2B6CA

Predicted dna alkylation repair enzyme from enterococcus faecalis.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
213
structure length
213
Chain Sequence
TLQFQKNPETAAKMSAYMKHQFVFAGIPAPERQALSKQLLKESHTWPKEKLCQEIEAYYQKTEREYQYVAIDLALQNVQRFSLEEVVAFKAYVPQKAWWDSVDAWRKFFGSWVALHLTELPTIFALFYGAENFWNRRVALNLQLMLKEKTNQDLLKKAIIYDRTTEEFFIQKAIGWSLRQYSKTNPQWVEELMKELVLSPLAQREGSKYLAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein EF3068
publication title Xray structure of predicted DNA alkylation repair enzyme from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 83
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08713 DNA_alkylation DNA alkylation repair enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1660.10 Mainly Alpha Up-down Bundle ARM repeat fold Hypothetical protein (EF3068) 2b6cA01
1.25.40.290 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat domains 2b6cA02
4X8QA 3L9TA 2B6CA
chains in the Genus database with same CATH superfamily
3G2VA 2KM4A 4HI9A 4UWFA 3APDA 2J4BA 3L54A 4GZDA 4ZHBA 4BETA 4O1PA 3MCXA 3NOCD 5B1BE 4HNAD 4DLOA 4U8VD 2R5SA 5KNGA 2IQCA 4MKTA 4K0RA 1LD8A 2GGFA 2A5EA 4LEUA 1XNFA 4JXTA 3OXGA 3DEOA 4I43A 3T9KA 4ANWA 4XKBA 1K1BA 5HI7A 1EF1C 3EIQC 2KCVA 2BKKB 4EECA 2Y69E 3FH5A 3LEWA 2HE0A 4KVOA 3FU6A 5ARFA 2KCLA 1IQRA 3BG0B 4WUYA 4NIKA 1HXIA 2X6IA 1WM5A 3HXCA 3IBEA 2P9PG 3LYAA 4A1GA 3ZNGA 4FC8A 2RD0A 1NI1A 2AXZA 3S2AA 3GW4A 4WWOA 3TWTA 2X6FA 3V31A 4L9PA 1O1TA 1NP7A 3P1UA 1ZBPA 1TJCA 3ZYKA 2EINE 4ANUA 5BW8C 2NC9A 4JC8A 4HBDA 3ZKJA 4WWPA 4I2ZA 2XRZA 3CHOA 2ETBA 4N3AA 4GYYA 3MV3B 5CBNA 3LY7A 3L22A 3EJNA 3ESLA 2LAIA 4JL0A 4HLLA 3D9NA 4I1OB 3CR3A 3AS4A 1O1RA 5CRVA 5FZSA 4HORA 2P9KG 4V3IA 4K5CA 5CEAA 2H6IA 4HRLA 3JUEA 5KJMA 4B93B 3UI2A 3NF1A 3MKRA 4G26A 5A23A 4WNFA 2ETAA 1OWOA 2XS8A 3PZDA 5FZQA 2YHEA 3ML8A 2WXPA 4I6GA 2A4ZA 2DYSE 2WQHA 2J49A 1W3BA 4O1OA 3ZFWA 4DUIA 4EPZA 2ZGDA 4GU5A 2V0PA 2J08A 3UM1A 3BU8A 3I4RB 3CEQA 3MEKA 4U7EB 2FEZA 2GW1A 2DCPA 1SZAA 3V30A 2R59A 3HVEA 3PNTB 5AQ9A 2AXUA 1N9AA 1E7UA 3BQOA 3SQVA 1FVHA 2Y3AA 1ELKA 3ASNE 4RQIA 4P29A 2ONDA 3NZSA 4I9CA 3L08A 2PM6A 3FTZA 4ATZD 1A17A 3OXFA 1Z3YA 3C3OA 3OAWA 3TG5A 2KZTB 4HFGA 3CK9A 2J9QA 2B0OE 1Y8MA 3B13A 3LDZA 4N5CA 4F6RD 3CIAA 5BXOA 2DIWA 4DX2A 2PL2A 4CDNA 2XQ0A 4JW1A 4LG6A 4R7LA 4BEPA 5LX8A 1HG5A 4K5BA 1ELWA 4K5AB 4FLHA 3UXGA 4UWKA 4GCNA 1LD7A 4KYOB 3FP3A 2XGSA 4XZ4A 3AG2E 4GTTA 5G55A 3CVNA 4BFRA 3D9JA 2HO1A 3TL5A 4CDMA 3EHMA 2OOEA 3J5QB 4FP7A 4EBAA 2AVPA 1MX2A 4UI9C 3TWWA 2AW6A 2MYOA 4O60A 3E37A 4UWGA 5HQ8A 2QYJA 5ENRD 1PY1A 1G3NB 4QFVA 2L0TB 1EPUA 3B7SA 2UY1B 4DX5D 1H6KA 1NA0A 4GCOA 2XGOA 2FF4A 3HXEA 2GRPB 3QARA 4KXKB 4XE0A 4L1BA 5EIDA 5KJNA 2ILRA 2V5QC 4AJWA 3FTXA 4JZYA 5LFAA 3I4GA 4GA2A 4D10C 4J0UA 5CRUA 2OVFA 4MLPA 2V8SE 2VGEA 2WXOA 5D66A 1Z5SC 3FU5A 4YNDA 4ZFHA 4BY6A 2I2OA 4B8AA 3G2UA 4GZ3A 1OY3D 4GPKA 3C3QA 5ENOD 4AVXA 