2B7CB

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Elongation factor 1-alpha
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b7cB00
4DV5F 1N34F 1IBLF 4LFAF 1FJGF 4DV7F 4JV5F 4X66F 5LMNF 4JI6F 4DV6F 2UU9F 1QJHA 3T1HF 4LF7F 1RISA 4YHHF 4JI5F 1GH8A 4DUYF 1G7CB 4LFCF 4DV3F 4LF9F 1I94F 1CQMA 4DR4F 3OTOF 1N36F 1FKAF 1CQNA 2BXJA 2B7BB 2UUBF 2UUCF 4JI7F 4JI0F 5BR8F 4JI8F 4NXNF 4K0KF 4B3SF 4DV0F 1N33F 4JI2F 1HNXF 2UUAF 4B3RF 4YY3F 4LF8F 4DV4F 5AJ3F 4X65F 4X62F 2UXDF 2KJWA 1F60B 5IWAF 2J5AA 2BVZA 4DR2F 2E5LF 1IBMF 2UXCF 4DR7F 1LOUA 5LMUF 1IBKF 4KHPF 4DV1F 1IJEB 4LF5F 3T1YF 4B3MF 4DUZF 1N32F 2YY3A 1IJFB 1VMBA 1HNZF 3R3TA 2HHHF 2KJVA 4LF4F 1J5EF 2UXBF 1XNRF 2F4VF 3ZZPA 2VQEF 1XMQF 4B3TF 4DR6F 1XMOF 4JI4F 4NXMF 1B64A 1G1XA 4DR1F 2VQFF 1HNWF 1HR0F 4LF6F 4DV2F 2ZM6F 4DR3F 1XNQF 4AQYF 4GKJF 2B7CB 4OX9F 2RJZA 4X64F 4DR5F 4LFBF 4GKKF 4JI3F 4JI1F 4JYAF
chains in the Genus database with same CATH superfamily
2U2FA 1T11A 4NLXA 2V2QA 3KTQA 3AB2B 2GQQA 5AE1A 2NZ4A 1I94F 1B0VA 2P9GA 5ETRA 4M5LA 3H25A 3WC2A 5C42B 1RLDA 5E41A 3MM7A 3S7RA 1MNEA 3J81U 4NLVA 2G9OA 4LVOP 1QSLA 1TMJA 4ZLLA 4ZVRB 1VCTA 1RAAB 3PKYA 2V8HA 4L75A 4DUZF 4ECUA 1MN9A 2GJIA 4AD6A 2KZZA 4F4AA 1KC8T 4EBDA 1YWXA 1ZAXA 4G6VB 3EGZA 1HARA 2XC9A 5IT9Y 2E9TA 1RWKB 5DG7A 5G0RB 2W9AA 2JH3A 3JSMB 3MURP 3SEOA 2HNDB 1VK8A 3ITHB 1B3TA 3C15A 2JFKA 2Z2ZA 3P5TL 2LQBA 3T5KA 1FNXH 4C7QA 3Q8RB 4JYAF 2C3MA 4O23A 3P49B 2AW0A 4ZOSA 3QGGA 4ES2A 2LQJA 2IAJA 1ZA1B 4MYUA 2PA8D 3ENWA 1IWAA 4WFYA 4LR9A 4H4KA 3ZZ0A 4J9KA 1T03B 3OQ2A 2ZFHA 1UJ5A 2BKNA 4PG5A 3OXGA 3M6UA 4RW8B 1FJ7A 4JB8B 2ZE2B 2W9BA 1Q0NA 1RT4A 1YIJS 3BKUA 3VR1A 1FJEB 2V50A 3BDPA 5L8RC 5KT2A 5LSRA 4LRAA 2XWXA 3EWGA 4DR5J 3AD8C 1KHWA 1RTZA 3KUEA 1IJFB 4QWCA 1V3SA 3R5AA 1FRMA 2WVDA 1UA1A 3PJXA 4C8OA 1GEHA 4AT1B 3BYPA 4X4SA 1FRHA 2VBZA 2YWEA 5T7LB 3NAHA 1FKPB 1F9HA 3A3PB 3D6TB 1NK9A 2PI4A 3TZYA 5CA5A 1WTFA 2DHSA 1L3TA 2J6SA 2ZITA 3ZZZA 3G9CA 5E7OB 4NE9C 5KG4A 4DL7A 3C46A 5KFCA 2WSFC 2AYGA 4QIVA 4WYLA 4KO0B 4RNNA 1TR0A 1U47A 4KQZA 3DI6A 4IRKA 2ZJPQ 2IBKA 4LIWA 3IWLA 4AQYJ 3R1LA 5L1KA 1N6QB 2AYMA 4RNHA 3KK1B 3RZAA 4P9SA 4OIXA 4CNYA 5LL6d 3BSOA 4I2QB 3DOLA 2QL7B 1HI1A 4ECQA 1REVB 3BBFA 1FJCA 2AYBA 3PO5A 4FVMA 2B4PA 4KT0C 5FD1A 2CPDA 2VG6A 4DQPA 4YB6A 5K8OA 4DCPB 3P6YC 4X4VA 1FI4A 3JTPA 2OPQB 1SV5A 1PAEX 1IXKA 2FYXA 2RT3A 2PSZA 3AA8A 4C8NA 1U25A 1PGZA 3N4WA 2AJFE 3R2CJ 1WDDA 3RJMB 2ZH3A 4F02A 1AT1B 3FVYA 1FDAA 2XGQA 5CHCB 3AQPA 2HGLA 1UVNA 3RB0A 2H3EB 4DPWA 2E5LJ 1OO0B 4EEYA 4MIBA 3JQMA 2CQIA 2CPFA 2AYEA 3CSKA 4O4GA 2FJBB 2XMVA 4DSJA 4KY3A 4ZVSB 3MPDA 5HQMA 5AE3A 2H48B 1R8BA 2FJAB 3JQJA 4YB7A 3VAIA 3K8WA 2HHPA 3QRRA 2C28A 3DYAB 2Y1LB 3OJSA 1ZAWA 4MKBA 3CMQA 1TL1A 2HFOA 2W24A 4H4OA 4O3SA 4O0NA 4WZQA 4RW9B 5DDQC 2IA6A 3ZTOA 4CO3A 4P74A 3I32A 2I8EA 2YKPA 4FF4A 2UZAA 2RDDA 4B3TF 2OTLS 1GTHA 1RTJA 4PYAA 4F3MA 5MAOA 3IG1A 2FLNA 1OY9A 4OX9F 4LIRA 4OV6A 3LW5C 3OR1B 4C2MA 1N34F 1H72C 4X66F 4ED3A 2D41A 1SL1A 1LW0A 2HHSA 3DLKB 4EYHB 5FDLB 5LOQA 1RISA 1SJ4P 3SQOP 3G96A 3MWBA 4CLFA 3A1YG 3AB4B 2VODA 1N36F 1F6TA 4C8MA 4KGMA 4JV5J 1OYDA 2VA2A 2DCUB 2ZKTA 5A2QU 4PWDB 1PYOB 3UE2A 3UDVA 2QMWA 1JLGA 2W2MP 3E8OA 2WVFA 3ZC4A 2DITA 3Q8YA 2RHSB 3UVJB 4NCGB 3DRSA 2YKMB 2J76E 1RT5B 1UP1A 4AXJA 2KJVA 4IOAQ 3S8SA 3OUYB 4LF9J 3BYRA 5ETTA 3DOMB 5A2QY 1EAYC 4WK3A 3M2VA 5KG5A 3DKDA 4K4TA 3BSAA 3GIRA 5L39A 1Y3JA 5F8JA 1JNZB 5KFLA 4X64F 2HHHJ 2PEHA 5CYJA 4M5HA 5C24A 1WTBA 3MEEA 1RTDA 1V6HA 5JVGQ 2F1FA 3RBDA 3MECA 2GJFA 4JI6F 3MEDB 4OYPA 2XWYA 2LP4A 1S5ZA 4TU9A 3LWLA 5SUHA 3NS6A 2W7OA 4ZIVA 4AUKA 3TP2A 4GKJJ 3R7NB 1TL7B 3FBFA 4HDHA 3NGRA 5LXYA 1Q7LB 2RRNA 2I0XA 4C8LA 2E5IA 3IMQJ 3R2DJ 4RLEA 2QLXA 1Y11A 4RO0A 2CPZA 3KK2A 2QSFA 2W1BA 3KHLA 1FRJA 2B3TB 1DZ5A 4BWMA 2CUYA 2P5VA 3DMJA 3WX4A 1TKDA 3MEKA 3SQGA 3PW4A 2AQ4A 1PYTA 2ATCB 2YY3A 3M32B 3H40A 4R8UB 3UI3A 3GFZA 4K7QA 1ICEB 1HKAA 3KUHA 1YBTA 2F65A 1F2HA 3MZIA 3MEGB 3RB3A 5DETA 3HHEA 1OY6A 1F1BB 5B0BA 3N01A 1T7PA 4MKVA 1SBRA 3UR3C 1TK8A 3ETMA 3C6UA 4PWWA 4KH1B 5ETPA 1TTHB 2XSFA 2VL1A 1S48A 3PRBA 4JI4J 4WU2A 5E3AA 3Q86A 1QD1A 1GH8A 5GMDA 2DJWA 5KT6A 2ZHOA 1RK8A 2QC3A 4ECYA 1WKKA 4HI2A 4WYWA 3QFHA 3MM9B 5T14A 3G8QA 4CO5A 3J7AN 2MY8A 3HPOA 3W65A 2CQ0A 4DBQA 2JEFA 4P7VA 5GMEA 2MB0B 1F3VA 1B99A 4D3HA 2BACA 2A10A 4NL5A 2AZ3A 4PZVA 5E33A 3HLUA 3N6LA 3CJ5A 1R31A 3VV2B 4WFNQ 5BXIA 2YQ1A 1T9WA 1FERA 2XLJA 3BKTA 3HI9A 1QAYA 1B7FA 1MLAA 1HNVB 4IDKB 1KRPA 4YDDB 4KTQA 3RG6A 2OO4A 3THPA 2FDNA 2G0CA 2EKNA 3BREA 5HBMB 2BKOA 2JZ5A 2ZZTA 1GFWB 3IP0A 2PC6A 1R0AB 2MGZB 4RJVA 4FXWA 4RNMA 3EZ5A 3V6HA 2CYYA 4ID5A 2B9WA 4J9LA 4ELTA 2JSXA 3V6DA 3FCHA 1J5EJ 2AJ2A 3NS7B 5DZ7A 4M94A 1FESA 5G0RA 2J0WA 2KVQE 1D8ZA 3JSMA 1HW8A 2VB6A 1T9VA 1ZZFA 4DL0C 2B5JA 3T9NA 1GTEA 3UQSA 3THVA 1YHQS 1N5SA 1LFPA 4I1TA 2G1HA 3GZ7A 5ITHA 5CAAA 1O8BA 1NHKL 3CCQS 2UVWA 2QT7A 2B4VA 2N3LA 3H7HB 5A0YA 2GV1A 3M8QB 1U2FA 4J9NA 9RUBA 5HMWA 5BYRA 3I5BA 3OTCA 2EFQA 2VPZB 4NRUA 2BRLA 3FEYB 1UJ4A 2BANA 1REGX 2RQMA 4S0MA 4ZPWR 3TVKA 5FIIA 4P10A 5M2UA 2Z58B 