2B61A

Crystal structure of homoserine transacetylase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
357
structure length
357
Chain Sequence
SVQNVVLFDTQPLTLMLGGKLSYINVAYQTYGTLNDEKNNAVLICHALTGDAEPYFDDGRDGWWQNFMGAGLALDTDRYFFISSNVLGGCKGTTGPSSINPQTGKPYGSQFPNIVVQDIVKVQKALLEHLGISHLKAIIGGSFGGMQANQWAIDYPDFMDNIVNLCSSIYFSAEAIGFNHVMRQAVINDPNFNGGDYYEGTPPDQGLSIARMLGMLTYRTDLQLAKAFGRATKSDGSFWGDYFQVESYLSYQGKKFLERFDANSYLHLLRALDMYDPSLGYENVKEALSRIKARYTLVSVTTDQLFKPIDLYKSKQLLEQSGVDLHFYEFPSDYGHDAFLVDYDQFEKRIRDGLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Homoserine Transacetylase from Haemophilus influenzae Reveals a New Family of alpha/beta-Hydrolases
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
molecule keywords Homoserine O-acetyltransferase
total genus 112
structure length 357
sequence length 357
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.110 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2b61A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2b61A01
2J4CA 1H2XA 1LZLA 2V96A 4EY8A 1WPXA 3PUHA 3RARA 1VE7A 3FLAA 2VJBA 4FFWA 3O4HA 3A2LA 4BDTA 2ZJ7A 1VJ5A 4AN0A 3MVEA 4MQMA 3AFIA 1A7UA 5AI9A 3G7NA 3QPAA 1XRQA 2XLBA 4H7HA 4OD0A 3I2KA 4X71A 4MJ3A 2WJ6A 1YA4A 4F0JA 3W04A 5JASA 4GBGA 2O7VA 3STVA 2Z8ZA 3W05A 2OAEA 1DX6A 3D2CA 3D2AA 1PV1A 3O9MA 4XIIA 2JEZA 1YA8A 5T4FA 5YASA 3V1NA 3QBJA 4N8EA 3LIIA 4K6KA 3G9ZA 5E2IA 3FOBA 4OSEA 1QTIA 5AKGA 2WKWA 1ODSA 4Y2YA 2RAUA 3ICVA 4C89A 1IUPA 2VT6A 1RWQA 5I9IA 1BS9A 3G0GA 3GUUA 3ESCA 1CUUA 1G4HA 5HKBA 1IZ8A 3D7RA 3I2JA 4IHAA 3KXPA 5EHXA 4WDQA 2AJBA 5EIHA 4X95A 3O0DA 2XMQA 1H22A 4OPMA 5CH8A 5ALRA 1Q0ZA 4C4XA 4X97A 4C01A 5ALEA 3Q0TA 2Q0XA 3WMRA 1W1IA 1QIHA 1CUFA 3ILSA 4P92A 3DYVA 3M83A 3R3XA 1E8DA 5CT4A 1W75A 1TCAA 4C6HA 3MUNA 5C8XA 1EA5A 3WKBA 4U2CA 2QXTA 2OCLA 2HA3A 1ZIYA 2H7CA 1EB8A 3C6XA 1BE0A 2JIDA 2IX9A 1U65A 3PI6A 2HA7A 1ORWA 4K6HA 4RNCA 1N8SA 4YASA 3FNBA 3WJ2A 1ZJ5A 3H2HA 5AKJA 5AKXA 4PNZA 5ALLA 4AO6A 4Y2PA 1OCEA 2VEOA 1DT3A 3ICWA 2OQVA 1O6GA 1VA5A 3AILA 1YB6A 2XUKA 3IUMA 1VXOA 1DWPA 3HSSA 4DNOA 5AM4A 3H17A 1CUJA 1UOQA 3WJ1A 1JJBA 4W1QA 1N1MA 4WJLA 4X93A 1CQZA 4CCYA 3IUQA 2WUDA 3F97A 3I2HA 4V2IA 4BE9A 1SCKA 2QUAA 4G4JA 4BE4A 2Z3WA 4QLAA 2FX5A 4Y2QA 5CT9A 3DCNA 4J0DA 4EB0A 4AB1A 3IBTA 4J0IA 4Q3KA 2ZYRA 1XZHA 4PW0A 4S0XA 2H7YA 2PSJA 4WFKA 5JIBA 4XJVA 5HK8A 1CUAA 1DX4A 2ZJFA 1W76A 2WFZA 2HIHA 4KE6A 5CH5A 4CFSA 4ZRDA 3FYUC 1CUIA 4W1RA 5AI4A 4J03A 2PUJA 2XUFA 4RPCA 3QITA 1K4YA 4AZ0A 2XE4A 2VA9A 4I3FA 4H35A 4UHEA 2WM2A 1DTEA 1CUCA 1AZWA 3GROA 2WG1A 5LIPA 3D2BA 2OXEA 5LZ5A 1WM1A 1CFJA 5FV4A 1E66A 2R8BA 5K3FB 2PSHA 3WQHA 3R3VA 1R4ZA 2VJAA 3IURA 1JJIA 2EEPA 4BP8A 3WK5A 3BDIA 3I6ZA 2DQZA 2JGIA 4W1PA 5LZ9A 1MX9A 2PSDA 5ALMA 1EI9A 3NGMA 2QJRA 4XWGA 1H2WA 1BROA 3FWHA 3WIOA 3DLTA 5JARA 1JKMA 4CI9A 1JMKC 1Q84A 5HF9A 4UBMA 3IA2A 3ZLUA 1ZD4A 1CUXA 2YYSA 4G8CA 3ED1A 5AK4A 1U2EA 2VTVA 1RYYA 3EQ7A 5K5EA 1BEEA 2HU8A 1XQWA 1MJ5A 4IH1A 4LYEA 3R3YA 4Y2VA 2OCGA 4AMYA 5JADA 3BJRA 3DJYA 5ALWA 1MN6A 4DMHA 4Q82A 4L3WA 5AOCA 5AKKA 4IQ4A 2WIDA 3DL7A 5FPQA 4FHZA 4B84A 3RKSA 2W22A 5ALGA 5HFAA 5LZ2A 1XZAA 4PSUA 4W63A 3S8YA 2NW6A 1LPSA 1LBTA 3WK8A 4I19A 3STYA 5ALYA 2HRQA 1HPLA 4K5QA 5AM0A 2UZ0A 3X3HA 2CUTA 3AZOA 5SYNA 1VXRA 3DYIA 1A8SA 5JZBA 3C8HA 1CUSA 1USWA 5AKYA 3GBSA 1ZD3A 1R1DA 3K2IA 3VDXA 1BEZA 2ZYIA 5E4JA 2XMGA 1WB6A 5AM5A 4MWTA 3O95A 2ROQA 4G5XA 4J0CA 3HACA 5AKIA 1UOPA 2QUBA 4LIPD 1XZIA 4LKOA 4H7FA 4UBOA 3FCXA 5AJHA 4RE6A 1GPKA 4YPVA 2QXUA 5EIEA 3CN7A 2JGFA 4CG3A 2VATA 4DLNA 2XMZA 1WB4A 1YS1X 4MXDA 5A6VA 3A6ZA 4C87A 3FAKA 1IMJA 1P0MA 4OUKX 4X00A 2X76A 4W9RA 5JD4A 2QTBA 3KSRA 2PSFA 3H19A 3QZUA 3C87A 3I2IA 5FKJA 3FSGD 4UHFA 3QH4A 4B9EA 3SX4A 4EHBA 4IO0A 3WYNA 1NX9A 1ZI9A 3RLIA 2BUCA 3R3UA 1XZEA 3P2MA 2AJDA 2XUAA 3SWWA 1CPYA 1K63A 4XVCA 1SCIA 4X3CA 2DQYA 2WU4A 3FYTA 1QONA 4PO3X 3G02A 4BCBA 3R40A 2C7BA 1YCDA 1SCQA 1XROA 5EHQA 4BCDA 3EF3A 1MNQA 1XLVA 1TK3A 1XQXA 4H77A 3MUOA 1ISPA 1QIEA 1HLGA 3L1IA 2YASA 3T52A 3BJMA 3WA6A 4B7ZA 2PM8A 4CCWA 2WQZA 4UHBA 1EB9A 1QOZA 3HRHA 5EHZA 1WOMA 1AKNA 1QIJA 5EGNA 2OGZA 5K3CA 3V1KA 4FNMA 3ZV7A 1HBJA 4X7BA 4PSDA 5A7GA 1CUVA 5D3ZA 1S8OA 4HRYA 5AM2A 4E11A 1JU3A 3D4LA 2XUDA 3HABA 3GELA 1MX1A 2K2QB 2WJ3A 1XRPA 2HFJA 1TRHA 3KDAA 2D5LA 1XZFA 1YS2X 4AXBA 1CRLA 1ZD2P 3H2KA 3FYUB 2E3JA 2OCIA 1HQDA 3C6YA 3HC7A 4DYHA 3DKKA 1FFAA 1DWQA 2WUEA 2RHTA 4H7KA 1CV2A 2QS9A 3OC0A 5C8ZA 4BAGA 1TCCA 1T2NA 1HDEA 5FDFA 4WFJA 1LBSA 1CUGA 1C7JA 3QVMA 4L0CA 1L7QA 2PSEA 1W6RA 1WB5A 1CEXA 2GBIA 4J3JA 2HA5A 2G5PA 4OB8A 1R9NA 1MAAA 1P0IA 3OTQA 1VZ3A 3F8SA 3U0VA 2XUPA 3E1GA 5LYYA 5JANA 3HEAA 1A8UA 1A88A 3PF9A 4BDSA 2Y2UA 1YR2A 3AIOA 4Y2XA 5IH7A 5HF8A 4PV7A 3STXA 1R88A 4KRXA 3D0KA 4BAZA 1AC5A 2JGLA 4Z49A 3F67A 1SFRA 3FLEA 1CQWA 4F60A 3IIIA 4D9JA 5CXUA 5AIAA 4EY5A 4QE3A 5ALXA 2G4LA 3ZPXA 3H18A 5LKRA 3ESAA 3WWEA 2X5XA 4LYDA 2VAVA 2ZSIA 4OB7A 1E89A 3G0DA 5HCUA 4UBNA 4W1SA 2JGJA 4EBBA 4H18A 1ACJA 2W6CX 5ALPA 4ITVA 4XX1A 4QDUA 1QIMA 5AI0A 4DMFA 1FSSA 5BWCA 2WHRA 3JWEA 4KRYA 4MYDA 4OYLA 2Y1KA 4ZV9A 1FFBA 2JGMA 3TGLA 2WFMA 3G9UA 5KBYA 2PKYX 2AJ8A 2QMQA 4X6UA 3E3AA 