 3DZKA 3LC2O 5FBQB 1QLJA 3K71B 1OXXK 4FOOA 2BFDA 3NTOA 4DLUA 2ZANA 1KS2A 1OXVA 2NAPA 1WF6A 2QGNA 3E9DA 2IEAA 1YAHA 4K9OA 4TXLA 4WLEA 2R6FA 3QE9Y 4RMJA 4C03A 4H6WA 2PZFA 3I64A 5DU2A 1ADGA 3V1KA 2AC2A 5EZQA 1IBCA 1XYGA 3RE1A 1EVZA 3GFPA 2BMFA 2PL1A 2OZLB 3VR6H 2OHJA 2ZUVA 4BVJA 1PQ4A 4XGIA 3ZCXA 1X42A 1NM5C 2NZYA 4IR7A 2FZGA 1K4YA 1YR9A 2CHFA 2PAAA 4K81B 4UOEA 4DWVA 3DMYA 2F59A 2P2LA 1LDMA 1FS5A 1Z68A 2BMDA 2IU4A 2JGRA 1E1KA 3EXAA 3VYWA 3X2FA 3ZHOA 3IPLA 2PKXA 3V48A 3KQSA 2VXOA 5I7WA 3BRWA 5CT4A 4AS1A 2LIVA 5LZ2A 5U4QA 4BMYA 4BL5A 4DLPA 5DNDA 4KQGA 5KJ1A 5U9CA 4N54A 4IDBA 3WGJA 2MOKA 3GUCA 3VYSB 2XYHA 4BO4A 5DNUA 1QDEA 3MGAA 4DUPA 2IHJA 1T1GA 3IOBA 3SR4A 5CVUA 5AW7A 2JIPA 4CE6A 1ZK3A 3D2BA 1B8VA 1YJ8A 2Q6IA 4HX9A 2WQZA 1CHNA 4H60A 4HMQA 4Q1FA 3RNLA 3USZA 5J3JA 4IVPA 4BXOA 1UJBA 2PWYA 2RGAA 2YIVX 3K31A 5IBCA 1FQWA 3HCRA 4N8DA 1TJPB 1Y48E 2XIJA 2YDXA 1PDOA 4K87A 2V6JA 3WRWA 4AJHA 3ENQA 1Z37A 3GVHA 4F2GA 2F4VB 2AXEA 2CHQA 3K0BA 821PA 1RKUA 1TCBA 1YJCA 3IQWA 1R0RE 2ADOA 1EXMA 2Q21A 2XUJA 2R62A 3DVQX 4OK3A 1QHFA 5JLJA 5JI2E 2JEYA 4OMCA 4LK3A 2UZ1B 2WMOB 4PZLA 1EVYA 2RK4A 3BH0A 3MD9A 1EFKA 3G7UA 3NEPX 5LOVB 3HFGA 1GGHA 1I36A 4J0FA 2NP7A 3LDAA 1LZKA 2ZTMA 1LC3A 1JHDA 2COUA 2A6PA 1YJ5A 4ISBA 2FWRA 3COZA 3TE6A 5L45A 4S05A 3SZ3A 2POCA 4JEIA 4C5AA 4W5WA 4B2YA 3FNHA 4XB2A 1ZK2A 3MT0A 2QN3A 3Q98A 4KDCA 2P9CA 3HU2A 2UVQA 5ALNA 3T1VA 4ZXPA 5TC4A 4P4SB 2LKDA 4YLEA 1OMOA 4EKIA 1QK3A 3F4BA 4Y7DA 3NT2A 5EZ6B 4ZDJA 3OOWA 4HP8A 1ZVVA 2O3RA 3ZC3A 3ZXUB 1L5LA 5ERYA 4AROA 5K8IA 1THZA 2CMHA 3E2PA 1W30A 1XZAA 2OMKA 3BK1A 3WGGA 1WLSA 2C0CA 2BEUA 5E4TA 3O1IC 4TMWA 5DBGA 2A86A 1MR3F 5DEOA 2XZOA 1NBOA 1RAFA 4KLNA 3QKRA 4G84A 1LPMA 2I7VA 1Z7BA 2G71A 2XCUA 2GN8A 2MINB 4MOWA 4C08A 1W0JA 4BQEA 1FXWA 2X0KA 