2HGNA 2COLA 4F04B 1MMNA 3T1HF 2FVSA 3CIMA 3IAM9 2VQFJ 1P9YA 4WFZA 4KH0B 4DZDA 1S6PA 3C6TA 2W25A 1FKPA 2FJWA 1VJQA 3O3LA 2ADCA 1RB0A 4DQRA 3CCMS 2MTLA 4USIA 2YNIB 1OPZA 3VQTA 3W2WA 4Q8FA 2DH8A 1VQSA 3ENVA 4RW7A 3FK4A 4EBEA 2MJNA 1NM2A 4MFBB 4KR0B 1JLFB 4HH1A 4NLGA 2HRTA 4A4JA 3DLHA 5BYSA 4ZMMA 2HMIA 3RBEA 3KUGA 2QA4G 1EZZB 3AOAA 1N5QA 3CCWA 2GW8A 3FBEA 3T3FA 3RR8A 4NA2A 4HT7A 1ZPWX 2GIRA 5KG2A 4I2QA 2VBXA 1RT6B 3EPIA 4FKXA 1PC4A 2H1YA 2FGCA 4LQ3A 4YR2A 4PQUA 2HNZA 3R97A 4KBIA 2KZMA 2ALYB 5DDRC 2E66A 2HEKA 4LVNP 2QSWA 5L9XA 2NREA 4LMZA 2C2ZB 2DRDA 1IM4A 2F7VA 3Q8QB 2JEIA 2V63A 3EDQB 4DU8A 2CADA 2VDHA 1U8WA 4DV3F 2ASJA 1VJWA 4M5KA 1LK7A 4JI7F 3T1AA 4USTA 4UOFA 4ANDA 3Q24A 3RR7A 4JP8A 5LSOA 4LF1A 1ZBTA 3UCGA 4UZBA 2CJXB 2C3OA 4HLBA 2CQ2A 4CM0A 2NYIA 1CJTB 4DV6J 4Q5VA 5KG7A 1P27B 3HXMA 1P6TA 5E3PA 3C19A 3KJQB 1GK8A 4F50A 2D9PA 3W9IA 2OAUA 3OTOJ 4ZK7M 4RR5A 1RU1A 3MPWA 2XSJB 4CLZA 2DH9A 2NXCA 1CJVB 2CQBA 5A6PA 4OX7A 3WIUA 4C48A 3C66A 3N0VA 1ITPA 3OFFA 4P2FA 3SMZA 2LA6A 4DV7F 1S77D 4DOZA 4G3IA 1Q4RA 1NRKA 2DD8S 1U24A 2NXJA 4EZ9A 3KKFA 5JMNA 2R9LA 2B7BB 3KMQA 5ETMA 2ATLA 4CP5A 2GVZB 3TYTA 1RACB 3VALA 4I4BA 4UOCA 2BE9B 5KT3A 5BR8J 2OD6A 1MWZA 1NPRA 4DL2A 5KFEA 2VPYB 2N3OA 4LF4F 3G87A 4WK1A 1RKJA 4ZJLA 4NLQA 1BQMA 2FTRA 3CCTA 4NWBA 2WONA 3IN5A 1AA1B 5KT5A 2FVCA 4PWDA 1RP5A 3OSNA 3QNWB 2WB1D 1LWCA 2K8GA 2OPPA 2CQCA 2XI3A 3UVJA 4NCGA 1JXEA 2ZDOA 2YKMA 3GR0A 1RT5A 4FYWB 4YHHF 4AL7A 1SC3B 2YKNB 3GJSB 1PG5B 4XDDA 2HQGA 2C2KB 2BXJA 2UV8G 2BOPA 4O3QA 1N54B 1KQSR 3N6MA 4R0EA 2A6OA 5H9FJ 3V4MA 3QIPA 3VZHA 1I94J 3A3OB 4K5RA 1J2VA 1NLKL 5LMUF 1U1OA 1SC6A 3RRGA 3HFKA 5HVGA 1S6QA 1QUPA 4E2FB 3K5OA 4Q0BA 5AXKA 2K2PA 1FCAA 1L5UA 5D4PA 2ZVIA 3ET6B 1U6BA 1URNA 3A3NB 1NZ8A 3M9MB 1S1VB 2DXDA 4IFVB 3HO1A 4DUZJ 3D66A 2Z2MA 2ZC4A 2NUUG 3BGFA 1H2UX 4B9TA 2BBEA 4YB1P 2DCLA 4ANCA 1I51B 3RTVA 3EICA 4CLYA 1BMQB 1VQ7S 3D28A 2CJKA 2PD1A 1NK6A 4JYAJ 1WHWA 4HR2A 1RDRA 5JXSA 1DLOA 1HBNB 4CO0A 2YNGB 5HVHA 2XEXA 1X4EA 5ETKA 2ZHAA 1BE4A 1ACMB 5F3ZA 3IC1A 3DRYA 3LP0B 2R7VA 4KAIA 1Y10A 2MYFA 4ZLNA 2BE2B 4EK2A 2ZH6A 3AXMA 4H4MB 5KT4A 5J2QA 1T3OA 3VWSA 3ZTPA 1RWNB 2A0FB 4E8UA 2HZAA 1I1GA 4Y2IA 4PG4A 3MD1A 4YQWA 4CLWA 1RBAA 4PCQA 2HFUA 4QIWD 3KWMA 1ZS6A 1RZMA 4FNHA 4HEA9 5K20B 2D3ZA 2ZH7A 3R7SB 1MSWD 3UO0A 1OIAA 4CIOA 3S01A 4MKAA 4R5PB 4LF8F 4IDKA 4PG8A 2HWIA 3LP2B 5A8RB 3NCQA 1KKHA 3IRXB 4PUOA 2KT5A 4DR7F 3D0IE 1PILA 4KHPF 4ZCLA 3PYGA 2R7UA 4V1Ak 1NMEB 2MGZA 4A8MP 3UD3P 1RWMB 2DGOA 1VQ4S 2CA9A 3FFIB 4NXMF 1X4BA 2Z57B 1OQ3A 3OL7A 2LVWA 4FPRA 3HT3A 3CO0P 4KHMA 1Q86T 4B3RJ 3NY0A 1TFYA 3CT9A 3Q8SB 2LXIA 2BJ3A 4LFAF 2BABA 4BDPA 3FUYA 3QGPA 1TUVA 3RYLA 4YMEA 4OYBA 5HK4A 2W4DA 5IT0A 4LFCF 5F8MA 2HBRB 3M8QA 1B7YB 2AZ1A 1U1QA 2KHDA 1XIQA 3E51A 5HI7A 5KFAA 3I55S 2EK6A 1OWXA 1RHUB 5HSPA 1S9FA 1WC4A 3NBPB 2HPUA 3I5CA 1XR7A 2BMBA 1FRLA 3KG4A 3CUNA 4C4WA 2D3O1 2GCFA 4OHWA 5GAGI 3QJPA 1FX2A 4X4RA 4N77A 1IR2A 4PKDB 4CLLA 4JOUA 2I9SA 3MMAA 4LBPA 3MM8B 3ICLA 3T5JA 2O66A 4ENOA 2AEFA 2GMLA 2OPRA 5KFQA 5EDWA 2O5DA 1KQGB 2YNIA 3MR2A 1KN6A 5B0FA 4PQAA 2J0SD 4B08A 1GXUA 2XYHB 1D9AA 3I96A 2C1EB 3MMJA 5IM0A 4DV5F 2ASLA 2P2CB 3HULA 2VC1A 2ZHBA 4B3TJ 3IM8A 3G6ES 4BLGA 5HLFB 2GX8A 2CQDA 1H7WA 1CJUB 3H5YA 2ROEA 4QBUA 5F9LA 1NSAA 4MKYA 3GPAA 3DN9A 3W66A 1Y5NB 4XPCA 1J5OB 1IKYA 2YWKA 4TN2A 4DN0A 4C3LA 1RT6A 1TMMA 1N34J 1RWPB 4X66J 4FF3A 2BW2A 2GMHA 3OPKA 2KYXA 3DGPB 4TYAA 4ID8A 1MROB 1HI0P 3CJ3A 2CVEA 1CC7A 5DO2A 3PYDA 3TA0A 2QLJB 2W8LA 1N36J 1UZDA 2HLUA 2XMKA 3QJLA 1C1CA 2KM8C 5F0WA 5DQHA 1D8YA 1VIXA 4Q2LA 1WEYA 1TL3B 4Y2KA 1GXTA 2QRRA 1YQHA 4CTAA 1JX4A 3HJVA 1NB7A 1JLBA 2F63A 3SV4A 3CJ2A 4C0BA 3SXLA 4BS2A 3MTKA 4ED1A 2UU9F 2E5GA 4N8NA 4OHVA 3KLEB 4X64J 2APOA 4DQIA 1X5TA 4ETZA 5BJRA 3M2UB 2MMYA 3KHGA 3T6BA 4K0KF 3CJQA 2OD4A 2U1AA 4JI6J 1CJVA 4A8SA 3JSRA 4L73A 3EXYA 4UTGA 3NNHA 2QJ3A 4NOHA 3TX0A 1RA7A 5ADZA 1LOUA 4BC9A 3CW2C 1VLYA 1HIYA 2X51A 2GO8A 5ETNA 3QMQA 3DLBA 2JEJA 3NGKA 3CWJA 2G0JA 4DSLA 4D3GA 3TARA 1FXLA 4FBTA 2HQ3A 1SQEA 4WCEQ 3E01A 3HP6A 4FYXB 1S1XB 2IC3B 5GAHU 1NK5A 5AJ3J 4DR5F 3QGHA 3M6VA 5KFSA 3Q2SC 1RT7B 1WD6A 4IG3B 1U1KA 1LEOA 2C42A 3FEXB 1FTRA 4MAKA 4KYZA 4N5SA 2Z2YB 2G1DA 3PXGa 2HFVA 4Z7CA 5I3UA 2WBMA 3JYTB 4LQ9A 3SI8A 3H4DA 1RHRB 3V4IB 2MZJA 2FJXA 2D7SA 3B6BA 1EP4A 1R8CA 1RYSA 1IBKF 2QA4S 4EI2A 3L4BC 1DURA 1IVZA 2DTJA 4QWAA 2YKNA 1T05B 3MM5B 3MM6B 3GE9A 4X4UA 1YLXA 5AE2A 3J7A1 4WF9Q 5F0UA 4ERDA 1Q82T 1DFDA 1TV6B 4DI6A 2HBQB 1M5SA 2P9EA 3RUBL 5CD4A 3TUJC 1V5IB 1HMVB 1VISA 4QR1A 2OSQA 2ZBQA 5KFXA 3CNQP 3Q0AA 3P5BP 3K5MA 2MEWA 1D09B 1TVRB 1X4AA 2VDIA 2GVDB 2VBYA 4J9VA 2PFFB 4JI5F 3QSYB 2M88A 1G7CB 3EGNA 3W7BA 2MQPA 4OYMA 4DSEA 2DRBA 1S1VA 1U02A 2IDLA 2RU9A 3EM1A 1YITS 2R42A 4MT1A 1HR0J 2VFTA 2BVZA 2E5LF 1TUGB 1RJJA 2QYGA 2J6TA 1IKXB 5DZ6A 1X31C 4ZCMA 4USHA 3DOKB 2V4QA 3X1LB 2EKYA 4F36A 1FTCA 4FVCA 1TKZA 4Q44A 4B3OA 1QAIA 4ZVEA 1D0EA 4TY8B 1R8PA 3RRHA 4J91A 2IVYA 2KO1A 3NCPA 4ZCIA 3PFEA 4CNZA 1HBNA 2PIIA 3PRVA 3GWCA 3K17A 3K5NA 4C11A 1KLMB 1T9XA 2HBYB 2IRYA 3FEZA 