2B61A

Crystal structure of homoserine transacetylase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
357
structure length
357
Chain Sequence
SVQNVVLFDTQPLTLMLGGKLSYINVAYQTYGTLNDEKNNAVLICHALTGDAEPYFDDGRDGWWQNFMGAGLALDTDRYFFISSNVLGGCKGTTGPSSINPQTGKPYGSQFPNIVVQDIVKVQKALLEHLGISHLKAIIGGSFGGMQANQWAIDYPDFMDNIVNLCSSIYFSAEAIGFNHVMRQAVINDPNFNGGDYYEGTPPDQGLSIARMLGMLTYRTDLQLAKAFGRATKSDGSFWGDYFQVESYLSYQGKKFLERFDANSYLHLLRALDMYDPSLGYENVKEALSRIKARYTLVSVTTDQLFKPIDLYKSKQLLEQSGVDLHFYEFPSDYGHDAFLVDYDQFEKRIRDGLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Homoserine Transacetylase from Haemophilus influenzae Reveals a New Family of alpha/beta-Hydrolases
pubmed doi rcsb
molecule keywords Homoserine O-acetyltransferase
molecule tags Transferase
source organism Haemophilus influenzae
total genus 112
structure length 357
sequence length 357
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.110 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2b61A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2b61A01
1XQYA 3C6ZA 4L3WA 5ALOA 4QZVA 5T4BA 3AIKA 2QJWA 1HDEA 5LYYA 2X76A 1AKNA 5SYMA 2W6CX 4PF1A 2HA0A 1CUFA 1IVYA 1CUCA 2DFPA 1YASA 4P9NA 3OG9A 5CTAA 2WFZA 5JASA 1UOPA 1ZIXA 4OYYA 3CN9A 4UBNA 1FJ2A 5HK8A 3STYA 1W6RA 1LPAB 4P93A 4L9AA 1XLWA 1K6EA 3S2ZA 1LZLA 5CT6A 1TIBA 3BDVA 1W4LA 4OD0A 3KXPA 1PFQA 1M33A 2VT6A 4FMPA 3WKDA 2VAXA 3I2IA 5AK5A 1QE3A 4TGLA 5IH7A 4DSZA 1MPXA 3R40A 3OC0A 4KAAA 3STVA 3GFFA 2XB6A 3VKFA 3DJYA 1ZD2P 4G1FA 4A5SA 4P92A 2GBIA 5J3JA 2WFMA 5LZ4A 4G8BA 4N8DA 3HACA 1E3QA 4FNGA 4KACA 1B6GA 4I3FA 5ALYA 3UMJA 4MYDA 4BRZA 5AM4A 1LPOA 1EXWA 1CUIA 2LIPA 3O95A 2XMZA 2CB9A 2WG0A 1JJFA 2XUDA 3C5WP 5JAOA 4FTWA 4AB1A 1USWA 4JUIA 1TCBA 3WMRA 4Q34A 7YASA 5C81A 3H17A 5ALHA 2WQZA 2PU5A 4C88A 2ZYRA 3F67A 2D5LA 3TRDA 3GROA 3PE6A 1MU0A 5HKBA 4J0JA 2XQFA 1XZHA 2DQYA 2K2QB 4BP9A 4M0EA 4B9EA 1G4HA 2XUKA 3WA7A 3IUJA 1S8OA 4M0MA 4C89A 1E5TA 3F9CA 4EZIA 2YASA 4B80A 1QIEA 4W1RA 3O4GA 4Q3KA 3FVTA 3WWCA 1WB5A 4DGQA 4B0OA 1XKLA 4J0DA 4LXIA 1R50A 3WKAA 1ZI8A 3O4JA 2HA7A 1XRLA 3DEAA 4G4IA 3DL4A 5K3BA 3C6BA 1UK7A 4UUQA 1YR2A 5JZBA 1YS2X 2OCKA 3S8YA 5C8ZA 1XZFA 4BBZA 2HM7A 2OQVA 4B6GA 5LP1A 1QONA 2RI6A 1MX1A 1E8DA 2G5PA 2E3JA 3JWEA 1YS1X 2PSEA 3CXUA 3DD5A 5K3AA 1JU4A 1WPXA 4AXBA 5AP9A 5LIPA 2PBLA 2XLBA 5FPQA 1W76A 1J06A 3O4IA 2V98A 5I7UA 4GDMA 3E0XA 1LBTA 3STWA 3VVLA 4KAFA 3WYDA 1JT2A 1EB9A 1ORWA 1YB7A 2V96A 1CUAA 5ALDA 3QYJA 2ZJ7A 1JI3A 1JJIA 1FFAA 5FPPA 4JH0A 1MTZA 3H2IA 5E4YA 3I2JA 2WG2A 4X3CA 4G4GA 2EDCA 2WIGA 5ALUA 3DYVA 5AIAA 3RARA 1H23A 3I6MA 2CMFA 5C8XA 2OAGA 4KAJA 1WHTA 4B84A 3OURA 4FWBA 3AZOA 4BP8A 1XRPA 4X71A 3D2BA 1JJBA 5DNUA 3I1YA 1X2EA 3IA2A 2VQ6A 1XZIA 1F8UA 3VJMA 3STUA 1DWPA 1H22A 4HXFB 1DT5A 1R88A 4PW0A 5IKXA 2H7YA 5BWBA 1NU6A 4OPMA 5AKXA 2VJBA 3WWPA 3C6XA 3T4UA 4U2GA 5LZ2A 2OPHA 1AZWA 3NOXA 5AKJA 4BAGA 5AI4A 1HLGA 4EY7A 4X00A 1W75A 4W1PA 4BDSA 3F96A 4X6XA 5ALEA 4U2CA 1ACJA 1XQVA 3U1TA 4EY8A 2VF2A 1GGVA 3B5EA 5DYYA 3UUFA 5K3EA 1EVEA 4H7EA 3PICA 4G9EA 1U8EA 3EQ9A 1IUNA 5CH5A 5ALNA 3C6YA 1BE0A 4F21A 4MJ3A 3BXPA 1QTIA 1QO7A 4JYPA 1Z68A 1U2EA 2QXTA 2VSQA 4HZGA 5HF5A 1CUYA 1BU8A 2G5TA 5FLKA 4G5XA 5ALKA 5AICA 2PUJA 5AK3A 3STTA 3L1JA 5JATA 1ZGCA 4Y7DA 4EY6A 5CT5A 5HQ3A 3WYNA 1MX9A 3H19A 3H2GA 3OPMA 2DHEA 1QIGA 3O9VA 2ROQA 5ALXA 3DCNA 5CW2A 1N8SA 5AKLA 1XKTA 1GZ7A 2OG1A 1K8QA 3FNBA 3IBTA 3A6ZA 1L7RA 4BTLA 5LKRA 3M3DA 1K63A 1CV2A 4BC0A 5FKJA 3WA6A 3ILSA 4TVKA 4X91A 1XZBA 1XZAA 3WL8A 3WK8A 4G8DA 3LLCA 4QLOA 3IUNA 1XQXA 6YASA 5LZ8A 2WUDA 4U2FA 5ALJA 4QDOA 4MEAA 2HDWA 3WKEA 1EI9A 2JGKA 1OCEA 4RPCA 4MQLA 1CR6A 5FDFA 5AKGA 2PSFA 2PX6A 2BGRA 3BJMA 1TAHA 2OAEA 2RHTA 3W9UA 3M81A 5T4EA 1R3DA 5KWIA 5HF8A 3WK4A 2CKMA 2XMRA 1D07A 1G5FA 2XI4A 2PU7A 3TGLA 4BVKA 1UKAA 2QUAA 2RONA 1THTA 5C7YA 4INZA 5DTIA 3F98A 4CIAA 5AKYA 4K6GA 3FSGA 2YH2A 1ZD3A 4YASA 2QRUA 4OB8A 3FYUA 3QMWA 3R41A 1L7QA 1K4YA 4B0PA 4IQ4A 4Z49A 2C0QA 3IURA 2HHAA 4FKBA 1EA5A 4IH1A 1KU0A 5ALWA 5EIAA 5EHZA 4E14A 3W04A 4KR0A 5I8PA 2H7XA 4V2IA 1LNSA 4CIBA 2Y2UA 4GEGA 4N5HX 3WZMA 4BZZA 4ITVA 2H7CA 5E2IA 1XZCA 2FUKA 4N8EA 1CUSA 4ZGBA 1PJAA 1T4MA 4LHEA 4YPVA 3WK9A 4QDTA 5CBKA 3WKBA 2OXEA 3RM3A 1Q0ZA 3PUIA 2VAVA 1ETHA 5YASA 3ZWQA 4QNNA 2WJ4A 2ZJFA 1E8MA 3HJUA 1G66A 4G8CA 3G0IA 4Y2TA 3R3UA 1EVQA 2PSDA 4C01A 2ZJ6A 2JGJA 3DYIA 1VXRA 1MN6A 3CCBA 1O6FA 2WILA 2GYVA 5FUMA 5ISMA 1UWCA 3KWJA 2PPLA 4UBMA 4W9RA 2FJ0A 4ZWNA 1XZKA 5ESRA 3VJLA 3VISA 3H1BA 2C5GA 2WIDA 2FJPA 2BGNA 3SK0A 5EFZA 1ZGBA 4DYHA 3W9BA 1AGYA 5IVDA 3DS8A 3WL5A 3Q8WA 4U2DA 2VATA 1DINA 1BEEA 2ZSHA 2BUBA 2WIJA 5DYWA 4NZZA 4I19A 4PO3X 4KJXA 1EX9A 4B9AA 2WTMA 3C43A 2VJCA 3D59A 1AQLA 3D2CA 4UHCA 4H0CA 1OILA 4PNZA 2WSLA 4Y2QA 4OB6A 1DWOA 5AI0A 4OCZA 3LP5A 4F0JA 4WDQA 1ISPA 3WIOA 4RNCA 4HXGA 5K3FB 3AILA 5EHNA 1EB8A 2XUPA 3HABA 3VJKA 4AZ3A 4UHHA 4AO6A 2Z8XA 2HA2A 2YXPX 4KE8A 1Y7IA 5FOQA 4HAIA 4UBKA 4BB0A 3V1NA 4KE6A 5JANA 3FYUC 1J2EA 1VA4A 4BCBA 3WWDA 1KEZA 3NUZA 1ODTC 1CUEA 4D9JA 1AX9A 2JEZA 1BN7A 3B12A 5I9IA 4UBLA 1CUBA 4S0XA 4J7AA 2QMQA 3N2ZB 4Q82A 3I2GA 2CEKA 5JD4A 2XMSA 1BEZA 1P0QA 4CG1A 3YASA 5FXMA 2AJLI 