4Y2JA 2IITA 4FLMA 3HYSA 3WKAA 3ZI7A 3S2ZA 3ZWQA 2ECFA 2WU3A 1KU6A 2XUQA 1UK7A 3VJKA 3E4DA 3KWJA 3T4UA 2FJ0A 1DQYA 2CKMA 1GKLA 3N0TA 3QPCA 5FLKA 3EQ9A 2WG2A 1Q83A 1HL7A 4HAIA 4MWSA 3ESBA 4U2FA 3MGAA 4QWWA 4G4GA 4AQDA 2O7RA 2XMCA 2ZJ6A 1E5TA 4B6GA 5I7UA 5DWDA 1MAHA 3BF8A 4GECA 1TAHA 3ZLVA 2EDCA 4PSCA 5HQ3A 4PF1A 5AI8A 1BCRA 2C5FA 5AHXA 3LCRA 4MQLA 2QOEA 5DYTA 1G42A 2CZQA 2I78A 3DEAA 1XQVA 3EIOA 2Z3ZA 1HKHA 5FP0A 3UMJA 4UBIA 2OLEA 1R9MA 4DNQA 3WWPA 5CT8A 4P08A 3STTA 5AK6A 1LPOA 2HDWA 1EH5A 3U1TA 3ANTA 2ZYSA 1W4LA 1LPPA 4FOLA 4HTAA 1XRLA 4BTLA 3LIPA 4ROTA 4KEAA 1F0NA 1AQLA 2WIFA 3NOXA 4G8BA 1L7RA 1WHSA 2ORYA 3FVTA 3WK7A 2WJ4A 4C4ZA 3BL8A 1F6WA 4CIAA 4GWLA 2XMDA 4X90A 4EY4A 1UKAA 3WKDA 1XZGA 2PL5A 5DNVA 5DTJA 4BRSA 1XRNA 2H9YA 1YAJA 1LZKA 2YXPX 1N5MA 3G0BA 1PJAA 2FJPA 2LIPA 1OILA 2GYUA 5JAUA 4HXFB 5K3BA 2XI4A 3VJLA 5T4EA 4J7AA 3W06A 4H7EA 2Y6VA 2BCEA 3NWOA 4QA9A 3TEJA 2XDWA 2VAXA 4L72A 5BOVA 5H3HA 2GYVA 1AUOA 4B82A 5DNWA 4E46A 4BC1A 5AKEA 1QZ3A 4JH0A 2WHQA 2CMFA 4TPKA 4X6XA 3G0CA 3DOHA 3I2FA 2J3QA 1YB7A 1QFSA 2DFPA 4NS4A 1YASA 4NVRA 5AO9A 2BGRA 2XQIA 3K9BA 2V98A 3AIKA 4Q3OA 1XKTA 4O08A 1IUNA 5ALQA 5K3AA 1MX5A 2WUFA 4QDZA 4QLOA 1ZGBA 2R11A 1D07A 5ALVA 4IH9A 3DKRA 3O4JA 3ESDA 4JYPA 4KJXA 1EVEA 1Q0RA 4WDRA 1LPMA 2HFKA 2GBCA 1QO9A 3NUZA 4KYVA 3TJMA 3WL7A 4CCYB 1EDBA 4WY8A 1ODCA 5A2GA 1AMNA 3H1BA 3OPMA 4FDMA 1E8MA 3WYDA 1VKHA 3DL4A 4ARBA 1L7AA 5ALTA 5CRIA 3R41A 3IVMA 1UXOA 3C5VA 5C7YA 1Y7IA 3PUIA 4X85A 1UT6A 3H2JA 4UFPA 1EK1A 1AURA 1UK9A 3FLBA 5HKAA 3H04A 3B5EA 2XUOA 2B20A 3M82A 1UK6A 5ALDA 2HA0A 2PVSA 1WPRA 2RHWA 1TIBA 4B80A 3W9UA 4B83A 4WY5A 3DS8A 3KD2A 4AMZA 3H2IA 3WL5A 2XMSA 4FTWA 1GPNA 4J0HA 4DTCA 3I2GA 1Z68A 4WCVA 2HA4A 4BAUA 1JI3A 5JAPA 3OG9A 1BN7A 2XQJA 2OGSA 5ALFA 4B0OA 3H0CA 3W9BA 2OGTA 1LPNA 4F5ZA 5CW2A 1KEZA 4Y2TA 2ZSHA 2QKYA 1EXWA 2XUHA 2D0DA 1TCBA 1NU8A 1M33A 1F8UA 2C0QA 4HRXA 2ONCA 2XQGA 4UHCA 2WHPA 4G9GA 1ZIXA 5AKHA 4QEKA 4YK7A 2HRRA 4KACA 1QIGA 1ORVA 3CN9A 4KAFA 2ZYHA 4OU4A 5BWBA 2XQFA 1U4NA 3WIBA 1LGYA 5AOAA 2J4FA 1JU4A 2DSNA 5ALHA 5A62A 1QTRA 1I6WA 4A16A 3C43A 2I03A 2WUGA 1QJ4A 1J06A 2XQKA 3VXKA 1UKBA 2XUJA 1NU6A 2WLSA 1GKKA 1O6FA 2RI6A 1UWCA 5LZ7A 3RM3A 4C88A 1LLFA 1CUEA 5K3EA 5LP1A 1C7IA 3F98A 5AH0A 4B9AA 1K8QA 3Q8WA 5AI5A 3G0IA 5D6OA 1CUWA 2GBGA 3D59A 2HM7A 5LKAA 2G63A 3UUEA 4BZZA 4GDMA 4EUSA 4Y7DA 5ISMA 1XRMA 5ALUA 1IZ7A 4M0MA 3B12A 1Y7HA 2AJLI 3A2MA 2H7XA 2RIPA 4NMWA 4CG2A 2VQ6A 5JD5A 4QWMA 4KE7A 1GGVA 4QDTA 2QT9A 2BGNA 4X94A 2G5TA 4FFVA 2BKLA 3BIXA 4BB0A 1BN6A 1QO7A 2XB6A 2OCKA 3C6ZA 1WHTA 3BDVA 5DYYA 5C8VA 1VA4A 2YH2A 2WTMA 2VF2A 4BRZA 2HADA 5JALA 3PICA 4KR0A 4AN1A 5EFZA 5AIBA 4BVLA 2HU7A 3EBLA 3SK0A 1YAHA 4JNCA 4ZXFA 5AK3A 5E4TA 4Q05A 3I28A 4C4YA 1B6GA 1P0QA 5JZSA 4ZI5A 5A7FA 3BWXA 1VOTA 1XLUA 3I6YA 3L1JA 1AGYA 2AXEA 1ETHA 4LHEA 4BYMA 3WLAA 3N2ZB 5JAHA 1CUDA 1QFMA 4H7DA 5EI5A 3WK6A 1ZICA 2PX6A 1XQYA 3G9XA 2QJWA 4A23A 4DSAA 4G9EA 5BV7A 2QVBA 4J0JA 4U2EA 4Y2UA 1C4XA 1H23A 4K2AA 3QMVA 5EHNA 4IH4A 1ZJ4A 2RGUA 1FFCA 3WWDA 3BF7A 5KWIA 4BATA 1EHYA 4A5SA 3O4GA 3QYJA 3C70A 1H2ZA 4OB6A 1K6EA 2WG0A 4LXGA 3DQZA 1G66A 3FBWA 3WI7A 1QE3A 4Q34A 5AK5A 1CUHA 3WL6A 1YSCA 2JEYA 4H0CA 1GZ7A 4M0FA 4HZGA 3D3NA 2ACKA 4BC0A 4N8SA 3PDCA 3WK4A 4HXGA 2PBLA 4G4IA 1B41A 1EINA 3G8YA 1UK8A 4B0PA 2GZSA 4QNNA 3PFBA 5J3JA 4EZIA 2PPLA 1WCYA 3HLKA 3DD5A 4E14A 4DNPA 3I1YA 5ESRA 1ZI6A 4TGLA 3STWA 2DHDA 2C5GA 5EIAA 3WZMA 4AO8A 2C4HA 2B4KA 2XLCA 5IKXA 3GA7A 4DMCA 1GXSA 4OU5A 2DCMA 5DYWA 4P9NA 1G5FA 4EY6A 4FBMA 1J1IA 2XT0A 3AIMA 4UBJA 3IULA 1P0PA 4BVJA 3FYUA 3AJAA 4MYSA 2WIJA 4OYYA 3L1HA 3QMWA 1FFEA 4DMKA 1BU8A 5KWJA 1XZLA 2WHPB 1Y37A 5A7HA 4BCCA 1RP1A 2OAGA 2CEKA 2IIVA 1GQSA 3I6MA 2O2HA 4J0GA 3STUA 4AZ3A 1QIKA 3H1AA 2WSLA 1QIDA 4UBLA 4BBZA 1XZJA 2WFLA 4KE8A 3LP5A 4LXHA 1BRTA 3BE8A 4GI1A 5IVHA 2WTNA 5ALZA 1EK2A 4FLEA 4DGQA 5DNUA 2GYWA 5ALKA 2OQIA 2FUKA 5LZ4A 3ANSA 1DQZA 4RE5A 2OPHA 2VSQA 1U8EA 3C6BA 2ACEA 3DNMA 5FXMA 7YASA 2I3DA 2Z8XA 2B61A 2VT7A 2DR0A 5DJ5A 1MO2A 5CURA 2X8BA 4H7JA 4QDXA 3A70A 3GFFA 2WFLB 5CH3A 3WWOA 4KAJA 3QMMA 5AM1A 1QLWA 3C8DA 5DTIA 4ZWNA 1JMYA 4RGYA 4CG1A 1XZKA 3QM1A 1XRRA 3I1IA 2VJDA 4FNGA 2V9ZA 4ETWA 3AINA 3C45A 2HU5A 5JD6A 3JYHA 4G8DA 4DM7A 5SYMA 2QM0A 4K6GA 2HL6A 4X92A 4B85A 3V1LA 2BUAA 1XZBA 5D3KA 2PUHA 1XKLA 4BZWA 1X2BA 3KOOA 3V1MA 3PFCA 2AJCA 4N5IX 3A2NA 5CT6A 3FVRA 1XLWA 1E3QA 4GLBA 4FWBA 5AI6A 3WWCA 2XUGA 5JZ9A 3WL8A 2C58A 3WKCA 1LNSA 1LPAB 1DWOA 3F9CA 5HZGA 4DSZA 2JGKA 5C81A 5HQ3B 3HXKA 2XUIA 1N5RA 2BFNA 3SC2A 3W2TA 4UFOA 5IVDA 1MNAA 3R3ZA 4U2BA 3IDAA 3M3DA 2PU7A 5F4ZA 4UHDA 4LXIA 1FFDA 5CBKA 4UUQA 5CXXA 2JGEA 5JAOA 5K3DA 4FKBA 1CVLA 5AKLA 5HK9A 2WIGA 1GQRA 2BAGA 4N8DA 5JYCA 2O2IA 2CJPA 1XZCA 2RONA 5I8PA 4QZVA 5KREA 2CBGA 5T4BA 1F0PA 4BP9A 1THTA 2GBFA 1VLQA 3K6KA 5LLSA 4H7IA 1XFDA 3O4IA 3BIWA 2Z5GA 2DHCA 2ES4A 3OOSA 4AX4A 3CCBA 3RK4A 4ARAA 3E0XA 2O2GA 1CUBA 1XZMA 3HJUA 4AO7A 3DDUA 1T4MA 5IVKA 3EQ8A 1CUZA 2CB9A 4HS9A 3VVMA 4EA6A 5HF5A 2H1IA 4BTVA 1QIFA 1TKRA 3BXPA 5CT5A 4QDOA 1J2EA 4GW3A 2QRUA 2P8SA 5IVIA 1OXMA 5LZ8A 2PU5A 3TRDA 1MU0A 4FBLA 3WK9A 4FMPA 4U2GA 2ZVDA 5FPPA 4Q1VA 