2L3MA 5B0CA 3LP0A 4DX8H 1KDNA 2YQ3A 4OZ0A 1UFWA 4TXSA 1JLAB 4NASA 3FSXA 5D4NA 2BE2A 3KLHA 3C14B 1VBKA 2VPWB 2YKOA 2I6WA 4FNIA 4B9NA 4TU8A 1E6YA 1IR1A 3T1HJ 2V4JA 2DO4A 2OJ3A 3S6EA 1R27B 4CCHA 3I0RB 2GAHC 4Q7AA 2P8IA 5DLGA 2HHXA 2EC2A 3NGTA 2IBOA 1SH0A 3MHYA 2YBVA 2ZNYA 2FB0A 5GMKa 4I69A 1MW7A 3QLHA 3SSSA 1RQ0A 4CDIA 7FD1A 3KLFA 1H2TZ 4DV0J 3LP2A 5A8RA 2AX1A 2LECA 1S97A 2HZVA 2RH3A 1H73A 3SIPB 3HVRA 5KG3A 5IS2A 1I6JA 1FXRA 4Z7YA 4U9RA 1NJWA 4ZITA 4HHHA 1RWUA 1BUXA 1S76D 4EBCA 2G13A 1M90T 4LF9F 4NLPA 1LXJA 4WXWA 1X9WA 3ILIA 3FFIA 2V2KA 4JI2F 1M0SA 2DGWA 3LA0A 3M8PA 2B4OA 4P75A 1HWIA 3TZWA 5D0HA 4DV3J 1ZM2A 5J2PA 5KFNA 2C2NA 3ILJA 4LFBJ 3MM7B 4JI7J 5G4DA 2HHTA 4BC7A 2HK3A 1NO8A 3G86A 2EFNA 1YJVA 1IR0A 3MCSA 3BGRA 4BWJA 4UF4A 5C2CA 3KFWX 1Y3KA 2A6MA 1XK8A 3ELHA 1N33J 5LSLA 5C5JA 3PTWA 2ZH5A 1NPKA 2B7CB 2F9DA 2RHQB 3MTJA 1N32F 1SC1B 3A12A 1RU2A 2DGXA 3IR5B 3TEHB 1IBCB 5EN1A 1HYSB 2CPXA 2Y0SD 3C15B 2ZH4A 2DKOB 2BJ8A 1DJ0A 5GADI 2OPSA 3HT0A 4DV7J 4I6WA 1WHVA 2X1FA 1Z2ZA 1AFJA 4MYTA 1YG0A 3PW7A 2ZM6J 5LXRA 2XB2D 2EEYA 3UPFA 4ZCKA 3Q8PB 3KK3A 2W9BB 2B8PA 5HLFA 3IO1A 1RWXB 3BO3A 3IFEA 4ZN1A 4A46A 4WZMA 1VK3A 1QSSA 3QGIA 1CBKA 1J5OA 1HBMB 2FJDB 2GIFA 4QW9A 1U1RA 5I42A 2RQKA 2QA1A 3BH6B 1DARA 4ITSA 4C9DA 4LF4J 4TY9A 2BQUA 1I3OB 2JRSA 4ED6A 4ES3A 2UUWA 5C2GA 2H5IB 3AQOA 1ZA2B 1SH2A 3V81A 1H74A 1NHVA 3HHLB 5E3RA 1WG1A 5HQ8A 4P6QA 3DI6B 4B17A 4YHHJ 2RUGA 3D9BA 3KHHA 2FZCB 5FLXU 2WVCA 3R6GB 3FZ2A 3Q23A 3V2UC 2L41A 3TJAA 1JLCA 4LF5F 3DOLB 3GYXB 2MKCA 1QVFR 4N41A 2QV6A 3DDNA 4DL3A 1FF2A 1OPIA 1LKZA 3ISND 1J5EF 1XR5A 1M5HA 4DSFA 2VG6B 3M8SA 2KFYA 2ZC3A 2V94A 3ULHA 1ZYQA 1RABB 4E0DA 1SV5B 1HQUA 1UFLA 5D4OA 3A13A 1NK8A 1FWKA 2VOOA 2C2DA 1IBLF 3DLEA 2CJBA 3C16A 1HD0A 2R7WA 1XC9A 1KVKA 3VGVA 2PI5A 4DUYF 1GNKA 2AIRB 1ROFA 1SKWA 1HNZJ 2OMOA 4YS2A 3PACA 4P73A 2MPUA 2WRMA 3FDSA 2E5HA 3BBBA 2R7RA 5EGYA 1RHQB 3J7ZT 4RL1A 1HPZA 4RW4B 2J8SA 3NNAA 4P2SA 1S1XA 4O4GB 2GJ2A 4NLUA 1UPPA 4M63A 1VGYA 3H2VE 2AJ4A 4F4XA 3K0JA 2DNRA 2AP6A 2MHNA 2PT0A 3AA9A 1SJFA 1T0TV 2MKSA 3CCSS 4DSIA 1Q78A 1VQLS 2AEMA 1KTVA 2BQ3A 2N7YA 1YDLA 1UPMB 3TA1A 2LKZA 4JUZA 1GT8A 3I5AA 1TL1B 2DPIA 3HF5A 3V4IA 2DNYA 3G8TA 4YP3A 1AB8A 2BJEA 2LEBA 5J2NB 3QAUA 5D0GA 1FDNA 3ZTSA 3R9LA 3FQKA 1UWAA 2QO3A 2EI5A 1IKWA 5KFMA 1RTJB 2IM0A 3I4PA 1A7GE 1X4DA 2L9NA 3M7VA 1RI7A 1Z1ZA 4E98A 2MZQA 4U7UK 2YPYA 4JI0F 1TL4A 2DISA 3WHIA 4A8KA 3MF5A 3BH7B 1N48A 2VBWA 2W2NP 2A1BA 1S59A 2L9DA 4OX8A 5D0RA 3FBBA 1BWVA 3TWZA 1BQNA 3SYZA 1VOMA 5MLCV 2J8AA 4CT9A 1JLGB 3TZZA 3X3UA 4ECVA 1YGYA 1T9YA 1Y4ZB 4DR7J 2VG7B 1AUDA 4KHPJ 4RBUA 5E3CA 1P1LA 3O2IA 1T3NA 1S4FA 3J80U 3DRSB 5HN0A 4M5JA 4UZCA 2V67A 3OL8A 5DG9A 3EZUA 1GX5A 4TLRA 5JVHQ 4J9QA 3HDSA 1FT8A 4OZ3A 2RS8A 3H8YA 3G8SA 3M2VB 2R8IA 3DOKA 4DV6F 4NXMJ 4DPYA 5KFBA 3PVXA 1GMWD 3PEHA 4HT5A 3TX8A 1DAXA 3OTOF 2YVSA 1JMTA 4TY8A 1F2GA 2V69A 3O6QA 1CQNA 5C24B 2DR9A 4ILMA 3MEEB 1RTDB 3R1HA 4M5DA 1Q95G 4LFAJ 3M8YA 1NZAA 3DLGA 2QMUB 3N79A 3W61A 3BQ2A 4LFCJ 1UEKA 5AXLA 3VAGA 3T1YF 1U49A 4Z2XA 2KL8A 1YZ7A 1JLAA 2XI2A 1VR6A 1SUQA 2OIHA 3R5DA 3GV8B 3C14A 1SB6A 3SZ2A 5CQGA 4PRFA 4ZA1A 1BXNA 2BJ1A 3DHXA 4ICLA 3HD2A 2EBEA 1TK0A 1TKXB 4DLGA 2RJZA 2XS7A 3K8VA 5LM7E 4EMDA 3WX8A 1H98A 3I9ZA 2WSEC 4XDCA 1U7LA 1V9OA 4K4WA 1JQGA 3MCOA 3T5HA 1C1BA 3W1YC 1H6KX 3A8KA 3JS9A 1JJ2R 2XMUA 4HACA 1WSVA 4ECWA 2A2DA 4DWIA 3R8YA 1X5OA 4OMFG 1SJ1A 3C6UB 4OI3A 2DHAA 2GGPA 2HAFA 4GVBA 1UJ6A 1RT3A 5FJ4A 4RZRA 2VQEJ 7AT1B 4DV5J 5J2MA 3FCVA 1YX2A 3CJ0A 3UN3A 1EJ7L 3JSYA 1WWHA 2XQCA 3FRZA 1FRXA 1WC0A 2VICA 5F8LA 3FSYA 1N4LA 1RKIA 1E6VA 1IKVA 2E1RA 2IM2A 2G2ZA 1UEUA 1S1UA 3HD1A 2CFXA 1P8GA 3RRKA 1C4CA 2W01A 1A0OB 2SXLA 4LREA 5JJBA 3MMCA 2AT1B 3MI7X 2QLWA 1S6OA 2KRBA 1O51A 3LALA 8RUCA 2KKHA 3EZOA 4G1PA 3H59A 2FLPA 4I64A 2ZOMA 3K7RA 1U1PA 1NH7A 3JTOA 1WSRA 1XBWA 4DPOA 4DSKA 1VRUA 4Y65A 5IT9U 2ZBIA 4I67A 1U09A 1S0MA 1KNZA 2W4PA 4GO7X 2CQ1A 1FHTA 4ELUA 3IGNA 4W98A 3BPDA 2DEIA 2ZEJA 2UU9J 4ZVUB 1WKJA 4CLUA 2IA0A 4XAKA 4KRWA 3DFEA 1RWVB 4WKRA 2R8KA 4ID5B 3KDNA 2JC0A 2CJAA 1UTAA 3V6DB 1RE1B 2ROPA 2PMZD 2MJUA 3EX7B 4JI3J 2EW9A 2VC0A 3B8HA 1BGXT 4K0KJ 4KC5A 1P1TA 2DNOA 1HYSA 2B5JB 2RIJA 3MR5A 3Q83A 2KG1A 4QU6A 1XTZA 2E7VA 2KT2A 2CPHA 1S7HA 2Z4PA 3LPEA 2DNMA 4A8FA 2IM1A 1B64A 3BQ1A 3I87A 4O3RA 4L72B 4B3SJ 2HK2A 2AJ1A 1OMSA 1TAQA 2J7WA 3HM9A 2N4CA 4I2PA 4J9OA 1TKTA 3CGIA 3H5XA 5A0YB 2RS2A 3LOUA 4C97A 2YTCA 4GVLA 5LT5A 1DTTA 4R0JA 2DGUA 1U8SA 5D77A 2BANB 2GA7A 1NDPA 4C0OC 4OFZA 4CO1A 2N4DA 1HBMA 1VLOA 1K1QA 4U95A 1TZ0A 4OZ1A 2EFOA 1XNRJ 4P7TA 3E3XA 1N5VA 1WF1A 2M52A 5F8IA 4K4VA 3IWNC 1S6PB 3C6TB 2K7KA 3EE3A 4OV1A 2X7IA 2DNNA 1WF2A 4O3NA 4HDGA 4XK8C 4JBCA 4YFUA 4IG0A 4UOHA 2CNNB 1QAJA 1HBUA 1I5OB 1SVDA 3W2WB 4DQSA 1QLNA 4RW7B 3HHLA 2F4VF 5EX3A 2BW7A 2IVFB 1YJRA 1S72S 1NJXA 4DR6F 1IBKJ 2HIQA 4ZVGA 4DR1F 4USKA 3OFGA 4OYAA 2HMIB 3QRQA 3Q8VA 3CD5A 4ZIWA 1XN9A 2JLFA 2IRXA 4QIFA 3FKBA 1JIHA 1S1WA 4CH0S 2IJRA 2WW8A 2FY8A 3HVWA 1U1MA 4NCAA 4PQUB 2HNZB 3ZTRA 1WF0A 2VD3A 4B9LA 3WBZA 3M30A 1OSCA 2QL9B 2ZJRQ 