3HDXA 4J8SA 3L17A 3FUJA 2QY7A 3RO2A 3B7BA 3FDHA 4YVOA 1WAO1 1KT1A 4Q96A 3FH8A 3UKRG 4I17A 2HM8A 4GTVA 1S63A 4NRHB 1TNBA 4HQDA 3DEPA 5E76A 1MYOA 5EKQD 3PEUB 2E2EA 1XGWA 2UY1A 2AXVA 2PM7A 3DBSA 5JJ7A 3JQ0A 1DNPA 5G04C 4UQXA 3DXKG 1PC2A 3RIBA 5ENSD 4GTPA 3FY4A 4LUNU 3FU3A 1DCQA 4DX1A 4ILIA 3FTWA 3NQPA 3QK0A 5JJTA 5EX3A 3RRUA 3SBSA 4EZKA 3MYVA 4IN3B 3TWQA 3QKYA 2XEHA 3LJNA 3S7DA 1N4PA 4TXQA 3IKOB 3PNLB 1HF8A 1IKND 2RFMA 2XRYA 3CVXA 3MV2B 3QC1A 3MX3A 2EILE 1L5JA 2EQXA 2ZIRA 3B7UX 1UN8A 2ZU6B 2E0IA 3Q15A 3PZ4A 2KXPC 4WNEA 3HXDA 4F3VA 5AARA 3PZ1A 4AP2A 3Q9NC 2F8YA 3Q49B 4G2VA 4GZCA 3CVPA 3DSXA 3ONLA 1JWGA 5JHBA 1HZ4A 2EIKE 3EHNA 3GYZA 1FPPA 1RZ4A 4JA9A 3SFXA 2H6GA 3B7TA 3CHPA 2V4HC 1A5EA 5CCMA 4J8EA 4HRMB 4J7WA 3RSEG 4PS3A 3TWXA 3PVLA 3ULQA 5EYLA 2B6CA 2WXFA 3ULYA 1O1SA 3ESKA 3SHFA 3UM0A 1UJJA 4N3BA 3BEEA 3AG3E 3PEVB 4A63B 1S0PA 3MKQB 3CQGB 4YDWA 4J8DA 3GZSA 5JJ6A 3KD7A 1E8ZA 4DPRA 3RRMB 3E34A 3R9AB 3ASGA 3DWLG 3RRNB 1BU9A 3QJZA 4OAVB 3LJ3A 5ENNA 4Z68A 3G2TA 3N71A 4RLYA 2VSXE 2X6JA 1H19A 2GRLA 1IQUA 2V5FA 1JUQA 3E30A 4XI0A 5FQ8A 2WMOA 4PH4B 1EDUA 4A3TA 3CKBA 3AJIA 4IYPA 3L6AA 4DJAA 2DYRE 3ZXSA 4CT0A 3FTUA 1OWMA 1H6OA 4FULA 3T8KA 1H6PA 3WXXA 1PAQA 3SD5A 2JLBA 2A5UA 3R7QA 3V2OA 2OEWA 3ZUVB 4G23A 4WWNA 2P9LG 4TXPA 5KBAA 1D8DA 4RG6A 4CRWA 3ABLE 1LTXA 2DWZA 5C2YA 2WXMA 1INZA 5D0OD 3R9MA 1S64A 3FUKA 3CQCB 2WXJA 2EIJE 1N54A 3UINC 4I6EA 4XEIG 3VTYA 4C0MA 2I9CA 2YNQA 5CERB 1OWNA 3HXBA 2R2LA 2P9IG 4N2QA 5KJLA 4ACKA 4F1SA 1NA3A 3RJVA 3L13A 2FULA 4UWHA 4EQFA 2C0MA 3CK7A 5CMYA 2WXIA 1TN7A 4ATGA 1UN9A 4HI8A 2HYZA 3QWWA 5G05J 1K8KG 4AM9A 3TJPA 3L16A 3Q75A 4QQIA 1V55E 3ZRHA 1X81A 2FO7A 1P5QA 4HOUA 5FQ4A 3NZUA 1BI7B 2CHZA 1K1AA 2L0IA 3CVWA 3DSTA 2LAHA 4TXRA 3MA5A 3ZHEB 5FTPA 3QDNA 2J4DA 4U07A 3SI5A 3ASOE 3GZ2A 2AJAA 3JYSA 4XX5A 3CV0A 4KZ0A 3KSQA 2WXHA 3T5XA 3CVUA 2WVIA 2CFZA 3ZN3A 4DI3A 5T8IA 4E85A 3KEZA 3PUKA 1HFAA 5HRYA 2XPZA 1IXVA 2WXLA 3URZA 5JMND 4PDXA 3CVLA 1SZ9A 5ENPD 2LO6A 3EU9A 3JUIA 4LRZA 1BPOA 4Y6WA 1N4RA 4U8YD 2CHWA 4ACLA 5LCWC 3EHRA 5B3SE 4FA6A 2OCCE 4B89A 4YDYA 2CG2A 2VYIA 2LUHA 1KPSB 4I1AA 4KZCA 3I5PA 4CGVA 4IRUA 3ZXPA 3UPVA 5EILA 4EZLA 2I1KA 1FT2A 3L82A 4FJYA 2VTBB 4APOA 5AJDA 3E32A 1TNUA 3U64A 3CHMA 4EBAG 2L6JA 1N94A 4ILGA 3UT7A 2I6HA 3ZGQA 5EN5D 1N11A 2ETCA 4HXIA 4HRNA 1UJKA 2PQNA 3PZ2A 2DVWA 5A7DB 2YHCA 2BF0X 2LSVA 3CVVA 2Y1LE 1QYMA 3ABKE 3SFYA 4UUCA 3D3MA 4Q94A 4BX8A 5IY5E 1YYHA 2Q7FA 5LOZA 4GA0A 2XEVA 1JCQA 4ABNA 2L9BA 3TGOA 4DK5A 4GMLA 4RSYA 4JA7A 1JWFA 2QC9A 1SA5A 2PZIA 2XHEA 3UQ3A 4HOTA 4LNBA 5CMWA 4CGWA 5FWQA 4N5QA 1KZOA 4A1SA 2WQ7A 3UMVA 1OCCE 5BUZA 3O4ZA 4GTOA 1FCHA 2KZTA 1FT1A 3RAUA 4N3CA 5CHEE 5J90A 2WXNA 3FEYA 3DSVA 3G2WA 4M7CA 3PUJA 1D8EA 4OVUA 3Q5MA 1OWLA 3IHVA 2WPVA 4EZJA 4C48B 1BLXB 4JHJA 2I1JA 3NBNB 5AQBA 3MZLB 2MOWA 3HRAA 2P58C 5M72A 3CLJA 4CYMD 2J09A 3EHQA 4GYOA 1AWCB 3LCAA 3PDNA 2WXKA 1KT0A 2VQ2A 4J6IA 