3DBLA 3WO0A 3ABZA 2B8NA 3PTLA 5E4YA 3WGOA 1GYRA 5JYBA 2PGIA 4EO4A 3B3JA 5DYTA 3QLVA 5FO0A 4R31A 1JIKA 2GH1A 1Q12A 1X1AA 3ZNPA 4F21A 1KJ8A 2VXYA 3OJXA 5E1OA 4DCOA 5DLQC 4BZZA 2PUHA 3G0HA 5KINB 3UUGA 5DKFA 1YQXA 1U9IA 2HXGA 4IJKA 4CQMA 3VNUA 4NCJA 2Y2VA 2XNCA 1DTWB 5GAJA 3P19A 3ZI0A 2ZJOA 3L7LA 3ENVA 4KUHA 1T6ZA 2QN6A 1T5SA 1MEEA 3KRTA 4W5TA 3B53X 1U3CA 1WOMA 2XGSA 2ZRAA 1BJTA 2AR0A 3GLQA 5IMSA 4DBLE 3H87A 5IXYA 3H65A 5C4IA 3RV3A 1XDBA 3KKEA 1O0BA 3C5HA 1ECFA 4X61A 3HKEB 1Y7PA 4MUBA 1SOAA 2O8EA 4K6FA 2HO4A 5IBRA 5H02A 1JLLA 3K9BA 3CMCO 3L7CA 3UHAA 4PW0A 1KOFA 2ACWA 1T9HA 1CT9A 1P3DA 2UUAB 1YRYE 3AC0A 5JS1A 2QD5A 4RIIA 2PSFA 4JCCA 5G1PA 5JRZA 1WVIA 2XDAA 4MB6A 2AIRA 4O4HA 4Z4CA 2I7TA 2QMQA 2X6RA 1IXZA 4MWEA 2UYCA 3HBNA 5FYQA 1KBZA 1CEYA 1TK2A 2I34A 2WT4A 5IM4F 3KEQA 5L3RA 4M22A 1XMOB 2I8LA 3KOMA 3HXMA 5ALQA 2WM8A 2Q4RA 4D4GA 1FOEB 2BKXA 4EFKA 2AN5A 2II6A 1NAHA 4OB8A 4DY4A 1DVRA 3FDZB 3OM0A 4OUKX 1QYIA 5FRDA 3EQ2A 3MQFA 4C89A 5C18A 5JFGA 2IXFA 3AVQA 1KRWA 4QU8A 2P9BA 1LBQA 1N6KA 3M33A 3AETB 4I9UA 5AVSA 4JT4A 4H1VA 1Z8NA 3LRXA 5BW4A 1BMTA 2NVBA 2V7BA 2FTKE 4IQ8A 1VCMA 5HRAA 4W63A 1IB6A 1YMQA 4FWIB 4AKIA 2QE7D 3C5WP 5IZCC 2JHFA 1H42A 3BMOB 3HV2A 3LRPA 5HIMA 1O95D 5JZ9A 1HQYE 3CLSD 3HXQA 5HEKA 1T2AA 3D6HA 2H1CA 4JI5B 2IDKA 4BX2A 3HQ4O 4JSRA 1RXVA 4XQ0A 2MIIA 4BV2A 4NJEB 4DIOA 4MV9A 3CR3C 4NYMR 1QZXA 3C6QA 1GCOA 2DETA 2YWGA 2WUVA 3BRQA 3D2CA 2V3VA 3PC8A 4JLKA 4P4GA 1N1EA 2P5YA 2Y66A 4K6GA 4A6XA 3LBAA 1E79D 5DT2A 2PGOA 2JFHA 2P2YA 2CVHA 3WGKA 1U7OA 2Z2IA 1JHUA 4DLKA 4Q47A 5K0FA 2AFIE 2YR0A 1TF7A 1T6BY 3HN7A 3WK8A 3B70A 1W19A 2GZRA 4FCTA 2HMYB 3IQDB 4PQYA 3RS2A 1W52X 1WUJS 4YCJA 1QHHB 3HCCA 1TQ8A 3PVCA 2ZAOA 4LXHA 4LV6A 4R51A 3S55A 2NVUA 1PD0A 5FBKA 4WINA 3HWSA 4V03A 1Z6ZA 