2B6CA

Predicted dna alkylation repair enzyme from enterococcus faecalis.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
213
structure length
213
Chain Sequence
b'TLQFQKNPETAAKMSAYMKHQFVFAGIPAPERQALSKQLLKESHTWPKEKLCQEIEAYYQKTEREYQYVAIDLALQNVQRFSLEEVVAFKAYVPQKAWWDSVDAWRKFFGSWVALHLTELPTIFALFYGAENFWNRRVALNLQLMLKEKTNQDLLKKAIIYDRTTEEFFIQKAIGWSLRQYSKTNPQWVEELMKELVLSPLAQREGSKYLAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein EF3068
publication title Xray structure of predicted DNA alkylation repair enzyme from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 83
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08713 DNA_alkylation DNA alkylation repair enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1660.10 Mainly Alpha Up-down Bundle ARM repeat fold Hypothetical protein (EF3068) 2b6cA01
1.25.40.290 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat domains 2b6cA02
2B6CA 4X8QA 3L9TA
chains in the Genus database with same CATH superfamily
4HBDA 3UTMA 3UQ3A 4JHRA 3QKYA 3GW4A 5ITZF 3LEWA 1E8WA 2CG2A 4NURA 3SY2A 3ASHA 1V55E 2ETAA 4U8YD 5G05J 1AWCB 5AQAA 3G2SA 2J8SD 5ENRD 3VTXA 4ANXA 1EPUA 1E8XA 2WQHA 4V3IA 5FIOA 3L17A 4HXIA 3CQCB 3SFYA 3C3QA 4AY5A 5CBOA 2H6IA 1H6PA 3BQOA 2VSYA 3GZSA 4BSXA 2GW1A 4AOFA 4BWRA 1TN8A 3RRNB 3D9KA 3RJVA 2X6HA 3AU5A 5AN8A 2L0IA 3I5PA 1DVPA 1W3BA 3PUJA 5BUZA 4A1SA 2KM4A 5CBNA 1SVXA 4I6GA 4CZ2D 4L1BA 5BV1A 3ZEFA 4J8YA 1ZB1A 5ENSD 3PH0C 1N4QA 2ZU6B 3CQGB 3FEYA 3GZ2A 2WXOA 5LCWC 1UOHA 4LERA 4D10C 5CECB 3JCKC 1MHQA 5DIZA 3LXUX 1MZCA 5AENA 2YHEA 1INZA 5ENOD 1WAO1 2E0IA 4N5QA 1MYOA 2LUHA 2VJ8A 3TXMA 2FULA 3CV0A 1JCRA 3OXLA 1L5JA 4RVBA 3R7RA 3B7BA 2DVWA 4EZLA 4L9PA 1OUVA 1ZBPA 4U7EB 2YQ8A 2H6GA 3GZ1A 4PS3A 4B94A 4GU5A 2WQ6A 1PAQA 4PS7A 3MJWA 4GZ3A 4J8SA 2I6HA 4GYOA 4I9EA 3ZGQA 3CHMA 1QYMA 2WXJA 3EIJA 4Y6CA 5FWQA 1PC2A 5FTPA 3RKVA 3OAWA 4UQXA 2H6HA 3MV2B 3ONLA 4FHKA 3PZ4A 2FI7A 4WNGA 1BLXB 2J09A 3CIAA 2XPZA 3CVWA 4HQDA 2XEEA 4JL0A 2CG3A 3UMVA 3QC1A 4LNUD 1UN9A 1PY1A 2X3MA 3VTYA 2KCKA 1KT0A 4HORA 3FUFA 5FT9A 4CGWA 5C2YA 2NXPA 3SHFA 4JC8A 5FZSA 3CHPA 3G2WA 2VTBA 2H6FA 4EHMA 3ASOE 4OAUC 4YDYA 5A6CA 1K1AA 3LKUA 4IULA 2FF4A 4E85A 3E32A 3TJPA 4O60A 4HFGA 4F7AA 3CVYA 3HVEA 4BT9A 3HG0D 4GZDA 5G05C 3FDHA 2VSNA 2Y0BG 4BEPA 4U96D 3OXFA 4DJAA 1N4PA 2P9KG 3ZYKA 3HRAA 2XCBA 1TNUA 3JUIA 3SBSA 1S63A 1FVHA 3TWXA 1S0PA 2MYOA 2VSOE 3CVUA 4I1AA 3FU5A 1LD8A 3DEOA 3FH8A 1Z3XA 3BEEA 4WWNA 4Q69A 3FU3A 3CHSA 4B8AA 5JHBA 5JHAA 4N5CA 4BX9A 3HXCA 5B3SE 2P9PG 4KBQA 1IXVA 2XPIA 3IV0A 4TUMA 3L16A 3LVQE 3D3MA 1BPOA 5FJYA 4HOTA 2L9BA 3N71A 2VGXA 4OVUA 4DLOA 3TXNA 2CHZA 4ILIA 1RZ4A 3CSFA 3S7BA 4GB9A 1A5EA 4ANVA 4X8QA 2LAIA 4L2YA 5G2NA 3NZSA 3B7UX 2X6JA 3CVLA 3PEVB 3UINC 1N4RA 3Q49B 2DBAA 2DYSE 1TYQG 3LPZA 5C1DA 2OEVA 4FP7A 4Z68A 3I4GA 5EX3A 1EDUA 2XS8A 3DSUA 3SO8A 2FO7A 4I1OB 5ARGA 2F37A 1JPLA 4EZJA 4XZ4A 2KATA 4Y6WA 