4WFIA 5K3FA 3G9TA 1GT6A 4UHHA 3AZQA 4DIUA 4JEIA 5D7BA 3F96A 2J3DA 3IUNA 3WKEA 3OURA 2GZRA 3O9VA 1VE6A 4MEBA 1CIJA 1PFQA 1ZD5A 1MT3A 1IUOA 4KE9A 4EY7A 4ZREA 1MPXA 5JATA 1DU4A 2Y2VA 1ODTC 3LLCA 3H2GA 4PQEA 1LPBB 4BVKA 3C5WP 1UFOA 3VJMA 3CCCA 4INZA 4GEGA 1X2EA 2B9VA 6YASA 1H2YA 1UZAA 3CXUA 1ZOIA 2QR5A 3R0VA 2WILA 4F21A 2EDAA 3JW8A 4P93A 2HA6A 1UOOA 1XZDA 3WZLA 2V97A 5AICA 1AX9A 2DHEA 4Y2RA 1EX9A 4MEAA 4X91A 1X70A 1J07A 3ZLTA 1CUYA 1EDDA 5DLPA 3AUKA 4GXNA 4M0EA 4KAAA 5FRDA 4GHWA 4UBKA 3AZPA 2I3ZA 5AKZA 3GZJA 3PE6A 1DINA 1IVYA 3HI4A 4Q3LA 3VVLA 1JFRA 1MTZA 4ZV7A 1K5PA 4J0KA 3V9AA 5ALOA 3YASA 4JYMA 1EDEA 3HZOA 2Y6UA 2XMRA 4YX9A 4JUIA 2C0PA 1ZGCA 3WA7A 5ALNA 4CIBA 3KWFA 3R3WA 5E4YA 2BJHA 1UKCA 4UFNA 3VKFA 1BCSA 4Y2SA 3DOIA 1EVQA 5FOQA 4UPDA 3QPDA 1W52X 3V48A 3OM8A 3D5EA 2JBWA 5AM3A 1E8NA 1A8QA 5CMLA 5AP9A 4N5HX 1ZI8A 3IUJA 4DNFA 4I4CA 4OCZA 1VZ2A 5CTAA 4E15A 3LS2A 5T4HA 2JF0A 4X6YA 2WIKA 2OG1A 4L9AA 1QIIA 5AOBA 1JJFA 1QGED 3PF8A 5HF6A 4HVTA 2QZPA 1KU0A 5ALJA 3UUFA 2HA2A 3IB3A 2BUBA 4G1FA 1SC9A 5HFNA 4NZZA 1JT2A 1CLEA 1FJ2A 3VISA 1TQHA 1THGA 1SOMA 3FSGA 1DT5A 4Y9SA 4TVKA 5A71A 3FCYA 3M81A 5ALSA 4HXEB 3B3QA 4B81A 5FUMA 4ZGBA 1ACLA 2HHAA 5ALIA 1R50A 4U2DA 2VJCA 2XMBA 1CR6A 4FLFA 1R3DA 1GPLA
chains in the Genus database with same CATH superfamily
1UC9A 1B6SA 1NXWA 1IYZA 1NE7A 2D1QA 2D7CA 3OP1A 4G89A 4PQGA 4CR7A 1KI3A 1WPXA 1MTOA 3GLVA 1N2SA 4S1WA 5FJJA 5BSWA 1HOXA 4BNDB 4R2WA 4FFWA 4GX5A 4PHCA 1APBA 4L6AA 5AW9A 1LFAA 1UBGA 3OU7A 4AN0A 2J5XA 4E5PA 3QLVC 3W8RA 2FPUA 4HN4B 1PFVA 2ZIFA 4A8PA 3E5MA 5LXTA 9GPBA 4WXYB 1Q7EA 1PIWA 4WADA 1PT5A 4GKAA 2WF9A 3RU9A 4Y6QA 1K9VF 2YWRA 4YP7A 4JX8A 5FV7A 1MIOA 2TMDA 4HK4A 2D00A 3Q98A 2V8BA 3PG5A 2BP7A 2ZBFA 4UQLA 3U7GA 3K6JA 4RIEA 1HDCA 4DJFC 2PX5A 3I2KA 2HJGA 4I9NA 3GD5A 4EABA 2ODWA 1ODKA 4NKRA 1Z0ZA 1XOIA 1C2YA 2OR3A 2Z2ZA 4KVGA 4S2EA 5ICFA 3W04A 3SF8A 2NNLD 1L8XA 5E7QA 2O7VA 5EXEA 3C2QA 1E5VA 4PC6A 3G88A 2OZKA 4XSGA 3LNTA 3NHBA 3PA6A 1U63A 3UATA 3ZV4A 1WQ1R 1WP4A 1WBJB 4G6ZA 5FBQB 3MFYA 5IMSA 4GH5A 1BO6A 2BN4A 2ZR0A 3TGPA 2W11A 3B36A 2PZLA 1R6UA 1TU3A 3IAAA 3LKVA 4BFCA 2Q1WA 3P4YA 5FTWA 2V5UA 3ZVKA 1XEWY 3JYLA 4JFRA 3C97A 2HPVA 4BGDA 1YA8A 5T4FA 2J5KA 3CNLA 3JWPA 1PJLA 3GJYA 3MFQA 3V1NA 5EQDA 2E4XA 2JGDB 2CNDA 3T54A 1N2CE 4N8EA 1UJ4A 1FQOA 3NW9A 4HTFA 1XD8A 2QW8A 3UJPA 3LIIA 3GW8A 2QN8A 2JC3A 1I1HA 3CH7A 3FKSA 3IODA 3KVYA 2XKKA 3IS3A 4OSEA 5JRZA 3IAM6 1OZFA 3P2EA 3IKTA 4MKFA 3EG9A 3L04A 4B4UA 2BBTA 1ODSA 2F6RA 2MSLA 2Q5OA 2RAUA 4OQZA 4F12A 3KQMA 1JN0A 2A94A 1IUPA 1LH0A 2R6GA 4MIOA 4KXFB 1MFZA 4DXAA 1LBHA 1XCBA 2PD6A 3F8TA 1IRXA 4MS3B 5DBGA 1CWUA 2PKEA 4RETA 2XRZA 3IIKA 5CDFA 1BS9A 1RZVA 3BWDD 2GH1A 3BMOA 4HH3C 4IGEA 5LDHA 3DMTC 1A97A 3AY0A 3ZVRA 1PU2A 3MTJA 3UA4A 5KU1A 3SVZA 4IW3B 4M9RA 1JSZA 3GBPA 3QE2A 1IZ8A 3D7RA 4E2FA 3ZDCA 4AG6A 1IBSA 2H0QA 3SXUB 4XQGA 4CCAA 2WP8J 4I5EA 3LMKA 2R86A 2CL5A 1QB7A 5FL7A 3UHAA 2GZHA 3ZIAD 4X95A 4E5SA 3OA2A 3NC4A 1PDVA 1RKBA 1DL5A 4A0SA 1H22A 2XOEA 2VPWA 1FTNA 1I33A 1EAYA 2BFDA 2H4YA 3EMVA 4M60A 4U8HA 5JJIA 3UFBA 1IXSB 3LQ2A 2ID8A 1BJRE 2VJMA 2DX7A 4IIGA 2UZ1B 3FAZA 3GYBA 3IPYA 1YS7A 2QLNA 3PWSA 1NGSA 4JK3A 4M0LA 1T6YA 1QIHA 2IXAA 3B6MA 1DC3A 3ZWXA 2WJVA 1O9BA 3RS3A 5K0FA 2YYZA 1K97A 2R7LA 3HP1A 1O96A 2Q1UA 3OY7A 4J07A 4JUBA 3U3RA 3G68A 3G79A 3UW1A 1YFKA 2PEZA 1NOIA 3R3XA 1MB9A 4DHEA 3OEED 4TLAA 5CT4A 1DQSA 4D41A 4RVUA 4C6HA 3HN7A 2OP0A 4KBYA 2QZSA 2OCLA 1ZNYA 1L8QA 2HA3A 3AJ9A 4QL3A 4XUCA 1U1IA 4C7JA 4AYTA 3RE1A 4DTIA 5L4NA 4QXQA 4JA0A 1P61B 1BE0A 4XYBA 2JHPA 3M6IA 3VO1A 1UBRS 2QLJA 3MJRA 1CP3A 1TM2A 5HG0A 3NM4A 3CH4B 4H4EA 3RABA 3ZWKA 1U04A 3MGGA 3C6MA 3D8SA 121PA 2NO9A 3LXUX 3RC9A 2XDAA 1NJ5A 1TUGA 1DELA 3LZDA 1PT7A 1NVVQ 2HA7A 4OSPA 2R6CA 1JAHA 3C3YA 3JALB 3K05A 4PZYA 4QYIB 3WTBA 3ZGOA 2GCNA 2OFWA 5JS6A 1M5RA 4RNCA 4CJXA 3M49A 2F90A 4IILA 2WEKA 1K8RA 3F6PA 2R7KA 5ADVA 3WJ2A 5JECA 3FA2A 1E60A 3WB0A 2LD4A 1IZ9A 2IP1A 3VAYA 1TW2A 2EBFX 1O87A 3COZA 3NS7A 4TKLA 5ALLA 5ILGA 1Y82A 2OSVA 5C3MA 2QRZA 2IUSA 2P6PA 3W8FA 5LLTA 1UM8A 4EKEA 5LMCA 2C4TA 3EPRA 5KAMA 3ISVA 2HJRA 1KNXA 3FBGA 4RK1A 3CLHA 5SV2A 1PX0A 2CWDA 2Z5FA 1JYEA 1UBLS 5JJBA 5FOXA 1I6LA 2I7DA 3DQPA 4R2HA 1DT3A 1GGKA 3BRCA 5K09A 3ICWA 4QEZA 2VYQA 4WK0B 2FWIA 3FUDA 1YB6A 4URYR 2ODBA 2OD9A 1VXOA 5KVVA 3HSSA 4JLDA 4ZALA 2QN7A 1W19A 3KQOA 3PXUA 4IHQA 4U0KA 3WJ1A 3GNTA 1N36B 1V3TA 4LRSB 5JAZA 4FJ2A 3BILA 1R6TA 3I34X 1JI0A 2PS0A 2QAGC 1XR3A 1Y6GA 4CLOB 1SK9A 4LOLA 5JNWA 1G7CA 4PYRA 4QQ8A 2CFOA 1NVUQ 1XNQB 1Z4PX 2JGDA 1WNTA 3AHHA 4MQ6A 5B53A 4EGQA 5J23A 3KQKA 1SC6A 3FPSA 4V0KA 3F97A 3I2HA 1IY9A 2ZB3A 4OI2A 1SCKA 3M5DA 1UEIA 3LT2A 3E27A 1NRIA 2PUGA 3V6LA 3UMGA 2JFFA 4ZW7A 5DW3A 3UEOA 2Z3WA 1C4KA 4DKJA 4B7CA 5CT9A 5ULLA 5DM2A 2H5IA 4JKOA 3KRTA 1N6IA 3GLTA 2O4UX 2EFEB 4K6FA 4AB1A 2GPAA 3AY3A 1YJCA 4Q3KA 3FUHA 2ZYRA 4Q9KA 1SQ6A 2GZ3A 2WF8A 2VF4X 1ISJA 3WLMA 3PHJA 4MV0A 5EP4A 4XJVA 2QSZA 1NLZA 1U0TA 2C1EA 4D4HA 1EUZA 4G1CA 2XTNA 4OBBA 2XGMA 3TB6A 1C0PA 4ALLA 5EWMA 1YVEI 1ZW1A 3Q88A 4N39A 1DX4A 1JFTA 1OV6A 4FGWA 3JD0A 3RPEA 4YUYA 3EAFA 2NUAB 3R9XB 3OU2A 1W76A 3UTCA 2JAQA 3JAKB 