3PREA 3DPYA 3ZPJA 3CVYA 3DSUA 3QWPA 3R7RA 2P9NG 1OXJA 1TJFA 4BT9A 2X3MA 4K03A 2ZGGA 4J8YA 1TNOA 1HU3A 1Z6TA 3Q73A 3U3WA 1NL4A 3LVQE 1EYHA 2IO2C 4N39A 4X8QA 1RW2A 2VJ8A 2DBAA 3FFLA 5ANLA 1TN8A 3UM3A 1U3DA 4JHRA 4HLEA 4FJZA 4XKCA 1LF8A 3X2QE 1TEZA 1MZCA 4JB8P 4BESA 1N95A 4MBGA 5BPPA 1OUVA 4GB9A 3E33A 2F0YA 4AY5A 4W9RA 2M63A 3L9TA 5FJYA 1TR4A 3V79K 2Y0BG 3TG4A 3SY2A 3TWUA 5AAOA 4FLBA 3Q47B 3JXJA 4GTRA 3B7RL 4HVBA 5G2NA 1OWPA 1WY6A 1IHGA 3FTYA 2P2CP 2MHKA 1ZB1A 4DX7D 5EX0A 4GMRA 3D9LA 4LNUD 3UT8A 3NAWA 5J08A 3ULEG 5A6CA 2H6HA 2L6BA 1QBQA 3LKUA 4C0EA 3K9IA 4L2LA 2OEVA 4U0SA 2XPIA 3VTXA 5CCLA 5HS0A 3S7JA 1N0QA 1SW6A 3JXIA 3FTVA 1NFIE 4Y6CA 2PQRA 3LY8A 3AS5A 3TWRA 3HG0D 4TUMA 2EIME 3APFA 3LXUX 4FU3A 4F7AA 5FQ7A 1DCEA 2IONA 2J8SD 4AY6A 5FINA 4BERA 2WQ6A 4ME2A 3HIZA 1V54E 4RG9A 3MJWA 5HKPA 4PS7A 4GYWA 2C0LA 2JEKA 4UI9J 4LNGA 3S7BA 2BKGA 4L23A 3FULA 1Z3XA 1MX4A 2X38A 5AJLA 2F37A 5LP0A 2JABA 4KMOA 1IHBA 3Q4AB 5ENTD 4NQ0A 2IEJA 4LERA 3UM2A 4WNDA 3PE3A 1QZ2A 3SNXA 3DSSA 4A55A 3E4BA 4BWRA 1MX6A 2GRQB 4I6JA 3O48A 1O5MA 4HB5A 1WDYA 3HXFA 5EDSA 3U66A 4RVBA 1TNYA 2GRNB 2LXMA 2NXPA 2PNNA 4U0ZA 3CHQA 5AENA 2Y4UA 3D9KA 2IOSA 4GMJA 1K3ZD 1TN6A 5BXUA 3UKUG 4JHKA 3GZ1A 3FUHA 2H6FA 3LY9A 1N4QA 1U3CA 4MS6A 4GZ5A 4GTQA 1H2VC 3PRZA 5JHAA 3IV0A 3NB2A 5T3RA 2R02A 4I1MA 3Q7FA 2NYJA 2XS1A 2IOLA 5EYPF 4JD2G 3MKQA 4BT8A 1MQSA 2X6KA 3W9GA 3WG7E 3AU4A 1VDYA 2WXRA 2KBXA 3T8MA 2GROB 3TXMA 1E96B 3JQ1A 3SGHA 5G04J 1N0RA 3SO8A 1E7VA 3SZ7A 4YDEA 2IJGX 4OAUC 3Q79A 1WG0A 2FBNA 4GZ6A 3QAQA 1OT8A 3LPZA 3KAEA 5BT1A 4C9BB 1DVPA 4U0UA 3T5VA 4APFA 3I3NA 3OXLA 4G8LA 3VLDA 1UW4B 2KCKA 3CVQA 3FUIA 2BTDA 4U96D 1B89A 5AQ7A 2OVBA 3AG1E 3OTNA 3BG1B 3B95A 3APCA 2XCCA 3EU5A 5BNWA 3HVEB 2WXQA 3D9PA 4GTMA 1HX8A 2X6HA 3IXEA 3FUDA 4UI9K 2R05A 3FU0A 3C5RA 5BV0A 2DZNA 2R03A 1HH8A 4OYSA 5BV1A 3MGBA 3ZW3A 2QZAA 2FO1E 1N4SA 4HOQA 4G24A 2LXLA 2LSUA 4G1TA 5DIZA 4KBQA 3TWSA 2MRIA 3D9HA 1E90A 3FUNA 4FHKA 3QB2A 4U63A 3TWVA 3EUVA 2UWJG 3DXMG 3PZ3A 3TXNA 3ZIMA 1E8YA 4ILHB 4H7XA 3IHYA 3TAXA 3W9FA 4B8CB 2XZDG 1SVXA 3ASDA 3CK8A 3KEAA 3UX4A 2CG3A 5KWDA 2C2LA 2P9UG 3ZEFA 4XIFA 4LSZE 3VLFA 4U04A 1MJ0A 3RU0A 5D0QD 3P2BA 3UIOC 3ZHEA 5ENQD 4URKA 3ML9A 2WMNA 4CDRA 1HS6A 4BTAA 3RK6A 5AIJA 3KSLA 2CHXA 4U95D 3CHSA 3RKVA 3C98A 5KJKA 3AG4E 4DX6D 4N2SA 4H7YA 4AIFA 5FZRA 1ZU2A 3PE4A 3U4TA 4F53A 4CT4A 1OCOE 5CEDB 4AXHA 2F8XK 2CFUA 1BI8B 1OCRE 4KVMA 1BD8A 3IEGA 2IFUA 3AU5A 2AWIA 3JCKC 4FHJA 1AP7A 3FHEA 5CECB 2IU1A 3SF4A 1UG3A 1U2VG 3D9OA 4KT6B 2P9SG 4BSXA 3QOUA 1YCSB 1Y6IA 1GW6A 1KZPA 3ZVVA 2HR2A 3VLEA 3D9MA 4TUUA 4WAFA 1QNFA 2QYUA 3ZYLA 2VSOE 2VTBA 2XGMA 4YVQC 4HS2A 4CEMA 4AEZC 4BSZB 5E75A 4B94A 4M3OA 4GA1A 4L7TA 1FVFA 3U9WA 3FH7A 3PH0C 3AS8A 3PS6A 5CBOA 3KS2A 4G11A 3DRAA 1MHQA 2NSZA 1N52A 1NZNA 4TRQA 3FWVA 2XZTG 4UQYA 2VGYA 3FEXA 3F6QA 3ASHA 4TV3A 2Y4TA 2ZXWE 2J07A 1JCRA 3C3RA 3FUFA 2KATA 4BX9A 4G25A 3UUXA 3EDTB 