2MLXA 2Q66A 3AD7C 2YWFA 2MQOA 1HLWA 1VYAA 1ZTWA 1OSDA 4FKYA 2VIHA 2ZH9A 1PAUB 4B3RF 2WOMA 3T6JA 4ZLJA 4CLTA 4WE1A 2YX4A 3PYFA 3GTYX 1PJ6A 4JI5J 2BKPA 1YK9A 2OKQA 3A8IA 2Q43A 2FC8A 4ED4A 4KV8A 3VGUA 2LU1A 2WCXA 3TZXA 2VKZG 2DNGA 4RU2A 2Y1IA 3AXKA 2PE8A 5F8HA 1M5VC 2DXFA 3L7OA 4LUBA 3IWXA 5I4MA 4ECRA 2WSCC 2VG5B 2NUHA 2CNOB 2WZ1A 3HVAA 2Z8QA 1MMLA 2AGPA 4RW4A 3TR5A 2OELA 3HKZD 2HFZA 1SJ3P 4LF6F 2JEGA 3P96A 4ANEA 2HVEA 5KFFA 5HMXA 1BC6A 3WQPA 2BE7D 2DYAA 1D9DA 4DPUA 3IBWA 4J9RA 1G2EA 2IYGA 3LP1A 1RAGB 1FDBA 5C25A 4ZP8A 3TJ9A 2HSEB 3K59A 2V8DA 1NXIA 1SXLA 3HSZA 1EX8A 2P9CA 1SKSA 1Q7YT 2O01C 1DQ8A 2WBRA 3H0PA 1NPPA 1NU4A 5A8KB 3HHLD 2V34A 3BM7A 1UVIA 4O0IA 3OSPA 3D5MA 2HHWA 5J2NA 3CD7A 1K47A 2JVOA 2UXCF 3D68A 3IGVA 1DRZA 4ED7A 1VHFA 1YBUA 4FXVA 5EWFA 1EB0A 2Q6BA 4DCOB 2QEXS 4DUTA 4L6V3 1N5TA 1RAFB 3BO2A 3H5UA 4HTIA 3DNCA 1RAHB 2XG8A 1ZOTA 2LQ8A 4ZP9A 2YWWA 2K3KA 2DEJA 3VTIA 1KBRA 1XNQF 1WOSA 4NA3A 1CJKA 2DBBA 4CLSA 4F67A 2B9YA 3CJ8A 5B0DA 4UY8T 1BQMB 3SV3A 2WONB 3CJRA 1NK0A 5LMNF 2C3UA 3O8WA 3TOQA 3EGVA 1Z2LA 3TNVA 1FVSA 1LWCB 5D0EA 3IS9A 2OPPB 2I38A 2VG7A 3AT1B 1FKOA 1HQEB 3KG1A 3J7Z5 1S79A 2R8HA 3OTEA 2W2OP 4F3OA 3K5PA 3FC9A 2M0GB 4F4ZA 1R3NA 3L9ZA 2ZH1A 1JXLA 2KFNA 2HFSA 4UQGA 4CRJA 3R5GA 1NDCA 4ZJOA 2R7QA 2D3UA 3QIPB 4JI2J 2KTQA 2EFPA 1APSA 3LWMA 1HD1A 3KHRA 2NZCA 4HTJA 3PCOB 1RADB 3VGSA 2CWXA 4RNFA 1S6QB 4IH5A 3SCIE 3CE8A 4Q0BB 2WAQD 3OHAA 2DNKA 2XS5A 1Y7PA 4JI1F 1XR6A 3I6PA 2JX2A 2DVIA 2CWKA 3GLJA 1JKHA 1NKCA 3UWTA 1RT1A 1R43A 5CZXA 1XJWB 4OI4A 3PX0A 1N32J 1PJ7A 3M8ZA 1JXVA 2AHOB 4ILLA 1FFSB 3WIVA 3D1QA 1FVQA 5AJ3F 4GMKA 1TKXA 1UKUA 1YJTA 3TVYA 4F4WA 3GIJA 3M8WA 2E7XA 4QOTA 5KFIA 4KHRA 2LXUA 1FJGJ 3EVMA 1DLOB 3MUMP 5K14B 1WC6A 3SDEA 4J9SA 5SZTA 3R5CA 1K8AT 3R27A 4DFKA 2K7JA 2BYCA 4WIIA 5GAGU 1SKRA 1S1TA 1G3OA 1K0VA 2W4CA 3H20A 3LANA 3ZTQA 1GX6A 1NBEB 3CB4A 4CLKA 3PZPA 3TQEA 3AODA 4FYDA 2HS4A 2AWZA 4FXDA 5J2QB 1MMDA 2RKIA 3B54A 5DG8A 1DTQA 3IBFB 3B4DA 3DRXA 2LDIA 3LGMA 4ZDNA 2VJVA 2M8DB 2LYVA 3GIIA 2M4MA 1H38A 2DRAA 4ZVOB 1VQ6S 3DRPA 4NLSA 2BJ9A 3PX6A 4EUVA 2JLGA 4ZKAA 4LSNA 3VAHA 2DH7A 1HFEL 3TJ8A 5IC4B 2G2YA 1FEHA 1Z4UA 3MFHA 3TQ1A 1FDDA 1C0UA 3M1VA 4AFFA 2MSSA 2HVHA 4Y2CA 2P6TA 3H2LA 1LWFA 3IXQA 1O5JA 3V6KA 4PUOB 2NCKL 5KTQA 1F5BA 1Q53A 3N9UC 5HROA 1HNIA 1SJQA 2MZRA 1HR0F 4L74A 4LF5J 1BQXA 4YUDA 3BR9A 2Z0GA 3MPVA 4TQSA 2FD2A 2VV5A 2XBPA 3O5TB 2DGTA 4OZLA 1VQPS 4DFJA 1FRIA 4X4QA 3UN2A 2HVIA 5A6WA 1DQ9A 3EJMA 2MY7A 4DHVA 4M5IA 4O4RA 1TFWA 1M1KT 1IBLJ 2CQ4A 4DF4A 4I7FB 2DR5A 4NLYA 1Q79A 3ZZUA 4EWTA 4DUYJ 2GHWA 3NP5A 1LWEA 1DHMA 4U67Q 4ES1A 2FJEB 3CCUS 3SSQA 3ZO7A 3ILOA 2KVIA 4URQU 4QWDA 1IQZA 3RAXA 2KXHA 1F9FA 1ZZNA 1S0OA 3M2RA 3W9HA 4UT4A 2B43A 4Y00A 2VFSA 4RUHA 3DHWC 2O3DA 4JI8J 2PA3A 1C0TB 1BY9A 1X0FA 1Q5YA 4W92B 2R8JA 2BDPA 3MMAB 3OXLA 2BJ7A 2UXDJ 1CVJA 1JWWA 2OPRB 5KFHA 2A3JA 2F4FA 1EKRA 5KFDA 1FNMA 2JFDA 2BOAA 4WXOA 2QTWA 4QYRA 4OJ3A 3BO4A 2XY6A 4RW6B 3HCXA 3CDAA 4ZS6A 3W2VB 2UUCF 5IM0B 4DV0F 4ZP7A 1HBOA 3TAQA 2KH9A 2DR6A 3A8JA 2CNKB 1U26A 2ASDA 1IKYB 3PKMA 3TO8A 4PXDA 4JI0J 3PFOA 4Q2MA 2B9XA 3EVWA 3TUPA 1W25A 3AFGA 3QAEA 3NRBA 2PDAA 1WC3A 4XPEA 1R89A 4YR0A 5KFYA 3QO9A 2PFDA 4BCAA 1JNRB 3AY0A 1HWUA 1C1CB 5LJ5Y 2Q6CA 4IOCQ 4ZHRA 3UR0A 4P72A 1KS2A 1HQ2A 1VBYA 1RXOB 4M5GA 4LFBF 2XMWA 3GYNA 3GV7B 4OZJA 4ZPVR 5B0GA 4CTAB 2RB7A 5A8WA 4WKYA 1JLBB 4NZ7A 1ZAVA 2VG5A 2V0NA 4OYZA 5K9FA 1H7XA 2NXUA 4KKOB 3H98A 1N33F 4ATNA 1XWLA 2RDJA 2GFFA 3G6VA 2RQ4A 2J9CA 3GJRB 4USJC 3GSIA 4X4PA 4IRCA 4K2XA 2HLTA 1IJEB 3M9NB 2KRRA 1NAQA 1KQKA 2OEMA 4IR9A 3LTOA 1Q81T 1VQOS 1VQMS 5CABA 4O3OA 3LGNA 5A8KA 4QR2A 2NQPA 4GC6A 3NEKA 3T1YJ 2ACYA 2XY5A 2ZM6F 2DK2A 3ISZA 4WJBA 3MD3A 3D67A 1PCAA 3OTBA 4FF1A 4U7UD 1UMJA 3BPSP 1C4AA 4OYIA 2OFHX 3U02A 3E01B 1UVLA 4LSLA 3FSIA 4M5MA 4ED8A 1CQMA 2MKKA 2J6UA 1UWBA 2M9KA 4OI1A 1AXQA 3W3SA 3DU6A 1L3VA 3GFHA 4I6YA 4DFPA 1WOOA 2LQ9A 4DR2F 4NI2A 1JLQA 3FRYA 4WU3A 5I3UB 3BR8A 2X3DA 1YKWA 2EG1A 3JB9k 4UUXA 1NSQA 1WC5A 2LCWA 4QPXA 2EPIA 1EP4B 4HYKA 1HQEA 2MSTA 4WP9A 1SQGA 1FEEA 7FDRA 4J9UE 2B0GA 2F3JA 1RAEB 1JK9B 1PIEA 3MR7A 3J81Y 4M5NA 4YR3A 1HL6A 1S4EA 1LWXA 2HNYB 5J1PA 3KLVA 3JTNA 2HWTA 4MIWA 3C3LA 4PXBA 3VVTA 1TL5A 3QSIA 2FHOB 5AXNA 2NR0A 2F9JA 2B6AB 1KOHA 1S0VA 5L38A 1X8DA 3H2UB 3TEGA 2AU0A 3CD0A 5HJYA 1XQIA 2B9EA 3BF4A 5IWAF 2R7SA 3NMAA 4YB5A 2CVIA 3MPYA 6FDRA 4GRSA 3JXOA 4I6AA 3FNNA 1HNZF 3J7YU 2BJDA 3H5SA 3I4HX 5EUHA 5ETQA 3THTA 3GMGA 4USVA 2EVZA 4I68A 3RW6A 3EUNA 1RBOB 3RAQA 2LXFA 1HA1A 1TKZB 2NLWA 4B3OB 1T9UA 2R8GA 1B4SA 3ILLA 2FHMA 2CDRB 4UY85 1RYRA 2NPFA 1EHWA 2XCAA 1UCNA 4ED0A 5K14A 4KB7A 4C11B 2VU5A 3QT7A 3CCLS 2CAJA 4F26A 2D3OR 3OR2B 3CVKA 4TLQA 4ECTA 3VQSA 4B9VA 2ZJQQ 1ELOA 3PW2A 1ZETA 4PPDA 2EG2A 2Q79A 2XS2A 2PN6A 2OH2A 2J5AA 3GYGA 3V5RA 3KLHB 1HWLA 3UNYA 5GADU 4O44A 1SL0A 2DIUA 3Q89A 2WW4A 3W62A 1E6YB 1QSYA 2XO6A 2V4JB 2XHCA 4ED2A 2YKQA 3KYLA 3RBXA 3MGJA 5EHHA 3L95X 2V68A 1TELA 2JOQA 4DX6A 4QYZK 4TNOA 4ZVPB 5KAKA 5KFUA 1U0HA 2IFXA 1SCJB 1VHIA 3TAMA 3FMBA 3QLHB 4CH1A 3KLFB 