4Z0NA 4O2AA 5LP6F 3TLBA 5CH5A 4YS6A 1JR2A 4D43A 2NSLA 4BX0A 1JEDA 1HDGO 5EQJB 2FR8A 1Z4KA 2YINC 2NU7B 3CZKA 4LISA 4ZRDA 3A1DA 2ADOA 5EE3A 1X1DA 3E7WA 3I5UA 1Z36A 2MAOA 4L07A 5CJ2A 1J6UA 2PZJA 2JDID 3ILHA 4HDQB 3R20A 1F0KA 4P4UA 4MI9A 4Y9DA 4IYJA 4J03A 5EUQB 1AA6A 2JFVA 4LOKA 3S5UA 3WHKA 5BQFA 2PRJA 3I1JA 3AVVA 2VLAA 2X2PA 4UTZA 1L1QA 1KC3A 1CZKA 3RWMB 3JVEA 3JU3A 3JRXA 3W1WA 4XPIB 2ZYWX 3TD6A 4YB8A 5C8YB 4HNVA 1WUJS 3MPUA 2BE9A 2NYRA 2NUTA 2O8FA 5KYVA 3ZWWA 3PQ3A 1ZPDA 3WDMA 1H94A 1WHTB 1D6NA 1OU4A 1TZMA 3QVGA 3WSVA 1SCAA 4M54A 1TM1E 3RRFA 4BLSA 1O94D 4M8KA 1QQBA 2QRMA 3E2IA 5K3FB 1E1NA 1S2NA 1G55A 4YFYA 1V1JA 2VDPB 4C4OA 1XDBA 4Z7QB 1ZBDA 1BGWA 3FTYA 4HADA 5DT9A 1ZUD1 3NETA 5JU6A 5F9FA 1Y33E 1PG5A 3IPXA 4MK4A 3MTQA 4D9KA 5JG7A 5PGMA 1J2RA 3OCVA 3R09A 3GJSA 3BDIA 4JCOA 2B3TA 4L8VA 2P68A 3ZHRA 4B6JA 1U9CA 4RF2A 4YPFA 1W44A 3N05A 5C7LO 2FGKA 2N1MA 3PHCA 4NOLA 3QVJA 1HFJA 2WVHA 4XVQA 1EI9A 4OSOA 2P6RA 1EZ4A 3MJ4A 5I48A 3QX8A 3O8LA 3MJVA 2JFZA 1FVHA 3CZLA 1FNCA 3C0KA 3F5MA 3DLTA 4OQLA 4MI6A 5G1PA 4ADSG 4PO9A 4ENTA 1IPFA 1JKMA 2FDRA 4J3BA 5TB5A 5DM60 4LVUA 2GRUA 4UE2A 1EVZA 2G6BA 4DR3B 4L6IA 3BXFA 4I50B 2HD4A 3QE0A 1V5GA 2BR5A 5HF9A 1F4LA 4R8VA 4OXYA 3WMWA 4KNYA 1JTVA 2FH5B 5HRUA 2VRBA 1VP3A 2BF4A 2O57A 3IA2A 3ZLUA 3FFTA 3MWDA 3SBXA 1VIYA 2ZB4A 4G8CA 5JBQA 3A1SA 3FYCA 1QYDA 1EUCB 3P96A 4EL5A 2VZ0A 4P0PB 3GT7A 3PK0A 1WY5A 4UQOA 3ROGA 1ZN9A 1TLTA 3R7AA 1F48A 3DB1A 2M9MA 5COQA 1WXDA 1H6AA 3UV6A 4MJLA 2DQMA 2R8EA 2PWPA 3PFIA 3IT2A 4K9PA 3E9DA 4UZEA 4WZBB 5TPWA 2R1VA 1BEEA 2MMGA 3CLRD 2FPSA 4W8HA 3MMPA 2NADA 3ZWDA 5L4LA 1XQWA 3TQSA 3A6DA 4UNSA 3H9JA 4IH1A 1R9JA 3ORQA 2RFLA 4IZ6A 2AUMA 3NR2A 1KEEB 1G6OA 4L4SA 4E5VA 3A1TA 1WQ3A 2BBOA 5EPUA 4YJHA 4DJTA 2GXAA 3O2QB 3IUYA 1BFDA 1XHFA 4I8DA 3W4JA 4AC9A 4XMZA 4MITA 1U3VA 2W2OA 4DMHA 4Q24A 4W9NA 3TW8B 3MJFA 1BXRA 4DRYA 3FUWA 4A82A 1DJPA 4EG4A 2X3YA 2Q4OA 2H08A 3VTZA 3LHKA 1HV8A 3NIDB 4P0TA 3VR0A 5HJ5A 1RWMA 1MEJA 1LY1A 3IJ5A 3CF6R 5FPQA 1RAEA 1U0HC 3C3WA 3Q3IA 1O4WA 5AYVA 1JH9A 4B84A 1BQ3A 1HE2A 3G82C 3RKSA 5KJCA 3I76A 4ZO4A 1YDMA 4YLEA 2HU2A 1ZKMA 1RMTA 4XGKA 4MV3A 5J2UA 3BBPA 4E07A 5BR4A 3VO8A 2Z6UA 2C8LA 4GRIA 4J1TA 1ZBQA 4RKEA 3LWZA 4PSUA 5FHRA 4OYHA 1ECGA 1UPXA 2EJWA 3M0EA 3MWGA 1BG6A 3K1ZA 5C8DA 3VKVA 4XO5A 3I0NA 3K70B 4S1NA 1RAFA 4E5YA 3BWEA 4P3YA 4I19A 2VH2A 5JSFA 5JXJA 2IYRA 3BHIA 2OV3A 1E5XA 1QF9A 3QXGA 5HQTA 3PD1A 3QPBA 2DWPA 4LWQA 3ANNA 2JLBA 4WESA 4ZI7A 4B73A 1M66A 1RPJA 3LT1A 2QE7A 3U6KA 2CUTA 2G25A 1KA9H 4R5VA 1QQ6A 2QYHA 2VF7A 4EUKA 8ABPA 2GK3A 3IDFA 4JQOA 1IHPA 4WXEA 1XLTA 3UK2A 1USWA 3D2LA 3EB9A 1GLVA 1GLNA 2ODAA 4ZXPA 3OHSX 5ICSA 2MYNA 1N2CB 3DPIA 1E6KA 3AIIA 3GRPA 3MAGA 1I2MA 1VHDA 1DDGA 5LD2B 5E4JA 1JLMA 2GD6A 4N01A 5H3CA 2J0EA 1WZIA 3UQYS 1DMRA 4IJVA 1IM2A 1CNFA 1D2GA 1Z33A 4ECAA 3O95A 4G5XA 4KXYA 1TIKA 3ZXUB 3GJ6A 2MOKA 1V5FA 1X7WB 3LPAA 2EBWA 4PX2A 5EP3A 1CIPA 1ZRHA 2QUBA 3O8QB 5FTLA 3F73A 2X7HA 1B74A 1RC0A 1SVIA 2XYGA 2CLKB 2DJ5A 3D1LA 1IC6A 5TT1A 1XMSA 1XQ1A 4A8HA 1POWA 1XZIA 3EZ9A 3FB1A 2XHZA 4QRIA 4BNHA 3QLVA 4Y6OA 3W78A 2CYAA 1BE6A 3K71B 4D9EA 1BMTA 2CV2A 4DCNA 2HSGA 4OHWA 2I6QA 1CS0A 3KWMA 1GA1A 3RRNA 1RQGA 5KYYB 1ZQ9A 4FFMA 5K0SA 4ZAYA 4B3XA 2EWVA 3PFGA 3SE0A 2QSUA 4CG3A 1OH8A 2C5BA 2XMZA 3L7MA 1WB4A 1GADO 2QBYB 1BQEA 4TSRA 3EAGA 4ZCTA 4HXYA 4ANFA 2L82A 2BD0A 2MSWA 3JD1A 1K98A 1GTVA 3NHLA 3RSHA 3FAKA 1Y3HA 3BQMB 3FZQA 3R3HA 3UT0A 1P0MA 3HU5A 4AG3A 5E7MA 3R7SA 1BMFA 2X76A 5CFLA 3SBOA 4W9RA 4ECEA 1EQUA 5IKEA 3THYB 3WG9A 3P8ZA 3FU0A 4Q39A 3H19A 4ZK2A 1A9OA 4NS1A 1VGQA 1E98A 1KR5A 4YJ3F 1E1DA 1UCFA 1SH7A 4F92B 3FOEC 3AONB 3LKBA 1HURA 3GEGA 5CR9A 3N8NA 3AKCA 3NDBB 4UHFA 2NUPB 1DCTA 1QHGA 2QTMA 3LBYA 5IMBA 3WIEA 1DEAA 4RTJA 1QUEA 4B46A 2FVYA 1OAKA 4MVJH 4YRRA 2IZ7A 1ZA2A 1TM4E 4QJBA 3SQNA 1CRZA 1JG3A 1PQPA 3D6HA 4KQXA 1WKVA 1ZI9A 3RLIA 2GEFA 3P7MA 2ASVA 1GZ6A 4RLFA 3X2FA 2OSBA 2ONYA 3O5AA 1PSZA 2VJQA 4D9IA 1QRSA 3NAZA 4KR3A 3ILYA 1KZ6A 2BHNA 2E48A 1X1TA 2J85A 2QGZA 3OICA 4NPCA 5CLFA 3SNHA 3PEYA 1ZM7A 4DDVA 1SUPA 1OROA 2QLTA 3GVIA 4EG7A 5CYOA 1MBZA 3PPIA 2DQYA 1Z5WA 2J6IA 3AEXA 4FR2A 4L5AA 3TZLA 4BQEA 2VXOA 4TYNA 3DDCA 1UFVA 3DZBA 3F2IA 4QG3A 5K45A 4IQFA 2ATVA 4G09A 1R5BA 3HV2A 2J1LA 1GILA 4J9UE 1FS5A 3UG7A 4CCSA 4NCXA 1Y6RA 3T7AA 1Z2OX 5JNLA 5D8DA 1TQ6A 4ZC1A 4BQFA 3OTOB 3GJ8A 3FTVA 1FRNA 1P1RA 1TF5A 1OXTA 2DTXA 3AB7A 5EESA 3GIDA 5F35A 3EFBA 3GEPA 5EHQA 3FHLA 1JBEA 5EFOA 3RSLA 1R6VA 4LDJA 3T99A 2A57A 1SHZA 5EJ5A 4GO1A 4EI8A 1XQXA 1H1TA 4YVFA 1RKUA 2P9ZA 3V2GA 1X7YB 1QIEA 4XN9A 2QIPA 3PNSA 4PGGA 1U9ZA 1Q1BA 4ZYXA 4DV6B 1T2DA 1KHTA 2Z5LA 3L1IA 4KI0A 1H2FA 1MT0A 1WWKA 4OO3A 4F3CA 4E4RA 2B5VA 3WBBA 2WQZA 1E2GA 4V0OA 3ZV5A 4HVLA 5HEKA 1DCFA 1SKAA 4UHBA 1DIRA 3TCNA 3KPYA 1NG1A 2OZVA 3MT7A 1IU9A 1EB9A 1UBOS 1XL1A 1B14A 4EVSA 4CU5A 3A7EA 3TKYA 3Q44A 1WOMA 3HA3A 3COYA 3KX2A 3DMDA 5BNIA 2OGZA 4ER3A 1OH5A 5K3CA 2JA1A 5AXCA 5JC1A 3N76A 4MYUA 3WRXA 3BREA 5JHGB 3WYEA 2CNWA 4PRLA 1VIDA 1Z38A 4N47A 4EENA 3VYSB 1YFLA 4R7TA 3SLRA 3DHNA 3V4PB 4GZLA 3U16A 3OZ7A 3PE3A 1PYOA 4RLSA 4NCNA 5EP2A 4ZVOA 4ZDIA 3NO4A 2P4HX 2X4LA 1ISGA 3ORHA 4Z4FA 2O8BA 