2YINA 5JA4D 4ACKA 3UX4A 4DPRA 2C0MA 1N52A 3APFA 4BT8A 2WMNA 2WXRA 2WMOA 2VGXB 2R5SA 4UWFA 2F8XK 1ELKA 2KC7A 3ML8A 1YYHA 1YA0A 3S2AA 4JHJA 3TWWA 2IFUA 3APCA 2YHCA 2AJAA 3FUEA 4K0RA 2LSUA 4EPZA 3SD5A 2C0LA 2R05A 5BXUA 4RQIA 3RO2A 5HQ8A 2KCVA 2WVIA 3VLFA 3L9TA 1N95A 2ETBA 3L54A 1OCOE 4HOQA 3PZ3A 2XPYA 3QWWA 3TAXA 3DBSA 5HKPA 4TXRA 5AQ7A 2WXKA 2QYUA 3JUEA 5M72A 1E96B 5D0OD 3C98A 4HI8A 5CMYA 2MHKA 4GTMA 3FTZA 2LNIA 2DWZA 3PNTB 3VLDA 2DIWA 2Y3AA 4RG9A 1KLXA 3UT4A 5AQBA 5ARFA 4O6FA 3QDNA 1DC2A 1HS6A 1TJFA 2GRQB 2LXMA 4F3VA 4BERA 4A1GA 5KCMA 1D8DA 3FY4A 5EIBE 2KBXA 3CGHA 3ONKA 1OWPA 3RO3A 3W9GA 3SQVA 3IXEA 3RRMB 2AW6A 4K5AB 1QNFA 3DPDA 3AS4A 3Q7FA 4NIKA 3PNLB 4YVOA 3ABLE 3Q7AA 3FUNA 4UWLA 4BTAA 4DLQA 4ZFHA 3CK8A 3UI2A 4GMJA 1Y6IA 3ZN3A 3TWQA 1UG3A 5ENPD 3T8MA 3JQ0A 5JMND 5FQ7A 2GRLA 2QZAA 2DZNA 5HRYA 3BG0B 2VGYA 4ABNA 3DPYA 3FUIA 3EU9A 2XCCA 2YNQA 3SI5A 4JEHA 3E34A 2WXLA 4TRQA 2B6CA 4U0SA 2I9CA 4GTVA 3LY9A 1E90A 3E30A 2LAHA 3T8KA 3LDZA 4DX5D 4K5CA 1O1RA 2ZGGA 3UUXA 4DX1A 1YMPA 4KYOB 5JJ6A 4WWPA 4XKCA 4FULA 3RIBA 3T5VA 3FH5A 1TJCA 5J90A 3Q75A 4CGVA 1HX8A 4I1MA 4KZCA 4DI3A 3Q47B 4BTBA 2P9IG 4HB5A 3Q73A 4JW1A 4PS8A 3G2VA 1HXIA 4DX7D 4UWKA 4G25A 4PUCA 1OWMA 3ZHEB 4CYMD 3PDNA 4NACA 4TV3A 4EBAG 4UWGA 4J0UA 2Y4TA 2HE0A 4FADA 3C5RA 4ACLA 3ULQA 5CMWA 4GAAA 2QFCA 4DK5A 3CKCA 4UI9K 4CDRA 2ZIRA 1HO8A 4FA6A 1JUQA 2IONA 2XENA 4OYSA 1QQEA 3FWVA 3CK9A 4GA2A 3ZXPA 3T5XA 2F0YA 5ENNA 3B13A 4GMRA 1MX4A 4XE0A 1D8EA 3Q9UC 3DSTA 2J49A 2OOEA 3UKUG 2KXPC 2NSZA 2WXIA 4XX5A 3DSXA 3R9MA 4UI9J 4BESA 3HHMA 1TN6A 5KNGA 3PZDA 1OWLA 2Q7FA 3Q4AB 3IEGA 2Y4UA 2IF4A 1IYGA 3ZW3A 3T9KA 2BUGA 4B0ZA 2DYRE 2OVFA 3ML9A 5T8IA 3ZUVB 4GCOA 3RK6A 1FVFA 5T3RA 4BSZB 4AIFA 3HXDA 4CT0A 4MBGA 3AU4A 5JJ7A 3WXXA 1MQSA 4RG6A 2PM7A 2Y69E 3E33A 2I2OA 4U04A 2P9SG 3MYVA 4U07A 4ZHBA 3DSSA 2AVPA 3LS8A 2DZOA 4HOSA 3DSWA 3HIZA 1OY3D 3ULEG 3FTVA 5T4YA 4AY6A 2P9NG 4YDWA 2WXHA 5EN5D 3TL5A 3LY8A 3ZYLA 3FFLA 4J8FA 3CSTA 4WNDA 4CEMA 4GZCA 5HS0A 4HOUA 3EHNA 3BUAA 5EX0A 3V2XA 3QK0A 3L22A 4I6JA 2FBNA 4FU3A 4U0UA 1HF8A 2L0TB 1JCSA 2PQNA 3PE3A 3QWVA 1VDYA 4EQFA 3LJNA 4I2ZA 4B93B 1H2VC 4BX8A 4OAVB 4YDOA 2BTDA 4Q94A 3LYAA 5B1AE 4A63B 4EZKA 3UXGA 3K9IA 4ME2A 1LD7A 1YCSB 4HLLA 3ZPJA 1D9SA 2J4DA 4JB8P 1KZPA 3ENEA 1N0RA 3D9PA 3U64A 2AWIA 1Q2ZA 3P1UA 3CVPA 5A23A 1Z6TA 5BNWA 3C3OA 3ZYMA 1H2TC 2ETCA 2DCPA 5D2MC 4I2WA 1HZ4A 4GTRA 3CVXA 1E8ZA 2XEHA 1QZ2A 1JCQA 1NFIE 4RLYA 1HE8A 4ATZD 5G55A 5H7PA 1GW6A 4IRUA 3EHQA 3WG7E 5KWDA 3EHRA 4G26A 2OCCE 3ESLA 5LFAA 1MX2A 1SA5A 4UQZA 4IYPA 4GTQA 2XRZA 3U3WA 5BPPA 1EYHA 3UM2A 2Y1LE 4FHJA 4C9BB 1E7UA 3QAQA 4FLHA 2CFZA 5FQ4A 4R7LA 1LF8A 3MCXA 2LXLA 3LCAA 3IHYA 1Z3YA 3V30A 2P58C 3HYMB 2AXUA 5EYLA 4UI9C 4NRHB 2X6KA 3PUKA 2IOLA 2IU1A 2XGSA 3FUHA 2J9QA 1NA3A 4YNDA 2EIJE 1FT1A 1XGWA 1KT1A 3ISMC 2FEZA 4KMOA 3S7DA 2WXPA 4YDEA 5AJDA 4AV7A 3B7SA 4GYYA 2IOSA 5EYPF 2AXZA 4HRMB 2A5EA 