5KNHD 4JPSA 5H7PA 4JEHA 2R17C 3Q78A 1H2TC 1HE8A 3CHRA 2WXGA 3ASFA 4DI4A 2BUGA 2YINA 3QNKA 4WNGA 5C1DA 4JVSA 4YDOA 2DZOA 5DBKA 3DPDA 5T4YA 4IULA 2RFAA 2VGXB 4PUCA 2FI7A 5FQ6A 4AV7A 3S7FA 3J5PA 1E8WA 4ANVA 3UIPC 5ITZF 3FUEA 3EIJA 4FADA 1JCSA 4NACA 1E8XA 4F1PA 5EIBE 3LS8A 2VSYA 4OVVA 2QFCA 1YMPA 5FIOA 4I9EA 1TNZA 3DSWA 1D9SA 4GTSA 4UWLA 5AQAA 1SA4A 5JA4D 3ONKA 2OV8A 4AOFA 5LCWJ 3LVRE 3FTSA 4BTBA 3CKCA 5G05C 4ANXA 1HG2A 4B0ZA 2GRMA 4DRXE 3CSFA 4J8FA 1SQMA 1HO8A 4MRUA 4DLQA 4PS8A 3G2SA 4LCTA 1ELRA 2IO3C 2ZISA 3HYMB 3D9IA 2VGXA 1H2UA 3CGHA 2IY0C 4O6FA 2XPYA 3ISMC 2VSNA 3RO3A 4JEUA 2IF4A 5B1AE 1DC2A 2GRRB 4HOSA 2LNIA 3CSTA 4CCAA 2XENA 3HHMA 4GPMA 1H0AA 3BUAA 1IYGA 5D2MC 4U8HA 1KLXA 3AAAC 3ABME 2V4LA 1QQEA 3FUMA 5KCMA 3SBTB 5AN8A 2KC7A 3ZYMA 1X5BA 3V2XA 2WB2A 3QWVA 3Q9UC 4EHMA 4CZ2D 1TYQG 2XEEA 3NOGD 1Q2ZA 5FT9A 5AYWD 1UOHA 4Q69A 4GAAA 4NURA 2RKKA 4A3VA 3UT4A 2BEDA 3UTMA 4XI9A 3Q7AA 4I2WA 3C72A 1JPLA 2WM9A 4UQZA 4E6HA 3ZU7B 4G8KA 1S70B 2XCBA 2YQ8A 5ARGA 4L2YA 2RG8A 3ZYQA 1OCZE 3ENEA 5ANRA 1YA0A 3SFZA
chains in the Genus database with same CATH topology
4X8QA 3L9TA 2B6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8Q A;  3L9T A;  2B6C A; 
#chains in the Genus database with same CATH topology
 3G2V A;  2KM4 A;  4HI9 A;  4UWF A;  3APD A;  2J4B A;  3L54 A;  4GZD A;  4ZHB A;  4BET A;  4O1P A;  3MCX A;  3NOC D;  5B1B E;  4HNA D;  4DLO A;  4U8V D;  2R5S A;  5KNG A;  2IQC A;  4MKT A;  4K0R A;  1LD8 A;  2GGF A;  2A5E A;  4LEU A;  1XNF A;  4JXT A;  3OXG A;  3DEO A;  4I43 A;  3T9K A;  4ANW A;  4XKB A;  1K1B A;  5HI7 A;  1EF1 C;  3EIQ C;  2KCV A;  2BKK B;  4EEC A;  2Y69 E;  3FH5 A;  3LEW A;  2HE0 A;  4KVO A;  3FU6 A;  5ARF A;  2KCL A;  1IQR A;  3BG0 B;  4WUY A;  4NIK A;  1HXI A;  2X6I A;  1WM5 A;  3HXC A;  3IBE A;  2P9P G;  3LYA A;  4A1G A;  3ZNG A;  4FC8 A;  2RD0 A;  1NI1 A;  2AXZ A;  3S2A A;  3GW4 A;  4WWO A;  3TWT A;  2X6F A;  3V31 A;  4L9P A;  1O1T A;  1NP7 A;  3P1U A;  1ZBP A;  1TJC A;  3ZYK A;  2EIN E;  4ANU A;  5BW8 C;  2NC9 A;  4JC8 A;  4HBD A;  3ZKJ A;  4WWP A;  4I2Z A;  2XRZ A;  3CHO A;  2ETB A;  4N3A A;  4GYY A;  3MV3 B;  5CBN A;  3LY7 A;  3L22 A;  3EJN A;  3ESL A;  2LAI A;  4JL0 A;  4HLL A;  3D9N A;  4I1O B;  3CR3 A;  3AS4 A;  1O1R A;  5CRV A;  5FZS A;  4HOR A;  2P9K G;  4V3I A;  4K5C A;  5CEA A;  2H6I A;  4HRL A;  3JUE A;  5KJM A;  4B93 B;  3UI2 A;  3NF1 A;  3MKR A;  4G26 A;  5A23 A;  4WNF A;  2ETA A;  1OWO A;  2XS8 A;  3PZD A;  5FZQ A;  2YHE A;  3ML8 A;  2WXP A;  4I6G A;  2A4Z A;  2DYS E;  2WQH A;  2J49 A;  1W3B A;  4O1O A;  3ZFW A;  4DUI A;  4EPZ A;  2ZGD A;  4GU5 A;  2V0P A;  2J08 A;  3UM1 A;  3BU8 A;  3I4R B;  3CEQ A;  3MEK A;  4U7E B;  2FEZ A;  2GW1 A;  2DCP A;  1SZA A;  3V30 A;  2R59 A;  3HVE A;  3PNT B;  5AQ9 A;  2AXU A;  1N9A A;  1E7U A;  3BQO A;  3SQV A;  1FVH A;  2Y3A A;  1ELK A;  3ASN E;  4RQI A;  4P29 A;  2OND