5CT8A 4WFKA 3WK7A 1LPMA 3SX4A 4MWTA 5ALFA 2PSHA 2R8BA 1GXSA 4DMKA 5DTJA 4CCYA 2EEPA 3R3XA 4Q3LA 5CH8A 4X6YA 5DLPA 4E46A 4DNFA 1R4ZA 3IDAA 1CUVA 3VXKA 4PV7A 3BL8A 3H2HA 1LZKA 5ALTA 1IZ7A 4MWSA 2O2IA 3AIOA 4W1QA 1JMYA 5AI6A 2BUAA 4H7JA 4UHEA 1TQHA 1CPYA 5FRDA 3WWEA 3ANSA 2CJPA 3GZJA 5KWJA 2O7RA 3F97A 2XUAA 1SCIA 2OGZA 3WWOA 5EHQA 1EDBA 4BZWA 3DKRA 4L0CA 3EQ8A 1MT3A 5HKAA 4B82A 4RE6A 5LZ7A 1YA8A 1CQZA 1B41A 4FBLA 1MJ5A 4X94A 1C7JA 5D3ZA 4Y2JA 3OM8A 5T4FA 4BDTA 5EIHA 3ZLUA 1GPKA 3BIWA 2QOEA 4GHWA 5AOCA 4L72A 4LYEA 1EH5A 2QUBA 2GYWA 1E66A 5BOVA 3K9BA 1IUOA 4GLBA 1EHYA 1TKRA 2HIHA 5AOAA 1THGA 2HA3A 3D5EA 5BV7A 2DCMA 1N5MA 1FSSA 1GKLA 2XQGA 1CUZA 1LPPA 2VA9A 5CXXA 1CFJA 4EY5A 1L7AA 2QM0A 1SC9A 1AUOA 4ARAA 5JD6A 1VLQA 1H2ZA 5K5EA 4GBGA 3C70A 3FWHA 4X95A 3HC7A 1CIJA 2PM8A 2JIDA 3FAKA 5IVIA 2R11A 3KSRA 3WJ2A 4MYSA 2QXUA 4ARBA 1UK6A 1RYYA 5A2GA 5LZ5A 4Y2SA 4KRXA 5AKEA 1BS9A 4DMFA 3QPAA 1UT6A 2QTBA 4C87A 1ZOIA 4FOLA 1IZ8A 3A2MA 4WCVA 3G0GA 3HSSA 1GQRA 2J4FA 1GQSA 2PSJA 4BYMA 1F0NA 2WJ6A 4P08A 1DWQA 4FNMA 1LBSA 2C0PA 4AZ0A 4ZV9A 1WB6A 5EI5A 1DX4A 3JYHA 3PFCA 4X92A 2XMQA 3GA7A 4AO8A 1EDEA 1CQWA 1XZLA 5HK9A 1H2YA 2HADA 5LZ9A 3BJRA 4XJVA 4ZV7A 1X70A 1XQWA 4AMYA 5K3CA 4WY8A 4F5ZA 4OUKX 4HRYA 5CRIA 5KBYA 4UBOA 3DDUA 4J0KA 1ZICA 4E11A 3K2IA 1DT3A 2IX9A 3QBJA 4AMZA 1QO9A 2I3ZA 2RGUA 2ACKA 1XLUA 4Y9SA 2B9VA 2Y6VA 4IH4A 3Q0TA 4Y2PA 2FX5A 4DLNA 1VJ5A 1MNQA 1AMNA 1G42A 3DOHA 4QA9A 3ZLTA 4HVTA 2OGTA 1UOQA 2C4HA 3QH4A 4UFOA 4EB0A 2WHPA 5AKZA 5DNVA 4HXEB 2B61A 2WFLA 1YCDA 1N1MA 2GBGA 5C8VA 4WY5A 1C7IA 4H77A 1UK8A 1VE6A 3D3NA 2OGSA 2G4LA 4XWGA 3PI6A 4KE9A 5A71A 2CBGA 4X93A 3PUHA 2JGFA 5SYNA 1QJ4A 2I03A 3I2HA 2QKYA 5AIBA 3NGMA 3WIBA 2PL5A 4Q3OA 4UHDA 3W06A 3WL6A 2XQIA 5LLSA 2J3QA 3L1IA 4WFJA 3BF7A 2WKWA 2WJ3A 2OLEA 1XRRA 2PVSA 3DKKA 3WJ1A 5AKIA 1QTRA 4FFVA 3PF9A 2HA4A 1UZAA 1AC5A 2OCIA 5EIEA 4KRYA 4H7HA 5JAPA 4UFNA 2BJHA 3ED1A 3N0TA 4QE3A 4W63A 1N5RA 3RKSA 5JZSA 3AJAA 4IHAA 4UBIA 1SFRA 5E4JA 1UOOA 1ZJ4A 3FSGD 1EK1A 1VE7A 1LGYA 4EUSA 5T4HA 5AKHA 4FLFA 2BFNA 1JKMA 4EA6A 1CUDA 1YAJA 1QIHA 3UUEA 4WFIA 4N8SA 2AJCA 4C6HA 2UZ0A 5K3DA 4C4YA 3G9TA 1CUHA 5AM5A 3WL7A 1ZD4A 3ANTA 4BTVA 2DSNA 2QZPA 3ESAA 4ETWA 3AUKA 3FVRA 5AK6A 2VJDA 2ECFA 3O9MA 4GI1A 3BE8A 4UPDA 4LXHA 3WLAA 2XE4A 4PSCA 5JD5A 2QS9A 2HU7A 1O6GA 2HU8A 3R3ZA 4FHZA 5DWDA 4ZI5A 4QLAA 4QDXA 3I6ZA 1HBJA 3EIOA 5ALRA 4ZREA 1CUUA 3HLKA 5HQ3B 5JALA 5AM0A 3QM1A 4BE4A 1HKHA 3BDIA 4BE9A 4HS9A 4GWLA 2VJAA 1IUPA 2WM2A 4NVRA 4Y2UA 4BCDA 1E89A 5ALZA 3V1LA 4PQEA 3G0DA 4DMHA 5JAHA 2ZSIA 2Z5GA 2V97A 1FFDA 2XUJA 5FP0A 5A7HA 3DOIA 4M0FA 2WU4A 5ALVA 1HQDA 1XRMA 4X85A 4G4JA 4C4ZA 1JFRA 5AM3A 2ZVDA 3I28A 4GECA 2XLCA 1ZI6A 3IVMA 4A23A 1VXOA 1T2NA 2OQIA 1QIMA 4XVCA 4KEAA 5CURA 1HPLA 1UFOA 5CH3A 1JU3A 4ZXFA 4DTCA 1UXOA 1WM1A 5AHXA 5BWCA 4X7BA 4UHFA 3MUOA 4H35A 4CCWA 2JGEA 1CLEA 1OXMA 4FLMA 4OB7A 1FFEA 3QVMA 4ROTA 4JNCA 4FDMA 2C58A 5IVHA 3KD2A 3G0BA 1H2WA 1R9MA 4F60A 3MVEA 4NMWA 1A8QA 1MO2A 5AOBA 2ZYIA 3VDXA 4K6KA 3QMMA 4B81A 1SCKA 4OU4A 1MNAA 2PUHA 4OSEA 5AI5A 3OOSA 4BATA 3I2FA 1U4NA 1Q83A 3AZPA 4KE7A 3WK5A 2IIVA 3AFIA 4TPKA 2AXEA 3QMVA 3ESBA 2WHRA 3FYUB 3A70A 3C5VA 3A2NA 4X6UA 2OCGA 1ZIYA 3C8HA 3AIMA 3KOOA 2ZYHA 5CMLA 4FFWA 1J07A 1CUXA 1FFCA 2HFKA 4WDRA 2Z3ZA 1CUJA 5HF9A 5CT9A 4JEIA 4J03A 2O2HA 1RWQA 1MAHA 4DNPA 2XUIA 4X90A 1VA5A 1VOTA 1CUWA 2GYUA 4H18A 1UKBA 2GZRA 1PV1A 3LS2A 4QDUA 5JIBA 3M82A 2B20A 3E1GA 2O2GA 1KU6A 1XZEA 3IIIA 2I78A 4BAUA 2XUHA 4UFPA 3DL7A 2NW6A 4Q1VA 1XRQA 2W22A 2ORYA 3HI4A 2XMGA 3BIXA 3G9ZA 2WU3A 3G0CA 1WHSA 5A7GA 3FLAA 4A16A 1WCYA 4LXGA 1LPSA 1P0MA 1U65A 2VEOA 2VTVA 4QWMA 1BN6A 1ZJ5A 5AH0A 2WUFA 2I3DA 2WG1A 3G8YA 1CVLA 3GUUA 3FCYA 4N5IX 2CZQA 3C8DA 4DM7A 2QR5A 1CEXA 2OCLA 4BC1A 1XLVA 3TEJA 3W05A 5AI8A 1P0PA 2HRRA 5F4ZA 4H7FA 4YK7A 3C45A 1QZ3A 3HEAA 3HRHA 1XROA 5ALGA 3FLBA 1XRNA 2Q0XA 2WUEA 4XIIA 1GKKA 1Y7HA 1ZI9A 5AKKA 3PF8A 4K2AA 3R3YA 3WZLA 4DNQA 3EQ7A 1QIKA 3ZV7A 1I6WA 2O7VA 4B85A 3DQZA 4LYDA 1Q0RA 4H7DA 2BUCA 5DNWA 3A2LA 1E8NA 4GXNA 4CFSA 1R9NA 5JAUA 2XUOA 5ALPA 3O0DA 4HRXA 1VZ3A 3T52A 3RK4A 2B4KA 1ODSA 4J0IA 2RIPA 3RLIA 5A7FA 1Y37A 3ESDA 5AM2A 2J3DA 2QT9A 4Y2YA 3AINA 5AJHA 5A62A 3FOBA 1QOZA 4FLEA 4YX9A 3H0CA 5HF6A 2DR0A 1W52X 4OU5A 4MQMA 5E4TA 3TJMA 2DHDA 1UK9A 5HCUA 1IMJA 2Y2VA 1NX9A 3H2JA 5DJ5A 3HZOA 2WIFA 2XUQA 5ALLA 2JEYA 2GBCA 1QIDA 5FV4A 3NWOA 4LKOA 1RP1A 1ODCA 4CI9A 1CRLA 3KDAA 2XT0A 2H1IA 2WLSA 5EHXA 3CN7A 1DU4A 5JADA 3O4HA 2ACEA 5AM1A 2EDAA 4HTAA 2VT7A 1YAHA 2RAUA 2HRQA 4CCYB 4E15A 4H7KA 3D0KA 3I2KA 2Y6UA 5H3HA 2WUGA 4AX4A 1EK2A 4EY4A 2X5XA 3W2TA 4OYLA 1BRTA 3FYTA 3M83A 2XMBA 1TRHA 4U2EA 2XMCA 3K6KA 3U0VA 4K6HA 1F0PA 4AQDA 4B7ZA 1YB6A 1BROA 4Q05A 1JMKC 2IITA 4IO0A 1UKCA 1LLFA 5D6OA 1QGED 1XFDA 4J0GA 3P2MA 4RGYA 3H18A 1A8UA 3V1KA 3H2KA 4U2BA 4K5QA 4MEBA 3SC2A 2C5FA 1A7UA 3GELA 4UBJA 3FBWA 3QZUA 4NS4A 2BKLA 2QJRA 4W1SA 1DQZA 2AJDA 3WKCA 2P8SA 3LIPA 3MGAA 1EINA 3G9UA 4EBBA 2DHCA 3IB3A 5CT4A 5IVKA 2WTNA 4IH9A 3IUQA 3EBLA 4AO7A 2ZYSA 2G63A 2JGIA 3I1IA 1QFMA 1XZJA 4JYMA 3ZI7A 4MXDA 3B3QA 2HU5A 4BCCA 4BAZA 3I6YA 3ZLVA 1X2BA 3LIIA 1ORVA 2ONCA 3EF3A 5ALIA 