3ABKE 3E4BA 4QFVA 5DBKA 3OTNA 1O1TA 2VYIA 4GPKA 3FULA 4QQIA 3CHOA 2PZIA 2L6BA 2P2CP 3NOGD 1OT8A 2XGMA 2R17C 3D9NA 3EIQC 5ANRA 5CERB 3D9HA 3L82A 3RRUA 3PS6A 5CHEE 1DCEA 5CEDB 3ULYA 3JYSA 3L08A 3UM0A 2R59A 2EILE 1EF1C 3EHMA 1UW4B 3PZ2A 3E37A 4LUNU 2MOWA 3PVLA 1NA0A 4GYWA 4M3OA 4MS6A 2WPVA 3CVVA 3KSQA 4IN3B 3MZLB 1A17A 1DNPA 3FP3A 4MKTA 1O5MA 3CR3A 4GZ6A 2GRMA 2WQ7A 5EIDA 2L6JA 3U4TA 5EILA 4E6HA 3FTXA 2XHEA 5BT1A 4U0ZA 4AXHA 1LTXA 3AG1E 3Q78A 1OWNA 1G3NB 3CVNA 5BXOA 3GYZA 4N2QA 3CHRA 1E7VA 1AP7A 1KPSB 4CRWA 3KS2A 1X81A 3TWUA 3IBEA 4HS2A 2VQ2A 1S70B 5BW8C 4ANUA 2RKKA 2P9UG 3SBTB 3KD7A 4UWHA 4DI4A 2RFMA 3TWRA 4HRNA 4K5BA 3IHVA 2OV8A 3L13A 2V4LA 2BF0X 3BG1B 4A3TA 2LSVA 1UN8A 1NZNA 1P5QA 2V8SE 3HXEA 2EINE 1B89A 4DX2A 1K1BA 5CCMA 3C3RA 4WAFA 3MGBA 2ZGDA 2HR2A 3UIOC 4FJZA 4G1TA 3ASNE 3MKQB 4FJYA 2KZTB 3NOCD 5FZQA 5LX8A 2V5FA 3ZHEA 4LNBA 2XEVA 4KXKB 3APDA 2VSXE 2EIME 4G2VA 2IEJA 5E76A 1IHGA 3HDXA 4PH4B 4AP2A 3ASGA 5BV0A 3ZNGA 2IQCA 4P29A 3FU6A 3Q9NC 1HG5A 4L2LA 2X38A 2FO1E 1S64A 5FQ6A 3FEXA 3ABME 3FUJA 1BD8A 4U63A 2J07A 3ZVVA 1IHBA 3LY7A 1TNYA 3UKRG 5FQ8A 4WWOA 3U66A 4CDNA 2J08A 1WG0A 4GZ5A 4F1SA 3FTUA 1SZ9A 2F8YA 3D9LA 3BU8A 1TNOA 2E2EA 3JXIA 1N4SA 2XZTG 3G2TA 3SF4A 4JEUA 1JWGA 1WM5A 3NB2A 2XQ0A 1ELWA 4YVQC 4KVMA 3QOUA 2KCLA 3FH7A 5IY5E 4L23A 4URKA 3G2UA 3LVRE 5CRVA 4GPMA 2XS1A 1BI7B 3Q5MA 5FZRA 4I9CA 4A55A 4H7YA 1TR4A 3ASFA 3LJ3A 5KJLA 4ILHB 3TWVA 4G11A 1TNZA 3PREA 2X6IA 4Q96A 4KVOA 3FUKA 4APOA 1V54E 3D9IA 2I1JA 4JZYA 1MJ0A 4W9RA 4GTOA 4C0MA 1Y8MA 5AIJA 2ZISA 4JHKA 4I6EA 5HI7A 5LP0A 1RW2A 2EQXA 3V31A 4BY6A 2OVBA 1H6KA 3J5PA 1O1SA 2ZXWE 2GRRB 2QY7A 2BKGA 2HYZA 4NQ0A 4MLPA 4JXTA 1HU3A 3AJIA 1IQUA 1IKND 3QNKA 3DWLG 2C2LA 4CCAA 4TUUA 3QB2A 3CKBA 3VLEA 3B7RL 1QBQA 2JEKA 2CHWA 4JD2G 4KZ0A 5G04J 1HH8A 2RG8A 3RSEG 4CT4A 1JWFA 3MKRA 3TG5A 3R7QA 2RD0A 4A3VA 5B1BE 5J08A 5JJTA 1H19A 1FT2A 4O1OA 1HFAA 2J4BA 3V79K 2IO2C 3QJZA 4K03A 4XEIG 3CEQA 4AJWA 3FU0A 4G23A 1TN7A 3UM3A 4M7CA 3PRZA 4C48B 2A5UA 2AXVA 4ATGA 3SZ7A 4BFRA 1H2UA 4CDMA 3AG2E 3HXBA 3RU0A 4HRLA 5FINA 5KJKA 4B89A 4XI9A 3TWSA 2GGFA 3ZRHA 1U2VG 1WY6A 5ENTD 4ANWA 4RSYA 5AQ9A 2BEDA 2IJGX 3R9AB 2WB2A 1H6OA 3PZ1A 1K8KG 4AEZC 4XKBA 3UT7A 2WXNA 4XI0A 3F6QA 4APFA 4EECA 5CEAA 2UY1A 3UIPC 2V5QC 4G8LA 1XNFA 1OWOA 3EDTB 4HNAD 4GCNA 3SFXA 4F53A 1NL4A 3ZYQA 1U3DA 3AS8A 4DX6D 3NZUA 4AVXA 3PEUB 3KSLA 2GRPB 3JQ1A 3FHEA 4KT6B 4XIFA 4F1PA 3TGOA 3PE4A 2NC9A 2B0OE 2NYJA 3KEAA 4HI9A 3W9FA 3OXGA 2PL2A 2BKKB 1U3CA 2XRYA 3DXMG 5D0QD 5KJNA 4LG6A 3Q79A 2WXGA 2V4HC 2R03A 2QC9A 2ILRA 4OVVA 3X2QE 4G8KA 5AJLA 3O4ZA 4J8EA 4JPSA 3MX3A 1UJKA 4LRZA 2JABA 3D9OA 1DCQA 2WM9A 3TG4A 2VTBB 3EJNA 2I1KA 3L6AA 1N94A 5CRUA 5ENQD 1UJJA 4I43A 2HM8A 5LOZA 3SGHA 2UY1B 3DXKG 4U95D 2PNNA 4F6RD 3HVEB 3FTWA 4N39A 3CLJA 1OCRE 4L7TA 4UQYA 4JA9A 3AG4E 1BU9A 4TXQA 4JA7A 5ANLA 3FTYA 3UT8A 4WUYA 3J5QB 3V2OA 3I3NA 3MA5A 2X6FA 3UPVA 1BI8B 4LCTA 