A;  3NZS A;  4I9C A;  3L08 A;  2PM6 A;  3FTZ A;  4ATZ D;  1A17 A;  3OXF A;  1Z3Y A;  3C3O A;  3OAW A;  3TG5 A;  2KZT B;  4HFG A;  3CK9 A;  2J9Q A;  2B0O E;  1Y8M A;  3B13 A;  3LDZ A;  4N5C A;  4F6R D;  3CIA A;  5BXO A;  2DIW A;  4DX2 A;  2PL2 A;  4CDN A;  2XQ0 A;  4JW1 A;  4LG6 A;  4R7L A;  4BEP A;  5LX8 A;  1HG5 A;  4K5B A;  1ELW A;  4K5A B;  4FLH A;  3UXG A;  4UWK A;  4GCN A;  1LD7 A;  4KYO B;  3FP3 A;  2XGS A;  4XZ4 A;  3AG2 E;  4GTT A;  5G55 A;  3CVN A;  4BFR A;  3D9J A;  2HO1 A;  3TL5 A;  4CDM A;  3EHM A;  2OOE A;  3J5Q B;  4FP7 A;  4EBA A;  2AVP A;  1MX2 A;  4UI9 C;  3TWW A;  2AW6 A;  2MYO A;  4O60 A;  3E37 A;  4UWG A;  5HQ8 A;  2QYJ A;  5ENR D;  1PY1 A;  1G3N B;  4QFV A;  2L0T B;  1EPU A;  3B7S A;  2UY1 B;  4DX5 D;  1H6K A;  1NA0 A;  4GCO A;  2XGO A;  2FF4 A;  3HXE A;  2GRP B;  3QAR A;  4KXK B;  4XE0 A;  4L1B A;  5EID A;  5KJN A;  2ILR A;  2V5Q C;  4AJW A;  3FTX A;  4JZY A;  5LFA A;  3I4G A;  4GA2 A;  4D10 C;  4J0U A;  5CRU A;  2OVF A;  4MLP A;  2V8S E;  2VGE A;  2WXO A;  5D66 A;  1Z5S C;  3FU5 A;  4YND A;  4ZFH A;  4BY6 A;  2I2O A;  4B8A A;  3G2U A;  4GZ3 A;  1OY3 D;  4GPK A;  3C3Q A;  5ENO D;  4AVX A;  3HDX A;  4J8S A;  3L17 A;  3FUJ A;  2QY7 A;  3RO2 A;  3B7B A;  3FDH A;  4YVO A;  1WAO 1;  1KT1 A;  4Q96 A;  3FH8 A;  3UKR G;  4I17 A;  2HM8 A;  4GTV A;  1S63 A;  4NRH B;  1TNB A;  4HQD A;  3DEP A;  5E76 A;  1MYO A;  5EKQ D;  3PEU B;  2E2E A;  1XGW A;  2UY1 A;  2AXV A;  2PM7 A;  3DBS A;  5JJ7 A;  3JQ0 A;  1DNP A;  5G04 C;  4UQX A;  3DXK G;  1PC2 A;  3RIB A;  5ENS D;  4GTP A;  3FY4 A;  4LUN U;  3FU3 A;  1DCQ A;  4DX1 A;  4ILI A;  3FTW A;  3NQP A;  3QK0 A;  5JJT A;  5EX3 A;  3RRU A;  3SBS A;  4EZK A;  3MYV A;  4IN3 B;  3TWQ A;  3QKY A;  2XEH A;  3LJN A;  3S7D A;  1N4P A;  4TXQ A;  3IKO B;  3PNL B;  1HF8 A;  1IKN D;  2RFM A;  2XRY A;  3CVX A;  3MV2 B;  3QC1 A;  3MX3 A;  2EIL E;  1L5J A;  2EQX A;  2ZIR A;  3B7U X;  1UN8 A;  2ZU6 B;  2E0I A;  3Q15 A;  3PZ4 A;  2KXP C;  4WNE A;  3HXD A;  4F3V A;  5AAR A;  3PZ1 A;  4AP2 A;  3Q9N C;  2F8Y A;  3Q49 B;  4G2V A;  4GZC A;  3CVP A;  3DSX A;  3ONL A;  1JWG A;  5JHB A;  1HZ4 A;  2EIK E;  3EHN A;  3GYZ A;  1FPP A;  1RZ4 A;  4JA9 A;  3SFX A;  2H6G A;  3B7T A;  3CHP A;  2V4H C;  1A5E A;  5CCM A;  4J8E A;  4HRM B;  4J7W A;  3RSE G;  4PS3 A;  3TWX A;  3PVL A;  3ULQ A;  5EYL A;  2B6C A;  2WXF A;  3ULY A;  1O1S A;  3ESK A;  3SHF A;  3UM0 A;  1UJJ A;  4N3B A;  3BEE A;  3AG3 E;  3PEV B;  4A63 B;  1S0P A;  3MKQ B;  3CQG B;  4YDW A;  4J8D A;  3GZS A;  5JJ6 A;  3KD7 A;  1E8Z A;  4DPR A;  3RRM B;  3E34 A;  3R9A B;  3ASG A;  3DWL G;  3RRN B;  1BU9 A;  3QJZ A;  4OAV B;  3LJ3 A;  5ENN A;  4Z68 A;  3G2T A;  3N71 A;  4RLY A;  2VSX E;  2X6J A;  1H19 A;  2GRL A;  1IQU A;  2V5F A;  1JUQ A;  3E30 A;  4XI0 A;  5FQ8 A;  2WMO A;  4PH4 B;  1EDU A;  4A3T A;  3CKB A;  3AJI A;  4IYP A;  3L6A A;  4DJA A;  2DYR