3PG5A 3N2KB 2DULA 3PUXA 4P08A 3L7IA 1ATZA 1VECA 5ALXA 1M5UA 4HB2A 4C30A 3HGQA 2HREA 5E7QA 3QMMA 3R7LA 4A2QA 5JQGA 3WI7A 1XKLA 1L7PA 3GLIE 3QVTA 1TFUA 2X9GA 4DYDA 4F4HA 1D4FA 1LPAB 2WWXA 1HYGA 2UXCB 1P0MA 1GG9A 2REXB 4PC7A 5DCYA 4RL6A 2YASA 1U04A 2ANCA 3N2GA 4GDMA 2V55B 3RFVA 3JQ6A 2CLOB 3EG9B 2RE8A 4PBRA 5ALIA 1YJBA 5FPQA 5P8WA 1MABA 1OVGA 4LHEA 3WGLA 4RHCA 4C6HA 4CEIA 1FSGA 4G85A 4L15A 3L7NA 1KDVA 2ZUFA 3R5JA 4IV0A 3PT5A 1UM9B 3ANYB 2YH2A 4PPFA 3G79A 2CD7A 2EJTA 1Z6YA 3EQ8A 3R9XA 2XMQA 5EFZA 1SEVA 4Z1MA 1O94D 2CSUA 2RJNA 4KWHA 3VPFA 5K7SA 1YR1A 2N0SA 2HBRA 2JGDB 3LI2A 3PRHA 5AQEA 4TS3A 1XFAA 3RBXA 2OHVA 4QDOA 3BSWA 2Z6QA 2OV2A 1V7ZA 2GAAA 3MAAC 4JBLA 3AG5A 2EXXA 1PJTA 3HKCA 3JALB 4A6PA 5JADA 5EESA 3GVXA 4OFBA 4U7FA 5KDDA 1G63A 4EG7A 1R0LA 1K63A 2GLUA 3UXEA 4AKSA 4D0GA 2VDUE 2WJVA 3O03A 5BOSB 3L0PA 3W7VA 4RQTA 3FNQA 2XVAA 4WACA 3WRXC 4MNTA 5IJ9B 1YL5A 4IIYA 5DX8A 3SIPA 4RULA 3LPNA 5EWMA 3UUEA 3TECE 2NZUG 3DXFA 5HSGA 3G23A 2Z5VA 3DFUA 1GPH1 5EJMA 3PWSA 1RQGA 2AI1A 1J7KA 4L2IA 4F72A 4B7CA 2Y4OA 5BR1A 5JVDF 2FLVA 4CMEA 5I4KA 2HADA 5IXJA 1ADCA 4CQMB 2RI1A 5J2UB 5C1DA 1BQ4A 2R96A 5C5CA 4WA7A 1PZHA 1RMYA 4S1NA 1J25A 2ODEA 2WQ7A 4KKXB 2I6QA 4MVJG 4WOJA 3R6GA 5JPDA 4QAQA 1O95C 5G02A 1T9ZA 4EMBA 3GWGA 5DULA 1O0SA 4R1TA 2Q4TA 5EUBA 3E9MA 5KTSA 4AMBA 2YIMA 2KQUA 4PF1A 3RYFA 3EPHA 4Q3DA 4ZOLB 1EWVA 2F00A 2RGGA 2W8ZA 1KWKA 1JR6A 4I8DA 3B3QA 1BDMA 3A2LA 3ZGYA 2ZWOA 2F55A 4G37A 2VPTA 1W88B 1JR3E 4HAYA 3SDZA 4PO8A 5AW9A 1YGYA 3UW1A 2C0QA 3EH2A 3W8EA 3EA5A 3MT9A 3IE1A 2GM5A 2A9KA 1RI4A 2IQIA 2BBWA 3NETA 4HJXA 3PRYA 4JDUA 5C7YA 5CCEA 1ZBDA 2Y9PB 2ZFUA 4LSWA 3OIVA 2COKA 4RL4A 4TN5A 4YPVA 4Z7JA 1P6XA 1XP5A 1BN7A 1RSZA 3CRNA 3F5FA 4AJ4A 4A10A 2PL9A 1QO7A 4FDVA 4MUXA 1JJIA 4N0MA 1CY2A 4FFSA 