2B7CB

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Elongation factor 1-alpha
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b7cB00
4B3TF 4DV4F 4LF7F 2UXDF 4DR3F 1CQNA 4LFBF 1QJHA 2B7CB 1GH8A 5LMNF 2UUAF 4JI3F 1FKAF 4DR4F 1N33F 4K0KF 1XMOF 1FJGF 1XNRF 4B3MF 2UUCF 2VQEF 4LF6F 4B3RF 2B7BB 2UXBF 5BR8F 1IJEB 1XNQF 2F4VF 1J5EF 4LF4F 1LOUA 2J5AA 2KJWA 4X65F 4X66F 1N34F 1XMQF 1CQMA 1B64A 4JI6F 4DUYF 4JI2F 4DR1F 4JI1F 2YY3A 3T1HF 4GKKF 1N36F 3OTOF 4JI7F 4JI0F 4DUZF 4B3SF 4DV7F 1HR0F 3T1YF 1IBLF 2ZM6F 4DV3F 4X64F 4LFCF 4JV5F 4OX9F 4DV2F 2BXJA 4DV1F 1HNWF 2HHHF 4LFAF 1HNXF 1HNZF 4DV0F 4NXMF 1F60B 4LF9F 4NXNF 5AJ3F 4GKJF 5LMUF 4JI8F 4AQYF 2E5LF 1IBKF 4DR5F 4JYAF 1RISA 2VQFF 1IJFB 4KHPF 2KJVA 2RJZA 4X62F 4DR2F 1VMBA 4YHHF 4DR6F 1N32F 5IWAF 4DR7F 2BVZA 3R3TA 4LF5F 4LF8F 1G7CB 2UUBF 4JI4F 4JI5F 1G1XA 3ZZPA 4DV6F 2UXCF 4YY3F 1I94F 4DV5F 1IBMF 2UU9F
chains in the Genus database with same CATH superfamily
5FDLB 5KFWA 5E3CA 5DLGA 3PJXA 2ACYA 4EFAC 2ZZTA 4DQRA 3D6TB 1T9UA 2JWNA 2XGQA 3CJ4A 3CD0A 3KG4A 2ZOFA 2M88A 4PR6A 4DFKA 2HWHA 4FF4A 1RWMB 1YZ6A 1KLMA 1IR1A 1WJ9A 3QO9A 3QRRA 2G0JA 2W7PA 5KFFA 2D41A 2CJXB 1JLGA 3TAMB 3CD6S 1XR7A 4YB7A 4G6VB 4B17A 3HCXA 1FFSB 2WK4A 1HFEL 4PQAA 4UW2A 2ZJRQ 3HSJA 1YJVA 2W2OP 4ZJQA 4X62F 2HPUA 3JSYA 4IDKB 1TKZA 3CMQA 2WHOA 1S6OA 1HLWA 3LP2B 3GJQB 2DEJA 4DSFA 1Q5VA 2EBEA 3TQEA 2J9DE 1S6QA 4I7FB 4USWA 2BBEA 1NSPA 3D3CJ 3CGIA 4X4SA 3CUNA 1WSVA 4NX9A 1XEZA 3PIOQ 3T5KA 4ER8A 4MTPA 2DHGA 1IM6A 1RLCL 4IUFA 3HHNB 4LRFA 4LVNP 4KAIA 4LRAA 2B9EA 3HXMA 2Z2LA 4GKKF 3KK2B 1MMDA 2MXYA 1TFYA 3UNGC 2MQLA 2VC0A 2RDDA 2HAIA 4C4WA 2IM1A 4OJ3A 5KT2A 1Y3JA 5IV4A 1M5PC 3BYRA 3SZ2A 4HH1A 1ZAWA 3AODA 1FDNA 4XDCA 2B4VA 3VGVA 1VDHA 3M8SA 2GO9A 4LQ3A 3M6WA 4DR6F 2ZH6A 5AJ3J 4JI5F 1G1XA 3T9NA 4I69A 2R4FA 2VQFJ 1NKEA 3ZTRA 3E2EA 3C16B 1Y10A 2YNFB 1QJHA 1VISA 4O44A 4K0KF 2LA4A 1SXLA 