2Z3WA 1Q84A 4CG2A 4J0CA 1R1DA 5JZ9A 5HFAA 2JGMA 3LCRA 5KREA 2Z8ZA 2JBWA 1A8SA 2WHQA 4BRSA 1FFBA 4PSUA 1GPLA 2PKYX 4ZRDA 5LKAA 4DSAA 1F6WA 1NU8A 5A6VA 5ALSA 1XZMA 2HL6A 5AO9A 3L1HA 4QDZA 1TCCA 1QLWA 1AURA 1LPBB 5EGNA 3V48A 1EDDA 1LPNA 2BCEA 2QVBA 1SOMA 3V1MA 4H7IA 5D3KA 4DMCA 1VKHA 3E4DA 4UHBA 2HA6A 4CG3A 2JGLA 1WPRA 1C4XA 3R3WA 2ES4A 1J1IA 1XZGA 1YSCA 3G02A 3D4LA 4RE5A 2X8BA 2HA5A 2XUGA 2XQJA 3QPCA 2WIKA 4X97A 3ESCA 1K5PA 1GPNA 3V9AA 1BCRA 3H04A 1DQYA 3ICWA 4Y2RA 3CCCA 4XX1A 3GBSA 1QFSA 2BAGA 4DIUA 3MUNA 4BVJA 4Y2XA 3JW8A 3KWFA 2GZSA 4J3JA 2Y1KA 3ICVA 1SCQA 4EHBA 3VVMA 3IULA 1CUGA 2GBFA 2JF0A 3WK6A 2AJBA 3H1AA 5K3FA 4C4XA 5AK4A 5ALMA 3G7NA 4WJLA 2XUFA 2J4CA 1BCSA 2XDWA 3F8SA 3PFBA 2RHWA 2WHPB 3DNMA 2CUTA 3D7RA 3FLEA 5CXUA 2WFLB 4J0HA 3WQHA 5AI9A 5DYTA 1W1IA 3OTQA 2AJ8A 1WOMA 4QEKA 3FCXA 3WI7A 3D2AA 1ZD5A 3QPDA 2V9ZA 4Y2VA 1ACLA 3IUMA 4LIPD 4G9GA 4I4CA 3STXA 3R0VA 3AZQA 2HFJA 3C87A 3E3AA 4BVLA 3HXKA 1P0IA 2XMDA 3SWWA 2DQZA 4GW3A 1WB4A 3BWXA 1MX5A 4KYVA 5HFNA 4AN0A 1DX6A 4DNOA 4AN1A 1QIJA 1QIFA 3ZPXA 3G9XA 4PSDA 4O08A 2H9YA 2C7BA 3BF8A 1A88A 1VZ2A 1TCAA 4QWWA 5HZGA 1GT6A 1MAAA 4B83A 1DTEA 1QIIA 5JARA 1YA4A 3QITA 3X3HA 1H2XA 1HL7A 5D7BA 2XQKA 4FBMA 3R3VA 1XZDA 5JYCA 2D0DA 2YYSA 5ALQA 3HYSA 3DLTA 3PDCA 1TK3A
chains in the Genus database with same CATH superfamily
1XQYA 1NNSA 2AOUB 1VGVA 3CZGA 2IY8A 3HL4A 2C1ZA 3RSCA 5F33A 1HFJA 1P75A 4L3WA 5ALOA 2X22A 5F5LA 5T4BA 3T5TA 5CIYA 1TZKA 4RWZA 1L8XA 2C31A 3TIVA 1ZN9A 2V03A 3I9MA 5BXQC 2DLCX 1MRSA 2GK3A 5LYYA 4PAWA 2GPNA 2NP6A 1AKNA 2GNOA 1HTWA 2R00C 3O3MB 5SYMA 1NR5A 2QVGA 3CNNA 5CG1A 5I7SA 1H94A 1JQEA 3DF9A 5IK2D 4IKEA 2HA0A 1EMDA 1Q3TA 2OVFA 2C3YA 3BMQA 4Z4GA 3K2QA 3QLVA 3ZU2A 3BB4A 2JJQA 4PXYA 5BV0A 2WTXA 1Z3CA 4KC0A 1T5OA 4JGBA 4W4TA 1CP3A 1YASA 5EXTA 3CVXA 4C7OB 2OT3B 4IDDA 4RKFA 5JYBA 1EVZA 3OG9A 4LDAA 1FU4A 5FL3A 4V03A 2H4ZA 3BG5A 1OYVA 3AF6A 3P0EA 1QQTA 2X6QA 2DHRA 4OBEA 1XN1A 1OV4A 4OQEA 5L3SB 1Y48E 3IAS6 4GF5A 1IN5A 4IIYA 5C7OO 2ZT8A 1BMQA 2XWJI 3DOOA 1YVUA 2DU8A 2A0XA 2NU7B 2R44A 2RGYA 1MB3A 5HZHA 2O0HA 4MUHA 2J33A 5CT6A 5BY2A 3R7AA 4IVRA 6REQA 5K0BA 2MDTA 2OWEA 3G5LA 4I7EA 1GSHA 5KOIA 1C0IA 2B4TO 4RV5A 4NKRA 2YN2A 1K9VF 2VT6A 4RY9A 1OOEA 2R6FA 5GZ1A 3PPVA 2JVJA 4FMPA 2WYIA 2YVLA 2ZYAA 3DZHA 1VDZA 2IW3A 5K0NA 3UV3A 2VAXA 2GJAA 2QQEA 5L7WA 1Q20A 1QE3A 5E8JA 4LQDA 3OZBA 2Y1LA 4FYPA 4TGLA 4DSZA 1FP4B 3T3DA 3UNXA 2PG3A 2GF2A 3P20A 2HPTA 1DTSA 3KWMA 3UEQA 2GPJA 4O4IA 3OC0A 1VIYA 1D2HA 4KAAA 3JSZA 2XB6A 3GFFA 1TA0A 3HCAA 3NNSA 4TV8F 5JZMA 3EVBA 4P92A 2GBIA 4X3PA 4UAVA 1F3LA 2OKCA 1EQAA 3I58A 3JD3A 3OEYA 3C3DA 3LQFA 3V33A 3TNDA 4BFYA 4BLWA 4O4HA 5FI0B 1SPBS 3IILA 1E3QA 3IRVA 2FFJA 5EWLB 3AY3A 1W46A 1T6ZA 1VLJA 2J0QA 1SCUA 4WN3A 4KACA 1B6GA 1JRLA 2JBHA 1R4NB 2XR1A 1F0YA 1DV1A 3FWKA 4BRZA 1GFSA 3GFTA 4P0PB 3L6OO 2GPAA 3CCFA 3PUUA 1MC5A 4MH0R 5G4KB 4F12A 4ZIRB 1JEJA 1IC6A 5C53B 2ADOA 5H8WA 3TR6A 3UCXA 1YK1A 4U2KA 5IKOA 1Z0DA 2WG0A 2AKYA 4RFSA 5JAOA 5AMXA 3O8RA 3LU1A 1YZ3A 3E9CA 4FTWA 2W6JD 2IBTA 3IHLA 4L3VA 1BO6A 4FFBA 3OQ1A 4AIIA 2YJTD 3WMRA 3BWYA 3LBFA 1L7OA 4Q34A 4C3ZA 1FNDA 1H9BA 2OBFA 3FBTA 3FI0A 5HNHA 1SVKA 4FKMA 4HLDA 4MV8A 5F51A 4HZIA 1VL6A 2VLBA 3NGLA 2BEKA 3BB3A 3SXJA 1J70A 1DJLA 3H17A 2WQZA 4Y6RA 5TRTA 1BDMA 2Y76A 2PU5A 1IOZA 1QHIA 3U4QB 4F7WA 4C88A 4OGLA 5C2JB 2XD4A 3M5PA 4UNQA 3JS5A 4A26A 4BGEA 1PGNA 1PVVA 5CFOA 4PZPA 1E69A 2VXBA 1F38A 3PE6A 4PGGA 4XCQA 1TT5A 1TE2A 5EZ6B 2W70A 5HMLA 3ZWKA 3OT1B 4MDHA 3LDUA 5HKBA 4NF2A 5HG0A 2JGNA 5EJAA 3N8NA 1CX9B 1E2LA 4MQEB 2DQYA 3IP8A 3QTLA 4FOPA 5J40A 4ON9A 4IIJF 2L0XA 4BP9A 3EEBA 4O2BA 1PQ4A 1L3IA 1RT9A 4RXTA 2RH4A 3D6AA 4FT2A 3O0TA 4JN6B 3N8GA 3WA7A 1S8OA 2CVPA 3FF4A 4EJ2A 2XCUA 1R4MA 1VSTA 2C97A 3TEMA 3PGKA 4GM1A 4LTDA 3ABOB 1QYCA 2TMDA 1DQPA 1Q2XA 2QRVB 4F6CA 2P78A 2FRVA 4Q3KA 3WWCA 5EZYF 2ZBFA 3G59A 1RPTA 3PCTA 2X4IA 3PFGA 3OQOA 1NLFA 4II2A 3IB6A 4R2LA 2E48A 5B3AA 4CMKA 2QLTA 4HAZA 3CZRA 3BFKA 2EV9A 4J07A 3T3EA 4BX0A 5AOVA 1A5ZA 3UJNA 1XKLA 5AHWA 4ZJYA 2C5LA 4PAQA 2OILA 2W2LA 4IEEA 2XNJA 1NRWA 1H2FA 4LXIA 4RHFA 3V00A 3WKAA 5C32A 1OXTA 1W88B 2HA7A 3PHHA 2CWDA 1U5AA 4G4IA 3IVRA 4LJAA 2IYYA 3L0IB 5ES4B 3BN3A 1L6RA 2Q4OA 2QX8A 2GEDA 3PQ3A 3ROMA 2RKOA 3TINA 1ZG3A 1XHFA 3AOEC 1D7AA 4KREA 1NLZA 4A0SA 1YS2X 3NX4A 1ULHA 4Q4JB 2GN2A 3ZE2B 2NVWA 5C8ZA 3FTZA 2OPBA 4LI0A 4P4SB 2CZGA 2VQDA 5TS3A 1G3QA 1EAMA 4TS4A 4CEJA 4CM9A 4B6GA 3BERA 1II8B 3WLTA 1TTHA 1F1BA 5G3YA 5JC1A 1P4HA 2RI6A 4OAOA 4P54A 4RC9A 1UJBA 2C4MA 4YBRA 1N2HA 3JWEA 1YS1X 4Y1RB 3DD5A 5HKOA 3HUUA 4OY3A 4FQ7A 1NR7A 1TLTA 3EAQA 4AXBA 2PWPA 5AP9A 2R96A 4LHYA 3G2PA 2OCXA 1GPBA 4HWSA 1TMOA 3JWJA 3L01A 4QJ3A 3NEYA 1KIAA 4DQDA 1U1IA 3PT9A 5I7UA 3FI9A 1MJHA 3ZTYA 4YJ2A 3ASZA 2D5IA 3GMIA 1AKVA 1GNSA 3ON5A 1DL5A 4IGAA 1C7EA 3BH7A 2CMDA 4RK7A 4RIIA 1GL6A 1ZHHA 3E0XA 3U48A 4CMHA 3VVLA 5B3JA 5K8UA 3TLKA 3UPTA 1D2RA 5F21A 1RC1A 4DV3B 5AVXA 3G2NA 5G3ZA 5JROA 1U0LA 3FVVA 5K09A 1JT2A 2FN9A 1SUFA 1EB9A 1NXPA 1ORWA 1SHTX 1XXLA 2FPIA 3FSRA 4OP3A 1A72A 4PC2A 4LKRA 3JZMA 4Z5XA 2NZXA 1CUAA 4B33A 5A4FS 2QA5A 3A7EA 2HCFA 3KB8A 3TKYA 4RJJA 5C31A 3U44B 1Z63A 1UPUA 