3HMJG 3JQKA 2FVRA 2F4VJ 2O67A 1CLFA 1KTQA 3TW0A 4DR6J 1LK5A 4DR1J 3HZGA 2J7KA 2FZGB 2X1GA 1HHTP 3KDOA 4PXEA 2UXBJ 2MDAA 3BGLA 4R25A 4NZ0A 4BHQA 2D9OA 2XYPB 3CULA 2GQCA 1NJYA 1U6FA 5J1NA 2C22A 1B0TA 1S9EB 3D6FB 2KJWA 2VKRA 3ZZRA 4EYIB 5LJ3Y 2XLIA 2XHWA 3HKWA 1K1SA 4N7TA 3HX9A 3QZ7A 1G4CA 3ISNC 3H4BA 3QFWA 3AD9C 2HQIA 1DBDA 3ENQA 3M8PB 1ZPVA 3DRRA 1G6BA 2RILA 3MMBB 1ZM4A 5J2PB 2GAGC 1UL3A 1XMQF 4W4MA 2UUBJ 4DF8A 4K8RA 4I7FA 1HNWF 1QM9A 1WI8A 1NSPA 4LBIA 1N5YA 1SJRA 4RX6A 2MQMA 1VQ9S 2RSQA 2X1AA 1TP7A 4X62J 2VOPA 4XTTA 2RRAA 1AZSB 3BGRB 2DT9A 2DIVA 2J7UA 4LF6J 1QAXA 3NGUA 1EQ0A 1EKSA 4CQ1A 1OYEA 3MAAB 5H9EK 2E9RX 2CQGA 4OZ2A 4UW2A 1RCXB 1D3WA 1FXDA 1FK9A 3M6XA 1C0TA 1SL2A 4WPAA 4JV0A 4YOEA 2DHHA 2J9EA 4O3PA 3CJKA 1EETA 5BYQA 4DL5A 2ZOGA 4B3MF 3OHBA 2OPSB 4LT6A 2ILZA 3DM2A 2E7WA 4QPTA 4ZPTR 5IT4A 3MCMA 4K4ZA 4F3QA 4K4YA 4W90B 4F0KA 2CPEA 1LW2A 4RW6A 4ETXA 1CC8A 2VQEF 3W2VA 2UXCJ 3HZEA 4DG1A 1N8RT 3KK3B 3PV8A 1R0CB 3K2YA 5HP1A 2LMIA 4CT8A 4A48A 1HNXJ 2MQ8A 5K8NA 1CULB 4GKKF 2R7XA 3JSBA 3SSRA 1RCOB 3NS5A 2IJNA 3UN5A 3NOGA 2HQCA 5I42B 2YQ0A 4U96A 1XNQJ 1Q8IA 2IY5B 4DQQA 2WB4A 3EVOA 4B9MA 2R2TA 3QT8A 3F41A 1SC4B 3W5XA 2ILYA 2V2VA 2DGQA 2FHJA 3Q8UA 5LMNJ 4YY3F 2QA2A 3GB0A 3OVSA 1TQLA 2HS3A 3LO3A 4DR3J 3PYEA 3V81B 3BB5A 4ECXA 3SCKE 3IR7B 4L76A 2Y3YA 1TK5A 5AT1B 1V3RA 3EMTA 5L9NA 1R8AA 3KLIA 3D7SB 1RT2A 3L09A 1R6VA 3OFHA 3PNIA 2FJVA 3K57A 5D3GA 4LRDA 4ZPDA 5KG0A 1H2VZ 1JB0C 1RWOB 5THWA 4KKOA 2WVBA 1JLCB 1QTNB 4ZP6A 5D15A 1W2IA 4NLOA 2G0IA 5HAOA 5ETOA 1Q8BA 5DLFA 4JI3F 4G65A 4JV1A 2P6SA 4OLPA 4PG6A 5DM6Q 4FS1A 2MKJA 4I56A 3MFIA 1UA0A 1AW0A 2V4RA 1HQUB 1F5AA 3AHPA 3PG9A 2LEAA 2VFVA 4J9MA 2AGOA 4OHXA 4NEZA 2DY1A 1FKAF 2YNHA 4ZVQB 2XGPA 3TUZC 5KFRA 4NLDA 4NYOA 3GFYA 4JI1J 2IIHA 2DXEA 3DLEB 4B3SF 4HI1A 2LA4A 2EBGA 3KNAA 3P8BB 3GILA 3C16B 4LF2A 2QE5A 4DV4F 1WHXA 2CQPA 3QWUA 4FPIA 4Y3CA 1VI7A 3G71S 3GJQB 4DL6A 2Y8WA 4NCBA 1WACA 1HPZB 2HGMA 2KHCA 3ZZTA 4U7CA 4LF7J 4K59A 3QWPA 2Y8YA 5DDPC 1QVGR 2ZD1A 4LR8A 2NSBA 1F5CA 1JLEB 1XNRF 1VQ5S 3D2WA 3OVBA 4KGXB 2YX7A 2DY9A 2GO9A 3U1LA 5J1EB 4DCJB 2HQDA 2R2UA 2FHJD 5K8MA 3D0GE 4DMZA 4A8XA 1LV5A 4K4XA 1CPZA 2C2OB 3KMSA 1F3FA 2FGOA 5C42A 1M1GA 2FVQA 6AT1B 3D0HE 2XNRA 4CI0B 4RUBA 1YJUA 2DR7A 1RTHB 4TKTA 3OFEA 4KGKA 3K5LA 5DS7A 2RDIA 1W2BR 2LQ5A 1IKWB 1U4BA 4P2MA 3PW5A 1PSDA 3D3CJ 4NMXA 5IV4A 2D69A 2AV5A 3CJ4A 3KLGB 3M05A 5DGAA 2QIFA 4CYUB 3IRWP 2BQRA 2HNYA 1KVIA 2E9ZA 1A9NB 2HNDA 3MCNA 2ZNZA 3ITHA 4ZJQA 5EX0A 2AX0A 3CDEA 4OJHA 4PYDA 2B6AA 2CNLB 1URRA 1SIWB 2B4UA 1BQNB 3S1TA 4A8OA 1A6LA 4UUWA 1T03A 3DU5A 1VBXA 1WEZA 1NCLA 2Q3PA 2CG4A 1QDUB 4RW8A 2RD5C 2HHVA 2ZE2A 1RHKB 1IUJA 5IQQA 1YJNS 4K2JA 4OI6A 2VA3A 3IBCB 4C8ZA 4IYQA 3CCVS 3OLAA 4B9SA 2X3GA 4RNOA 2IHR1 3BSNA 1CG2A 4OL8A 4YN3B 2VUGA 2XZTB 5T7LA 3QYYA 4ZPBA 2Z30B 3U7JA 3BQ0A 1S57A 4M5DB 2V8VA 3DGVA 2XMMA 2IM3A 3DLGB 2JWNA 2DB1A 4K50A 1M5PC 3R5BA 4J7CA 4K5SA 1ZM9A 2FZKB 3OR2A 4DS4A 5CCMA 3NWGA 1KSPA 2ZBPA 8ATCB 2GIQA 4LRCA 4KO0A 2H54B 4MK7A 1FFGB 3CO9A 4NXNJ 3GSDA 3M6WA 1N6QA 1HI8A 4DDFA 2R7OA 1SUQB 3KK1A 1FRKA 2DHGA 3F0NA 3PJ9A 4U8YA 3ZNJ1 3UDLA 1M5KC 4ICLB 1REVA 4WIQA 2QZ8A 3GQCA 3MR6A 1LNQA 1T9TA 3CCRS 2PO4A 4DL4A 2RE1A 3IR6B 2V6AA 3OT9A 1HHQA 3F73A 2OPQA 1C1BB 2OEKA 3W8GA 2QFIA 3CPWR 4HACB 1WI6A 3E2EA 1SIZA 1LQ9A 1F60B 4F4KA 5DM7Q 4IOBA 5F8NA 2GGPB 4GVBB 1R7IA 1RT3B 1X4GA 3BEGB 2UUCJ 4CWBA 4Z37A 5J2MB 1CS4B 2C2RA 5C7PA 4URGA 2YX1A 3W60A 3RAMA 2AEJA 1RGVA 3CD6S 3D1OA 1DQAA 2R3VA 1WJ9A 1E6VB 5L1IA 1IKVB 3B78A 5KFVA 4NLWA 3NGSA 4X4NA 4V19J 4IRDA 4FZVA 1S9EA 1S1UB 2KT3A 5CZVA 4IUFA 3FJ2A 1C2PA 3PY8A 3CDBA 1NDLA 4X65J 5L1JA 5M2RA 1KQFB 1RAJA 2V9KA 3MMCB 5HJXA 3N5FA 5KFKA 2IVMA 4AYBD 2X1BA 3J7YI 4C3KA 4L3NA 3MMBA 4FYYB 4EGLA 4J90A 3DYAA 2R4FA 4AE5A 4H4KC 1UEVA 1VRUB 3US5A 3N28A 2MXYA 5HANA 4RW9A 3BKFA 3D3BJ 1JJCB 4Y0FA 2LFVA 1YBAA 1VC5A 2DR8A 2AMCB 1AZSA 2FHKA 4U8VA 1EIYB 1NKEA 3UDEA 3Q2TC 1U1NA 4Y34A 3R3TA 5KFTA 4NZ6A 2GZOA 3OR1A 3MAAA 3NGDA 5B0EA 4PG7A 3R7BB 3VF0B 2HW3A 2GS8A 3DLKA 2QX0A 2K3IA 5FDLA 4QWBA 1L3KA 1M5OC 3WDOA 4F0HA 2BRKA 2V8PA 3ONQA 4Y28C 3ADAC 4KPYA 3HHNB 1FJGF 1Y0HA 2IPOB 1VRTB 1D1UA 5KT7A 4H54A 3HHLC 2BV3A 2WK4A 4I2PB 1NUEA 1TKTB 3TAPA 1T8EA 2FLOA 1R6YA 3RB4A 2C2MB 1DTTB 1S9GB 1OY8A 3VCDA 1X9MA 3LF0A 5ETVA 4NA1A 1CULA 4USWA 3A4TA 2O1PA 1O6XA 3OUYA 3KG0A 5ETSA 3W64A 3DOMA 5HMYA 3SBMA 4DV1F 2ZBRA 2I5JB 4MJKA 1Q16B 4B9UA 1BHNA 1RLCL 1KONA 2IDEA 4DR2J 4NMLA 3LGHA 1YI2S 4P2XA 4K4UA 1WNEA 1RAOA 2CKWA 1GAOA 1VIOA 4IG0B 5DJBA 3MEDA 4G1QB 3GV5B 4RUAA 3J81j 3PRDA 1HBUB 2HAIA 4F25A 4LRBA 1NKBA 1TL7A 3EDRB 1WHYA 1X0PA 3CDWA 1QE1B 1V3ZA 1RTIB 2XZWA 2MZ1A 2QLBB 5D78A 3ZZOA 2JDJA 3PEJA 2H4WB 1K73T 2KDOA 3U1NA 1S1WB 1SI9A 1XMBA 1UVMA 1IN0A 3M32A 4TU7A 1NDKA 5JUMA 4R8UA 1XERA 1YJ9S 2HG4A 2IRUA 3M30B 1NK7A 3CXCR 3M4XA 3MEGA 3W8PA 3UCZP 4B02A 5KOXA 3PJWA 1FO1A 2WOMB 1UVKA 2H65B 1ZH5A 4WE1B 3NLCA 4HKQA 4LJMA 4URSA 3ZFVA 3ZNUA 2F8MA 2J9DE 5IWAJ 4UQTA 2CJYB 2L48A 3OJUA 2PMWA 4KV8B 2BZ2A 2XY7A 2JC1A 2AGQA 5EWGA 5HQLA 3O1LA 2YWGA 5DGBA 