1LF0A 2HEIA 5J2TB 3FUKA 5EJFA 1EP2B 1LWOA 3AB8A 1TZJA 2RI0A 2RH5A 2XUDA 3PU6A 2R4TA 3BPSA 3HABA 1Z37A 4X3OA 3GELA 1MX1A 3DOOA 3D7NA 4K03A 1B8UA 1T35A 4ER5A 1QC5A 2EJCA 1XRPA 2HFJA 2OL4A 1T4BA 3G1UA 3KDAA 4MGHA 4B79A 2HDHA 3MTDA 4CR8A 1SG9A 5ESXA 1JF8A 2KMLA 1N7JA 2GD2A 2C84A 2GM5A 2WM3A 4WLEA 5DYIA 3SYTA 4YT2A 5AQ1A 5B5SA 1TJPB 3V3KA 2NU9B 3FE2A 1I1QB 3C6YA 5TS3A 3ZKAA 5MN5A 3DA8A 2PL1A 4IVRA 1RXSA 1QRTA 1QC5B 3OE1A 5LMZA 2Z3VA 4A8TA 2RMKA 4RD4A 2B2XA 3QEJA 2W71A 4H7KA 5HMLA 4B3HA 5JJ5A 4C1BA 4MQFB 7MHTA 4IDQA 2RJOA 4EJSC 3KCNA 4BO0A 4JXKA 4K8OA 3OC0A 3C5EA 3ME5A 5DK4A 4FCWA 1LTHR 1QVVA 5C8ZA 2FSVC 3EARA 3DSRA 3SCZA 2PA0A 5CDUA 2GHRA 4MQEB 4DVJA 2A84A 3EUEA 3PQ5A 1R0RE 1WVGA 3D7KA 2PXHA 3A37A 1G0OA 3K1YA 4BFSA 4FYIA 1I2ZA 3NCHA 4NYMR 3WLQA 1I3MA 1EGMB 2Q4RA 4TXHA 5T6BA 5ITVA 1CUGA 3FHCB 4UTVA 2FPKA 3QVMA 3IHTA 4LOAA 1HFKA 2WY2D 3VR3A 3U80A 2GEUA 3DDWA 4Y3UA 4ZGGA 2F8TA 2MDTA 1L7QA 3PENA 3PC6A 1R0CA 4JNKA 2OO5C 3NWBA 3HKBA 1DARA 4K0RA 2DE0X 3UT6A 4D74A 4ZYYA 1WB5A 2IS1A 4MAFA 5G0TA 3GIWA 3GQBA 5FFFA 1CEXA 2JGRA 2YVQA 1SXJC 4J3JA 2DR3A 4DPRA 4OB8A 5DYNA 4OQFA 4P22A 1OLUA 2HV9A 1CJBA 4XOUA 3OT1A 4M7PA 1TD9A 4E31A 4O4JA 4DLKA 5LQAA 1SQSA 4M0CA 1U98A 2I22A 5COBA 4C04A 3LT0A 3MCZA 3A28A 4O5OA 3O2NA 4GXQA 4ERNA 2XUPA 4HAZA 3VV2A 1TB4A 4JCCA 3NEAA 3CB4A 2HBZA 4OVKA 5HM8A 3BB1A 3N7AA 4DDTA 6ABPA 4KMOA 1EJ2A 3ZV6A 4D8YA 4RACA 4EARA 3IKVA 3IP1A 4UVIA 4EI9A 4RTNA 1A8UA 4OHYA 3L06A 1IXRC 4QNRA 3NV7A 4OMCA 3GLRA 1DC4A 2ORWA 4TV8A 2IZ1A 2RAVA 1K75A 3PF9A 1D1SA 3MJSA 4BDSA 2FCAA 3AIOA 4INAA 2ACWA 4Y2XA 2P2DA 4UU0A 3H0EA 5F2EA 3OAAD 5P8WA 4NBKA 4P7JA 4OJTA 2PUWA 4MKGA 1U31A 3QOWA 4BAZA 1AC5A 4CKEA 3F6CA 1HMYA 4HVAA 3D4OA 4ZPJA 1SFRA 1SHJA 2GCEA 3FLEA 5DTEA 3D4PA 3PNLA 2O3JA 5ARDA 1NF2A 1N32B 1Z5OA 3F7NA 1KMIY 2FRDA 4ZVVA 5TJHA 1L1FA 4PLCA 5KX5B 2ZJ8A 4BKOA 4RVHA 4GMGA 16PKA 2QUKA 3EVTA 1SHTX 5C3UA 5TQJA 4EY5A 1EEXB 1QNFA 5I9BA 1R00A 1PGPA 2QMOA 1IY1A 5LKRA 4XD7D 1XDDA 2X42A 4CQLA 1WCWA 3BUSA 1AKTA 3IHKA 4Y18A 2VAVA 4CM9A 2FFHA 4LV6A 5D51S 3TNLA 3PX2A 4O2BB 3WFIA 1X8JA 1PGQA 4HQOA 1BZYA 3PS9A 1ECFA 1XYYA 1ZH2A 2C9BA 2J67A 2KBFA 1BXZA 4IHJB 4MPJA 2ZSIA 4DDHA 3RUHA 3RADC 1DTSA 3G0DA 4G1BA 1NP3A 2JIRA 3ZV3A 4U7PB 4D79A 1F17A 1NBMA 4OXNA 1KE1A 4GOND 4BLWA 2PRYA 4MUIA 2YUIA 1Y8QA 5DCLA 2HLHA 4B3CA 4ITVA 3GQBB 3HJAA 1Y6JA 3NZEA 3PUJA 5AW8A 4NRDA 4MI1A 1NULA 2QRPA 3I09A 5AI0A 4BXOA 1VMAA 4YACA 4C5BA 2PMEA 4DCJA 2GAOA 1KQPA 1EHCA 4QBKA 2WVGA 4BQSA 4HFJA 4RZXA 5HS4A 2ZJBA 4WD3A 2WHRA 5GVSA 4D44A 4MYDA 4OYLA 5KPDA 3U4GA 1Z0IA 5HHTA 3L77A 2A92A 2GLXA 1JZQA 1R15A 1VLLA 3E03A 3LUCA 1R9GA 3UC5A 3TGLA 3M9WA 2IYXA 4LSWA 1AM4D 3QVUA 3TRKA 1XU9A 1A5ZA 1VL6A 4LZAA 3W6PA 2ZDQA 3ZWOA 2PKYX 4UOZA 5KBYA 5EJ8A 1BW9B 5ARCA 2E4AA 4RVCA 1D5WA 4R2KA 3QA3E 2FR8C 4JI6B 4Y2JA 4YCLA 1QP4A 1B8NA 3G2PA 2IITA 4R9NA 5IFLA 3DAPA 5JSYA 4JI2B 1H0KA 1BMDA 2FLVA 2JCGA 3L40A 4ZX6A 3NHYA 5BSMA 2Y3IA 5LC1A 1U8UA 3NNDA 3PLAE 2ZI7A 3H9CA 4LY9A 2ZKLA 3A1VA 4LPSA 4JQYA 3GK3A 4L2IA 2YOHA 1JEJA 5EMKA 3ZI7A 3TG2A 3GG2A 3BK7A 4BMXA 4UM9D 4ZQEA 2ECFA 3D1VA 1DG1G 1EWQA 4M1EA 5EJ7A 1SC5A 4CU2A 3ROQA 2QTAA 4O4IB 3NJ4A 1YE3A 2G06A 3JARB 5FNVB 1KBOA 4CUZA 1N0IA 1W49A 2SNIE 4YMLA 3VJKA 3E4DA 3KWJA 3OKCA 2NTYC 3EXAA 1DQYA 2VQ3A 5DF1A 1Z7GA 5KVSA 4G37A 4RMJA 1U7HA 3ZOZA 5K8LA 3SHVA 2YY5A 5LA6B 1Q83A 1HL7A 3G8CA 3U62A 1AGXA 4KOAA 1MRSA 4PTZA 4KPFC 3BSWA 2VTEA 3IEXA 4HQKA 4U2FA 3ZCXA 2X7XA 2Q3DA 1LD3A 2JJ2D 2QVLA 4J3NA 3IE2A 4G4GA 4ALIA 5MN6A 1RTKA 3BWYA 3GEMA 4LUPA 3WNDA 3OOWA 1I10A 2Q46A 1AKMA 2XMCA 3DZIA 4WPGA 2WICA 3IELA 2Y1EA 1R6DA 1YFJA 1AXGA 2ZJ6A 3W1EA 5KQLA 1P7YA 4JOQA 1AQ6A 3QUAA 5DGXA 2DY1A 1D0VA 1UMDB 2CHUA 3NBAA 1N5DA 5GQSA 3ELBA 4B6GA 5I7UA 2DUNA 2XBUA 3CBGA 3K9QO 3OJOA 1N2ZA 1O7JA 1U4SA 2HQ1A 1I5EA 2IFTA 3DBHA 2MCFA 2VSYA 1Z07A 4NYJQ 1KAHA 1IBLB 2OXFA 3LQ1A 1EE2A 4CKBA 2B4YA 1JKJA 4PF1A 3U48A 2HQOA 6PFKA 2WKQA 3M6WA 3PHGA 3LXXA 2SCUB 4ML3A 3V1TC 4JLJA 1P2UA 3IH5A 4OBEA 1ZONA 4JP5A 5AHXA 2IXEA 4D3DA 3F4LA 1YL7A 1O1YA 3LCRA 1CY2A 4XWAA 4GL2A 5AW2A 2K7ZA 3N58A 3FTUA 2F3RA 2QOEA 1G42A 3ONEA 1RFLA 2V4ZA 4KIFA 4Q1DA 4BO9A 2I78A 2IHBA 3GDWA 2YIVX 3TOCA 4B45A 1MLDA 2P69A 3EIOA 4URXR 5HRAA 2OZPA 4OP2A 4R83A 1HKHA 1T2AA 3HO8A 3FZEA 3QIAA 4PLPA 1KFKB 1LQTA 2GN1A 4RPIA 3SU8A 2Y1GA 6GPBA 1DIGA 1NQXA 4JOBA 5BOSB 4COKA 1GU7A 2A4KA 5FFNA 1DRJA 2W2TA 4MPRA 2W9XA 2O8BB 4G25A 1IBKB 2RCYA 2EZTA 3KT8A 3PFWO 4C0AC 2HNAA 3LLUA 5JH7A 1E79D 3O47A 1SN7A 1KE2A 3FUMA 3GEIA 1TA4A 4P08A 2AZMA 4R0NA 2YWJA 1I7QB 4QUHA 4C3ZA 3WGOA 1G7RA 1UDAA 3OFVA 1QZZA 4RM3A 4YBZA 4I4TF 3MB5A 4B8YA 1Y9EA 2G08A 1KVTA 4JLMA 1VTKA 4OJMX 5LXTF 3VR4H 3V7FA 4HTAA 1XTKA 1WZCA 1C9DB 1HYGA 1SQ0A 4BTLA 2FNAA 4G65A 1J5XA 3AETB 4FU0A 4MROA 1E5LA 1DOHA 1RM5A 4PY2A 4F71A 1UJBA 1F0NA 4LC9A 3UMVA 3W2GA 1Q1ZA 1JEEA 1O6CA 5KNBA 1VCHA 3NOXA 3RIXA 3V2IA 3WWYA 4RJIA 1WHSA 3L5OA 1WUTA 2IDKA 2REOA 4HMPA 4M0KA 1C7RA 2XJ4A 4RVNA 3S81A 4G85A 1SCNE 4MW4A 2NMVA 3KJNA 1YDGA 3PSHA 3TM5A 4M49A 2BSQA 3EVNA 3PQ8A 4D92A 4CM7A 1GYRA 3PZBA 3AEZA 3EGEA 3PWTA 2QP3A 1FMJA 5KX5A 2C61A 2IU4A 3D0QA 5D5HA 4ZV4A 2OTCA 5IM4F 1PFYA 3DZDA 