2D7CA 2ZJ7A 3LUFA 4EVIA 5F7XA 1H85A 3ACCA 3EZXA 1WUIS 1TFRA 2PHZA 2R6DA 3T7CA 4Z53A 1JJIA 2X2OA 2B1JA 3FUNA 1FFAA 1KAOA 4NATA 1TYEB 1UJCA 4HXYA 4OF4A 2RGAA 4QBTA 5F1YA 3GLFA 1Z2PX 2X2FA 3SZ3A 3K2BA 2TS1A 3T06B 2J3KA 2PBRA 3CR7A 3I9JA 3OJWA 3SIRA 3H11B 1Q12A 2IQ5A 3VPBA 2FOIA 1YKGA 1CJSA 1D1SA 4FE7A 2JIZA 4KQ1A 1Y5NA 4L85A 4NBUA 3R5XA 4GVLA 5E4YA 3RU2A 1ARZA 3GJSA 4B31A 3GEMA 4BNDB 3I2JA 1MV5A 4OH1A 1NYQA 3B9PA 2OZKA 1WHSB 4C3OB 4X3CA 1IVSA 1D4OA 3BX1A 2QZZA 3JYPA 5AIAA 2HPOA 1AKRA 4OKIA 1NFRA 3ILVA 1WX1A 1XZQA 2YOHA 4LWOA 3J81A 1O97D 3PRHA 4B84A 3R0ZA 3N05A 4YXWD 1PUIA 3OQIA 3R8FA 3FY4A 3WFZA 2ZRCA 4TSRA 4BZPA 4JVSB 3PWKA 1EZ4A 4MAMA 1T8SA 3FPJA 1Y6RA 1Z18A 3D2BA 1FCJA 1BWSA 3HXMA 1W94A 1OJ7A 2I66A 2IEYA 3I1YA 1X2EA 2JB9A 1KJIA 2JK0A 1NN5A 1RJDA 5ITVA 2HB6A 1CZOA 1NMYA 1VI5A 4MQ4A 4YUVA 1EVYA 5D3MA 3T3IA 3VJMA 3QU9A 4BU1A 5KAPA 3B8HA 4K6FA 1SG6A 3SHWA 4ID3A 2QQ5A 3P2IA 4JSTA 1H22A 2JPDA 3ZDEA 3S28A 1R88A 3KNZA 3KXLA 2G0TA 3SR3A 3E7WA 3QKSA 4PWZA 3I9LA 3K32A 3LT4A 3USCS 2HD4A 2H7YA 3X44A 1T5IA 4RVUA 1PDVA 2VK8A 3OLXA 1GIAA 1CB0A 1UZUA 2VWGA 1KFKB 2Z57A 2FRDA 3GFSA 4KBYA 4DSOA 4ZCRA 4QOHA 3A31A 4OPMA 1RYNA 1JHRA 4C7BA 4HUTA 1H0SA 1Z45A 2VJBA 3Q3IA 4PCLA 5LLDA 5J59A 4YCDA 3DLCA 1IB0A 2HT1A 2BP7B 3TQSA 4GRIA 5K6AC 3TTUA 1PUXA 1Q6ZA 4U2GA 2CGEA 4JUDX 2G1AA 3UMCA 1AZWA 3UJBA 1QNLA 2RH5A 4DYVA 4RTNA 2YINC 3O1JC 3IEMA 3O93A 3EZ7A 3SJ7A 5EJ9A 2Z43A 4CEHB 4MRPA 4Y1GA 5BUQA 3ZE1B 3AERA 4YRKA 3VTZA 3GVCA 4A91A 3BE5A 1A5SB 3ISJA 4BDSA 3LYHA 2J9FA 4ER0A 2CW5A 1A50B 2VYVD 3IAXA 4M0UA 2AC7A 3LPAA 4P33A 3RVDA 1ACJA 1C3OB 1EGHA 1XQVA 3O03A 3OTWA 4FMCF 4NYMQ 3U1TA 4EY8A 1JDTA 2XAAA 4RLFA 2Q41A 3PDJA 2BT4A 4P81A 4TYPA 4LOHA 1OTHA 5MFPA 4D4GA 3UUFA 4QU5A 1HT0A 2IU0A 3TN7A 3SQXA 1XMJA 4PYLA 1RQNA 1KVUA 1OTXA 3CQ9A 4M83A 1CR0A 4YUYA 3OO0A 3CHQA 2VYND 3HKCA 5CFPA 4PAGA 2FXIA 5MFZA 3BD9A 3THWB 3ZCQA 2OFXA 2AG8A 1X3LA 2YJ3A 1TMYA 5DM1A 5GVRA 5JTUA 2QD3A 3GLQA 2JFQA 4OVKA 3ZQUA 3AVUA 3EVDA 1INLA 2R6HA 3S8EA 1RM4A 3QKTA 4RKQA 4EA8A 1JFSA 4H1WA 1ABBA 1O94A 1QO7A 3B1JA 4JYPA 4NFYA 2GPTA 4XSGA 3QELA 3JVDA 4YMHA 4WI1A 5EUQB 2BKUA 5DX1A 4E1BA 4IWXA 1XVAA 1GHTA 2X5OA 1ZGGA 1BD4A 3G82C 3DFFA 3OCZA 4Q1CA 4HZGA 4EMUA 4MVJG 5HF5A 3R0JA 2XV1A 4BO3A 2A9OA 4UM7A 4G1CA 3TDNA 2AE2A 3MS2A 4Q4CA 1RMYA 4M4SA 3REGA 2FWIA 4ZCPA 1G8JA 4LF4B 3VR4A 1WVIA 3P9RA 1XYVA 4G0NA 5ALKA 2ID8A 1MR3F 5AK3A 2PUJA 3JQGA 5F76A 2AG5A 3SS7X 1KDOA 1X19A 1ZGCA 4YR9A 4RJLA 5JATA 3L6RA 4QGGA 1GQ2A 2DP4E 2ATIA 2ZRHA 3FUCA 3VSAA 2IDJA 2OENG 4ZGGA 2PQ6A 2PXCA 3C7AA 4WZZA 1JTEA 3TO5A 2AI1A 2XBLA 4Q24A 5C4MA 1EP9A 1RABA 4IUYA 4WXMA 4OLFA 1C30B 4XIJA 4OUDB 4L4XA 1TA9A 2ARKA 2DWOA 1C9YA 1KYIA 4S0ZA 3VR6H 3WYNA 5KS2A 3HN6A 5C5EA 2NQ2C 3OTOB 3MJCA 2LKDA 3H2GA 3OPMA 2JI7A 3MJVA 2ROQA 3U9WA 1JAHA 1K7FB 1VCNA 3WAGA 1XKXA 1VPLA 1NUAA 3ORYA 4UZEA 5JCOC 1EFRD 1WBBA 2GM3A 4TZ6A 1OE0A 5J5VA 1IBLB 3RJZA 2Q0QA 221PA 3JZFA 1F6BA 1MCZA 2MINB 2O7QA 2DAPA 4YCSA 3Q6NA 1TKBA 2C78A 4HGRA 4UNSA 1BQ3A 3B13B 1L7RA 4IOLA 5TF4A 2QR3A 3NHBA 4H27A 2QN9A 2IUEA 2OO7A 4G63A 4LWPA 2HY7A 1G8GA 5E4FA 3M3DA 4F06A 4KQMA 4WXEA 5DHAA 4F5EA 1IBKB 4K88A 1PR5A 4TVKA 1CRPA 3AT1A 3ER6A 5CPBA 3WHKA 3RTDA 1U0JA 1XZAA 4FNOA 3ZQKA 4QM6A 1J22A 1XE3A 1U3DA 3CH6A 5KYXA 4MVJE 3JALB 1IN8A 3A4NA 4TVOA 3D4BA 2UYGA 4GOKA 1MDBA 3MELA 3WK8A 1ZVKA 3FR8A 4YY3B 2G9RA 1YVPA 3N86A 1ZMOA 3LLCA 1G7TA 2E4YA 4UAUA 4YH1A 1U7HA 1F14A 2ZRQA 2XKBA 4N0QA 4R2JA 1IHYA 3NANA 4OREX 1SQMA 3WBKA 1PJSA 2YDXA 4QYWA 4DLWA 3CE9A 1JI0A 3ER9A 1NKTA 1FTQA 2HTFA 3TFWA 4MI3A 2A35A 2PLAA 4QVKA 3AUAA 4PPYA 4FDTA 1D09A 4L6CA 4NRDA 2PUAA 1EI9A 2IIQA 4RPCA 2EBWA 3GK3A 5BN5B 4Y6SA 4BO9A 2FN7A 3FMPB 1TF2A 3DE4X 4ERXA 4DT1A 1UDXA 2IXGA 2E85A 4EVQA 1EE1A 1Z83A 4OGWA 4EA9A 1O89A 4GBMA 1YS7A 4ZDIA 5I7WA 5KWIA 1EXMA 1GKIA 4DLUA 3JV7A 1HY3A 2F59A 3E7DA 3ZHCA 5DBEX 1FQJA 4LY3A 3AVOA 2BMDA 3T7EA 1U6JA 1KRWA 4P2BA 1RTTA 4YPOA 2QTVB 3H9GA 1OZFA 1SZDA 3BCRA 3DEJA 4ZODA 1UAYA 2ZSJA 4YFYA 1J23A 3D8RA 2R1VB 4FMDB 4ASUA 1CDOA 3NJRA 4DV7B 2WE7A 2Z8YA 2C7OA 4FS8A 1G5FA 2ZRIA 2Q45A 3S1SA 1ISFA 3I0ZA 3RBAA 4WASA 2PU7A 3DE2X 1WMDA 1HOTA 3JSAA 2VP3A 4R9NA 4BVKA 2LVBA 3OZIA 1UKAA 2I6TA 2N42A 1X7XA 2QUAA 2RONA 1OASA 3CBGA 3RSOA 3ZZMA 4B5LA 2F62A 4KWIA 4PG8A 4F4FA 4Y9RA 1A8HA 4P38A 3RIYA 2QWXA 1G5IA 3CSUA 4INZA 4OL9A 5DTIA 5FBQB 4KNYA 3GLUA 4S1PA 3ZIAD 3A7DA 3ESQA 3A3KA 1Q1EA 4KDCA 4Z8YA 3WGYA 3W8NA 4N5NA 1PL7A 3JQFA 2GSWA 4ZCTA 1HORA 4HB4A 4NX2A 4Y9DA 4ZTUB 5CM9C 4NZPA 1V8FA 5HX7A 2Q46A 1TU4A 4KL8S 4ZVOA 1ECCA 1NP6A 4Z49A 1PO7A 4Y9TA 1W5TA 2IZ7A 3IURA 3DV2A 2ZBGA 3CX3A 1EGAA 3M2PA 1NW4A 3A14A 1T43A 3EWIA 1O96B 4Q01A 3K1TA 3WO0A 4DQVA 4TZTA 3SYKA 5JJCA 5TEWA 4B3TB 2NV0A 1T36B 4P3YA 2FPRA 3PQCA 5EPUA 4M2LA 5KWSA 3GP8A 3H75A 2YY5A 2P9FA 4I4TB 3IKJA 3ANMA 1K7EB 1RM3A 1SUDA 1OBVA 2IJGX 2WWFA 2HYDA 4V2IA 1G63A 1KH2A 2ONJA 4CIWA 5H4GA 3UO8B 4ETNA 4RVFA 2I3AA 1VFNA 2ZJZA 4ZVUA 4F7DA 2BTOA 4PO8A 4ZK2A 5A3RA 4IIGA 4BZZA 1VJDA 3K0EA 4ITVA 3DWEX 3EGDA 2DWUA 2UVDA 3QEMB 2Q6OA 1XZCA 2ZK7A 3MWEA 5T67A 2FUKA 1V48A 3OCYA 1G41A 5ESWA 2I2XB 3FMVA 1N8TA 3WB1A 1WVMA 1T5DX 3G2HA 5DZSA 2GTQA 