E;  3ZXS A;  4CT0 A;  3FTU A;  1OWM A;  1H6O A;  4FUL A;  3T8K A;  1H6P A;  3WXX A;  1PAQ A;  3SD5 A;  2JLB A;  2A5U A;  3R7Q A;  3V2O A;  2OEW A;  3ZUV B;  4G23 A;  4WWN A;  2P9L G;  4TXP A;  5KBA A;  1D8D A;  4RG6 A;  4CRW A;  3ABL E;  1LTX A;  2DWZ A;  5C2Y A;  2WXM A;  1INZ A;  5D0O D;  3R9M A;  1S64 A;  3FUK A;  3CQC B;  2WXJ A;  2EIJ E;  1N54 A;  3UIN C;  4I6E A;  4XEI G;  3VTY A;  4C0M A;  2I9C A;  2YNQ A;  5CER B;  1OWN A;  3HXB A;  2R2L A;  2P9I G;  4N2Q A;  5KJL A;  4ACK A;  4F1S A;  1NA3 A;  3RJV A;  3L13 A;  2FUL A;  4UWH A;  4EQF A;  2C0M A;  3CK7 A;  5CMY A;  2WXI A;  1TN7 A;  4ATG A;  1UN9 A;  4HI8 A;  2HYZ A;  3QWW A;  5G05 J;  1K8K G;  4AM9 A;  3TJP A;  3L16 A;  3Q75 A;  4QQI A;  1V55 E;  3ZRH A;  1X81 A;  2FO7 A;  1P5Q A;  4HOU A;  5FQ4 A;  3NZU A;  1BI7 B;  2CHZ A;  1K1A A;  2L0I A;  3CVW A;  3DST A;  2LAH A;  4TXR A;  3MA5 A;  3ZHE B;  5FTP A;  3QDN A;  2J4D A;  4U07 A;  3SI5 A;  3ASO E;  3GZ2 A;  2AJA A;  3JYS A;  4XX5 A;  3CV0 A;  4KZ0 A;  3KSQ A;  2WXH A;  3T5X A;  3CVU A;  2WVI A;  2CFZ A;  3ZN3 A;  4DI3 A;  5T8I A;  4E85 A;  3KEZ A;  3PUK A;  1HFA A;  5HRY A;  2XPZ A;  1IXV A;  2WXL A;  3URZ A;  5JMN D;  4PDX A;  3CVL A;  1SZ9 A;  5ENP D;  2LO6 A;  3EU9 A;  3JUI A;  4LRZ A;  1BPO A;  4Y6W A;  1N4R A;  4U8Y D;  2CHW A;  4ACL A;  5LCW C;  3EHR A;  5B3S E;  4FA6 A;  2OCC E;  4B89 A;  4YDY A;  2CG2 A;  2VYI A;  2LUH A;  1KPS B;  4I1A A;  4KZC A;  3I5P A;  4CGV A;  4IRU A;  3ZXP A;  3UPV A;  5EIL A;  4EZL A;  2I1K A;  1FT2 A;  3L82 A;  4FJY A;  2VTB B;  4APO A;  5AJD A;  3E32 A;  1TNU A;  3U64 A;  3CHM A;  4EBA G;  2L6J A;  1N94 A;  4ILG A;  3UT7 A;  2I6H A;  3ZGQ A;  5EN5 D;  1N11 A;  2ETC A;  4HXI A;  4HRN A;  1UJK A;  2PQN A;  3PZ2 A;  2DVW A;  5A7D B;  2YHC A;  2BF0 X;  2LSV A;  3CVV A;  2Y1L E;  1QYM A;  3ABK E;  3SFY A;  4UUC A;  3D3M A;  4Q94 A;  4BX8 A;  5IY5 E;  1YYH A;  2Q7F A;  5LOZ A;  4GA0 A;  2XEV A;  1JCQ A;  4ABN A;  2L9B A;  3TGO A;  4DK5 A;  4GML A;  4RSY A;  4JA7 A;  1JWF A;  2QC9 A;  1SA5 A;  2PZI A;  2XHE A;  3UQ3 A;  4HOT A;  4LNB A;  5CMW A;  4CGW A;  5FWQ A;  4N5Q A;  1KZO A;  4A1S A;  2WQ7 A;  3UMV A;  1OCC E;  5BUZ A;  3O4Z A;  4GTO A;  1FCH A;  2KZT A;  1FT1 A;  3RAU A;  4N3C A;  5CHE E;  5J90 A;  2WXN A;  3FEY A;  3DSV A;  3G2W A;  4M7C A;  3PUJ A;  1D8E A;  4OVU A;  3Q5M A;  1OWL A;  3IHV A;  2WPV A;  4EZJ A;  4C48 B;  1BLX B;  4JHJ A;  2I1J A;  3NBN B;  5AQB A;  3MZL B;  2MOW A;  3HRA A;  2P58 C;  5M72 A;  3CLJ A;  4CYM D;  2J09 A;  3EHQ A;  4GYO A;  1AWC B;  3LCA A;  3PDN A;  2WXK A;  1KT0 A;  2VQ2 A;  4J6I A;  3PRE A;  3DPY A;  3ZPJ A;  3CVY A;  3DSU A;  3QWP A;  3R7R A;  2P9N G;  1OXJ A;  1TJF A;  4BT9 A;  2X3M A;  4K03 A;  2ZGG A;  4J8Y A;  1TNO A;  1HU3 A;  1Z6T A;  3Q73 A;  3U3W A;  1NL4 A;  3LVQ E;  1EYH A;  2IO2 C;  4N39 A;  4X8Q A;  1RW2 A;  2VJ8 A;  2DBA A;  