4USUA 4F2SA 1TUWA 3OBIA 4DEZA 2BR0A 1HW9A 3MM9A 4HL9A 4WFAQ 1H3DA 2POKA 2ZUAA 2CPYA 4L3KA 4FN5A 1JLEA 1FNOA 4DR4F 4DS5A 3IAS9 3LP1B 4JI8F 5C25B 2FPHX 1AROP 5J1EA 3GONA 3H42A 1PC5A 3AAWB 4MMOA 2EXUA 2WVEA 1NNDA 2F5GA 2UXDF 3KJVB 2DGVA 2M2BA 3QBCA 1S10A 1KR4A 2J0XA 1BLUA 4IO9Q 3OTDA 2ABYA 1N88A 1HNVA 1RTHA 4MTPA 1Y00A 1NB2A 2MZTA 2Q1LA 3HK2A 2F8HA 3D4JA 3TUIC 5HBMA 4M8LA 2LEPA 1G1XA 2GQ2A 3LUYA 2H5JB 1SKUB 2VHGA 1R0AA 1PKUA 4RU9A 2QG9B 1SPBP 5L1LA 1IM6A 2OGUA 2XCPA 3KLGA 4CYUA 3QIDA 1RWWB 4C6AA 4A8YA 1UFKA 4WTOB 3MOZA 1CJKB 2CPJA 1VQYA 2A2CA 2NS1B 1L3UA 4NLTA 2KXFA 3MXHP 2BM0A 1FE0A 4WWSA 3G6XA 3OD2A 2AF6A 2V8GA 3DCAA 5B7WA 2H51B 3ZZYA 3T9ZA 3EYZA 3CCZA 2ASYA 3IS9B 2LDYA 1FKOB 2XMAA 5HO4A 3CCJS 1S12A 2OEJA 2H4YB 4ECZA 2DNQA 1YSJA 2DO0A 4N8OA 3PW0A 1WEXA 2EK1A 1Y9OA 1KP6A 5K5MA 1XMOF 4UOGA 2NXNA 1IQTA 4KFBB 4DV2F 4F2RA 3D6MB 2V2ZA 1XMQJ 4XIUA 3I82A 1W26A 1HNWJ 5B0AA 2RAQA 2CZ9A 2XTJP 1O0PA 4WP8A 3SCJE 5IFMA 4MFBA 1JLFA 2L08A 4IO1A 4PEOA 5CYMB 1GXLA 2FC9A 3AJ1A 4FS2A 3MDFA 1WC1A 3H90A 2UUAF 1JKHB 3QT5A 3QPIA 2UV8A 1RT1B 4OHZA 5GAEU 2M70A 1ZTTA 1KWMA 2CQHA 4OX9J 3ETOA 1IBMF 1RBLA 5F41A 3VAKA 1Q5VA 5ETLA 1S99A 1GMVA 4CO4A 1XEZA 3C8YA 2N7CA 2QLFB 1MWYA 4KJIA 1J27A 1UZHA 1SH3A 4MK8A 2UVVA 3SFUA 4IKAA 3CJTA 1MG7A 2OMLA 3W63A 4PPZA 4PWUA 4KIAA 4B3MJ 2CJQA 3MAHA 3SDEB 5DDOC 4ZVFA 2UVRA 4OZNA 2I2YA 1VDHA 3DDIA 1X60A 1RHJB 2V9WA 4ED5A 3CIZA 1QJHA 1S1TB 1CS4A 3BDEA 4LBHA 2ACMA 5KFWA 4NYPA 2NPIA 4ZVTB 4KGVB 3EPGA 3LPYA 4PXCA 2XZDB 3BSCA 1KVJA 5K8PA 4GKKJ 2RKIB 1DTQB 1NHUA 3CJSA 4NYZA 1CJTA 1OJ4A 2MQLA 1WOPA 2GMJA 2B56A 3IM9A 3KOAA 2OI2A 1ULRA 2QMXA 4FP9A 2ZZMA 3MR3A 3PO4A 4F8RA 3FMWA 3DRPB 2Y9HA 3B4MA 1AYEA 2XSJA 5CYQB 2RF2B 2KM8B 4YY3J 4RPFA 1HWJA 1UW9A 3G2XA 4IR1A 4LSNB 3UD4P 1Y5LB 5DRKA 2AKWB 4ER8A 2FLLA 2I1RA 1C0UB 3M1VB 2PEBA 4FDFA 3QATA 4WP3A 3PDNA 1LFWA 2AJ0A 1LWFB 3L7PA 2GNKA 1BWEA 4DN9A 3RBZA 1WG4A 3RU0A 3UD5A 4HHJA 5T41A 2KN4A 5HROB 4G1IA 4U6PA 2FUG9 3UW1A 1X7VA 1HNIB 3RGIA 4C8YA 2OSRA 2GVZA 4ALZA 1RA6A 3HSDA 4OX6A 4EZ6A 3NCRA 4NX9A 3HJFA 1PO6A 4Y6IA 4FF2A 2IYIA 1X9SA 3PIPQ 1WELA 3G82B 1F9EB 5E0OA 4X84A 3QT6A 2HKEA 1RSCA 4QJVA 4EU0A 3HFZB 3SCLE 2CG8A 2D1CA 2RMLA 1EQMA 4OYOA 1PBAA 2XLKA 1X5SA 2R2SA 5I3QA 2C2EA 3HVTB 3HHDA 1VRTA 4P52A 3POTB 4DLEA 2L9WA 1V5VA 4F0MA 2QYCA 4DV4J 1MU2B 2UP1A 4N47A 1LWEB 2QFJA 1U2RA 3MPUB 1K9MT 3EGWB 1S9GA 1VC0A 3NOCA 4AQYF 2KI2A 3UCUP 1S6UA 2YWHA 3TRGA 1VC6A 2W2QP 4IH7A 3M2RB 2ZZNA 3CC4S 1AFIA 4FBUA 1RHMB 2I5JA 2BA9A 2ERRA 4DX5A 1OS5A 4NPOA 4DU7A 2YPZA 2E1PA 3I0SB 2YNFB 1Y5IB 8AT1B 3V6JA 2HIYA 4HHUA 2CIMA 3OL6A 4G1QA 2QL5B 2ZDPA 2EFVA 3C2PA 4RUCA 2OLWA 2E5JA 6FD1A 3GG1A 4ILRA 4KPCA 3SFGA 4IFYB 3ET6A 5KG6A 3LQVA 3D1HA 5D6GA 4F7VA 3NL0A 1QE1A 4C3MA 1RTIA 1AUSL 4TVAB 2W9CB 4IFVA 1T95A 2HWHA 1HBOB 3NKYA 1VMBA 2JLEA 3IA0A 2NYHA 4QR0A 2UXBF 1KHVA 5DQIA 3AJ2A 3EXCX 3HSGA 4N76A 2HZCA 5CCLA 2K1RB 3W9JA 4A8QA 2R7TA 5B08A 1FE4A 3NNCA 3QO9B 4IQXA 1QY7A 1KOOA 2IMWP 5D8HB 4QQBA 2MQNA 3N5BA 4DXLA 4NRTA 1UVJA 1HHSA 9ATCB 2ZKUA 3ZXWA 4ZHRB 2RVJA 4XO0A 4WFXA 2YNGA 4IH6A 4OJ1A 4WFBQ 2ZVSA 2MKIA 2YH0A 1P9QC 2UUBF 2UVUA 2R2RA 4N56A 1LXNA 4MH8A 2LU2A 5A8WB 3RW7A 2MZSA 2DNPA 4QYZJ 1M1HA 3PHTA 4X62F 3I56S 4H4MA 1Q8KA 2OFGX 3CMAS 3Q22A 2BUNA 3AJDA 3ENAA 4TQRA 5E2QA 5KG1A 3GIKA 2FY1A 2YH1A 1QUVA 3M9OB 4ZLPA 2ALZA 4JV2A 5CH7B 3CMES 3G6YA 4QIGA 4PR6A 4P71A 4A47A 4ECSA 1S49A 1NK4A 2VASA 3KJVA 2W2PP 2HURA 2B51A 1T94A 1VFJA 3GR1A 3PIOQ 4JV5F 1BD6A 2M5YA 4ELVA 3LAMA 4OJGA 3GG0A 4R5PA 2AD9A 3FGVA 3B82A 2CRLA 2E1AA 1U45A 4X4OA 2ZUGA 3IRXA 1Q8LA 1KFSA 4EO8A 3KJFB 2CDQA 1ZM3A 3LAKA 3M8RA 1YJWS 3NWRA 4I0WA 4RBTA 2HHUA 2C3YA 3MOJB 3T41A 1HNXF 1N0UA 4NLRA 1WDTA 4LSLB 2KB2A 2J0QD 2EFGA 5GVQA 5CD4H 1UWBB 3BBCA 3GIMA 5KFGA 2AJQA 1X5PA 1KEKA 2GHVC 3BGOP 1VBZA 4LR7A 2JJ4D 2HHHF 2GC8A 3PR4A 3U27A 2HYIB 5E3QA 3WC0A 4IQMA 4NI2B 1JLQB 1IWGA 4PABA 3CCES 3P3DA 1NJZA 4DR3F 5H9EJ 4OI2A 4GKJF 2CZVC 3T5LA 2ZBCA 3DLLQ 2HS0A 2DGSA 5AXMA 1YJ7A 1NSKL 3P45B 1B0PA 3AH6A 1YTYA 2HQFA 2JHEA 2HHQA 4WBFA 4CZCA 3PM9A 4CM2A 5E5NA 5IXUA 1WORA 4HVZA 3NBPA 3CDUA 4DPXA 3FZBA 1GQEA 1RUSA 4KFBA 3TI0A 1RAIB 1TAUA 2DNLA 3MM8A 2K06A 2OTJS 1JJHA 3BGUA 1PJ5A 2YXLA 1WG5A 2HRUA 3GJTB 1UW4A 2IAJB 4J5OA 3BJYA 4Q45A 2M3DA 1TU0B 3W5ZA 4YEAA 2XYGB 5KOWA 2KXNB 5CXTA 2C3PA 5H9FK 4ZN3A 2BM1A 2HRYA 5CYMA 2NXEA 5HATA 2MKHA 3VAJA 3GU0A 3NAIA 4JI4F 1WUUA 2ZH8A 1K44A 3I31A 4GO5X 1RT4B 1FD2A 3GCXP 3VVUA 2JNJA 5KFJA 1CJUA 2ZWPA 3K58A 1U2CA 4OYWA 2Y0BB 3DLJA 2CXEA 4X2BA 2ZOFA 2CZ4A 4LF7F 4FYVB 5RUBA 3DGPA 2BEFA 1MROA 1FX4A 2DHXA 4KSEB 3T19A 2LLZA 4Y2AA 3MAQA 2YKAA 2RRBA 4EFAC 4C98A 1KD1T 1JJ4A 1YZ6A 3QJJA 1VRQC 3TANA 1TL3A 2M8HA 1U0SA 1D9FA 3FBCA 3FCWA 3KXDA 2W8KA 3PX4A 1DY3A 4QIEA 2KYZA 3NXZA 1MWQA 1U1LA 1VQKS 3UFCX 2XULA 5M2PA 1X4HA 4OI0A 4C8KA 1KFDA 3NMRA 2RU3A 1HWKA 2DPJA 1S0NA 4O44B 2MKYA 1UAWA 5IQ6A 4DV1J 3R5JB 3G4SS 3K89A 2IMOA 1R8HA 4OQJA 2XNQA 2QN6B 2E44A 3KLEA 3UNGC 4USMA 3O44A 2JL9A 5KFOA 3KJNB 3M2UA 2XMJA 2FVPA 1S7IA 5CYQA 5LMUJ 2RF2A 5HL7Q 1VQNS 1FFWB 5EWEA 