5HBRA 1W34A 1HFEL 1ZY2A 4LHEA 1G7SA 1T4MA 3ED5A 4YPVA 2XMPA 3WK9A 1C50A 3SFVA 2MYUA 4H08A 3QHPA 2D2VA 3OE4A 5IUKC 4AJNA 1C29B 4JLNA 3PHCA 3TIXB 3WKBA 4CRWB 4EPXA 1B00A 1L8QA 4LOAA 5SZKB 1U0GA 3WRYA 2AF3C 4JJAA 3RM3A 1Q0ZA 3JQCA 1YD7A 2PZLA 3RODA 3UJ3X 4XFDA 1W19A 4JLVA 5AR1A 3LWBA 4PYKA 4XN7A 3ZWQA 1P9NA 2ZULA 3KU1A 4CF4A 1E8MA 5TQ2B 2NZ2A 1I32A 3HJUA 1FSPA 1UUFA 2KM1A 1BS2A 3G0IA 2YZ2A 4RCYA 3W7VA 3P9NA 1WR8A 4MRAA 3U56A 3FR7A 4JELA 5LB4A 1DMSA 3HP4A 4R1TA 1XA0A 2YS7A 2YV3A 2C9OA 3WNBA 1A5TA 1EEXB 1H3NA 3DZDA 1R74A 3GJQA 3S2IA 3SBDA 1MN6A 3FKSD 2VDVE 1FMJA 3BORA 3NAMA 1E77A 2WILA 4KFSA 5BMVB 4C1BA 3QXXA 3UFXB 5EIOA 3O90A 1QGUA 2VHWA 1KP3A 2GYVA 3K9WA 2Z5LA 2WY2D 5CLFA 4D9CA 2GZMA 4MWCA 5LXTF 3EZ9A 3F7OA 4B6SA 2JGRA 2FJ0A 4FYMA 1Q44A 1X8XA 5DT2A 1IONA 4I2NA 2HQBA 5ESRA 5GY7A 2ZIXB 2Q1XA 3VJLA 3OMXA 1OV6A 3H1BA 2Y9MB 3CGWA 5CK4A 3M33A 4V0QA 4LRUA 5U1PA 1D5CA 3SK0A 1GLNA 5EFZA 5LYJB 4QXPA 3ITDA 1ZGBA 3SKYA 2Z6AA 2AEMA 1TKAA 1FDWA 5CGQB 5F5XA 3V7WA 4QJIA 1GVHA 3AOEA 1CC1S 1N5LA 1O03A 4C20A 5DLEA 2K7FA 1WXEA 2P9TA 4GI7A 3W9BA 1AGYA 3LQRA 2I2BA 3RC3A 3TQOA 2J0EA 4ARIA 4FX5A 1N32B 3JQAA 4NYJQ 1UBUS 4IYJA 2RB5A 1C8KA 3M4XA 4D6YA 1UWKA 2VATA 2ZJ0A 3AQIA 4H0FA 2JHGA 2BUBA 3JQ7B 1LBIA 1MQAA 4OMFG 4WLFA 4C0JA 3J80A 2O3SA 3SZOA 4RA6B 2ZWIA 2QRPA 2VJYA 2CK3A 3C5HA 2CVHA 1RU3A 1J8DA 4AG5A 4UQLA 3W5AA 2H3EA 3QX3A 2AXNA 2K2WA 4IM7A 1DEOA 2WTMA 4A8JC 1H1LA 3C43A 3M6XA 2VJCA 3OWOA 4RIHA 4IY1A 2GTPA 3DMPA 3H1FA 2A1TS 5IAEA 4EELA 3EPJA 3AI7A 5IJAA 2CUZA 3TPCA 2W6MA 2C5SA 4UHCA 4H0CA 3PUJA 4TWIA 5B6IA 3EK2A 3JWHA 3FNGA 3DTVA 4PNZA 1E18A 3ZVLA 2X0DA 4B4WA 5FBHA 3DF7A 4TS3A 4AU1A 2B7CA 3F7TA 5EAIA 3RK1A 1E3IA 3PYMA 2IPXA 5TVKA 4MYCA 1DWOA 5AI0A 4ZCMA 1AN0A 1WXXA 2VNJA 1SB8A 2QVCA 1WXHA 4ML3A 3B6JA 3BK2A 4A4DA 4CW7A 2B8JA 2I71A 4G09A 3N70A 3WIOA 3AJEA 2VRBA 4QGSA 2BEWA 2C5EA 1KSJA 1WV1A 1ZNZA 3DULA 3FRHA 3GFVA 3LI2A 4HXGA 1KEPA 3SHFA 5B4TA 4NXMB 5HE8A 2P0YA 4DJ5X 3HB5X 2GCEA 1ENYA 4C5CA 2FJUA 2I7VA 3AHGA 4OOEA 3TSAA 1PWXA 4AO6A 5FUQA 1RJEA 4MR9A 4RA9A 2LE0A 2Z2KA 3DMNA 4ZI7B 2HA2A 3V4FA 1ZX1A 4N3GA 2B37A 4CFYA 4EW6A 4KFCA 3U6BA 4TSFA 4XO3A 1TD9A 1MJFA 3KC2A 3V1NA 3AEKB 1C3LA 3Q3HA 4KQKA 4Q18A 3SICE 1S2MA 3HNRA 1SXJA 1NDHA 1RI1A 3DLPX 3EGVA 2OA0A 4QG3A 3DMTA 1PF7E 1VMDA 3INYA 4KX5A 4ND5A 1JN0A 4NS1A 4YROA 4AUMA 1UBEA 5FEUA 5IYZF 1YHZA 2W8ZA 3K92A 1G8KA 3EGIA 4GICA 2A5JA 2F1KA 3FYUC 1GGMA 1J2EA 1UP4A 4IFIA 4IQ8A 4S1VA 1WKBA 5A3SA 4IMIB 1Z5NA 3O94A 4HJXA 4KX3A 4ZRMA 3RYIA 1U5BA 1QNFA 2PS1A 1AT1A 3GU3A 3ZEIA 3DW1X 1VMAA 1Z5ZA 2I1LA 3VMFA 3VTAA 2DR2A 4BCBA 3TSCA 3PEEA 1W87A 1MEJA 1MHPA 3F73A 2CD7A 2ZRJA 3WWDA 5THQA 1DDOA 1PD1A 4ENQA 2VSXA 1ODTC 2X13A 1ZAKA 3G2IA 3NUZA 4RMGA 3UJ7A 3ER8A 2WC1A 1AX9A 2JEZA 1R9JA 3TZEA 2JD2A 1KMHB 4EQ6A 1G0OA 3IDQA 1KAMA 3I92A 1OAOC 4C0QC 4F3TA 3CX7A 4IDGA 1LJ8A 4UBLA 3T7IA 1SIUA 3BJZA 1NY5A 2YVKA 5FR1A 1DRUA 3VH4A 1D04A 4EYKA 1O8BA 1WCIA 3RG8A 3ADPA 3OFVA 4YP5A 1RHJA 2EATA 1V5GA 4R5MA 3N2ZB 4Q82A 5LUBA 4UNIA 4K9MA 2LV8A 4Y18A 2VAWA 3GY0A 1BEZA 3KS9A 1FSZA 1I7DA 1WBJB 2CLCX 2WJAA 3CBQA 3R3HA 5AXCA 1P0QA 3EVGA 1GR0A 5DPMA 5I4BA 3MTGA 1DAEA 1NXTA 1ZDMA 2TMYA 2MIIA 2WYUA 3IE2A 4NY1A 1YRWA 4B3IA 5IS2A 2UUPA 3HUEA 1ONPA 2H1CA 3MQ4A 3K0SA 1NC3A 2XZTA 4A6PA 1Z29A 5J2TB 2ILVA 2P9JA 3UAVA 1ZUWA 3PD7A 4JI4B 5IF9A 4JBHA 4XGNA 2R8BA 2W2OA 1DE0A 5K8IA 4CCYA 4ZEMA 2EEPA 3V9PA 2P79A 1QQ6A 2QNIA 4U0JA 1Z4JA 3PSAA 4CQLA 2GHTA 1ISJA 4AN4A 4TUYF 4X6YA 5CH8A 1YU6A 4FCAA 1XMPA 2BDTA 5SYAA 3LYUA 4NDZA 4R3UC 1R4ZA 2RCYA 4Y6PA 1E7QA 3H3FA 3IDAA 4GMDA 4NWIA 1FNMA 1J5EB 2Z98A 1T8WA 4IV5A 4UXJA 1MJGA 3VZRA 3H13A 3GD5A 1JP7A 5BW4A 5AVYA 2AMLA 3ZNPA 2G9QA 3CFYA 2YQZA 4G1UC 2QN8A 3A26A 3FHLA 1R18A 5JRZA 3QBDA 1PDWA 3N7AA 4X84A 4DA0A 2IHKA 4UTRA 4R5TA 5T5QA 3OA2A 1IN4A 5EEGA 1R0RE 4OHOA 1Y5MA 4CGYA 3HE3A 2ZT5A 3PHJA 5A5GA 1EUQA 3HUDA 2K5UA 3EDYA 4MUIA 5AI6A 4L16A 2W2XA 3UHOA 4Y0NA 1GNPA 1IOLA 1BFDA 2ISQA 3GJYA 3QFFA 2GK7A 4IUDS 4OKSA 4X41A 2C92A 3ZE7A 3OTHA 4X65B 4Q15A 1TQHA 3OEEA 3WDSA 1AJEA 1UBSB 1CPYA 1TGVA 2C2WA 2WPDD 4X8OA 1VL1A 4Z86A 5EXPA 3VH3A 1MABB 2YVAA 3EPKA 2QE7D 3RFCA 3GZJA 1OGIA 1RC0A 2B4RO 3P0JA 2O7RA 3C48A 3MOSA 2G72A 3GJ0A 8ABPA 4ZC8A 3HGMA 3RYTC 1XALA 1MGOA 1WLYA 1YZHA 2VHXA 2VJKA 3K4PA 3QUAA 5EHQA 3WWOA 3GXBA 4BZWA 2WAAA 1QJCA 1IDN1 2W8BB 2ZIWB 4R2MA 3WDMA 4XLZA 3KKOA 1GP2A 3QOYA 2X4DA 3ZXIA 2EFDB 2ZB8A 1ISHA 2GMWA 2I87A 2O07A 5CLIA 3FF1A 5HKAA 5A9TA 2VP5A 4K9LA 3FYCA 1T3TA 4C14A 2VKQA 3MLEA 1CY0A 3KEGA 3RW9A 3GMSA 3OIFA 4EPYA 3N74A 3QNWA 3AFGA 3A6HA 1ULBA 3KKLA 2IPOA 1GUDA 3A4LA 1VBFA 3ECAA 1TI7A 1I0IA 3SZLA 3CEJA 3M2TA 4LECA 1VIAA 3H2YA 4BDTA 1E2GA 3D7LA 4MIKA 5ED0A 3MYRA 4I50A 1U0OC 3BZWA 2IUUA 1VG9B 5JU6A 3DVAA 3ZLUA 3BIWA 1SKQA 3EPPA 4OL0A 4GHWA 1ZK4A 3RBXA 1FX0B 2R6GA 3C74A 4P5DA 4EKDA 4HAUA 1L8AA 2EXXA 4L72A 4N7MA 1EH5A 1PLLA 1V9SA 2H1SA 2PMDA 1NAIA 2QUBA 3RC9A 3U3JA 4F6LA 4WK0B 5KDDA 3G5TA 3BHMA 1GA6A 4HL6A 3ZV3A 1E9BA 3HEMA 2BGTA 4QNMA 4GVXA 2NU9B 1FUUA 5DN9A 1QB8A 4UEKA 2GUWA 5I7HA 3K0AA 5K2MA 3A36A 1XEAA 4P7GA 4Z99A 1NFFA 1CJMA 1MVNA 2DCMA 4JQZA 3RREA 2FZLA 2XQGA 4YUXA 2H0AA 3ZCPA 5LP6F 