3FFL A;  5ANL A;  1TN8 A;  3UM3 A;  1U3D A;  4JHR A;  4HLE A;  4FJZ A;  4XKC A;  1LF8 A;  3X2Q E;  1TEZ A;  1MZC A;  4JB8 P;  4BES A;  1N95 A;  4MBG A;  5BPP A;  1OUV A;  4GB9 A;  3E33 A;  2F0Y A;  4AY5 A;  4W9R A;  2M63 A;  3L9T A;  5FJY A;  1TR4 A;  3V79 K;  2Y0B G;  3TG4 A;  3SY2 A;  3TWU A;  5AAO A;  4FLB A;  3Q47 B;  3JXJ A;  4GTR A;  3B7R L;  4HVB A;  5G2N A;  1OWP A;  1WY6 A;  1IHG A;  3FTY A;  2P2C P;  2MHK A;  1ZB1 A;  4DX7 D;  5EX0 A;  4GMR A;  3D9L A;  4LNU D;  3UT8 A;  3NAW A;  5J08 A;  3ULE G;  5A6C A;  2H6H A;  2L6B A;  1QBQ A;  3LKU A;  4C0E A;  3K9I A;  4L2L A;  2OEV A;  4U0S A;  2XPI A;  3VTX A;  5CCL A;  5HS0 A;  3S7J A;  1N0Q A;  1SW6 A;  3JXI A;  3FTV A;  1NFI E;  4Y6C A;  2PQR A;  3LY8 A;  3AS5 A;  3TWR A;  3HG0 D;  4TUM A;  2EIM E;  3APF A;  3LXU X;  4FU3 A;  4F7A A;  5FQ7 A;  1DCE A;  2ION A;  2J8S D;  4AY6 A;  5FIN A;  4BER A;  2WQ6 A;  4ME2 A;  3HIZ A;  1V54 E;  4RG9 A;  3MJW A;  5HKP A;  4PS7 A;  4GYW A;  2C0L A;  2JEK A;  4UI9 J;  4LNG A;  3S7B A;  2BKG A;  4L23 A;  3FUL A;  1Z3X A;  1MX4 A;  2X38 A;  5AJL A;  2F37 A;  5LP0 A;  2JAB A;  4KMO A;  1IHB A;  3Q4A B;  5ENT D;  4NQ0 A;  2IEJ A;  4LER A;  3UM2 A;  4WND A;  3PE3 A;  1QZ2 A;  3SNX A;  3DSS A;  4A55 A;  3E4B A;  4BWR A;  1MX6 A;  2GRQ B;  4I6J A;  3O48 A;  1O5M A;  4HB5 A;  1WDY A;  3HXF A;  5EDS A;  3U66 A;  4RVB A;  1TNY A;  2GRN B;  2LXM A;  2NXP A;  2PNN A;  4U0Z A;  3CHQ A;  5AEN A;  2Y4U A;  3D9K A;  2IOS A;  4GMJ A;  1K3Z D;  1TN6 A;  5BXU A;  3UKU G;  4JHK A;  3GZ1 A;  3FUH A;  2H6F A;  3LY9 A;  1N4Q A;  1U3C A;  4MS6 A;  4GZ5 A;  4GTQ A;  1H2V C;  3PRZ A;  5JHA A;  3IV0 A;  3NB2 A;  5T3R A;  2R02 A;  4I1M A;  3Q7F A;  2NYJ A;  2XS1 A;  2IOL A;  5EYP F;  4JD2 G;  3MKQ A;  4BT8 A;  1MQS A;  2X6K A;  3W9G A;  3WG7 E;  3AU4 A;  1VDY A;  2WXR A;  2KBX A;  3T8M A;  2GRO B;  3TXM A;  1E96 B;  3JQ1 A;  3SGH A;  5G04 J;  1N0R A;  3SO8 A;  1E7V A;  3SZ7 A;  4YDE A;  2IJG X;  4OAU C;  3Q79 A;  1WG0 A;  2FBN A;  4GZ6 A;  3QAQ A;  1OT8 A;  3LPZ A;  3KAE A;  5BT1 A;  4C9B B;  1DVP A;  4U0U A;  3T5V A;  4APF A;  3I3N A;  3OXL A;  4G8L A;  3VLD A;  1UW4 B;  2KCK A;  3CVQ A;  3FUI A;  2BTD A;  4U96 D;  1B89 A;  5AQ7 A;  2OVB A;  3AG1 E;  3OTN A;  3BG1 B;  3B95 A;  3APC A;  2XCC A;  3EU5 A;  5BNW A;  3HVE B;  2WXQ A;  3D9P A;  4GTM A;  1HX8 A;  2X6H A;  3IXE A;  3FUD A;  4UI9 K;  2R05 A;  3FU0 A;  3C5R A;  5BV0 A;  2DZN A;  2R03 A;  1HH8 A;  4OYS A;  5BV1 A;  3MGB A;  3ZW3 A;  2QZA A;  2FO1 E;  1N4S A;  4HOQ A;  4G24 A;  2LXL A;  2LSU A;  4G1T A;  5DIZ A;  4KBQ A;  3TWS A;  2MRI A;  3D9H A;  1E90 A;  3FUN A;  4FHK A;  3QB2 A;  4U63 A;  3TWV A;  3EUV A;  2UWJ G;  3DXM G;  3PZ3 A;  3TXN A;  3ZIM A;  1E8Y A;  4ILH B;  4H7X A;  3IHY A;  3TAX A;  3W9F A;  4B8C B;  2XZD G;  1SVX A;  3ASD A;  3CK8 A;  3KEA A;  3UX4 A;  2CG3 A;  5KWD A;  2C2L A;  2P9U G;  