3CC2S 2ADBA 2V5HG 5FLXY 1K0TA 3JAMU 2OHDA 1U0HB 3TAMB 2M7SA 4ZPAA 1W7WA 3OLBA 4J37A 2XO7A 3KNGA 4DFMA 2MQQA 1NEEA 2OP5A 1OQ6A 1NH8A 1VS3A 2E29A 3OV7A 3BN4A 3PHEA 3JAMY 4C0HA 4CH7A 2KU7A 2IC3A 3D54A 4KGZB 1YRXA 2E1CA 1B70B 2N82B 2VPXB 1RT7A 4IG3A 4RWXA 1GMWA 2VQFF 3G82A 2DNHA 2ZH2A 4OHYA 3DRRB 5GAEI 3HFVA 3WZ0A 3HVTA 3JYTA 3POTA 2VFUA 3W5YA 3D6HB 4H4OB 2J9DA 3QRPA 5F8GA 1MU2A 1N5YB 3VGTA 1FWPA 5DQGA 3QQCD 4K4SA 5IOLA 4ZVHA 4NXNF 3NG8A 2JVRA 1N0VC 3I9V9 4X4TA 3BS9A 3R6LB 4LRFA 1MN7A 2WHOA 2D74B 2A18A 3IG1B 4EO6A 1T05A 3N6NA 3MM5A 3MM6A 2RUSA 2Z56B 2F40A 1SQFA 4DR4J 2CJ9A 3A8EA 1FA0A 1TV6A 1YRTA 2ROGA 5H1SV 4AXIA 3F44A 2VJUA 1LW0B 2IJFA 4MIAA 1FK9B 3I0SA 3CTRA 2MHEA 2YNFA 4RBVA 4BBYA 1HMVA 5IV3A 3CEDA 5F9NA 3CJKB 1EETB 4QW8A 4Y2MA 4DPTA 1TVRA 1FWLA 4AL6A 5KFZA 2KFZA 1UETA 2GVDA 3DM2B 2OUGA 3DXSX 1L3SA 4IFYA 4LF8J 1WKLA 2HVZA 1LW2B 1N56A 4QWEA 4TYBA 4V19X 2E1MC 3AOBA 3L3CA 4DG1B 3BV8A 3LH2S 2W9CA 3PR5B 5HP1B 4AL5A 2VH7A 2F8EX 3RB6A 2B8QA 2W7PA 2PGCA 2WTFA 2PMHA 1IKXA 1PBUA 1KLNA 2G2OA 1VQ8S 4DZ6A 2VONA 2K1RA 5U47A 2HBZB 1U48A 3FQLA 2DNZA 1N52B 4X65F 4PAAA 2G4BA 4HH0A 2Z2LA 3CF5Q 2ZWOA 5IC6B 5L46A 3J80Y 2QGFB 2KG0A 4A8WA 3MECB 3OVAA 1QTMA 3DXBA 1T02A 4NEYA 4GC7A 1R0BG 1CEZA 5IZHA 4DX7A 4Q43A 2Y1JA 3GP9A 3TA2A 1KLMA 5GAHI 4J9PA 2CPIA 4WTYA 2HFNA 4RKUC 3TVZA 3ZZPA 2VZ9A 2RQCA 2BX6A 1PYSB 4RWWA 3HHKA 4KE5A 1X4FA 1Q1KA 3KLIB 1RT2B 3VAFA 3U1MA 3DDKA 3KK2B 5D3GB 1U6ZA 5I3PA 2VFRA 2H9ZA 5F3TA 3VHQA 3DMJB 4OYXA 4MK9A 1YVFA 2EWHA 3QZ8A 3SQGB 1XMOJ 3BZQA 3AOCA 4OZ5A 5HVFA 3OL9A 2NSCA 4DV2J 1CSJA 5KFPA 2Y1RI 2H5EA 4M1KA 4Q8EA 1YRUA 2VF3A 3I0RA 4M95A 2UUTA 2GHPA 4QCLA 3UDCA 5D4LA 3DC2A 1F0XA 2MLZA 5BR8F 4LSZB 4F4YA 3L7UA 2FIUA 2RNEA 1H0HB 3MUVP 4ZPCA 1X4CA 3F56A 4CO2A 2YNHB 2HVDA 3BN7A 1GMUA 4CLPA 1NJIT 5B09A 3HSJA 3MUTP 2UUAJ 2EC0A 2XM3A 2MLYA 1FD8A 1IBMJ 5A76A 2W7AA 3VZIA 3GFXA 2XMTA 3GCWP 4OLOA 3VAMA 4QZVB 2FQQB 3OXFA 3P4UB 2CQ3A 5HMZA 4YDXA 3CC7S 2ZD1B 4DJBA 4QU7A 3OW2R 1EARA
chains in the Genus database with same CATH topology
3SXLA 3I6PA 4KPYA 2JX2A 4BS2A 3HHNB 1FJGF 2U2FA 1Y0HA 4NLXA 3MTKA 2DVIA 4ED1A 2UU9F 3KTQA 3AB2B 1VRTB 2GQQA 1D1UA 5KT7A 1JKHA 5AE1A 2E5GA 4H54A 2NZ4A 3HHLC 2BV3A 4N8NA 3UWTA 1NKCA 4OHVA 1I94F 1RT1A 2WK4A 4I2PB 1R43A 1TKTB 1B0VA 5CZXA 2P9GA 3KLEB 3TAPA 1T8EA 2FLOA 2APOA 4DQIA 1X5TA 4OI4A 4ETZA 5BJRA 3H25A 3M2UB 3PX0A 3WC2A 5C42B 5E41A 1R6YA 2MMYA 3RB4A 3KHGA 3T6BA 3MM7A 4K0KF 3S7RA 1MNEA 1DTTB 2OD4A 2U1AA 4ILLA 1S9GB 4A8SA 3D1QA 3JSRA 3VCDA 1FVQA 3EXYA 4NLVA 5AJ3F 2G9OA 3LF0A 4GMKA 1X9MA 1TKXA 1UKUA 4LVOP 3NNHA 1YJTA 4NA1A 3TVYA 4F4WA 1QSLA 4NOHA 3GIJA 2O1PA 3OUYA 1RA7A 2E7XA 5ADZA 1LOUA 3KG0A 4BC9A 4QOTA 3DOMA 5KFIA 5HMYA 1VLYA 4DV1F 2I5JB 2GO8A 2X51A 4KHRA 3PKYA 4MJKA 3QMQA 2LXUA 2V8HA 4DUZF 4ECUA 2GJIA 1Q16B 1DLOB 4B9UA 3MUMP 3DLBA 2KZZA 1KC8T 5K14B 3SDEA 2JEJA 3H5XA 3NGKA 4EBDA 1YWXA 3CWJA 4J9SA 1KONA 5SZTA 1ZAXA 4DSLA 3R5CA 4G6VB 4D3GA 3EGZA 1HARA 3TARA 1K8AT 3R27A 2XC9A 1FXLA 4DFKA 2K7JA 2BYCA 4NMLA 1YI2S 4FBTA 5IT9Y 2E9TA 4K4UA 4WIIA 1WNEA 5GAGU 5DG7A 2CKWA 2HQ3A 1SKRA 1GAOA 1S1TA 1VIOA 1SQEA 4IG0B 3MEDA 5DJBA 4G1QB 5G0RB 4WCEQ 2JH3A 3JSMB 3E01A 2W9AA 3HP6A 4RUAA 3GV5B 1G3OA 3PRDA 3MURP 1K0VA 3SEOA 1HBUB 2HAIA 4F25A 2HNDB 1VK8A 2W4CA 3H20A 1S1XB 2IC3B 3ITHB 3LANA 5GAHU 1NK5A 1NKBA 1GX6A 3CB4A 2JFKA 3P5TL 3PZPA 4DR5F 3QGHA 2LQBA 3M6VA 3T5KA 1FNXH 4FYDA 2HS4A 2AWZA 4C7QA 3Q8RB 4JYAF 1WHYA 5KFSA 1X0PA 2C3MA 5J2QB 1MMDA 2RKIA 1RT7B 3Q2SC 4O23A 5DG8A 3P49B 1DTQA 1WD6A 2AW0A 3QGGA 4IG3B 4ZOSA 2LQJA 4ES2A 1U1KA 2IAJA 3B4DA 3CDWA 2PA8D 3ENWA 4MYUA 4WFYA 1QE1B 3DRXA 1V3ZA 1RTIB 4H4KA 3ZZ0A 2LDIA 2C42A 4J9KA 2XZWA 3FEXB 2MZ1A 3LGMA 1FTRA 5D78A 3ZZOA 1T03B 2JDJA 3PEJA 3OQ2A 4MAKA 2ZFHA 4ZDNA 2M8DB 2LYVA 1UJ5A 3GIIA 1K73T 2KDOA 2M4MA 4N5SA 1H38A 3U1NA 2G1DA 3PXGa 2DRAA 1S1WB 4PG5A 1SI9A 3OXGA 5I3UA 3DRPA 1VQ6S 3M6UA 4RW8B 1FJ7A 1XMBA 1UVMA 1IN0A 2ZE2B 2WBMA 4NLSA 3JYTB 2W9BA 3PX6A 1RT4A 4LQ9A 3SI8A 1YIJS 3M32A 4EUVA 3H4DA 4TU7A 5JUMA 2JLGA 3V4IB 3VR1A 4R8UA 2MZJA 2FJXA 1XERA 4ZKAA 1FJEB 1YJ9S 3BDPA 2D7SA 5L8RC 5KT2A 2HG4A 5LSRA 2IRUA 3M30B 4LSNA 3VAHA 2XWXA 2DH7A 1HFEL 1NK7A 1EP4A 3CXCR 1R8CA 3M4XA 1RYSA 1FEHA 3MEGA 1IBKF 2QA4S 1Z4UA 3MFHA 3TQ1A 1FDDA 3UCZP 1C0UA 1KHWA 3M1VA 4AFFA 4B02A 1DURA 1IJFB 2MSSA 4QWCA 1V3SA 5KOXA 2DTJA 3R5AA 4QWAA 2HVHA 1FRMA 4Y2CA 2P6TA 3PJWA 1FO1A 2WOMB 3PJXA 3H2LA 1UA1A 4C8OA 1LWFA 1UVKA 2YKNA 3IXQA 1T05B 1ZH5A 3MM5B 4WE1B 1O5JA 3MM6B 3NLCA 4X4SA 3V6KA 4HKQA 4LJMA 3GE9A 4URSA 1FRHA 4X4UA 2VBZA 2YWEA 3ZFVA 5T7LB 5AE2A 4PUOB 2F8MA 2J9DE 3NAHA 4UQTA 1FKPB 2L48A 3OJUA 1NK9A 5KTQA 1F5BA 1Q53A 3N9UC 5F0UA 3J7A1 2PI4A 4ERDA 4WF9Q 5HROA 1Q82T 1DFDA 5CA5A 1WTFA 2DHSA 1L3TA 1TV6B 4KV8B 2J6SA 2ZITA 2BZ2A 1HNIA 3ZZZA 1SJQA 2XY7A 2MZRA 1HR0F 3G9CA 1BQXA 1M5SA 5E7OB 5KG4A 2P9EA 4DL7A 2JC1A 2AGQA 4YUDA 5EWGA 3C46A 3BR9A 5KFCA 2Z0GA 3O1LA 3TUJC 3MPVA 4TQSA 1HMVB 4QR1A 2WSFC 2YWGA 2AYGA 5DGBA 2OSQA 4QIVA 5KFXA 4WYLA 4F2SA 3OBIA 3Q0AA 4DEZA 4KO0B 4RNNA 1TR0A 3K5MA 2BR0A 1U47A 1HW9A 