2XVZA 3E15A 3GG9A 4GU5A 5CXXA 3RNOA 3ONDA 1CFJA 1RRKA 4FIDA 2GFHA 3WSTA 5MGBA 4ZVKA 3GEIA 4O4LF 1G20B 2R84A 1L7AA 2Y1XA 2Y1CA 3N5CA 4WL0A 5GP1A 1VLQA 1XELA 4NG5A 4B3HA 3LFUA 4C2BA 1TAQA 4DC0A 4YRNA 3N2GB 3SHTA 3THSA 3C70A 3PC2A 4OHFA 1TW2A 3E9EA 3HC7A 3GGGA 2QUIA 1TF7A 3CLTC 3LHSA 5T3UA 1CIJA 1IE3A 2PM8A 5J1TB 3TLMA 4RPJA 3A6LA 3H05A 2PA0A 2OSBA 3LHIA 5AM5A 1GNLA 3ZUPA 1E9FA 3IMEA 5IVIA 4XKJA 1MVLA 5J5CA 3NH9A 3KSRA 3WJ2A 3BXEA 4CIDA 2YXLA 4D6PA 4F6RB 5KQPA 3E9ZA 4MYUA 3NUGA 1EWQA 1MW3A 1V45E 2QXUA 3DWGA 1TADA 2YWRA 4GD3Q 1UK6A 3RFFA 3EX7C 2WYHA 2H92A 2ZJ3A 4YC7A 1J90A 4Q4DA 4UDOA 4KRXA 1LK7A 1QV7A 2R1UA 1L9KA 3I23A 3W5VA 2QM3A 4IF6A 1T0BA 3RSQA 3ZCTA 4D42A 2RHCA 1WD7A 4TRNA 4WX2B 5CA0B 1KR5A 2HC9A 1IZ8A 4X2UA 3UG7A 1KIFA 4WCVA 2JRCA 3PI7A 1J56A 3OESA 4ZVMA 2H63A 3I9KA 1ONBA 4TWAA 4DC1A 5IANA 3FOWA 2PSJA 4BYMA 4HRAA 4W9MC 1I4DD 2VUIB 4AZSA 3TW6A 3TLJA 4FNMA 4UM9B 1LBSA 3KVRA 4LK3A 2O6HA 3IP1A 4D99A 4EHDA 1ORHA 3B85A 4F8YA 4D0SA 4LOKA 1XK7A 4LOIA 2RK4A 3JTMA 1G7CA 3GJ3A 3NWBA 1E3TA 1UJ5A 2C2BA 4JDPA 3N3AC 3TW0A 3SR0A 4AO8A 1N6KA 5FOXA 2CLMB 3TDKA 1MG0A 3KEOA 5CM8B 1P1JA 4TOIA 1J8QA 1Z13A 2P9EA 4M9XA 1KZGB 3ORSA 3UAYA 3V32A 1XWWA 2HADA 4WSOA 2JZOA 2H1HA 3M89A 1M2OA 5BR4A 5LZ9A 3BJRA 4AJKA 2FZCA 4XJVA 1KFEB 3H0KA 2DUJA 4ZV7A 5LM3A 3A6FA 4TS9A 1X70A 2JCGA 3WAKA 3R5KA 2QSUA 3IE0A 3KKEA 4P80A 1QP8A 4AMYA 4NMXB 4TKVB 1WXGA 5JXJA 2X8WA 2HSWA 1SC5A 1ISRA 1Y9AA 2X86A 3PUXA 4HWKA 5DM60 5CCBA 3R9XB 5K3CA 1O54A 4ZU6X 4HS4A 1D9ZA 4G0XA 2ZFUA 5FPSA 4HRVA 1I0LA 4HRYA 1T4CA 4FFPA 4F5ZA 5JJIA 3ZJVA 2GVZC 1FDRA 3TUIC 1WXDA 4EGSA 1DBSA 1PYGA 1L7VC 1P1HA 2F55A 3DDUA 1YGYA 2ADFA 2N9UA 1QFZA 2LD4A 1DT3A 3RANA 2RHMA 1Z34A 1CS4C 1H2BA 1RQXA 2X8JB 1FRQA 5CYFA 4J9VA 3TW4A 3UAOA 2ACKA 1WQ3A 1C2YA 2CL0X 2Y6VA 4HATA 1V5FA 3OIWA 2JI6A 2HJGA 1T2UA 4HN9A 3H5WA 1REQA 4G01B 1VJ5A 4G37A 4JT2A 3VGPA 4DJDC 1AMNA 1G42A 1NP7A 1ZPDA 2CMHA 1PK9A 2Q49A 3DOHA 3INGA 4TYMA 4YJFA 2B36A 3GRFA 4DMRA 4UU1A 4JI0B 3DDWA 4M7PA 3ZZNA 1M34B 5L40A 2WAMA 1BMFA 2RC5A 1CE8B 3NNNA 2ZRFA 3PC8C 4TTIA 3OF5A 1NKVA 4LE1A 3SJUA 3RJ5A 1W1UA 2UZIR 3ZJ5A 3B34A 2YV4A 3B7PA 3NKFA 4QHTA 4C05A 1E3WA 2EWVA 4EB0A 5B6PA 4RFVA 5LIRA 1P3Y1 4MP6A 1OLSA 5AKZA 5EMMA 2PUBA 3HCPA 2B61A 3VKWA 3OAAD 5IHPA 2HJSA 2FFLA 2Q3LA 3UATA 4WY5A 1Z6TA 1KGSA 5K4HA 1UK8A 3WRXA 2DQ4A 3LW7A 3GRKA 4QFDA 3UHJA 2O20A 4BX3A 3JPWA 1V1MB 4QJ4A 4C6TA 1MC8A 4M1KA 3ZWAA 4KPEC 2VRNA 1MD9A 3HYTA 4AC9A 1W9MA 2G4LA 1T1EA 2WJGA 2QG4A 2Z8YM 1X77A 3PI6A 4NONA 3OQBA 4XWGA 3T9CA 5CDYA 1RKBA 1L5HA 3EIHA 1B2LA 1BAPA 1EG7A 1EP3B 2VJMA 1J1ZA 1ZMRA 2EOAA 5REQB 3J81k 1UBKS 4BKRA 4J7XA 1FNCA 3FTWA 1EBBA 4JEMA 2G25A 1VE5A 1XEFA 3AJ8A 3EXIA 4IG9A 4KO1S 3TRKA 3EDQA 5CEEA 4JVMA 4EFKA 2R5WA 3JQ8B 3P2JA 5JXIA 4GRAA 3CE6A 4CF6A 2DBQA 3I64A 1X7YA 2JI4A 5B1DA 3ZDDA 5AIBA 1O5OA 2RSLA 3UMBA 2J9GA 4JEHA 1JKJA 2FE1A 2AIRA 4E2YA 3NGMA 4M8KA 2Y0EA 3OPXA 4ZALA 3EZNA 1HV8A 4N5DA 3HNOA 2QJOA 3HNPA 3IVGA 5LLSA 1GPWB 3L1IA 4KO8A 2CJXA 3LO8A 3S0JA 4L27A 3PHBE 5E3HA 2L17A 5DLQC 2W43A 4LDQA 5FWYA 3RRMA 1NUSA 2EZ4A 1EVKA 2EWMA 2PVSA 5KQGA 3O84A 5EQTA 1HDYA 4X1KB 4UM5A 3ZC3A 4LJ7A 2IIPA 5IABA 5BYKA 1U2ZA 3LPCA 2HA4A 3ECSA 1I6MA 1P1CA 4GX0A 1AC5A 1Y5IA 3MIZA 1RBYA 2NACA 3TD9A 3SNKA 2VP4A 1W8DA 4H7HA 4ISCA 1FBNA 3W5IA 1TUBA 2XF2A 4KIWA 3DLBA 1GSIA 4D02A 3CR3C 2BJHA 4BECA 4DB2A 3G8DA 3N2IA 2RI1A 3N0TA 4YCJA 4CKCA 4QE3A 4LFCB 4WQMA 1KH3A 1TC2A 3EA4A 4Z7NB 1N5RA 4LMBA 4RVOA 3STHA 5JZSA 3AJAA 1Z2OX 3F7MA 4IHAA 3EPLA 3VNBA 3O1IC 1UMDB 4M54A 2BI7A 2ZUEA 1JA0A 1UOOA 3WTCA 1QDLB 1XQ1A 5C8YB 3FSGD 1JT9A 1G16A 2ETVA 1U1EA 4HQOA 2QORA 4EUSA 4WZBB 5TGZA 3JQ9A 3CKYA 1E9AA 1KK1A 1T29A 3OJXA 2AOUA 2PZBA 2EQ5A 2W2VA 3OQJA 5E2AA 1NMSA 4G0QA 1WMBA 2AVDA 3F3SA 1QIHA 3MT9A 3OIVA 3W2FA 9GPBA 2XRZA 4WFIA 4Q1BA 4EF4A 3T8VA 5K3DA 4Q47A 2PRSA 1SQ0A 3ZWOA 3P52A 3VO2A 3AFMA 1JU9A 1O77A 4DJJA 2R1ZA 3CEMA 2NN3C 1D0VA 1LDNA 3OE1A 5FI5A 4D3YA 2BFMA 1NHWA 4KR9A 4DYDA 4LJRA 3WL7A 1ZD4A 3M6MD 2DWCA 5M04A 1D03A 1JAYA 4JNKA 3T9EA 1W9HA 2GEKA 3ANTA 1YE5A 3PS9A 1MA0A 5L4SA 2QRNA 3TQIA 1ZK1A 4D5EA 4J4BA 2J0VA 1DIRA 3SZGA 3LXRA 4G25A 3RVLA 4B47A 3T5PA 2R8RA 4FMCB 2VDWB 1EE9A 3A6DA 4QUAA 1R66A 2H17A 2YWXA 3M1IA 5JPDA 3PNKA 5GIOE 3WLSA 3DJFA 3KD3A 3M4ZA 3IUBA 2H5LA 3BE8A 3VPFA 1DKNA 5CP8A 2V0GA 5L3SA 4LF7B 2J5KA 1M76A 3JAWB 5JW6A 3T4EA 3FCAA 1WA5A 1LLDA 2CY0A 2KBEA 2XE4A 1QO0A 3K1ZA 1G21E 1T0UA 3DYBA 1OAOA 1RKXA 2ODWA 5DRYA 2QS9A 4B87A 1QP0A 2ET6A 2A7OA 1M5TA 2HU7A 2NU7A 3KTAB 5FBRB 3AM4A 3SIWA 2G36A 3ETDA 3PL1A 4N7JA 1QXSA 1JR3E 4D25A 3B2XA 3LT2A 4MUGA 3CKLA 1HBJA 1I7QB 5CVCA 3LPNA 2D2XA 3I73A 5ALRA 1JFTA 4ZREA 2HLHA 4IZHA 2O14A 2RARA 1KAGA 5F35A 4LRQA 5CB4B 4AMGA 1YUBA 3HLKA 1AKEA 4ND3A 1RCFA 3TZHA 3LQQA 3CW9A 3HPRA 4OX9Y 1P1IA 3UJ6A 3ZNOA 4OGKA 1KMNA 3BKWA 3DWFA 3P0RA 4IIFA 2Y67A 1FP4A 3HYCA 3L7OA 5ESXA 1JXAA 1QPGA 5HOEA 3DA8A 3ROEA 4IWNA 5LPNA 2WMYA 3IPLA 1BHJA 4BE9A 1HNXB 1T5SA 2O59A 4NQZA 3WV4A 2LBPA 1R0YA 4NVRA 1UL1X 4NJMB 1GRVA 3V1LA 2JVIA 2P2CA 1OZ0A 4A8TA 4US1R 5HWSA 2A7XA 4MKIA 1M2WA 2IXEA 3DE0X 1AKMA 2XNCA 2BJWA 3EZ6A 4KZPA 4PHCA 5CNKA 4GDFA 2HK9A 1KWKA 2E5LB 