2ZBUA 4X90A 3T06B 1UKAA 4QIHA 3CGWA 4TS4A 4W5TA 3TZCA 2PL5A 1NWHA 2EJUA 2YJNA 3HKDB 4FFLA 4ARZA 1C3OA 3B89A 2GCIA 3LFUA 4WCFB 2HI0A 5H83A 3HKBB 4BRSA 2C00A 1ZY2A 2O50A 5IUJC 1RZ3A 2OHHA 6CHYA 2JAXA 4TMKA 2P4EA 2QQ5A 1JDUA 4OFZA 1N5MA 1NVMB 4GFDA 5LJLA 2XGJA 4TZ0A 3BMCB 1ETUA 1T5TA 2EF1A 4KGVA 2G9RA 4HLDA 4EA9A 5K3BA 4Z2YA 1SR8A 2XI4A 1R8QA 2PV0A 4K3VA 1AV7A 2OCYC 1MVLA 5T4EA 4KK3A 2V7QD 3VZSA 3B7GA 3NC0C 4PS1A 5IUKC 4C4RA 2DQ4A 1G6HA 2ZS8A 1D0SA 3KTAA 4S3MA 3WGNA 1Z8NA 3BTVA 4NDAA 5EUBA 4MS1A 3G49A 2ZI5A 3MC1A 4B7UA 4TKZA 4QA9A 4TWZA 3IAS1 1PT6A 2R7MA 3AM1A 5JSQA 1AGRA 4OMFG 3HV0A 3GLQA 4R54A 5LBTA 4WE3A 1SA0B 3ZS9A 5A6SA 3VNAA 3QYAA 2V1XA 4X64B 4PZDA 4N0QA 4YJ2A 4YJKA 2PHZA 4QOGA 1I13A 3T0GA 4MDFA 1ATZA 3DLAA 5AKEA 2NU6B 4RZSA 4U6NA 5FNVF 2VP4A 1G2IA 1M1NA 2AOXA 1XBTA 3SSNA 3H7AA 4TQGA 5CNKA 1Z4JA 3G0CA 3DOHA 5I47A 1EFPB 2J9FB 2YV2A 4OK5A 2UUOA 3R23A 1X7XA 5LP6C 1L5YA 3WB9A 4GE0A 1CJVC 4NS4A 1KQOA 3RHFA 1L5LA 3ZXYA 5KSZA 3AF2A 3PC2A 2GS9A 5FBWB 4YEDA 1YRAA 4POAA 1ZQ1A 4EELA 4ZU6X 5KEIA 1B2LA 2KS6A 1MAUA 2OBXA 5FF9A 1NSYA 3NVDA 1A9XB 3FH7A 4CF4A 4HB2A 3AIKA 3KHSA 2JLAA 4ZYWA 4QBFA 1OU0A 1XEAA 3LGXA 4O08A 5ALQA 2A3RA 2RKOA 1R6XA 5K3AA 3K9CA 5C2JB 2XKAA 3I1FA 4IOLA 4PCUA 3KEMA 3DXFA 2VSNA 3HNPA 4ZT6A 2AD5A 2NUBA 2OLKA 3DE5X 2YHAA 5CDTA 5CEJA 4AQ7A 3CHPA 2ZRLA 4KW7A 3I39X 2PUVA 2WJPA 2WHEA 2R11A 3LPNA 1D4FA 2N1BA 1TE2A 5FOUA 3DW3X 3DKRA 3TTSA 1O94A 4HGZA 5LA6A 3O4JA 1D2CA 3C3KA 2AFRA 2V4UA 1N2CA 1E18A 4L02A 4K5PA 1RJ9B 4JYPA 5IZCC 4PU2A 1X1RA 4DA4A 1R74A 2WAMA 4WNIA 4EB0A 2R1ZA 5L45A 5G1NA 3CR7A 4G5YA 4RAQA 2G7ZA 3UAZA 1EVEA 5LUAA 1E4VA 2FWPA 1SD5A 1KZ9A 2GTIA 1XU7A 1Q0RA 3OE4A 3COJA 5G4KB 2N3ZA 5HNHA 2YJTD 4QNMA 4BUJA 1OB2A 5BW5A 2Y1FA 3B6IA 3NUZA 4F4DA 3FDJA 3ITKA 4CCYB 3JVUA 1FQKA 1VBMA 1WR8A 2BRUC 3KZNA 3E1SA 1QH0A 2JEOA 3IUBA 1X3LA 2H8KA 1CT9A 3PDHA 4PZPA 4BEJA 1G9XA 2B1QA 3ZUPA 4WNAB 3UGKA 1P9RA 3SHWA 5E3HA 1LNQA 4IDFA 4TT3A 5FA6A 1KAGA 2ZBPA 4KOEC 3H1TA 4OHVA 3ZJYA 4OEHA 3WYDA 3LDAA 5HXAA 1A2BA 3GPIA 2YKGA 1J0EA 4M7WA 4RUKA 4D7AA 1DQRA 1AUXA 5KVAA 4O02B 1L7AA 5A3QA 1RWXA 2GJAA 3R41A 3OMWA 4MUAA 4ZKDA 1PLJA 5GGXA 3RYFB 1G5AA 4DLAA 2P5YA 2O19A 2TRSB 5TQ2A 1SKYB 3OIWA 1O96B 1H0RA 1KHHA 2LKDA 1SUWA 1AE1A 1IM8A 2PFGA 2R97A 1QCYA 3PGKA 4PBRA 3SJAA 4LY0A 5J4VA 4C6TA 3NRBA 2RE8A 1CBUA 3H2JA 1U8ZA 4S1TA 4CYMA 2HBYA 5JE8A 4IWYA 1UK9A 2WNHA 1SOVA 1LC0A 3AI3A 5JNUA 2VZEA 4C3OB 1XT6A 4BNTA 2PLFA 4QUBA 3OF2A 1CB7A 1U8FO 3M82A 1DKNA 2PX3A 4XJTA 1YHNA 1X74A 2CK3D 4D3YA 5C4IA 1PHRA 4UJ5A 5ALDA 3SDZA 4BX9A 1OGJA 1OBFO 3CO0S 4JA2A 5CAEA 3SQWA 2PLWA 3VYVA 3HG7A 2CEAA 4G07A 2XNHA 1TIBA 1JLSA 1BNCA 2W2NA 4JT8A 2BH2A 2B98A 2QLFA 1GR1A 3OZRA 3CM0A 4G5SA 4GI3A 1X13A 3C74A 3NTUA 3TOVA 4B83A 2VNSA 3A31A 4WY5A 4ZC8A 3DS8A 1YU9A 3DL0A 3ZCTA 2I6TA 2R6JA 1XCMA 4FCTA 2GT1A 2XOKD 4Z99A 3W7BA 2A1UB 3H2IA 4BWGA 1UMBA 2ISCA 2PXXA 3KEFA 4NLLA 3KEQA 2KLBA 3T4EA 3LHFA 5HJEA 5KB3A 3G7UA 4A6PA 2QQ0A 3DVRX 1JW9B 3DHWC 2IOQA 3O38A 3SQOA 4CLHA 1UKYA 1DS6A 2MSDB 1P2SA 2HO5A 3BTOA 3OQHA 2OFPA 4FILA 4ND5A 2YN2A 5LU8A 2O54A 1AQYA 1PL7A 4IJWA 5E2AA 5IEBA 4BAUA 1GNVA 4ZVRA 3UK0A 1NZDA 1ZYUA 3WICA 2EIHA 221PA 1H5QA 1KYWA 4KFRA 4CKWB 5JAPA 3OG9A 3QNMA 2H4HA 3FPLA 1II9A 4F2DA 3QG5A 5ALFA 2V7VA 4X2UA 5MGNA 4WV3A 1L5GB 3H0CA 4BX3A 2BFOA 5F7ZA 5IKOA 2OGTA 1WULS 1LPNA 3L6DA 1KEZA 1T0IA 2W90A 3O8OB 1ADFA 2GJ9A 4RCVA 2OOSA 2QQEA 2UVDA 2X9NA 4LEIA 4YRTA 2DKFA 1V9CA 1EXWA 1DKQA 3RGGA 1ZHHA 3IBYA 3Q8XB 4DS3A 4XGQA 4F5YA 5F2NA 1FSZA 3RVPA 5DN6A 5K0NA 4DSUA 3L79A 4MP3A 5HWSA 1J24A 2E82A 4OFWA 3PXBA 2FPRA 1CZRA 4X8LA 4FYPA 2I7VA 2A5JA 1WLYA 3GT0A 4DMRA 1U7WA 5HCIA 3VZRA 5H0IA 2WZGA 3IQEA 3NKFA 4PAWA 3LC0A 4HRXA 3OSZA 2NVBA 2XQGA 4NJMB 4Z0TA 2YJ5A 1RRMA 3KNZA 4N6NA 4QBTA 1TKBA 4F9EA 3ADOA 4BFWA 2R84A 2OZLA 1TKAA 1OYVA 2P40A 3DE4X 2QW1A 1VYVA 3OCJA 4GT1A 4MLZA 2B1RA 1O6BA 1ND6A 3TL2A 4G9GA 4KR7A 3LYHA 5TVKA 1KXJA 1M10A 2BMWA 1SHUX 2FYTA 3BAFA 3I9V6 4LMBA 1QDEA 2GAAA 2QRHA 4UMEA 3R4VA 1ORVA 3CN9A 4XOIA 5CFMA 2C94A 2ZYHA 2R6FA 3WXBA 1RJWA 2JD1A 2Q2QA 4MIKA 1AZSC 1IG0A 1U4NA 1WG8A 3FOWA 5AOAA 1BFUA 4KIJA 3KEOA 3C41J 1ZXXA 3AFMA 5HKLA 4IDOA 1RT9A 1FMTA 1AQUA 2ERXA 4IS3A 1V11B 3AP3A 4LYAA 5IDYA 3QXHA 5C7OO 1R18A 3PNQA 3UWPA 4JJAA 4TXJA 4MLPA 1XMQB 2IEBA 2ZAMA 2V1UA 4A16A 1T5HX 4DJAA 1QU2A 5HOEA 3AHDA 4G5RA 1VE9A 5IXYA 2QB5A 1JLHA 3BK1A 3IP5A 3NALA 2FEKA 3C8UA 3RJ5A 3Q7PA 3DO5A 1TPZA 4TYPA 2AMLA 1CLUA 2GM3A 3M5PA 5KQSA 1NVDA 1V7PC 1VBNA 3VXKA 5JR3A 1SUBA 4B8WA 5BQPA 4HOYA 1NU6A 2WLSA 1VRWA 4KMRA 5FO1A 5KIAA 1CYEA 1UQRA 3ZY4A 2FMHA 3ZCVA 3GJ4A 1O6FA 2BGUA 4LOJA 2H11A 4KJZA 3S2EA 5JXGA 1JJAA 1UFKA 2AOUA 3QSGA 4JROA 2CVZA 1KJZA 3T3IA 3RHSA 4GMDA 4BVHA 4CMIB 4MUMA 1FZTA 1K2WA 4LTDA 3KYDA 4QUOA 1JSCA 1R37A 2ADMA 3HWSA 4Q12A 1KZHA 5L95A 4BN5A 1KEWA 2I6UA 1BVRA 3ICPA 4KL8S 5AH0A 3T5BA 5BR1A 3EOBI 3DKIA 1T0UA 1U9IC 2EQAA 4XD7A 2CNWD 4IV0A 1V7QA 3CZQA 4H6WA 2P79A 3T4PA 3D59A 4O2LA 1F14A 4IUDS 2CNLA 2UVPB 4BGVA 4H08A 2IBTA 1TA9A 2FEPA 4OLJA 5EMJA 5IYZB 2GUGA 2OHGA 3PBKA 4K6MA 1Y7TA 4RZUA 4JY7A 3VR6H 2CB0A 2VDLB 1ESNA 1E2PA 4GMKA 4LZWA 1Q1GA 2K4MA 1XEXA 1ZD8A 