1N0QA 5KBAA 2CHXA 4PDXA 4HVBA 1MX6A 3SNXA 4DRXE 2JLBA 4J7WA 3CVQA 3IKOB 1IQRA 4MRUA 3Q15A 3ZXSA 5AAOA 2R2LA 5D66A 4HLEA 2IY0C 1NI1A 2XZDG 3QWPA 1ELRA 2IO3C 1HG2A 4LEUA 3NQPA 1SQMA 3B7TA 3NAWA 5E75A 5EKQD 1ZU2A 2M63A 1SA4A 3P2BA 4G24A 4B8CB 4GMLA 5G04C 2PM6A 5AARA 2OEWA 4N3BA 2WXMA 1KZOA 2EIKE 3U9WA 3TWTA 2GROB 2WXFA 4BETA 3HXFA 1TNBA 3S7JA 4FC8A 3ESKA 3I4RB 3FUDA 4AM9A 3FTSA 1N11A 4TXPA 1WDYA 3URZA 1FCHA 4GTPA 4EBAA 3CHQA 4UUCA 4LSZE 3UM1A 3DEPA 5LCWJ 1OCZE 3FUMA 1Z5SC 2QYJA 4FLBA 4GTSA 2WXQA 4J8DA 2LO6A 3ASDA 2UWJG 5AYWD 2R02A 2GRNB 3ZIMA 3ZKJA 3AG3E 3DSVA 3ZFWA 3MKQA 2KZTA 4U8VD 2ONDA 4N3AA 1E8YA 3S7FA 4ILGA 3JXJA 1N9AA 5KJMA 3DRAA 5A7DB 4DUIA 3AAAC 5KNHD 1SW6A 3ZU7B 1NP7A 3RAUA 3EUVA 3B95A 4GA1A 3KAEA 2VGEA 3AS5A 4J6IA 2V0PA 1H0AA 4O1PA 2A4ZA 3MEKA 1X5BA 2HO1A 3D9JA 2MRIA 3D9MA 5EDSA 2CFUA 4WNFA 2XGOA 4H7XA 4U8HA 3NBNB 4WNEA 4LNGA 1OCCE 4C0EA 3CK7A 3QARA 1TEZA 1FPPA 4GA0A 3EU5A 2P9LG 4N2SA 1SZAA 4GTTA 2RFAA 3KEZA 2PQRA 1OXJA 4N3CA 3C72A 1N54A 3NF1A 5CCLA 3MV3B 1K3ZD 3SFZA 4I17A 3O48A 4JVSA
chains in the Genus database with same CATH topology
2B6CA 4X8QA 3L9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B6C A;  4X8Q A;  3L9T A; 
#chains in the Genus database with same CATH topology
 4HBD A;  3UTM A;  3UQ3 A;  4JHR A;  3QKY A;  3GW4 A;  5ITZ F;  3LEW A;  1E8W A;  2CG2 A;  4NUR A;  3SY2 A;  3ASH A;  1V55 E;  2ETA A;  4U8Y D;  5G05 J;  1AWC B;  5AQA A;  3G2S A;  2J8S D;  5ENR D;  3VTX A;  4ANX A;  1EPU A;  1E8X A;  2WQH A;  4V3I A;  5FIO A;  3L17 A;  4HXI A;  3CQC B;  3SFY A;  3C3Q A;  4AY5 A;  5CBO A;  2H6I A;  1H6P A;  3BQO A;  2VSY A;  3GZS A;  4BSX A;  2GW1 A;  4AOF A;  4BWR A;  1TN8 A;  3RRN B;  3D9K A;  3RJV A;  2X6H A;  3AU5 A;  5AN8 A;  2L0I A;  3I5P A;  1DVP A;  1W3B A;  3PUJ A;  5BUZ A;  4A1S A;  2KM4 A;  5CBN A;  1SVX A;  4I6G A;  4CZ2 D;  4L1B A;  5BV1 A;  3ZEF A;  4J8Y A;  1ZB1 A;  5ENS D;  3PH0 C;  1N4Q A;  2ZU6 B;  3CQG B;  3FEY A;  3GZ2 A;  2WXO A;  5LCW C;  1UOH A;  4LER A;  4D10 C;  5CEC B;  3JCK C;  1MHQ A;  5DIZ A;  3LXU X;  1MZC A;  5AEN A;  2YHE A;  1INZ A;  5ENO D;  1WAO 1;  2E0I A;  4N5Q A;  1MYO A;  2LUH A;  2VJ8 A;  3TXM A;  2FUL A;  3CV0 A;  1JCR A;  3OXL A;  1L5J A;  4RVB A;  3R7R A;  3B7B A;  2DVW A;  4EZL A;  4L9P A;  1OUV A;  1ZBP A;  4U7E B;  2YQ8 A;  2H6G A;  3GZ1 A;  4PS3 A;  4B94 A;  4GU5 A;  2WQ6 A;  1PAQ A;  4PS7 A;  3MJW A;  4GZ3 A;  4J8S A;  2I6H A;  4GYO A;  4I9E A;  3ZGQ A;  3CHM A;  1QYM A;  2WXJ A;  3EIJ A;  4Y6C A;  5FWQ A;  1PC2 A;  5FTP A;  3RKV A;  3OAW A;  4UQX A;  2H6H A;  3MV2 B;  3ONL A;  4FHK A;  3PZ4 A;  2FI7 A;  4WNG A;  1BLX B;  2J09 A;  3CIA A;  2XPZ A;  3CVW A;  4HQD A;  2XEE A;  4JL0 A;  2CG3 A;  3UMV A;  3QC1 A;  4LNU D;  1UN9 A;  1PY1 A;  2X3M A;  3VTY A;  2KCK A;  1KT0 A;  4HOR A;  3FUF A;  5FT9 A;  4CGW A;  5C2Y A;  2NXP A;  3SHF A;  4JC8 A;  5FZS A;  3CHP