2ZSIA 3P9SA 4JI8B 3CVJA 4TQGA 1YT5A 1D4AA 2HMUA 1GA4A 3EA0A 5EWLA 1FFDA 3GLRA 2XUJA 4DOMA 3D64A 2MT9A 2DQKA 3PXBA 1O0CA 5D86A 1EESA 1U2SA 1R4NA 1JPVA 1N1EA 2LUOA 2X8AA 1IYZA 2WU4A 3DOIA 3O91A 4RZSA 2VHCA 4OQXA 4CIVA 3IP9A 1HQDA 3T8YA 1Y9DA 3LBAA 2FEKA 4G4JA 2DYKA 4HNSA 4TLEA 4X85A 4WNIA 5G4KA 1IXKA 5TV2A 2ZVDA 1V9CA 1IUKA 4GECA 1TTPB 5KOHB 2Y1EA 3IS3A 4AP6A 1CR4A 5L3QB 4MVJF 5TB5A 2J3EA 1JJ7A 1RRCA 1N5OX 3IVMA 5FPYA 3R7DA 1VE3A 2PKQP 1D2GA 3G2MA 4F4UA 3MBKA 4UTVA 3TPZA 3H42B 3K16A 2TRSB 3TL3A 5FTWA 1LSOA 2ZR7A 3GP3A 4YRSA 3H5TA 1B0AA 1UFOA 5CH3A 4IHQA 1ADFA 2OCPA 3KVNA 1EFUA 1GQOA 1XF1A 4ZXFA 4EG0A 1YZQA 2JHCA 3U4QA 1UXOA 1VI2A 4PZ0A 2DWPA 2LNDA 1JIXA 3K7EA 1L4BA 3AESB 4NCHA 4DG5A 3MMNA 4MQFB 5T41A 2NV6A 4ESVA 3LUDA 4WLOA 3EIWA 2EKBA 3QVVA 5C1IA 2JLXA 3OT1A 2QL6A 4HEA6 4LZJA 4WJZA 2XYGA 4KQEA 1EUCB 2DR3A 3A1VA 3LECA 4J4TA 4JU9A 1VLZA 5LWHA 4R83A 1VGQA 1ZK2A 3KD2A 4KMSA 4UE3S 5IMSA 3G0BA 1T9CA 3BMNB 3I04M 1FYWA 3L4BA 1CERA 1QR2A 4CMEA 3MVEA 2BD0A 3NIBA 1Q1NA 3V8MA 5EE3A 5B7GA 1G1MA 4FZVA 3BXOA 4XUEA 5KYNA 3LX6A 1WMFA 4WADA 5EFOA 1A8QA 1K8RA 1KP2A 2OHIA 2ZUVA 1PVDA 1N6LA 5KTNA 3PX2A 4QTUB 2QRVA 4QSMA 3VDXA 4YAWA 1L0BA 4MQUA 3ZG6A 1KJWA 1QVRA 2J41A 4HLUC 4K6KA 1J24A 2OMKA 4M0CA 3OZAA 1OT5A 3WGJA 2HMTA 1SRQA 1SCKA 4DNXA 1E63A 3W8EA 2IBSA 3RI3A 2C7RA 3UERA 1BHO1 4IG4A 1YMVA 1E32A 4ZJUA 2QAJA 2FPOA 4BS9A 1G8MA 3AXSA 3AZPA 4KE7A 4WFQA 4KR7A 5JSKA 1M2VB 3S68A 1L7XA 3PYLA 3ESBA 4JC4A 1MUUA 2BM8A 4IGEA 3EGOA 1O9GA 4IJ5A 1QTNA 4X6UA 4F91B 3KIPA 4MHTA 1W4ZA 3AR9A 3RSSA 3FTQA 3TH5A 3EDCA 3SS9X 1G9SA 2O05A 1H42A 1U7DA 4Q4JA 2DBZA 3C8HA 5AFSA 4P4SA 3KOOA 1SD1A 3RYFB 4D9BA 1CNEA 3QX7A 4R98A 1II8A 1J07A 3L3BA 4L5CA 2JD1A 4E5NA 2Q5LA 3B1KA 1SK9A 1GY8A 2YV2A 2GZ2A 2HFKA 2C94A 2PQ0A 1AKWA 3KVOA 3Q3EA 1RYEA 4Y1RA 4JA2A 4U9IS 5BN3B 1CUJA 1P5FA 4MPJA 3DTNA 5ADWA 5JSZB 5LD2B 2YZKA 3VDMA 4J03A 2R1TA 3I61A 1ORTA 4LK2A 1YFLA 1SQGA 1T26A 4HN4B 3K6JA 3VR6A 3A6GA 4ILEA 3L82B 4K0KB 5EXXA 3FKQA 4KDEA 1IQPA 3C3JA 5GOZA 3FDXA 1ODFA 1U04A 1Q7EA 1GPDG 4LSGA 1UM9B 1CUWA 1D9XA 2JFZA 1UIMA 3B6KA 3L43A 3OZUA 3BL6A 1IEVA 1UMBB 2GZRA 3DH0A 3QX9A 4H18A 3RAJA 5AW0A 1U3VA 5K0JA 1PQYA 3L7DA 3L0SA 3M8KA 3DEIA 2ZAYA 3MMZA 4O2AF 1SVOA 1VLHA 4QDUA 1RWPA 4ZPXA 2A9FA 4D3SA 1U1CA 3GPDG 1Z36A 2C88A 1QZXA 2O2GA 1YZYA 2CVFA 1YR3A 2ODNA 4TTJA 4WNYA 4IGKA 4BP3A 5HQTA 3PFKA 3U44A 4KSBA 1XT6A 2F48A 2BMFA 3RRNA 3RRZA 1U2GC 1SNYA 2XUHA 4JKIA 4FFRA 4Q6BA 4BAUA 5BNIA 1DCTA 2G7ZA 3W3ZB 1XRQA 1TM5E 3RS7A 1SMKA 1ZJ6A 4POOA 2DSTA 2OC9A 4I9FA 3GH3A 2QP4A 2EW8A 2I6UA 2Y4OA 3H11A 2D54A 1IBRA 3NV9A 5D85A 2KLHA 5ELLA 3FYSA 2ODAA 1UFKA 4IQFA 5G0VA 3QVXA 5CHEA 1XF9A 4JBIA 3R7SA 1R10A 4DABA 5FOWA 2G09A 1EM8B 3L0PA 4IXNA 3SKVA 4HSGA 3BIXA 3G9ZA 5TR9A 3ZYZA 4BNDA 4DLZA 4B79A 1EE2A 4PFJA 1WHSA 3N39C 5A7GA 2B7LA 3SPXA 4A16A 4FYWA 3CIFA 1OC2A 2JH3A 4M0PA 3L93A 1DLIA 2YYAA 4LXGA 2Q4TA 3EH1A 1H0KA 1E6MA 3L41A 4LBYA 1XU9A 2C3OA 2GT1A 3GAMA 2C2GA 2R8ZA 1QVWA 3KZNA 3P2EA 4ZQIA 5FULA 1SULA 2GQ0A 4RK5A 5HYVA 3KM0A 4TSKA 4BMOB 2WUFA 3ZHVA 1XU7A 1ZRNA 2O5RA 2GAOA 4QIHA 4YGXB 2VCEA 5DP2A 4ZOQI 4HKTA 2R7MA 4DR2B 2IV2X 4LZNA 4M36A 2RD2A 4N5IX 1BSVA 2CZQA 1P9LA 1PL6A 2B2XA 2C7VA 1CZKA 4LVCA 8GPBA 3AJ9A 1CEXA 4OFZA 5FORA 3FSEA 1E5QA 2YN4A 4J76A 4YAEA 4AYXA 3OPQA 3U80A 1CT9A 3ETJA 1M8FA 4BC1A 2QROA 5LXTB 4N0MA 5B30A 3OUZA 5H3LA 5F9MA 3T3GA 5AI8A 3LGSA 4BNGA 4GYJA 3AF2A 3K9LA 4JLSA 2XPYA 5EIBD 2H2FA 3DUWA 3ROGA 2QV0A 2OORC 3K05A 5ALGA 3ANXA 4DV4B 2Q5IA 1GNQA 1GU7A 2WKSA 3FLBA 1NV9A 4EF6A 2Q0XA 3INNA 2ANCA 2WUEA 5EMHA 4BO4A 1LH0A 3PLAE 1AA9A 1PGJA 2N1BA 4EEZA 4EUEA 4QOIA 3R3YA 1PG5A 2ZBQA 1PQPA 3QXSA 1DDGA 2PZFA 5BWOA 2JLCA 3A4VA 1YRLA 1C4OA 1I6WA 5KSOA 4PYNA 4TKMA 3QLJA 5KJFA 5DCYA 2BP7A 2BL4A 5K4AA 5G40A 1LSJA 4IBOA 4TTAA 4UTZA 1F8XA 4AZVA 4AKSA 1R3UA 1VBKA 2UYQA 4I3GA 3FTPA 2VQ3A 1V11B 2C2YA 2V0NA 4CEHA 4R51A 3ZW7A 1GQFA 4U7JA 3ABQB 3PC8A 3MHPA 1DEHA 1UKVY 2ODQA 3WMEA 4CFSA 4RGQA 3TUJC 1L4FA 3QSYA 2Y0BA 4LVOA 1BG6A 1D5WA 2XUOA 3DPSA 4E03A 2O8FB 1I2BA 3GRAA 5B4UA 1YR9A 3NAZA 4R2XA 4J1SA 5NLLA 4ZI3A 1X14A 2OHGA 1C3OA 4HWTA 2PXAA 1Y3BE 3AYZB 4CNBA 3I09A 5ICSA 4EJSC 1CIPA 1ODSA 2C00A 3NH6A 4KZKA 4JY7A 5FNZA 3ZE6A 2Q3FA 4DLLA 1SXQA 4YAIA 3AR2A 2BKEA 1XCMA 1Y3HA 4RVHA 2B4QA 3DE7X 1S02A 3GLKA 3FU5A 2G71A 1FS5A 1ZONA 2CVQA 1TYDE 2GTIA 4R0VA 3A32A 4Y2YA 2WLTA 3WGQA 4CKWB 4D5GA 1HR0B 3THWA 3ZJTA 5FPKA 1U28A 2X8LA 5EKXA 4QT0A 4B4OA 3LBHA 3LT5A 4M22A 5A0VA 1Y98A 4YX9A 3OJCA 5HF6A 4YMGA 2DR0A 4ZVPA 4TTRA 4YCNA 1C2TA 4KLRA 1BVHA 1W52X 2V4MA 3D4OA 5AESA 2XOKD 1E58A 2AQHA 4UARA 3MD9A 4OU5A 3T1OA 3W34A 3U49A 3FJ1A 1FLVA 1ZINA 5KNBD 4C4RA 4JYAB 4HUJA 3R5TA 4N3NA 1GPUA 5DASA 1E1LA 3KLMX 1P9RA 2VPQA 3UBMA 2AKAB 3MFQA 4R1UA 2W6PA 3GC6A 5DJ5A 5FLYA 2IYXA 5IYZB 4OJQA 4DV0B 3A11A 5K20A 2H4JA 2O54A 3SEAA 4IV0A 4B34A 3AEUB 2VZ8A 2XUQA 4R4JA 5LQCA 2WM3A 3LCJA 4YRCA 3EARA 2QVWA 3ZQ4A 2MR6A 3NJ8A 2JW5A 3CNOA 4WOCA 1DC5A 1KH1A 4R05A 1BKDR 5DI3B 2R3SA 1SHLA 2F3QA 2LKCA 1CDZA 2O7NA 5ILGA 4JBXA 3I6IA 3T3NA 1JEYA 4E21A 1C30A 1NY6A 3F78A 3C8ZA 1U80A 2CLSA 3E3NA 3IQIX 4OUDA 4M3NA 2CCJA 4XNBA 1ODCA 3Q2KA 4Q7QA 