4BO4A 1OTYA 4DCPA 4WEOA 2R4QA 4L0DA 3I12A 3T5DA 3DTVA 1N4DA 2RG1A 4O2RA 3MRTA 4MI3A 4QDKA 3UUEA 5EKTA 3AG5A 1XHEA 1NATA 1DUVG 1OI2A 2XB4A 5LQJA 2GKSA 4JT4A 1RPNA 3ORRA 3FPBA 4GDMA 4EMTA 1R8SA 1RPTA 4EUSA 5EJ9A 5IXSA 3TI7A 2HHLA 2ZRHA 3RYIA 5ISMA 4WLOA 1XRMA 5ALUA 1IZ7A 1J9EA 1Y8QB 1V8FA 1UDCA 3P9YA 2IHNA 1A9TA 2FPGA 3EIFA 1Y7HA 3LWNA 4OLAA 4MWBA 4DLLA 4DCOA 1O97C 2I62A 2QG4A 2ZTLA 3QW4B 3M1AA 4PQRA 5FD8A 1WB9A 1KQFA 4A36A 2NP6A 5C32A 1DOAA 1PJQA 1U2DC 4YHHB 4QQRA 4BU1A 3CZPA 3AEKB 4CETA 3KOWA 1YQGA 2D2VA 4PINA 1A2QA 2QLBA 3GGJA 1Z0UA 2Y93A 2J9XB 3VBEA 1ZSVA 2A9JA 2QTVB 2AZXA 1GPAA 4RF5A 4G84A 4QDTA 4TLCA 1N2HA 2DBQA 3FJOA 1AGNA 4IUCS 2BGNA 1C8LA 3ENNA 1Y80A 2WDZA 4KP7A 4HP8A 4O1IA 1SXHA 3RBXA 4M9ZA 1E92A 1F9AA 3DQQA 3FUCA 5BN4B 1FPQA 3H6KA 4CIVA 4HPJB 1S9HA 2IV7A 1F7VA 2QTGA 1PK7A 2M32A 3COVA 3D8NA 4K86A 1WHTA 3DXYA 1T0BA 5D3MA 4F3YA 3N8HA 3ZTTA 1KK0A 4BFTA 5DYYA 1NW8A 1ONPA 4TT3D 1SUIA 2YH2A 2CFSA 3E3OA 3NAMA 1TQ8A 2VF2A 1NQVA 3RSQA 2CMHA 1MDBA 1FFYA 5ITSA 3T3HA 2CV1A 2N47A 4LJ4A 1YVRA 4MRNA 2FUNB 2QP4A 2Y8EA 1RHKA 1TEXA 1GL9B 1RJ9A 2A86A 3INYA 2DM6A 4KR0A 4RHTA 3TJRA 3A4YA 4F4FA 4LV8B 3HGMA 3KSDO 5EIOA 4KB5A 5CD1A 5F7JA 1COWD 4G81A 2QRVA 3L7LA 4GQAA 4CFZA 5KCZA 3HR7A 1U7DA 5ES4B 3RYHB 2Z9BA 4XEUA 3WLNA 2A59A 1P0QA 4P33A 2QVCA 5DGCA 1RCUA 2B92A 4ZI5A 1ZWKA 1K88A 3DXZA 4OK6A 3TSOA 5HJ7A 5I51A 2GFQA 2FQXA 1VOTA 2FMIA 4FYVA 3L1KA 3UENA 3I6YA 4LHXA 3V4ZA 3KKMA 1L5OA 4D8UA 4DIOA 1AGYA 2AXEA 1ETHA 4LHEA 2BF7A 3DTVB 3HW2A 2NPOA 2Z58A 5EE5B 5C18A 4BJ1A 3OBIA 2JFBA 3JTEA 3UKOA 3WLAA 1SHKA 5BWNA 4H7DA 5JAHA 4ZU3A 2F55A 1HT1E 2QU7A 4LK2A 4KYUA 1JQLB 4A23A 3SEQA 1UJ6A 5KNDD 4G0VA 3VHXA 1CDZA 4XM1A 1C7QA 2JJ1A 3NTXA 2ZRCA 3VHQA 4MUXA 4RD2A 4WXHA 1COZA 2ZYDA 3NKVA 5A5FA 4K2AA 1P5HA 3Q15C 1HA3A 2PFSA 3O3OB 4A0FA 2PL3A 3ONWA 3D02A 3ZQ6A 2ZIAA 3RW9A 2YCBA 2VP9A 2BFFB 2XDQA 4IRMA 4RSGA 4TXMA 1IL0A 5CBPB 1FFCA 2HJVA 4K9MA 2TS1A 3BF7A 1KDYA 2I34A 4JBLA 4BATA 3NBMA 1S2DA 1E1RD 3EZLA 4GM0A 4WK4B 4A5SA 4L78A 1HTWA 3A4IA 3PIIA 2B5OA 3L18A 3C70A 1OTXA 2KSQA 4PWZA 1ZMTA 2GAIA 4I1SA 1KQNA 3L0BA 1H2ZA 2H00A 1QCCA 3VFDA 3X1JA 4G01B 3ABOB 1IIBA 1YMUA 2JPDA 2W48A 2WG0A 3DVAA 5EWLA 2BM0A 2QJOA 1OAOA 4PX3A 1LDMA 1M6YA 1N8TA 2DQKA 4IIDA 4LXGA 5K1ZA 5LN1A 3WQBA 5A04A 1HLFA 3A10A 3MJDA 5FFMA 5TQVA 3QKRB 2GJKA 1RLUA 1YUNA 3U4MA 2QX4A 3FR8A 3K9WA 3D3WB 2OE2A 2E5FA 4TV8F 1DAGA 4EGAA 1IE3A 1CUHA 5EXPA 1C1DB 1C0KA 4Z86A 1N77A 4KV7A 1YSCA 2JEYA 2A1TS 3KU1A 3HXQA 4PFJA 2NYUA 4UQPA 4BNYA 4BV2A 1XDUA 3EEIA 3OEYA 3QKUA 1Q0TA 4M0FA 1GRRA 4HZGA 2HK6A 3CLKA 4JYBA 3D3NA 3B20A 3LRPA 3AP1A 4WESB 1NLFA 3KVVA 2GN6A 4TZ6A 1M72A 1ZGHA 5DEIA 4CFYA 3G5AA 2ACKA 2R8XA 3GMDA 4PZCA 3AXTA 1BHO1 4ZPXA 2GZMA 2XA2A 4UDXX 3UMRA 2HHHB 3WK4A 3AI2A 4P38A 5FUVA 2UYCA 1V95A 4FC6A 1MJGM 5DLDA 3DLHA 4D9CA 3Q4GA 3GLFA 1EINA 3G8YA 1UK8A 3JV7A 4B0PA 2D7JA 3KZCA 3CW9A 3DPUA 2ZUVA 1SXJB 5KVCA 2CDBA 1A9SA 3RH0A 5LNK1 1L6IA 2POQX 4RVSA 2PPLA 1WCYA 2WD8A 3HLKA 3DD5A 3CH5A 2WU0A 4LS3A 3OJFA 4ZT3A 3ZHUA 2W8BA 5IK2A 2WF7A 2G80A 3O93A 4LQLA 4TGLA 4LZZA 4V38A 2YY7A 4H17A 4HMOA 3L0PA 3CY6A 1T1GA 4XZ3A 2J46A 4G0NA 1KZGB 1RLJA 1E4OA 4NJEB 3SG0A 4AO8A 4H4CA 2ABWA 3SGLA 4MVJM 4XMVA 1HZZC 1RLIA 3L5KA 2NU8A 5G0UA 5GONF 1UC4B 4BVBA 1U7OA 4DJEC 4YYZA 5JEDA 3GZ4A 2A5YB 3GOHA 2XLCA 1GUAA 5IKXA 1KKLA 2HF8A 2N9UA 2RSLA 4IRXA 3SC2B 2H1HA 4LYFA 1KSJA 4R9RA 1PUXA 4CHGA 4DM4A 2XWBF 1Y3DE 1G5FA 3U31A 1Z6XA 1YRLA 1QHFA 1R4AA 3AHFA 3WYGA 1M2HA 1IRIA 1J1IA 1FF9A 3CVWA 2F8SA 2XT0A 3G7SA 1Y1RA 2BIFA 3GC6A 5KSPA 4I7EA 1I30A 1YBFA 3K4HA 2HCTA 2GILA 2RB4A 3JXEA 4ZOLF 5CLJA 3HE3A 3VYWA 2JHCA 4W82A 3GUCA 3HBNA 1YB1A 4CMEC 3MYYA 4Q48A 3NORA 5E7IA 5IARA 4GKKB 4MYSA 4PC7A 1PRYA 2QBYA 1VLVA 4CV3A 1PLLA 1E4EA 1VMIA 2R00C 1M8GA 3L1HA 5F7OA 3R5TA 4JELA 3QMWA 1CRWG 4LMAA 4DMKA 1NUUA 2VCEA 3QVWA 5KWJA 3OJEA 1P9WA 1OMOA 1QK4A 1PL6A 1T3LA 1GPJA 3EZ6A 4MQUA 2EL7A 1DCMA 4QC2A 2FF7A 4II7A 1UZUA 1UBUS 2BDEA 2ZR7A 4Z4EA 4C07A 4CEJA 1DO8A 3NHRA 4TKVB 2FR0A 4ZYZA 2D6FA 1BDHA 4CKEB 3MINA 5BYAA 4PAGA 4MIEA 5F4BA 3DOFA 5IJ9A 2WTEA 1GQSA 2Q9AA 1L5QA 4OXQA 1W5BA 4UD6A 4Z54A 3EEYA 2IPOA 3Q1LA 4J0GA 1S2OA 1ZZGA 2FUG6 2QTLA 3H1AA 3N8IA 4TV9B 4ABYA 4C0XA 4HEA1 4HYEA 3TQTA 2HWUA 1T5BA 1H2RS 3H5WA 1XGKA 5CPFA 3ZHSA 4UBLA 3VAAA 1HOTA 1SKQA 1XZJA 4HO1X 4KE8A 4ZVMA 5K8JB 3VSCA 1K9SA 3BE8A 3PIRA 4MGYR 4FKZA 3D6AA 5CVUA 2IK8A 3KTOA 2PE5A 4E51A 2PN1A 1JBQA 4JI1B 2RH4A 4JLSA 2F9LA 5JNRA 2CVHA 4J43A 4NI5A 4MCJA 4OQYA 1PW5A 3AVPA 4FDAA 4K0KB 4I14A 2FUKA 1RPAA 4BFZA 3K70C 2FOLA 3TUIC 3EHDA 4M1YA 4RKFA 1W34A 2EJBA 3P9RA 2OPHA 4LJAA 1QTNA 4JOSA 2BJVA 4DT1B 5KTMA 3JT1A 3TG8A 2X8LA 5KHOC 2WB4A 2B61A 1TUIA 2IXDA 4LK3A 1GLGA 3HXMA 1I4DD 3AV3A 4L76A 4U6SA 2JV7A 2Q5EA 2ZJ1A 3ABQB 1MQAA 3EJWA 3GMTA 2DPGA 3L8FA 5KTTA 2HIMA 1I0ZA 3I9KA 4PTLA 2LR0A 3ZY5A 1ECLA 2IZ5A 2XSZD 1YCGA 4NULA 5DM1A 4MMYB 1QOPB 5SZIA 1QO0A 4D0LB 3KT0A 3VDMA 4M38A 2DB3A 2OC9A 3H16A 3LV8A 2QORA 3M2TA 4OHMA 3E4CA 4LJ7A 5DCYA 1COWA 3IEKA 5DNCA 4BZQA 1YOVB 1G2QA 1SMKA 1JVBA 2V74B 3PC8C 3QMMA 5K6AA 2BLNA 3UV7A 1RHUA 1IZZA 2QIOA 3UB2A 5CA0F 3MAAC 2AMVA 2POCA 4ZWNA 5TY0A 4C0QC 