A;  3G2W A;  2VTB A;  2H6F A;  4EHM A;  3ASO E;  4OAU C;  4YDY A;  5A6C A;  1K1A A;  3LKU A;  4IUL A;  2FF4 A;  4E85 A;  3E32 A;  3TJP A;  4O60 A;  4HFG A;  4F7A A;  3CVY A;  3HVE A;  4BT9 A;  3HG0 D;  4GZD A;  5G05 C;  3FDH A;  2VSN A;  2Y0B G;  4BEP A;  4U96 D;  3OXF A;  4DJA A;  1N4P A;  2P9K G;  3ZYK A;  3HRA A;  2XCB A;  1TNU A;  3JUI A;  3SBS A;  1S63 A;  1FVH A;  3TWX A;  1S0P A;  2MYO A;  2VSO E;  3CVU A;  4I1A A;  3FU5 A;  1LD8 A;  3DEO A;  3FH8 A;  1Z3X A;  3BEE A;  4WWN A;  4Q69 A;  3FU3 A;  3CHS A;  4B8A A;  5JHB A;  5JHA A;  4N5C A;  4BX9 A;  3HXC A;  5B3S E;  2P9P G;  4KBQ A;  1IXV A;  2XPI A;  3IV0 A;  4TUM A;  3L16 A;  3LVQ E;  3D3M A;  1BPO A;  5FJY A;  4HOT A;  2L9B A;  3N71 A;  2VGX A;  4OVU A;  4DLO A;  3TXN A;  2CHZ A;  4ILI A;  1RZ4 A;  3CSF A;  3S7B A;  4GB9 A;  1A5E A;  4ANV A;  4X8Q A;  2LAI A;  4L2Y A;  5G2N A;  3NZS A;  3B7U X;  2X6J A;  3CVL A;  3PEV B;  3UIN C;  1N4R A;  3Q49 B;  2DBA A;  2DYS E;  1TYQ G;  3LPZ A;  5C1D A;  2OEV A;  4FP7 A;  4Z68 A;  3I4G A;  5EX3 A;  1EDU A;  2XS8 A;  3DSU A;  3SO8 A;  2FO7 A;  4I1O B;  5ARG A;  2F37 A;  1JPL A;  4EZJ A;  4XZ4 A;  2KAT A;  4Y6W A;  2YIN A;  5JA4 D;  4ACK A;  3UX4 A;  4DPR A;  2C0M A;  1N52 A;  3APF A;  4BT8 A;  2WMN A;  2WXR A;  2WMO A;  2VGX B;  2R5S A;  4UWF A;  2F8X K;  1ELK A;  2KC7 A;  3ML8 A;  1YYH A;  1YA0 A;  3S2A A;  4JHJ A;  3TWW A;  2IFU A;  3APC A;  2YHC A;  2AJA A;  3FUE A;  4K0R A;  2LSU A;  4EPZ A;  3SD5 A;  2C0L A;  2R05 A;  5BXU A;  4RQI A;  3RO2 A;  5HQ8 A;  2KCV A;  2WVI A;  3VLF A;  3L9T A;  1N95 A;  2ETB A;  3L54 A;  1OCO E;  4HOQ A;  3PZ3 A;  2XPY A;  3QWW A;  3TAX A;  3DBS A;  5HKP A;  4TXR A;  5AQ7 A;  2WXK A;  2QYU A;  3JUE A;  5M72 A;  1E96 B;  5D0O D;  3C98 A;  4HI8 A;  5CMY A;  2MHK A;  4GTM A;  3FTZ A;  2LNI A;  2DWZ A;  3PNT B;  3VLD A;  2DIW A;  2Y3A A;  4RG9 A;  1KLX A;  3UT4 A;  5AQB A;  5ARF A;  4O6F A;  3QDN A;  1DC2 A;  1HS6 A;  1TJF A;  2GRQ B;  2LXM A;  4F3V A;  4BER A;  4A1G A;  5KCM A;  1D8D A;  3FY4 A;  5EIB E;  2KBX A;  3CGH A;  3ONK A;  1OWP A;  3RO3 A;  3W9G A;  3SQV A;  3IXE A;  3RRM B;  2AW6 A;  4K5A B;  1QNF A;  3DPD A;  3AS4 A;  3Q7F A;  4NIK A;  3PNL B;  4YVO A;  3ABL E;  3Q7A A;  3FUN A;  4UWL A;  4BTA A;  4DLQ A;  4ZFH A;  3CK8 A;  3UI2 A;  4GMJ A;  1Y6I A;  3ZN3 A;  3TWQ A;  1UG3 A;  5ENP D;  3T8M A;  3JQ0 A;  5JMN D;  5FQ7 A;  2GRL A;  2QZA A;  2DZN A;  5HRY A;  3BG0 B;  2VGY A;  4ABN A;  3DPY A;  3FUI A;  3EU9 A;  2XCC A;  2YNQ A;  3SI5 A;  4JEH A;  3E34 A;  2WXL A;  4TRQ A;  2B6C A;  4U0S A;  2I9C A;  4GTV A;  3LY9 A;  1E90 A;  3E30 A;  2LAH A;  3T8K A;  3LDZ A;  4DX5 D;  4K5C A;  1O1R A;  2ZGG A;  3UUX A;  4DX1 A;  1YMP A;  4KYO B;  5JJ6 A;  4WWP A;  4XKC A;  4FUL A;  3RIB A;  3T5V A;  3FH5 A;  1TJC A;  5J90 A;  3Q75 A;  4CGV A;  1HX8 A;  4I1M A;  4KZC A;  4DI3 A;  3Q47 B;  4BTB A;  