4GBGA 4PLHA 4ZOLF 1QCCA 3R0IA 4LF5B 2IZ1A 3OIYA 2XMRA 3C8DA 1MO4A 5GPBA 3IOMA 1IK4A 5IPFA 2W6PA 2J9FB 4N6OA 1M72A 2JK1A 2EJCA 4UJ5A 3IEPA 1NDHA 3TB6A 1GGVA 2BP7B 3ZU6A 1JKJB 1I7QB 3BCSA 4JFRA 5ADUS 5JQWA 2O48X 1NV9A 3JZAA 4N49A 3ZWXA 3KE9A 4A8JC 1WB9A 1RZ3A 4D8TA 1QTIA 3SQWA 2G1JA 4ZU1X 1LFAA 2FZVA 2GQ0A 2RFLA 3H2BA 3SQLA 2YRXA 4YLYA 2PVSA 5IJZA 2UKDA 1LLCA 5KOYA 3AUJB 3UT0A 3T5BA 3LO8A 4TZ6A 1N5JA 1YASA 4ZO6A 3O8OA 3UWDA 2C4VA 3ONEA 3VMFA 1NOIA 2HDNB 5K4HA 2JCXA 3TWOA 3DMDA 4CF7A 1U1IA 2VNHA 1VHLA 4JJ8A 2NO4A 1JX6A 5EEGA 1W36B 1QIJA 1EFVA 2ZSUA 4FBLA 16PKA 4FX5A 4WH0A 4UFPA 3TUZC 4MYUA 4TSKA 1D2GA 1RQXA 4UNRA 1KE2A 2MR5A 2CBGA 1AKVA 1E62A 2FCRA 1H2ZA 1WXGA 3QE4A 1U31A 2EW2A 4LYJA 4QSMA 1NASA 4ARVA 4AF6A 1Y6GA 3RCBA 3Q8LA 3TKYA 5JECA 4V2IA 4CCYA 1QONA 2GJ8A 3UHOA 3RU2A 4PICA 3D8TA 2JIBA 4L73A 2ZM5A 3IIKA 1VG8A 2JDIA 4W8HA 1E2HA 2NZJA 3I1YA 4LQ4A 4PWYA 4QGFA 4J1QA 4RKFA 4RY8A 5E38A 4ZCPA 4J3NA 3V4RA 5A7FA 2OC4A 3MGKA 3LQRA 1PS9A 4H15A 3RREA 3T54A 2GZAA 1ZRSA 1ZGGA 5FX2A 5MGBA 1IPHA 1GSOA 1MUUA 1UBLS 2GUWA 3KJZA 3NTUA 4LOKA 3U3RA 3WO1A 2IYYA 5KKCA 3T1HB 1T2FA 3PUWA 4M9SA 5DF1A 1AF4A 1R7RA 5AOAA 5BR4A 4YONB 3BFVA 4L0CA 1UKBA 5DHSA 3BRSA 3T3MB 3S8YA 1NI5A 3RK1A 4XYEA 1JXAA 1HXHA 4FQ7A 1IJBA 4WESA 1Y4AE 5IRCD 2DPHA 1MD9A 4UMDA 5CNMA 3PFNA 1EESA 1U3GA 2VZ9A 3OU2A 3K32A 1L5SA 3QPCA 4BU1A 4ESOA 1GQ2A 3BAZA 4W1PA 1H4SA 4RAQA 1FUIA 2XGOA 1DDGA 3IO5A 1FRZA 3IB3A 3ENKA 3F7TA 3OPYI 4I0WB 4AP9A 4B6JA 1FPMA 4IZ6A 1NUTA 3FGNA 3U3ZA 1ISSA 5AIBA 2FSHA 2MINA 1Q7GA 3TSYA 1M54A 2X3YA 1R64A 4Y98A 2INGX 1VIVA 4TSFA 4ZVLA 5FEUA 3IA7A 2R79A 2BR4A 1MXHA 1TMYA 2A92A 2VYVD 4ZVNA 2Z3WA 3A1UA 3ET5A 4E2YA 5LD2B 2Q8PA 3MMPA 4UE6A 5IDVA 4BJ5A 2QQ0A 2FX2A 3LPAA 1R5JA 5JQGF 5E1MA 1L4BA 2I33A 2PUTA 3FWYA 