2E5WA 1JR4A 1ZDMA 5GZ1A 2DUJA 1XZKA 2ZWIA 3ND6A 3W2IA 3T7CA 3RLFA 4AJHA 3EY4A 2B82A 4QJIA 1X1QA 3D5TA 3HWWA 1IVNA 4XPZA 3ZE7A 4QAQA 4JWTA 2VJDA 3LX8A 1P45A 2ET6A 3MRSA 2V9ZA 3BT7A 1HQCA 3UMCA 3CO5A 4Z9AA 1E6CA 4BMDA 1HQKA 1MZVA 3EXEA 4CQMA 4PHFA 5D7NA 5J1SB 1CR2A 3TSZA 4FPXA 4BZXA 3G85A 1MFPA 2BGIA 5JD6A 3CE6A 3ESZA 4K6OA 4PFKA 1Z06A 3P9XA 4JJGA 4LWZA 4PNEA 2I1VB 3DV0A 1P1KA 1GTG1 1NE2A 2AK3A 2VG8A 2XWQA 3H5VA 3UUWA 3PX7A 3JRNA 1YRQA 4N49A 2RK3A 1F8FA 3QUBA 4X20B 3PXCX 1RPZA 4HB3A 1M2WA 1N9ZA 2HL6A 2XA1A 3DAOA 4PPNA 4QOIA 4YJ2B 2PH7A 3VU8A 4B85A 3AHCA 1IIRA 3P2OA 4AR8A 3V1LA 2AGVA 2AFIB 3JATB 4IDNA 4I55B 1CHNA 2FI1A 2Z30A 4FDVA 5CFQA 3KOOA 3AM5A 4H60A 1EUQA 3EASA 3VR5H 4ZO7A 3C1TA 3PI7A 2OV1A 2PMWB 3OM1A 2QVXX 3PFCA 4M6WB 4N5IX 4RY0A 4ZVTA 5J4KA 1KYQA 4AAYA 5KNBD 1HE8B 4B44A 3BEOA 2IYYA 5IBPA 4J4TA 5EV7A 1RBQA 3GCDA 5CT6A 4BX2A 1OAAA 4BQQA 1E3QA 4GLBA 4L75A 2OD2A 1NQOA 1UF9A 5CDYA 3HVJA 3BE6A 3ORFA 4FWBA 1P5FA 1NWCA 3DGFC 2IEGA 1XMXA 3QNUA 4PZUA 1OYYA 1UBKS 1XDGA 3K8YA 3ST7A 4MWZA 3H5NA 3WL8A 2XADA 5ER6A 1NSTA 3SJUA 2WWIA 3UK1A 3ZJUA 4TTTS 2I7XA 2P3LA 3T3EA 3TZQA 2O7GA 1O77A 2YVAA 2JNWA 2OVBA 1Q1QA 4FXOA 4GZ6A 4HYYA 4ISBA 5KYTA 5LP1A 1PNTA 1DC5A 2JKVA 4QXPA 1B2RA 4PYQA 1JAIA 1GKIA 4DEXA 1M1YA 5CDFE 3F9CA 5HZGA 2A5FA 2F1OA 5DXAA 1PNOA 1SVUA 3Q0IA 4HNAB 3BERA 3MS2A 2YVLA 3OEHA 5I9LA 5DASA 3ETJA 2D5IA 4JFAA 3RQSA 3O82A 4TKMA 4HB4A 1E3IA 2BFNA 3SC2A 3W2TA 4IEIA 1Z88A 4MKTA 3NDIA 2HW8A 2FPOA 4TWRA 3D3JA 1MNAA 2HAEA 2V7QA 2TMKA 4ID9A 4Z9FA 5HQJA 3EA5A 1V6SA 4KRFA 1BKSB 2AG1A 2FPIA 3SIRA 5H80A 2BM8A 1C9YA 1UJMA 3FUFA 2PU7A 5C1IA 3OZXA 3IIMA 1HRDA 1PL8A 2IY9A 3RUIA 4I5IA 1LSSA 1ST2A 3MHPA 4QKQA 1F3LA 4RQTA 5DTRA 3HJBA 1XUOA 2DFNA 1U1EA 2HYIC 2AB0A 2BFEA 2A5DA 2VAMA 2ZS7A 5CBKA 4NXMB 3FR7A 3E3NA 3GEEA 3U7IA 3B3FA 2MHCA 3DMRA 3L7DA 3W2FA 2JGEA 3IMFA 3QFTA 5TARA 2BI4A 1JDTA 4P83A 5JRDS 1CVLA 1MEOA 2X23A 5AKLA 5CG2A 4G1MB 1GQRA 4OHOA 2BAGA 1YJBA 3GH3A 1JSRA 3B48A 4I4NA 5T3YA 3RS7A 1E9DA 4HGPA 3UJNA 2RONA 5I8PA 2VKQA 2QM8A 2CDCA 4QZVA 5JXHA 1DIBA 1YS6A 4B3RB 1GAJA 3LT4A 1DEOA 1E9CA 2Q29A 3FKJA 1EWRA 3I32A 3OLCX 4BP9A 2AT1A 1THTA 2JLUA 3BJIC 4H7IA 5B3AA 1EVLA 1LCIA 2O1XA 3WMFA 5F3RA 5NLLA 1PR2A 1U28A 5J4HA 5LMNB 2PLNA 3U7RA 8MHTA 1RLMA 1RKXA 3OOSA 2QDXA 3IR7A 3TD9A 3HUEA 1D5CA 1VECA 5AVVA 4PYNA 3FDZA 1DAOA 4C4SA 4YCSA 5GV7A 1U5CA 2HCFA 2B0CA 1RRPA 2Z2YA 4A5OA 5LVAA 3H6GA 5B1EA 1J8YF 1G8MA 2H92A 2EGUA 3LCCA 3PHBE 4R84A 4UAGA 1IDOA 2XEXA 1ZEMA 3FPJA 1JX6A 3OQNA 2V8OA 1CVIA 4MYCA 2A67A 1KWKA 3DTVD 4IR7A 4H3VA 1CEYA 1X14A 4YBRA 3LC2O 1E2FA 2HQBA 3HCOA 4AR1A 1MO3A 3T1NA 3WBKA 3EUWA 4GPAA 3VSBA 4US1R 3L9WA 1XCOA 4QYSA 4FHCA 2P90A 1DKLA 2HB6A 2J0SA 2QN2A 1HETA 2VF8A 3SP1A 4EA6A 5HF5A 2TSYB 2H1IA 2YFHA 4Q9NA 3P19A 4R1SA 4XM2A 1G2PA 1AMOA 4RGQA 4LJ8A 3TBHA 5TLSA 2XYPA 3R74A 5JOQA 3DONA 1RABA 3K0FB 1J22A 1NBIA 4D56A 5IVIA 2P8SA 1DBSA 1AK1A 4I55F 4IQ8A 2DH6A 5TSDA 4IP0A 3TO5A 2OVFA 3T1TA 3UPTA 2AQHA 3HCRA 4UM8B 4ZO8A 4BVGA 4DLPA 4NFSA 3U9TA 3QE9Y 4OQNA 3RQIA 1P8AA 4O4IF 4U2GA 1YQEA 2YOGA 3GFTA 3ZDFA 2J41A 4XN7A 3VH1A 3WLKX 1CP2A 4KQMA 2WMOB 3G9TA 2GJ8A 4CMIA 2JFOA 4U9UA 4Y9UA 1PEKE 3SJBA 3GQVA 4GMXA 2FZVA 3ESXA 2HUPA 2V3VA 5HA5A 4EI7A 2Q07A 3PD0A 4JASB 1E62A 4F3TA 3P0JA 2GZRA 3HWX1 1F06A 4RHUA 1VE6A 4FSDA 4MEBA 4QUJA 1J0BA 2DZDA 1S0UA 4QO8A 1CIJA 1XAIA 2PGXA 2VAPA 5AJXA 1ZD5A 3DKVA 5EZ6B 4F6RB 4W7IA 3PPVA 1EUDA 3C8MA 1JG7A 2L19A 1Z26A 4ZEXA 3SHQA 4B71A 1U28C 3AEQA 1YZTA 4F2PA 4Z1OA 1JB9A 4U3JB 3FZNA 1L5NA 2VZ9A 5AD1A 4P5DA 2AOTA 1HWYA 4MV7A 4DY6A 2C8JA 1HG1A 1DG9A 1Z5NA 3KZMA 3L8EA 4ILKA 5FPHA 3T3DA 3LLCA 4R2IA 3K1AB 3PA8A 1N2EA 3BCHA 3A32A 3KJQA 3SSMA 3LFHA 4J2HA 5JH7F 2IDZA 3A27A 1IWOA 1G21B 1VJDA 3CCCA 3II6X 3AUFA 2MAPA 3LCMA 3R6DA 2A9OA 1KVRA 1RWVA 2WK1A 2YICA 4FN4A 4INZA 2FWMX 1M0TA 1RWNA 2DG2A 1R6AA 4XN2A 4GEGA 2ZYVX 2B9VA 4F6LA 3KQHA 3GDOA 2PKQP 4LHYA 1FU7A 2PX4A 3UWSA 1FP4B 2RHCA 3WP0A 4UNPA 1Y6ZA 2GNOA 2HC9A 1DKOA 2LW7A 3CXUA 3FJ1A 4LJ6A 4PU0A 2QR5A 4PZZA 1EVYA 4Q9HA 3R0XA 2YN4A 1XMIA 5IBRA 2FDCA 3FTNA 3ETDA 3M3PA 5U4XA 2X15A 2D62A 2G3YA 3DMPA 4HH1A 3E1KA 4EX6A 2GCGA 1QQ7A 2DYKA 2ZT8A 5F52A 1CNMA 1EWKA 2CUNA 3R7BA 2V0NA 2HOQA 5B37A 3T4XA 4D45A 3GR6A 4AT1A 2HA6A 3IQFA 5K0LA 2EX4A 1UOOA 4ZFNA 3KYDB 1UP6A 4MWEA 2EJVA 3NBKA 5IP5A 1NDQA 3F3MA 4ENUA 3V8PA 1GZVA 2R4UA 5BUSA 2Q6VA 5B2ZA 1W85A 3BSFA 4I4LA 2V6JA 4BEWA 1JGTA 1WXQA 2R7NA 3OQVA 1EDDA 4HNAA 3UAWA 4NATA 1XA3A 1SUDA 4IGIA 4J8PA 4GXNA 1EFLA 3ZQKA 1F2UB 2EZ9A 2GQ0A 3B1JA 1O6ZA 2I33A 3CINA 1MA0A 2VRWA 1NPYA 4LGMA 5FRDA 5AKZA 2QN3A 4JJIA 3SD7A 1W30A 2BSXA 1XEXB 1KI6A 2N46A 3CRQA 4LY6A 4R41A 2WJJA 1V1RB 3TQQA 3F3KA 4E4YA 3VVLA 2P9YA 1JFRA 2VS1A 5L7TA 2XB8A 2RJ3A 1NVEA 1BGXT 2OBMA 3V9AA 2G6TA 1XD2A 3RFFA 3YASA 1UKVY 3BMQB 1G8JA 2HK7A 3G2IA 4MHOA 4JYMA 5BV2P 1PSDA 3EWNA 1JU9A 4XN8A 3HZOA 2DWQA 4U9IS 1K66A 3AJRA 1WCIB 3LJKA 3BH0A 5BRAA 2FQWA 1R4MA 2AVDA 1V9LA 4MGKR 4Q1EA 4QGFA 3PUUA 5F21A 1PZNA 1VE5A 1TL7C 1XCLA 2P5UA 3E9RA 2XEDA 3DEJA 5FAXA 4O4JB 3ORYA 3ZLJA 4CFSA 3GRVA 3KWFA 1D7AA 2D0PB 4ZCSA 1GOTA 2ZSBA 3A6FA 4P7FA 1T5DX 1UKCA 4QG7A 4IF6A 5E4YA 3VKF