2P9I G;  4HB5 A;  3Q73 A;  4JW1 A;  4PS8 A;  3G2V A;  1HXI A;  4DX7 D;  4UWK A;  4G25 A;  4PUC A;  1OWM A;  3ZHE B;  4CYM D;  3PDN A;  4NAC A;  4TV3 A;  4EBA G;  4UWG A;  4J0U A;  2Y4T A;  2HE0 A;  4FAD A;  3C5R A;  4ACL A;  3ULQ A;  5CMW A;  4GAA A;  2QFC A;  4DK5 A;  3CKC A;  4UI9 K;  4CDR A;  2ZIR A;  1HO8 A;  4FA6 A;  1JUQ A;  2ION A;  2XEN A;  4OYS A;  1QQE A;  3FWV A;  3CK9 A;  4GA2 A;  3ZXP A;  3T5X A;  2F0Y A;  5ENN A;  3B13 A;  4GMR A;  1MX4 A;  4XE0 A;  1D8E A;  3Q9U C;  3DST A;  2J49 A;  2OOE A;  3UKU G;  2KXP C;  2NSZ A;  2WXI A;  4XX5 A;  3DSX A;  3R9M A;  4UI9 J;  4BES A;  3HHM A;  1TN6 A;  5KNG A;  3PZD A;  1OWL A;  2Q7F A;  3Q4A B;  3IEG A;  2Y4U A;  2IF4 A;  1IYG A;  3ZW3 A;  3T9K A;  2BUG A;  4B0Z A;  2DYR E;  2OVF A;  3ML9 A;  5T8I A;  3ZUV B;  4GCO A;  3RK6 A;  1FVF A;  5T3R A;  4BSZ B;  4AIF A;  3HXD A;  4CT0 A;  4MBG A;  3AU4 A;  5JJ7 A;  3WXX A;  1MQS A;  4RG6 A;  2PM7 A;  2Y69 E;  3E33 A;  2I2O A;  4U04 A;  2P9S G;  3MYV A;  4U07 A;  4ZHB A;  3DSS A;  2AVP A;  3LS8 A;  2DZO A;  4HOS A;  3DSW A;  3HIZ A;  1OY3 D;  3ULE G;  3FTV A;  5T4Y A;  4AY6 A;  2P9N G;  4YDW A;  2WXH A;  5EN5 D;  3TL5 A;  3LY8 A;  3ZYL A;  3FFL A;  4J8F A;  3CST A;  4WND A;  4CEM A;  4GZC A;  5HS0 A;  4HOU A;  3EHN A;  3BUA A;  5EX0 A;  3V2X A;  3QK0 A;  3L22 A;  4I6J A;  2FBN A;  4FU3 A;  4U0U A;  1HF8 A;  2L0T B;  1JCS A;  2PQN A;  3PE3 A;  3QWV A;  1VDY A;  4EQF A;  3LJN A;  4I2Z A;  4B93 B;  1H2V C;  4BX8 A;  4OAV B;  4YDO A;  2BTD A;  4Q94 A;  3LYA A;  5B1A E;  4A63 B;  4EZK A;  3UXG A;  3K9I A;  4ME2 A;  1LD7 A;  1YCS B;  4HLL A;  3ZPJ A;  1D9S A;  2J4D A;  4JB8 P;  1KZP A;  3ENE A;  1N0R A;  3D9P A;  3U64 A;  2AWI A;  1Q2Z A;  3P1U A;  3CVP A;  5A23 A;  1Z6T A;  5BNW A;  3C3O A;  3ZYM A;  1H2T C;  2ETC A;  2DCP A;  5D2M C;  4I2W A;  1HZ4 A;  4GTR A;  3CVX A;  1E8Z A;  2XEH A;  1QZ2 A;  1JCQ A;  1NFI E;  4RLY A;  1HE8 A;  4ATZ D;  5G55 A;  5H7P A;  1GW6 A;  4IRU A;  3EHQ A;  3WG7 E;  5KWD A;  3EHR A;  4G26 A;  2OCC E;  3ESL A;  5LFA A;  1MX2 A;  1SA5 A;  4UQZ A;  4IYP A;  4GTQ A;  2XRZ A;  3U3W A;  5BPP A;  1EYH A;  3UM2 A;  2Y1L E;  4FHJ A;  4C9B B;  1E7U A;  3QAQ A;  4FLH A;  2CFZ A;  5FQ4 A;  4R7L A;  1LF8 A;  3MCX A;  2LXL A;  3LCA A;  3IHY A;  1Z3Y A;  3V30 A;  2P58 C;  3HYM B;  2AXU A;  5EYL A;  4UI9 C;  4NRH B;  2X6K A;  3PUK A;  2IOL A;  2IU1 A;  2XGS A;  3FUH A;  2J9Q A;  1NA3 A;  4YND A;  2EIJ E;  1FT1 A;  1XGW A;  1KT1 A;  3ISM C;  2FEZ A;  4KMO A;  3S7D A;  2WXP A;  4YDE A;  5AJD A;  4AV7 A;  3B7S A;  4GYY A;  2IOS A;  5EYP F;  2AXZ A;  4HRM B;  2A5E A;  3ABK E;  3E4B A;  4QFV A;  5DBK A;  3OTN A;  1O1T A;  2VYI A;  4GPK A;  3FUL A;  4QQI A;  3CHO A;  2PZI A;  2L6B A;  2P2C P;  3NOG D;  1OT8 A;  2XGM A;  2R17 C;  3D9N A;  3EIQ C;  5ANR A;  5CER B;  3D9H A;  3L82 A;  3RRU A;  3PS6 A;  5CHE E;  1DCE A;  5CED B;  