2R7OA 2FHJA 5LSRA 3RUBL 4DG1B 2Y8YA 4URSA 4OYWA 5CA5A 3Q8SB 4LRBA 4NLWA 1XNQF 5CHCB 1D8ZA 1JLQA 5B0CA 4DLEA 1Z2LA 2KVQE 2YH0A 3VAHA 1KBRA 2RRNA 1UEKA 4FXDA 4HT5A 2PD1A 3GTYX 2DY9A 1C0UB 5KFCA 1A7GE 4KO0B 1EQ0A 5E0OA 4Q2MA 3NCQA 2KFYA 2JL9A 2R3VA 1Q7LB 3GIJA 3HKZD 3PXGa 4ZITA 4CQ1A 4CI0B 1WEYA 4RWXA 1KOHA 1T05B 3IN5A 2GJFA 2DR5A 2GMHA 2WSCC 3P3DA 3MR6A 2WOMB 1UWBA 1CQNA 4QIVA 3D6HB 5F8LA 2JNJA 1HW9A 2OPRA 1S0OA 4Q8FA 1SL2A 1X0FA 1Y0HA 1XNRF 3IC1A 2H4WB 3RJMB 1VJQA 5FLXY 4XO0A 3FSIA 4ECXA 3W3SA 2KJWA 4DEZA 4C7QA 3DRXA 3JAMY 5H1SV 5I3UA 1JNRB 4XAKA 4K4VA 3MMBB 2POKA 1KDNA 3DDNA 3DDKA 4Q5VA 1XIQA 4PRFA 5BJRA 3THVA 2F8EX 3VAFA 3F0NA 4UZCA 3W5ZA 2YX1A 3F41A 2B9XA 4M5IA 2KXHA 4JI8J 4QIEA 1QVGR 5F9NA 1F3VA 4IG3B 3QJLA 9RUBA 5F9LA 2ROGA 1NZAA 3DOMB 3DGPB 1TKTB 4K50A 3H4DA 4AQYJ 5KFMA 3OUYA 2KB2A 3BBCA 1JLEA 3TZWA 1NDKA 2DY1A 2VOOA 4HLBA 2HBYB 2VG5B 1A0OB 2UUBJ 4DFJA 2MY8A 1FRHA 5E7OB 1WORA 5DZ7A 3G8TA 3QIPA 2R2UA 2FUG9 3GPAA 2K1RB 1APSA 1FXLA 1K9MT 4ZVSB 4FNIA 1RTIA 1YX2A 1LNQA 2C22A 4O3SA 2KG0A 4N41A 4IQMA 2APOA 4ATNA 4P10A 4ECZA 4AL6A 2Z2MA 3I0RA 5C7PA 5KOWA 1RCXB 5DETA 3G9CA 4GC7A 1K0VA 3DLHA 3LGMA 3LTOA 2R9LA 2YKNB 3MMAB 2KU7A 4ID5B 2XSJB 4ZK7M 5DG8A 3VGSA 4M5LA 3BSCA 3I55S 2ZOGA 1UJ6A 2HGNA 3PX0A 1BE4A 5H9EK 2D69A 4DF8A 3K8WA 1NPRA 2XCPA 4CLWA 3PACA 3PW2A 3N28A 5E3RA 1GTHA 4F67A 3KLHA 1MWYA 1G6BA 1X7VA 1RWUA 3B78A 5ETVA 4FS1A 3K17A 5IT9Y 2JEGA 1OMSA 2VG7B 1BC6A 3TWZA 4W98A 4KC5A 4DR3J 1RUSA 2CRLA 4ANEA 1KTVA 4B3MF 3VQTA 2OMOA 4ID8A 1HQUA 2CNLB 4WFZA 4HI1A 3LAKA 5CCMA 1TELA 3MOJB 1SBRA 1Q8IA 5KFAA 5I42B 5DG7A 2EK6A 4PUOB 4ES2A 1KP6A 3GP9A 1RWPB 1JIHA 4DUTA 2PI5A 1EAYC 2B56A 4NPOA 2A6MA 2OHDA 3MECA 2YXLA 3PW4A 3IRWP 1JLBB 3RW7A 4J91A 3FEYB 4CM0A 3ILOA 3J81U 3KNGA 2DNMA 1HNZF 1YJNS 4M5DB 4I56A 1GX5A 5B08A 3ILIA 4O3OA 3QJPA 3WZ0A 2HBZB 2QGFB 2EFGA 5HLFA 2J9DA 2YNIA 1GEHA 3HHEA 4OI2A 