3ZEF A;  4XIF A;  4LSZ E;  3VLF A;  4U04 A;  1MJ0 A;  3RU0 A;  5D0Q D;  3P2B A;  3UIO C;  3ZHE A;  5ENQ D;  4URK A;  3ML9 A;  2WMN A;  4CDR A;  1HS6 A;  4BTA A;  3RK6 A;  5AIJ A;  3KSL A;  2CHX A;  4U95 D;  3CHS A;  3RKV A;  3C98 A;  5KJK A;  3AG4 E;  4DX6 D;  4N2S A;  4H7Y A;  4AIF A;  5FZR A;  1ZU2 A;  3PE4 A;  3U4T A;  4F53 A;  4CT4 A;  1OCO E;  5CED B;  4AXH A;  2F8X K;  2CFU A;  1BI8 B;  1OCR E;  4KVM A;  1BD8 A;  3IEG A;  2IFU A;  3AU5 A;  2AWI A;  3JCK C;  4FHJ A;  1AP7 A;  3FHE A;  5CEC B;  2IU1 A;  3SF4 A;  1UG3 A;  1U2V G;  3D9O A;  4KT6 B;  2P9S G;  4BSX A;  3QOU A;  1YCS B;  1Y6I A;  1GW6 A;  1KZP A;  3ZVV A;  2HR2 A;  3VLE A;  3D9M A;  4TUU A;  4WAF A;  1QNF A;  2QYU A;  3ZYL A;  2VSO E;  2VTB A;  2XGM A;  4YVQ C;  4HS2 A;  4CEM A;  4AEZ C;  4BSZ B;  5E75 A;  4B94 A;  4M3O A;  4GA1 A;  4L7T A;  1FVF A;  3U9W A;  3FH7 A;  3PH0 C;  3AS8 A;  3PS6 A;  5CBO A;  3KS2 A;  4G11 A;  3DRA A;  1MHQ A;  2NSZ A;  1N52 A;  1NZN A;  4TRQ A;  3FWV A;  2XZT G;  4UQY A;  2VGY A;  3FEX A;  3F6Q A;  3ASH A;  4TV3 A;  2Y4T A;  2ZXW E;  2J07 A;  1JCR A;  3C3R A;  3FUF A;  2KAT A;  4BX9 A;  4G25 A;  3UUX A;  3EDT B;  5KNH D;  4JPS A;  5H7P A;  4JEH A;  2R17 C;  3Q78 A;  1H2T C;  1HE8 A;  3CHR A;  2WXG A;  3ASF A;  4DI4 A;  2BUG A;  2YIN A;  3QNK A;  4WNG A;  5C1D A;  4JVS A;  4YDO A;  2DZO A;  5DBK A;  3DPD A;  5T4Y A;  4IUL A;  2RFA A;  2VGX B;  4PUC A;  2FI7 A;  5FQ6 A;  4AV7 A;  3S7F A;  3J5P A;  1E8W A;  4ANV A;  3UIP C;  5ITZ F;  3FUE A;  3EIJ A;  4FAD A;  1JCS A;  4NAC A;  1E8X A;  4F1P A;  5EIB E;  3LS8 A;  2VSY A;  4OVV A;  2QFC A;  1YMP A;  5FIO A;  4I9E A;  1TNZ A;  3DSW A;  1D9S A;  4GTS A;  4UWL A;  5AQA A;  1SA4 A;  5JA4 D;  3ONK A;  2OV8 A;  4AOF A;  5LCW J;  3LVR E;  3FTS A;  4BTB A;  3CKC A;  5G05 C;  4ANX A;  1HG2 A;  4B0Z A;  2GRM A;  4DRX E;  3CSF A;  4J8F A;  1SQM A;  1HO8 A;  4MRU A;  4DLQ A;  4PS8 A;  3G2S A;  4LCT A;  1ELR A;  2IO3 C;  2ZIS A;  3HYM B;  3D9I A;  2VGX A;  1H2U A;  3CGH A;  2IY0 C;  4O6F A;  2XPY A;  3ISM C;  2VSN A;  3RO3 A;  4JEU A;  2IF4 A;  5B1A E;  1DC2 A;  2GRR B;  4HOS A;  2LNI A;  3CST A;  4CCA A;  2XEN A;  3HHM A;  4GPM A;  1H0A A;  3BUA A;  1IYG A;  5D2M C;  4U8H A;  1KLX A;  3AAA C;  3ABM E;  2V4L A;  1QQE A;  3FUM A;  5KCM A;  3SBT B;  5AN8 A;  2KC7 A;  3ZYM A;  1X5B A;  3V2X A;  2WB2 A;  3QWV A;  3Q9U C;  4EHM A;  4CZ2 D;  1TYQ G;  2XEE A;  3NOG D;  1Q2Z A;  5FT9 A;  5AYW D;  1UOH A;  4Q69 A;  4GAA A;  4NUR A;  2RKK A;  4A3V A;  3UT4 A;  2BED A;  3UTM A;  4XI9 A;  3Q7A A;  4I2W A;  3C72 A;  1JPL A;  2WM9 A;  4UQZ A;  4E6H A;  3ZU7 B;  4G8K A;  1S70 B;  2XCB A;  2YQ8 A;  5ARG A;  4L2Y A;  2RG8 A;  3ZYQ A;  1OCZ E;  3ENE A;  5ANR A;  1YA0 A;  3SFZ A; 
#chains in the Genus database with same CATH homology
 4X8Q A;  3L9T A;  2B6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...