3ULY A;  3JYS A;  3L08 A;  3UM0 A;  2R59 A;  2EIL E;  1EF1 C;  3EHM A;  1UW4 B;  3PZ2 A;  3E37 A;  4LUN U;  2MOW A;  3PVL A;  1NA0 A;  4GYW A;  4M3O A;  4MS6 A;  2WPV A;  3CVV A;  3KSQ A;  4IN3 B;  3MZL B;  1A17 A;  1DNP A;  3FP3 A;  4MKT A;  1O5M A;  3CR3 A;  4GZ6 A;  2GRM A;  2WQ7 A;  5EID A;  2L6J A;  3U4T A;  5EIL A;  4E6H A;  3FTX A;  2XHE A;  5BT1 A;  4U0Z A;  4AXH A;  1LTX A;  3AG1 E;  3Q78 A;  1OWN A;  1G3N B;  3CVN A;  5BXO A;  3GYZ A;  4N2Q A;  3CHR A;  1E7V A;  1AP7 A;  1KPS B;  4CRW A;  3KS2 A;  1X81 A;  3TWU A;  3IBE A;  4HS2 A;  2VQ2 A;  1S70 B;  5BW8 C;  4ANU A;  2RKK A;  2P9U G;  3SBT B;  3KD7 A;  4UWH A;  4DI4 A;  2RFM A;  3TWR A;  4HRN A;  4K5B A;  3IHV A;  2OV8 A;  3L13 A;  2V4L A;  2BF0 X;  3BG1 B;  4A3T A;  2LSV A;  1UN8 A;  1NZN A;  1P5Q A;  2V8S E;  3HXE A;  2EIN E;  1B89 A;  4DX2 A;  1K1B A;  5CCM A;  3C3R A;  4WAF A;  3MGB A;  2ZGD A;  2HR2 A;  3UIO C;  4FJZ A;  4G1T A;  3ASN E;  3MKQ B;  4FJY A;  2KZT B;  3NOC D;  5FZQ A;  5LX8 A;  2V5F A;  3ZHE A;  4LNB A;  2XEV A;  4KXK B;  3APD A;  2VSX E;  2EIM E;  4G2V A;  2IEJ A;  5E76 A;  1IHG A;  3HDX A;  4PH4 B;  4AP2 A;  3ASG A;  5BV0 A;  3ZNG A;  2IQC A;  4P29 A;  3FU6 A;  3Q9N C;  1HG5 A;  4L2L A;  2X38 A;  2FO1 E;  1S64 A;  5FQ6 A;  3FEX A;  3ABM E;  3FUJ A;  1BD8 A;  4U63 A;  2J07 A;  3ZVV A;  1IHB A;  3LY7 A;  1TNY A;  3UKR G;  5FQ8 A;  4WWO A;  3U66 A;  4CDN A;  2J08 A;  1WG0 A;  4GZ5 A;  4F1S A;  3FTU A;  1SZ9 A;  2F8Y A;  3D9L A;  3BU8 A;  1TNO A;  2E2E A;  3JXI A;  1N4S A;  2XZT G;  3G2T A;  3SF4 A;  4JEU A;  1JWG A;  1WM5 A;  3NB2 A;  2XQ0 A;  1ELW A;  4YVQ C;  4KVM A;  3QOU A;  2KCL A;  3FH7 A;  5IY5 E;  4L23 A;  4URK A;  3G2U A;  3LVR E;  5CRV A;  4GPM A;  2XS1 A;  1BI7 B;  3Q5M A;  5FZR A;  4I9C A;  4A55 A;  4H7Y A;  1TR4 A;  3ASF A;  3LJ3 A;  5KJL A;  4ILH B;  3TWV A;  4G11 A;  1TNZ A;  3PRE A;  2X6I A;  4Q96 A;  4KVO A;  3FUK A;  4APO A;  1V54 E;  3D9I A;  2I1J A;  4JZY A;  1MJ0 A;  4W9R A;  4GTO A;  4C0M A;  1Y8M A;  5AIJ A;  2ZIS A;  4JHK A;  4I6E A;  5HI7 A;  5LP0 A;  1RW2 A;  2EQX A;  3V31 A;  4BY6 A;  2OVB A;  1H6K A;  3J5P A;  1O1S A;  2ZXW E;  2GRR B;  2QY7 A;  2BKG A;  2HYZ A;  4NQ0 A;  4MLP A;  4JXT A;  1HU3 A;  3AJI A;  1IQU A;  1IKN D;  3QNK A;  3DWL G;  2C2L A;  4CCA A;  4TUU A;  3QB2 A;  3CKB A;  3VLE A;  3B7R L;  1QBQ A;  2JEK A;  2CHW A;  4JD2 G;  4KZ0 A;  5G04 J;  1HH8 A;  2RG8 A;  3RSE G;  4CT4 A;  1JWF A;  3MKR A;  3TG5 A;  3R7Q A;  2RD0 A;  4A3V A;  5B1B E;  5J08 A;  5JJT A;  1H19 A;  1FT2 A;  4O1O A;  1HFA A;  2J4B A;  3V79 K;  2IO2 C;  3QJZ A;  4K03 A;  4XEI G;  3CEQ A;  4AJW A;  3FU0 A;  4G23 A;  1TN7 A;  3UM3 A;  4M7C A;  3PRZ A;  4C48 B;  2A5U A;  2AXV A;  4ATG A;  3SZ7 A;  4BFR A;  1H2U A;  4CDM A;  3AG2 E;  3HXB A;  3RU0 A;  4HRL A;  5FIN A;  5KJK A;  4B89 A;  4XI9 A;  3TWS A;  2GGF A;  3ZRH A;  1U2V G;  1WY6 A;  