1U8ZA 3PYLA 4EKNB 3FCAA 3BEDA 4H4DA 5GOTA 1UWVA 3UMGA 2PBRA 1KI2A 3AMVA 2H1VA 2EATA 3NOXA 1X7ZA 4MPPA 4ZDIA 3GJ6A 1X1QA 4KEAA 3U7FB 3N2GB 4LF9B 5E1BA 2Z6AA 2JBHA 4ENPA 5BUSA 1V7QA 4ASUD 3DHEA 2EX0A 5F2OA 1D07A 2FH5B 3H9UA 5AO9A 4BMOB 3SZLA 1DKRA 1JMYA 4P93A 4RFSB 5C8XA 4II2A 4DNOA 4QBFA 3C5CA 4B6QA 1DBVO 2E85A 4ZEVA 4Y2QA 4CKXA 3HN2A 4KE8A 1TEVA 4WZAE 4O2RA 5JNSA 4PX3A 2H5JA 1C2TA 2J5RA 2ZAIA 4O4JF 2DQSA 3RIGA 5IH7A 3NBZC 3I0ZA 4PAWA 4F7DA 4E5UA 4O8CA 1QH8A 2J08A 3BTOA 1ZL2A 3KTFA 4PG6A 2Y76A 4BO9A 5JCOC 2GBGA 2Q49A 2YJ5A 3WLEA 5BYAA 5J2TB 1S2GA 3HZZA 2HIHA 4H6VA 5H4HA 5F2EA 4DA7A 3FNIA 3LNTA 4DR4B 3MWDA 5EQTA 4COKA 1OTXA 3RVSA 4UOZA 2WQ6A 5DGHA 1B2LA 4KXYA 7REQB 1K8XB 5IHXA 1JTEA 2ASEA 4U3JB 4NMWA 4ZEOA 4OKIA 3I0MA 1E92A 1Y81A 1VJCA 1AKRA 3EGDA 5L3QB 1J8VA 3PGXA 3O2QB 2VP9A 4K6CA 2ZRMA 4KHZA 4N3CA 4JEHA 5FOSA 5C1IA 4RIGA 3ZHBA 3TMAA 2P9ZA 1JR2A 3LXRA 1FC0A 5E8JA 3ROTA 3VPXA 1XQXA 2AYYA 3VFDA 5J4LA 5KMGA 1TADA 4EHBA 4UTXA 3KUDA 4HI0E 2QK4A 4WY8A 1KY4A 4MKHA 5EFOA 2IYLD 1JU9A 2D3WA 5DXFA 1D9XA 1NJ8A 4IWNA 3GLVA 3WTBA 1KOJA 1PL7A 1VI5A 2PZMA 5KWSA 4PN7A 3WNCA 3WLNA 4TYPA 5FUXA 3VZCA 2BVNA 2I91A 4D3DA 1AIPA 1JQJC 4EF5A 5CB4A 3GRRA 3OC6A 3RC8A 1DC5A 5D7NA 1G21B 2H48A 2ZWVA 1M2OB 2IE0A 2ZRBA 1ZO8A 4HWRA 5BXQC 2FGJA 3ZGOA 3PC7A 1PS8A 2HI0A 4GR9A 4GM1A 4KMSA 4ZQGA 1Z12A 2FW6A 4XFJA 5CXXA 3KV1A 2YMMA 1R6UA 1VB5A 1MAVA 2C2ZA 5DGIA 2YC2C 1UKYA 1FP4A 2P2DA 3JYLA 3JX9A 3DHWC 3ZDZB 4ZGWA 3PFBA 2YJ3A 3UGTA 5L4SA 4IW3B 1O54A 4C4XA 4ZKDA 3L5OA 2GVZC 3QUCA 1OH5A 3V1TC 4PYLA 4DSZA 2P3OA 1V39A 4PAMA 3W5VA 4C0AC 4F3CA 1A97A 3ROEA 5EGSA 3EX7C 1HY3A 3DZGA 2YS7A 3GEHA 3L6OO 4UC0A 2V3CC 5FI0B 1H1DA 4GPZA 2OFFA 5AVTA 1XYVA 2ZJ8A 1JMVA 1RYZA 4LMBA 2O7QA 3JQ8B 3EHEA 3K9HA 2KBEA 2D8AA 3PVSA 2BEVA 