4IDBA 1I1NA 2AZXA 5THXA 1TJPB 1CRLA 4E32A 1N3BA 2HJRA 3EF1A 3IXQA 1POWA 2H1IA 1KNXA 2WLSA 4RABA 3T1YB 3VBEA 3EUFA 3OD1A 1Q0SA 2DEUA 2H18A 3GHYA 1W7AA 1M2EA 5AM1A 4LW8A 1ZVJA 2MINA 2NUAA 4IGIA 2GZAA 1Q0LA 4KQ6A 3T94A 1T24A 1FL9A 4R71A 1JSZA 1MW1A 4HLCA 5TQVA 2ZQYA 3F5SA 1NW3A 4EMBA 1A5AB 1JF8A 3PJGA 4YRJA 3PDUA 3D0KA 3I2KA 5EJ4A 2IS2A 1ODIA 2Y6UA 3P9KA 4RO0A 3RG2A 2FKAA 2ZE7A 3GLHE 2PUWA 2OBNA 2PH3A 3DNFA 3FFBA 4W5HA 1ONNA 2AI2A 3ILHA 2ZXFA 5KYKA 2J1LA 1D2AA 2QL9A 1VYTA 3JALA 3PFIA 1K0FA 3S70A 4RADA 1EBUA 3NEAA 4LY0A 5JD3A 1IEXA 1LQTA 2IE8A 3T9FA 1A1VA 2EP7A 3U9SA 1PUJA 5CA0F 1AOXA 3FYTA 3V8RA 1WEHA 4TUYB 4XD2A 2J9XB 5EYPB 4MJ7A 3Q9NA 3QFCA 1K1EA 3GDGA 2BGLA 3ZI4A 1U11A 3GFQA 2AK3A 4KN8A 3TL6A 2I8LA 3WVNA 1TRHA 2PKXA 2HJ9A 2XMCA 5BRNA 4WNCA 4DWWA 4DSUA 1T8TA 2F43B 1U0HC 2HLDA 4DCMA 3ZHTA 3OO1A 1G98A 3EVNA 1GGHA 1OVMA 3K94A 1VMKA 4B48A 4JNDA 3OHSX 3ZKWB 4IINA 2P2DA 4BFXA 3E84A 2OZLB 4FR0A 5BN5A 4MWEA 2YJNA 4YDRA 1JMKC 1GUZA 1T13A 3B82A 4P3PA 4DTIA 4K9KA 2VZEA 3I4LA 4YA6A 5TQ0B 1XA3A 1QGED 2OXTA 4BMXA 1AK1A 1G6Q1 3KEQA 4FYIA 1LEHA 2W11A 2IVZA 1YR7A 2WYOA 3H18A 4EYOA 2VAMA 2VHYA 2IBMA 4HB2A 4JAVC 5ICFA 3LF1A 4E4RA 1PQWA 3HG7A 4U2BA 2QTVA 1NBMD 3W79A 3ETNA 1SVMA 3S2GA 1UZLA 1R0WA 2R1VA 1HFKA 1D4ZA 4KXUA 4NAHA 4J90A 3W2GA 3FPKA 3WXMA 2FW9A 4HZUB 3VR1A 4HNUA 4I36A 3GAFA 3MWLA 1PJLA 3OKFA 3K1AB 4NS4A 3SJZA 3OEWA 2JA2A 1PNOA 1CNMA 2QJRA 2YNMA 5AUQA 1T2AA 4IIBA 4NK4A 3UKOA 4ZCQA 4M1EA 3LE8A 4N7RA 1RTKA 4CLRB 1QYIA 4UPEA 2O57A 2CXOA 2XCIA 1ZEMA 4EBBA 1WY5A 3LGXA 3DZCA 1SVSA 2DHCA 3CPHA 3IB3A 5CT4A 2RGWA 1Z5UA 1I1OA 4RGBA 3TXXA 5F2NA 5HIKA 1N3IA 1NQUA 2G67A 3N2YA 4IH9A 1RRFA 1VP3A 3D1VA 3EVZA 3EC2A 1EXVA 4IS3A 2HXSA 2ZYSA 1MOSA 3OZEA 4LYHA 8MHTA 2N75A 1QFMA 3BSFA 3IKLA 3N75A 4JI7B 3G6WA 4KVFA 3LUAA 4ZMRA 4ZCLA 1EUYA 3TFOA 1O95A 1U3WA 1P74A 1SY7A 1O96A 3A1CA 1JHDA 3B3QA 3UCFA 4BCCA 1NUQA 3NEJA 4RAQA 4DF3A 1NVTA 2A5LA 4WEOA 2XB2A 1R6XA 1P39A 1P4AA 1T36A 1NN1A 3ZHBA 4DLAA 3IEPA 5LN1A 2VF5X 4KXVA 4CCWA 5KX5F 1Z4LA 2QN2A 4QEZA 3L8MA 5L95A 2G1PA 4L02A 4Q66C 4KV7A 4Z9BA 4E7PA 1SB9A 3E4CA 3NASA 4ENVA 3P2OA 1KK0A 1AS2A 3K1YA 2ZS9A 4CXFA 2DPGA 3DVSX 4JC5A 3GOHA 4KQGA 4YRLA 2ZU6A 1S2IA 3PTAA 3QEMA 1R1DA 2LDBA 5JZ9A 4KLZA 5HFAA 4RTRA 1OFUX 1RLMA 3HXQA 1EJ0A 1ID8A 1XCBA 1BE8A 4BMSA 4E51A 1KEWA 2PMKA 2VTKA 4MA4A 5C3UA 2FDRA 2WW8A 5LP6B 2D1RA 4CL3A 2QMHA 1RP3A 1VRWA 3LYLA 1SUSA 3OOJA 2OGUA 3MYYA 3PXCX 3KUDA 1KVTA 4C7VA 4O4LB 1XNHA 3CNBA 1A76A 4HDNB 4PSUA 1X39A 3Q3JB 1JHZA 5EPOA 1ZVVA 2J31A 1QKIA 4ZRDA 2X1LA 3U3KA 4AAYA 2XNSA 1HI9A 4RTQA 1L4KA 1VM6A 3MN1A 3F47A 4Q4EA 5B3LA 5JQGB 1OLXB 3I53A 4JJ7A 5KPJA 2AFRA 1KO5A 4I6GA 1GV1A 1HT3A 4KO4S 2RG1A 5TQ2A 4BUZA 4KQFA 1HF3A 1NNLA 2DBRA 3FHCB 3KVVA 4ZQCB 4EP1A 2EX1A 5A9SB 4Z3KA 2BBTA 1HQYE 1EFTA 2PRIA 1WU7A 3DE3X 4R2IA 4BU0A 1WBDA 2IYZA 1PU2A 1VG1A 1Z7BA 3GIWA 4QQRA 1QVZA 1LPNA 2TECE 2V3WA 2BCEA 2D4AA 2RGCA 4KQXA 3GUZA 4MPDA 4WMLA 4YMVA 5KYUB 5I7EA 2CDCA 1VKOA 1WF6A 6AT1A 3C1OA 4LYFA 4DZZA 4YNBA 5C37A 1D2EA 1V95A 4TT3A 1Y1RA 4RIGA 5IDYA 1PR6A 3V4LA 4Z0NA 2ZETA 3TF5A 4MO2A 5BMVA 2HIGA 4V24A 3SI7A 1RZRD 2HSDA 3AQ4A 4J3NA 3R6WA 4HLUA 5CNMA 5JAQA 2HA6A 5FWDA 3UFXA 2QG9A 4EB8A 4CG3A 1IM5A 4F3CA 2AR9A 2GERA 4RV9A 4MULA 1S6YA 1SC3A 1RQ7A 4RV4A 4ZVVA 4ZC1A 2ZIXA 1VKJA 1YS6A 2Y9PB 3KUUA 5H80A 4MDEA 1MQ9A 1V37A 2JGAA 4DDTA 4I0WB 1KJZA 1YCFA 1AMUA 2FQXA 1E2FA 4IXDA 2BBOA 1MQSA 3D4LA 4WJKB 1LX7A 2X8BA 1X1EA 3FNQA 4G3XA 5LYJA 4GSLA 3RS3A 1VHQA 2BV3A 5I9MA 2OBBA 3RADC 4DCUA 2I80A 1Q1AA 1EUDA 3IH5A 3KWLA 3ZV5A 1S3SA 5B58T 1TJ3A 4DDKA 4BLQA 2UUCB 2VJQA 1IQ0A 2WWWA 3RAFC 2E2WA 3BD7A 3RU7A 4ER7A 4N6OA 1JG1A 4U7WA 5ADHA 3GCXA 3V9AA 3KOMA 4JL5A 1UQTA 3S81A 2DECA 1DQYA 1RHUA 1YB1A 3JQ7A 3KTOA 1DXQA 4TLLB 3TMYA 1Z6GA 4KPGA 3ZU5A 1O97C 4RA6A 1E1RD 3CCCA 4M98A 2G8LA 1PZMA 4RMNA 3OKPA 2AMYA 2INGX 5D01A 3O4RA 2HKIA 4XN8A 1I3LA 3GF4A 2V7TA 3JY6A 4JX9A 3JD0A 4G5RA 3BFXA 3UK6A 3D6TB 2WT4A 3MUNA 3DXXA 1JQJC 3QWIA 1G3RA 2E7ZA 4HEJA 4Y2XA 3WIUA 4C43A 5K3SA 3E61A 1DVRA 1Z35A 4UU7A 5BT9A 1U9CA 3JWPA 3PNSA 2EEZA 1HM5A 4LWQA 5TARA 2WA1A 4O8ZA 2HXYA 2XB9A 3L0DA 5EQDA 2DY0A 1R5BA 1S0UA 5FA5A 3I39X 3OQ6A 4B4UA 5JMTA 1I7SB 2W9XA 3E18A 3CF4G 2OY0A 4J3FA 2OQ2A 3IULA 3QLUC 4IJUA 1DRJA 2HEGA 3F5FA 3TRJA 1TUIA 2AJBA 4MGZR 4CKBB 4LZAA 4ZYZA 1ID1A 4H3KB 2HRZA 3A2KA 2QTFA 3H1AA 4BLVA 1ZU4A 3DHNA 4MB6A 2BSXA 5AK4A 4H6PA 4TMZA 1T8PA 4WJLA 1UDRA 3A37A 1VHLA 2J4CA 4K26A 3UJCA 5KNLA 3R1IA 3FWNA 3PT5A 4HPJB 4ZI7A 3FLEA 4FB5A 6ADHA 3WL4A 4UUOA 3U7HB 3ZR4B 1C9EA 1WJGA 2WFLB 3K0FB 2GEUA 1WCXA 4R2HA 4QRDA 2OB2A 2MYNA 2D1TA 1K08A 3OTQA 4JR0A 3AEKA 2AJ8A 2H2GA 3DAOA 5KNDH 3LNTA 2I65A 2WQ6A 2W6ID 3FCXA 1S89A 2E87A 3VPSA 1RHQA 1YHNA 3D2AA 4A0HA 3RUHA 1V0JA 1RCTE 1ZD5A 2GX6A 3L7AA 2WF5A 2OYCA 3TIIA 4RDIA 4BNVA 3MB8A 3I52A 3WQQA 4Y2VA 2OBMA 5C7IO 5JOQA 3GOQA 3QQ5A 5A1TA 2MSEB 3LP6A 3CHSA 1LLQA 2FFAA 4UMVA 4ZEOA 3OFNA 4LRXA 1NVMB 2PGIA 4JP3A 4BTEA 3GX1A 3DHYA 3EE6A 2PT6A 3STXA 2VLAA 1D8AA 3W5SA 2IIBA 1ULTA 3ETEA 2F17A 3AHHA 4J16A 3HBNA 4C2TA 1H3LA 3UT5B 1WZUA 1ZIPA 1GLGA 2ZYTX 1KMHA 1EFAA 2NADA 1DC3A 3I30X 1A9XB 4O2RA 2I7XA 4OH7A 4HT3B