2FD2A 2VV5A 2XBPA 3MM9A 3O5TB 4HL9A 4KQZA 2DGTA 3DI6A 1TVRB 4OZLA 4WFAQ 1X4AA 1VQPS 4DFJA 4IRKA 1H3DA 1FRIA 2POKA 4X4QA 2VBYA 2ZJPQ 2CPYA 2PFFB 4JI5F 2IBKA 4LIWA 3IWLA 2M88A 4FN5A 3R1LA 1G7CB 5L1KA 1N6QB 2AYMA 2HVIA 1JLEA 3EGNA 4RNHA 3W7BA 3KK1B 1FNOA 4DR4F 2MQPA 5A6WA 4DSEA 1DQ9A 2DRBA 4DS5A 3RZAA 4OIXA 1S1VA 2MY7A 4DHVA 3IAS9 4CNYA 4O4RA 2RU9A 3LP1B 5LL6d 1TFWA 4JI8F 3BSOA 4I2QB 3DOLA 1HI1A 5C25B 4ECQA 1M1KT 1YITS 2FPHX 2CQ4A 1AROP 4DF4A 4I7FB 1REVB 5J1EA 2DR5A 1PC5A 3AAWB 4MMOA 4NLYA 1Q79A 3ZZUA 1FJCA 4EWTA 1NNDA 2VFTA 2AYBA 2GHWA 3PO5A 2UXDF 4FVMA 3KJVB 2B4PA 4KT0C 2BVZA 5FD1A 2CPDA 2E5LF 2J6TA 1RJJA 2DGVA 2M2BA 3NP5A 2VG6A 1LWEA 4DQPA 4YB6A 1IKXB 1DHMA 5K8OA 4U67Q 1S10A 4ES1A 2FJEB 1KR4A 3CCUS 3P6YC 3SSQA 4X4VA 4ZCMA 2KVIA 4URQU 4USHA 3JTPA 2OPQB 3DOKB 2J0XA 4QWDA 2V4QA 1BLUA 4IO9Q 3OTDA 2ABYA 3X1LB 1N88A 2EKYA 1IQZA 1SV5A 1HNVA 3RAXA 1RTHA 2KXHA 4MTPA 1Y00A 1F9FA 1ZZNA 1IXKA 1FTCA 4FVCA 1TKZA 1S0OA 4Q44A 2MZTA 2Q1LA 3HK2A 4B3OA 2RT3A 3M2RA 2PSZA 3AA8A 4ZVEA 1QAIA 4C8NA 1U25A 2F8HA 1D0EA 2B43A 4TY8B 5HBMA 1R8PA 3TUIC 3RRHA 1PGZA 3N4WA 2AJFE 4Y00A 2IVYA 2VFSA 4M8LA 4RUHA 2KO1A 2LEPA 3NCPA 1G1XA 4ZCIA 2GQ2A 3PFEA 3LUYA 4CNZA 3DHWC 2O3DA 2ZH3A 1HBNA 4F02A 2PA3A 3FVYA 1C0TB 1R0AA 2PIIA 1BY9A 4RU9A 1X0FA 3GWCA 4W92B 2R8JA 1FDAA 4C11A 3K5NA 5L1LA 2BDPA 3MMAB 3OXLA 1KLMB 2XCPA 3KLGA 2XGQA 5CHCB 3AQPA 2HGLA 2IRYA 1UVNA 3FEZA 3QIDA 2L3MA 5B0CA 1CVJA 3RB0A 1JWWA 1OO0B 2OPRB 5KFHA 3LP0A 4DX8H 2A3JA 4A8YA 4EEYA 2YQ3A 4MIBA 4OZ0A 1UFWA 2CQIA 2CPFA 2AYEA 1FNMA 4TXSA 1JLAB 3CSKA 4O4GA 3FSXA 5KFDA 2FJBB 3MOZA 5D4NA 2CPJA 2XMVA 2BE2A 1VQYA 2A2CA 2JFDA 2NS1B 4WXOA 4QYRA 1L3UA 4OJ3A 3KLHA 4NLTA 3BO4A 2KXFA 2XY6A 4RW6B 4DSJA 3MXHP 3CDAA 4ZS6A 3W2VB 2VPWB 5IM0B 2UUCF 2BM0A 5AE3A 2YKOA 4FNIA 1FE0A 4DV0F 4ZP7A 4B9NA 4TU8A 1E6YA 1HBOA 3TAQA 2KH9A 3G6XA 2AF6A 1R8BA 2V8GA 2V4JA 2FJAB 2DO4A 3DCAA 5B7WA 2OJ3A 4YB7A 3S6EA 1R27B 4CCHA 3I0RB 1U26A 3VAIA 3ZZYA 2ASDA 3T9ZA 3K8WA 3EYZA 2HHPA 1IKYB 3CCZA 2C28A 2ASYA 4Q7AA 5DLGA 3DYAB 3IS9B 2HHXA 3PKMA 3OJSA 2IBOA 1ZAWA 4MKBA 2LDYA 3TO8A 1FKOB 4PXDA 1SH0A 5HO4A 3CCJS 1TL1A 2HFOA 3MHYA 3PFOA 2W24A 4H4OA 4Q2MA 4O3SA 2B9XA 4WZQA 2ZNYA 2FB0A 4ECZA 4RW9B 5GMKa 5DDQC 1W25A 2DNQA 4I69A 2IA6A 3QAEA 1YSJA 2DO0A 4N8OA 3NRBA 1MW7A 3QLHA 3PW0A 2PDAA 1WEXA 3SSSA 2EK1A 1Y9OA 1RQ0A 4XPEA 1R89A 4CO3A 5K5MA 3I32A 2I8EA 7FD1A 3KLFA 4YR0A 5KFYA 3QO9A 2YKPA 4FF4A 1H2TZ 2UZAA 4B3TF 1XMOF 4BCAA 2OTLS 1JNRB 1GTHA 1IQTA 1RTJA 3AY0A 1HWUA 1C1CB 4KFBB 5LJ5Y 4DV2F 2Q6CA 4IOCQ 4F2RA 4F3MA 5MAOA 3IG1A 2FLNA 4ZHRA 3LP2A 3UR0A 5A8RA 2AX1A 4OX9F 1KS2A 4LIRA 3LW5C 1VBYA 2LECA 1S97A 3OR1B 4LFBF 2XMWA 2RH3A 4C2MA 3GYNA 3HVRA 1N34F 5KG3A 5IS2A 4X66F 4ED3A 2D41A 1SL1A 1I6JA 1FXRA 1LW0A 2HHSA 3DLKB 4XIUA 4EYHB 3I82A 3GV7B 5FDLB 4OZJA 4U9RA 1RISA 1NJWA 1SJ4P 4ZPVR 5B0GA 4CTAB 2RB7A 5B0AA 5A8WA 1RWUA 1S76D 4WKYA 4EBCA 1JLBB 3G96A 1O0PA 3MWBA 4NZ7A 2G13A 1M90T 4LF9F 4NLPA 3SCJE 5IFMA 3A1YG 1ZAVA 3AB4B 2VG5A 4MFBA 2V0NA 2VODA 1N36F 1JLFA 2L08A 4IO1A 1LXJA 4WXWA 5K9FA 5CYMB 1X9WA 1H7XA 2NXUA 1GXLA 2FC9A 3FFIA 4C8MA 4KKOB 3AJ1A 2V2KA 4KGMA 4FS2A 3H98A 1N33F 3MDFA 4JI2F 4ATNA 2VA2A 1XWLA 2DCUB 2UUAF 1M0SA 2DGWA 2ZKTA 2RDJA 2GFFA 1JKHB 4PWDB 3M8PA 2B4OA 3G6VA 2RQ4A 1HWIA 3QPIA 3UE2A 2J9CA 2QMWA 1JLGA 3E8OA 2UV8A 4USJC 1RT1B 4OHZA 5GAEU 2M70A 1ZTTA 2CQHA 1ZM2A 3ETOA 4X4PA 1IBMF 3ZC4A 5J2PA 5KFNA 4IRCA 5F41A 3VAKA 2DITA 4K2XA 2HLTA 1IJEB 3M9NB 1S99A 3MM7B 4CO4A 4NCGB 1XEZA 3C8YA 5G4DA 2KRRA 3DRSA 1NAQA 2YKMB 2J76E 2HHTA 1KQKA 4BC7A 2N7CA 1RT5B 1MWYA 4KJIA 1NO8A 1UP1A 4AXJA 4IR9A 1SH3A 1Q81T 2KJVA 4MK8A 4IOAQ 2UVVA 3SFUA 4IKAA 3G86A 1VQOS 3S8SA 1VQMS 2EFNA 3OUYB 4O3OA 3LGNA 5A8KA 2OMLA 1YJVA 4QR2A 2NQPA 5A2QY 1IR0A 3MCSA 4GC6A 3BGRA 4PPZA 4WK3A 3M2VA 4BWJA 5KG5A 4PWUA 3KFWX 4KIAA 2ACYA 2CJQA 1Y3KA 2XY5A 4K4TA 1XK8A 3BSAA 2ZM6F 5L39A 2DK2A 3MAHA 3ISZA 5LSLA 3SDEB 1Y3JA 5C5JA 5F8JA 5DDOC 4WJBA 2B7CB 3MD3A 4ZVFA 1JNZB 2F9DA 5KFLA 2ZH5A 2UVRA 4OZNA 4X64F 2I2YA 2PEHA 5CYJA 3MTJA 2V9WA 5C24A 4ED5A 1WTBA 3OTBA 1N32F 4FF1A 3MEEA 1RTDA 3CIZA 1UMJA 1V6HA 5JVGQ 2F1FA 3RBDA 3MECA 1C4AA 4JI6F 1QJHA 1S1TB 2DGXA 3IR5B 2OFHX 3BDEA 3MEDB 3U02A 3E01B 5KFWA 4NYPA 1UVLA 5EN1A 2NPIA 2XWYA 3EPGA 4LSLA 4TU9A 3LWLA 5SUHA 1HYSB 3FSIA 3NS6A 2W7OA 2CPXA 4AUKA 3TP2A 2Y0SD 3LPYA 4ED8A 1CQMA 4PXCA 2MKKA 2ZH4A 3BSCA 2J6UA 1UWBA 4HDHA 1KVJA 1DJ0A 5K8PA 2RKIB 2M9KA 4OI1A 5LXYA 1DTQB 1NHUA 1Q7LB 4NYZA 2RRNA 2OPSA 5GADI 1AXQA 3W3SA 4I6WA 3DU6A 2I0XA 4C8LA 1WHVA 2E5IA 1L3VA 3GFHA 2X1FA 4I6YA 1Z2ZA 4DFPA 1AFJA 4MYTA 4RLEA 4A8QA 2MQLA 2QLXA 3KK2A 2CPZA 1YG0A 2GMJA 3PW7A 2B56A 2QSFA 3KHLA 3KOAA 1ULRA 2QMXA 4FP9A 1FRJA 2LQ9A 2ZZMA 3MR3A 2B3TB 4DR2F 3PO4A 5LXRA 1DZ5A 1JLQA 3FRYA 4BWMA 4F8RA 2P5VA 4WU3A 3DMJA 2XB2D 3WX4A 3UPFA 3FMWA 3DRPB 3MEKA 3BR8A 5I3UB 1TKDA 4ZCKA 3Q8PB 3KK3A 3B4MA 3SQGA 3PW4A 2AQ4A 2W9BB 2XSJA 5CYQB 5HLFA 2RF2B 2YY3A 3IO1A 3M32B 3H40A 2KM8B 3BO3A 2EG1A 3IFEA 4R8UB 3JB9k 4A46A 3UI3A 4WZMA 1VK3A 4UUXA 3GFZA 1HWJA 1QSSA 3QGIA 2LCWA 4IR1A 4QPXA 4LSNB