3ADOA 4G5YA 1W4CA 1VL8A 4HADA 4WY5A 5KMGB 3UBTA 1CD5A 1RJGA 2C9ZA 3AESB 3TLCA 1IBRA 1A9XB 3GJ7A 3MJ4A 1Q20A 3DC7A 5JAIA 3LLSA 5GV8A 1NVBA 5FWDA 3E03A 1CQXA 1YS2X 1FDRA 3C85A 4A8JB 1EK6A 5I47A 2G9VA 3BX1A 1I7PA 3FFXA 1AG9A 3E9EA 1XQ6A 1UEJA 4WI1A 3P97A 1FBTA 4BEJA 4MVJE 3KQUA 1NBMA 3U6KA 3G02A 1N77A 121PA 2WP8J 3B6ZA 3R6WA 3EDOA 5H1YA 2WVJA 3ODPA 4KWIA 4EL0A 2QORA 2FSVC 1C7ZA 2FFJA 4WT7A 1T9KA 4XIYA 1XF9A 4CKBA 2V6IA 2IYEA 3AEYA 2BGTA 2ZIXB 2FPGA 5JZBA 1GWNA 1LF0A 1J5PA 4BKRA 3HJFA 2WJHA 4OHPA 2Y05A 4B40A 3NANA 1RDFA 2CFSA 2WNHA 5G41A 3MA0A 2BM0A 2M6SA 2A7XA 1XPJA 2DC1A 2ORVA 3RT9A 4E0BA 1KJJA 1QC5A 4I5EA 4RS3A 4WLOA 5EKXA 3TVYA 5CDHA 1AJEA 1O1YA 3DEAA 4TWZA 3PLNA 5B37A 5LZ9A 3D7SA 1P3Y1 4P83A 5CYFA 2NZWA 1RLJA 3AIIA 2GTPA 1CUCA 4GOKA 1GM5A 3RIYA 3CT6A 1U0EA 4JBNA 2XITA 3RNOA 4HAZA 4WXPA 1Y80A 3O91A 4REMA 4OYLA 2GZSA 1JH8A 3KXPA 4R9VA 3MJFA 4XRRA 1ODLA 3LGAA 5HF8A 1ISRA 2BJHA 2HRQA 2JCVA 1N5DA 1WDTA 3AKEA 1ID1A 4HYQA 3TFQA 1MB0A 4RDIA 1XPRA 3N2YA 2AEEA 3OZIA 1FW6A 1XZJA 3U62A 3V2UA 2C2MA 4D81A 3SN6A 1P4SA 2DR3A 2ZYGA 4KITB 2P77A 1X87A 4RD3A 2Y1XA 3H5RA 4IRMA 1A9OA 3NIFB 1B6SA 2CXQA 3VHRA 4QBHA 2GRUA 1FSSA 5DGCA 1P1FA 2GEVA 3D31A 1K7XB 3E23A 1RWBA 1ZINA 2O20A 5CLGA 4QGSA 2IXTA 3HA3A 4DPMA 2D7JA 3GRVA 1E1QD 4OJMX 4TMZA 3KK0A 4QXAA 3F4KA 4IG9A 4L3VA 4UPVA 2G9QA 4CM6A 1N5IA 1UOQA 2WJYA 4WFKA 4WEOA 4ZQFA 4OBXA 1MJ5A 5G0SA 4Z86A 3TX2A 5CBPB 2WAYA 1ZA1A 2AFHA 3PRJA 1WF3A 4ADSG 2BDUA 2Z8XA 1JPJA 2G1AA 1C3VA 3HA2A 4LTMA 3AP1A 1YL7A 2QVZX 4F5WA 2O3TA 1TA9A 2B1GA 2SHKA 3PICA 1QV6A 1HDXA 3G5TA 2I4TA 3BS4A 4G2TA 3WLTA 3LCVB 3TGPA 1M0EA 2XECA 5AM4A 1VLHA 1T3GA 3YASA 2HBQA 4KQ2A 1AY0A 5F1KA 3RSHA 4Y6RA 3WK9A 3L7DA 4AG5A 1NFFA 2IP2A 3FPKA 2VF2A 3I09A 4YRQA 4AY3A 1FYXA 3HZRA 3ZWVA 