5ENT D;  4ANW A;  4RSY A;  5AQ9 A;  2BED A;  2IJG X;  3R9A B;  2WB2 A;  1H6O A;  3PZ1 A;  1K8K G;  4AEZ C;  4XKB A;  3UT7 A;  2WXN A;  4XI0 A;  3F6Q A;  4APF A;  4EEC A;  5CEA A;  2UY1 A;  3UIP C;  2V5Q C;  4G8L A;  1XNF A;  1OWO A;  3EDT B;  4HNA D;  4GCN A;  3SFX A;  4F53 A;  1NL4 A;  3ZYQ A;  1U3D A;  3AS8 A;  4DX6 D;  3NZU A;  4AVX A;  3PEU B;  3KSL A;  2GRP B;  3JQ1 A;  3FHE A;  4KT6 B;  4XIF A;  4F1P A;  3TGO A;  3PE4 A;  2NC9 A;  2B0O E;  2NYJ A;  3KEA A;  4HI9 A;  3W9F A;  3OXG A;  2PL2 A;  2BKK B;  1U3C A;  2XRY A;  3DXM G;  5D0Q D;  5KJN A;  4LG6 A;  3Q79 A;  2WXG A;  2V4H C;  2R03 A;  2QC9 A;  2ILR A;  4OVV A;  3X2Q E;  4G8K A;  5AJL A;  3O4Z A;  4J8E A;  4JPS A;  3MX3 A;  1UJK A;  4LRZ A;  2JAB A;  3D9O A;  1DCQ A;  2WM9 A;  3TG4 A;  2VTB B;  3EJN A;  2I1K A;  3L6A A;  1N94 A;  5CRU A;  5ENQ D;  1UJJ A;  4I43 A;  2HM8 A;  5LOZ A;  3SGH A;  2UY1 B;  3DXK G;  4U95 D;  2PNN A;  4F6R D;  3HVE B;  3FTW A;  4N39 A;  3CLJ A;  1OCR E;  4L7T A;  4UQY A;  4JA9 A;  3AG4 E;  1BU9 A;  4TXQ A;  4JA7 A;  5ANL A;  3FTY A;  3UT8 A;  4WUY A;  3J5Q B;  3V2O A;  3I3N A;  3MA5 A;  2X6F A;  3UPV A;  1BI8 B;  4LCT A;  1N0Q A;  5KBA A;  2CHX A;  4PDX A;  4HVB A;  1MX6 A;  3SNX A;  4DRX E;  2JLB A;  4J7W A;  3CVQ A;  3IKO B;  1IQR A;  4MRU A;  3Q15 A;  3ZXS A;  5AAO A;  2R2L A;  5D66 A;  4HLE A;  2IY0 C;  1NI1 A;  2XZD G;  3QWP A;  1ELR A;  2IO3 C;  1HG2 A;  4LEU A;  3NQP A;  1SQM A;  3B7T A;  3NAW A;  5E75 A;  5EKQ D;  1ZU2 A;  2M63 A;  1SA4 A;  3P2B A;  4G24 A;  4B8C B;  4GML A;  5G04 C;  2PM6 A;  5AAR A;  2OEW A;  4N3B A;  2WXM A;  1KZO A;  2EIK E;  3U9W A;  3TWT A;  2GRO B;  2WXF A;  4BET A;  3HXF A;  1TNB A;  3S7J A;  4FC8 A;  3ESK A;  3I4R B;  3FUD A;  4AM9 A;  3FTS A;  1N11 A;  4TXP A;  1WDY A;  3URZ A;  1FCH A;  4GTP A;  4EBA A;  3CHQ A;  4UUC A;  4LSZ E;  3UM1 A;  3DEP A;  5LCW J;  1OCZ E;  3FUM A;  1Z5S C;  2QYJ A;  4FLB A;  4GTS A;  2WXQ A;  4J8D A;  2LO6 A;  3ASD A;  2UWJ G;  5AYW D;  2R02 A;  2GRN B;  3ZIM A;  3ZKJ A;  3AG3 E;  3DSV A;  3ZFW A;  3MKQ A;  2KZT A;  4U8V D;  2OND A;  4N3A A;  1E8Y A;  3S7F A;  4ILG A;  3JXJ A;  1N9A A;  5KJM A;  3DRA A;  5A7D B;  4DUI A;  3AAA C;  5KNH D;  1SW6 A;  3ZU7 B;  1NP7 A;  3RAU A;  3EUV A;  3B95 A;  4GA1 A;  3KAE A;  2VGE A;  3AS5 A;  4J6I A;  2V0P A;  1H0A A;  4O1P A;  2A4Z A;  3MEK A;  1X5B A;  2HO1 A;  3D9J A;  2MRI A;  3D9M A;  5EDS A;  2CFU A;  4WNF A;  2XGO A;  4H7X A;  4U8H A;  3NBN B;  4WNE A;  4LNG A;  1OCC E;  4C0E A;  3CK7 A;  3QAR A;  1TEZ A;  1FPP A;  4GA0 A;  3EU5 A;  2P9L G;  4N2S A;  1SZA A;  4GTT A;  2RFA A;  3KEZ A;  2PQR A;  1OXJ A;  4N3C A;  3C72 A;  1N54 A;  3NF1 A;  5CCL A;  3MV3 B;  1K3Z D;  3SFZ A;  4I17 A;  3O48 A;  4JVS A; 
#chains in the Genus database with same CATH homology
 2B6C A;  4X8Q A;  3L9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...