4X1IA 2GD2A 1E20A 1GDHA 4HB0A 1N0HA 4IKEA 1PT7A 2QPOA 1OGJA 2D1QA 3KO8A 1TO1E 4OSEA 4FYXA 1C9JA 1ZVJA 2ON6A 3DZ8A 1VPDA 4F1KA 4OL0A 2I80A 4YFYA 3PUHA 4CM9D 4XARA 2LZ0A 3HNPA 4RD6A 5E0OA 1CUJA 3DT9A 4PONA 2XYVA 2NO6A 4R1NA 3RJZA 4RADA 4GUDA 3ROPA 5A03A 2YHIB 4TVBA 4LFAB 5EVCA 4CQJA 4QDKA 3RVMA 3GUUA 3WLQA 4L7QA 4RJJA 4YJFA 2C00A 1SCNE 4WWHA 3U17A 2N1MA 3IPYA 4RCVA 1PNQA 4O2AF 2GNPA 2IY8A 3CB4A 3KQYA 4Q3EA 3IP9A 1PJ3A 5EP3A 3ESCA 4Z3OA 2X77A 4MR8B 2P9GA 1PGNA 5EXPA 3H9GA 4J16A 4XM0A 1L5GB 3ZZTA 1RWOA 4KR0A 1KY2A 4Z7NB 4GR5A 2ZETA 4IIHA 4M37A 5BSUA 3VDMA 1JL3A 4AYWA 2G77B 3QVKA 4ZAZA 2OCPA 1G8KA 2YZGA 2P7IA 3O74A 2XB9A 3DF7A 5LQAA 3LHFA 1G4UR 4FKMA 4UJ3A 1X1CA 2XWSA 2JANA 3GRUA 4HQNA 4KXNA 4MUFA 3L77A 1NT2A 5A4KA 4NMLA 3Q7QA 2CB0A 1QNFA 1DC3A 2HJRA 2R7LA 1LU9A 3E1GA 1K08A 4ZQIA 5FCDA 1W4ZA 3VO8A 4YRPA 2HXSA 1VKOA 4Y1FA 4CKCA 1FVXA 1KYQA 1F7UA 4X1OA 3KZNA 3GO4A 4E07A 4A73A 4OGWA 4ESVA 4WXMA 4POOA 1GTZA 2OLJA 1II0A 5CB4F 1DAIA 1HLGA 2WFZA 3HI6A 2I9KA 3CX4A 1AX9A 1N2GA 2NACA 3RSFA 4OXYA 3M9XA 2J3LA 1UPXA 3H75A 1T1SA 2RAVA 1N8TA 3BXHA 1U0OC 3ELYA 4ID9A 3N6VA 4OX9Y 4IJMA 2R6AA 4MUEA 4LJ5A 3OTOB 3JVEA 4B7UA 2ZJ4A 4B6RA 1RXSA 2Q0SA 4KVFA 5BR8B 2ZPUA 3GJYA 1JHVA 3WQQA 2DHEA 3K0FB 2WFLA 3KWMA 3RIHA 1HEYA 3AOEC 4FXOA 4X94A 3D7KA 3DUWA 1JEQB 3EBOA 4BO7A 2B8WA 3A7DA 3DKRA 5EUCA 2QN8A 3ORHA 3OJWA 3IBCA 1FRFS 2Z9CA 3AHIA 1XEAA 1KMMA 4L5CA 5CPFA 1WBDA 3FJOA 4MQFA 4I9FA 5FD8A 1CZRA 1P1KA 2OBXA 4G1MB 4ZI3A 2B98A 2JEOA 1KQPA 4JP3A 3BGVA 4BVEA 3BFJA 1YNSA 1SHLA 3BQ9A 3OM1A 3FWPA 3Q3EA 4G4SO 4TV9F 3P9CA 4UVHA 3ZI7A 1DAEA 1HE2A 5ALMA 1P77A 3CV3A 1UJ6A 1KMCA 2HJVA 3KR0A 1YE8A 4IIEA 1DIGA 2KM1A 1KKUA 1KPGA 1UQRA 4MV1A 3KQWA 3I01A 1R74A 4EPVA 1T9AA 1JQDA 3IIEA 4QQKA 4IICA 2AGVA 1MVNA 5YASA 1W5TA 2R8EA 2BN4A 1QHXA 2VEDA 1XMIA 3L06A 4XUGB 5FYDA 1CP2A 1ORVA 1OBCA 1L4FA 1VKNA 5LOVF 3DMTA 3LA6A 2JJMA 2B92A 2DE0X 4QXOA 4LJYA 4WZAB 4YAEA 1I94B 3FSGD 4D4IA 3WFJA 3NT4A 1RC8A 2G17A 1GARA 4XVHA 2ADMA 5I3ZA 5ITZB 3H3XA 2BTEA 2UYQA 2QUHA 1BXRA 4KLZA 5EXEA 1KDRA 1XRMA 2PWBA 1Y9JA 3CWZA 4R3UC 4YP7A 1RACA 1T35A 3VUEA 1V4VA 1ZICA 3UNXA 1A7AA 3GQBA 2CJFA 3LA8A 4K1XA 4V0LA 3S1AA 3ZVRA 3MGBA 4D6PA 4GZ5A 5FUYA 3ZJ4A 1A96A 3OCUA 1JJAA 4YCCA 1RPZA 1NLUA 4IHJF 2MJLA 4LNUB 4IFIA 3GT4A 4M54A 4NWIA 1GZ7A 3GPLA 3HKEA 1ML4A 3QBEA 1I2ZA 4G1UC 4NCNA 1U81A 2GWHA 5C8DA 1GFWA 1RQPA 1ULZA 4P0QB 2OK8A 2PV7A 1LS1A 3DA8A 3BGIA 3PQ4A 5DHFA 5BNFA 5EE9A 3T3DA 1J33A 5KTOA 4B1FA 1T5LA 1Q0SA 1Y8QA 1Z4JA 3FI9A 3HYNA 4EDHA 1AKUA 4WKOA 1U0BB 3PWKA 4AJEA 3FNRA 5IVPA 2PE5A 4L02A 2DQ4A 5HG0A 4Q24A 4R68A 1I3OA 1P2GA 2WD7A 5FNZA 4A26A 2ZJFA 4BN5A 1B93A 4DWWA 5KSZA 1IRXA 3BD9A 3OQIB 3H2HA 1G19A 4ND8B 4QBKA 4O1HA 3VOSA 1SUAA 5D2CA 2J0UB 3HL0A 1ZRNA 4I4NA 5FBHA 4YCMA 2VK4A 4J0GA 3EDRA 4U8HA 2A9JA 2NXCA 3NC1C 5G40A 1HYHA 1VMDA 3AFHA 4NOMA 3NRCA 3WZ2A 1I33A 1VBNA 2ZDHA 3USES 2PL5A 2CLLB 2FPKA 4FEEA 4E6EA 4F6RA 1IN7A 3IFSA 3G88A 2Q4EA 1JHMA 3TG2A 1H05A 3F90A 3ISVA 1UDRA 4P31A 2D5AA 1CQWA 1G6HA 1NE2A 1W96A 1IMOA 3FF4A 1QVVA 2VKTA 4H6PA 4UAJA 2CC2A 2IYNA 5SICE 1QHYA 3CJTA 3R23A 3ZNOA 4F5YA 1Q1GA 3CNQS 1X13A 1UKEA 5C1OA 1Z08A 4R1QA 4DLXA 3FSRA 3UW3A 5BPFA 1ZNWA 4C6RA 1GZDA 2CL0X 3G13A 4PSVA 4KR9A 3WYBA 2IYRA 4YY3B 3CS3A 3SQNA 3UOAB 4MZDA 2NU6A 3VAZA 3WBFA 4GKKB 2FN9A 1K7SN 4G5SA 4LV8B 4OD0A 1WBBA 4ZHQF 4UU7A 1N2SA 4PLFA 3TL3A 1NQOA 2O8DB 4LV5B 4DMHA 4E5DA 2AVDA 3VU9A 4HXYA 1M0SA 1SCBA 3SF8B 3UT5B 2QM7A 5FI1B 2I1LA 4YCLA 2BCGY 3DFZA 3EMVA 3OTGA 4IL5A 3RW9A 3OKAA 3E8SA 3A3OA 1MZVA 3HYSA 4UAVA 2OYSA 3BSYA 3EXEA 3THXA 1JSCA