2B3TB 3WBZA 5E3AA 3OSNA 4N8NA 4Y34A 3W8PA 1TV6A 2DR7A 3PJ9A 3TAPA 5LMNF 3M9MB 2DGUA 4FN5A 1EETA 4CO5A 2NPIA 5KFYA 2M8DB 2MLZA 3PM9A 1PJ7A 4RWWA 3K59A 5F8NA 5ADZA 1CQMA 2HEKA 4R8UA 4JI2F 1KLMB 3KKFA 3QO9B 3PZPA 2DHXA 3OTBA 2KRRA 5KFKA 2E44A 3TA1A 4GO7X 2HVDA 2X3DA 4UQGA 2OJ3A 5K8NA 1KNZA 3CULA 3BN7A 2OI2A 1S1VA 4KPYA 1FI4A 3NG8A 2RF2A 4DU7A 1NM2A 2IAJA 1IXKA 2W2QP 3GCWP 3CO0P 1X9MA 1VHFA 4P71A 4A46A 3H25A 2HSEB 3HHLD 4J9RA 2XZTB 3TJ9A 2NUUG 5IS2A 2ADBA 2KDOA 1HYSA 1VRTB 3GYXB 2ROPA 4MK8A 2UU9J 2HW3A 2V6AA 4LR8A 1F2GA 1JXVA 2MGZA 3TJAA 1TAQA 2XNQA 3TVYA 4TNOA 3GG1A 3AB4B 2YWHA 1VJWA 2AJQA 3CC4S 3GIRA 5D4OA 1HIYA 2RUSA 1JLAA 3H2UB 1IKVA 1WHYA 1N34J 4P73A 2BOAA 2OKQA 5JVHQ 1U1NA 4J37A 2VIHA 1VBYA 4TU9A 2GQ2A 4OIXA 4C8LA 2GW8A 4MKAA 5ITHA 2HZVA 4X64J 3NGSA 2P2CB 3OFHA 5BYRA 3M8PA 1AZSA 4USTA 4Y2CA 4KHPF 4F04B 4LRDA 3M05A 1YBAA 1RAGB 2LU1A 3NCRA 2BQUA 3M4XA 3GJRB 5KTQA 1N4LA 3BQ1A 4DR2J 2FHMA 4ZN3A 2H54B 3AH6A 3LGNA 2ZJPQ 3CJKB 4FVMA 1KQKA 4P75A 1X60A 3OTCA 2WVBA 2IBKA 1JQGA 3HK2A 4FP9A 2BW2A 3DLJA 1N5VA 2GHWA 1JLQB 2Z0GA 5KFVA 4W92B 2YWWA 3T6BA 2K3IA 4A8YA 2E1PA 3R5DA 4N77A 2GHVC 5D78A 3V5RA 1SC3B 2KN4A 3BGRB 3HHDA 2HFNA 3MOZA 3FMBA 1V9OA 3AHPA 4OZLA 3G6ES 4M5JA 4K2JA 3DYAA 3T1YJ 2AJFE 2I38A 3DLEA 4JI8F 4ECSA 1CPZA 1F9EB 2XO6A 4DFMA 4HYKA 3Q8UA 4I2QA 1CJVA 1UWBB 4QZVB 4JP8A 1BWEA 2OPRB 2HFVA 3ENVA 1X5OA 1FTRA 1Y9OA 3ET6A 2X1FA 4XIUA 3MR7A 2QZ8A 2V0NA 2J6UA 4QU7A 4OMFG 4RPFA 2LYVA 4KRWA 1HI8A 3NP5A 2ZNZA 2FVCA 2WW8A 1YBUA 4TU8A 2ZC4A 5E2QA 1TL4A 5A6WA 4A8WA 4NLDA 4OI0A 4LF2A 4Y00A 2M7SA 4OLOA 2ERRA 1Q79A 1N54B 3BQ0A 2L41A 3G8QA 2BDPA 3ISZA 4ETZA 1FRXA 1NHUA 2CKWA 2YPYA 5HQLA 3FEZA 2VASA 1P27B 1UZDA 1HNWF 1EKSA 2YWFA 3E01B 3KHGA 1U2FA 2QV6A 4IRKA 2MHEA 2ZBIA 5DS7A 1JLEB 4ZVTB 4H4KA 5F3ZA 1B7FA 2OFHX 2E5LJ 3KTQA 4HDHA 4EYIB 3NS5A 2KYXA 5KFRA 2C3UA 4KPCA 1X31C 3OQ2A 1DY3A 5HP1A 4HHUA 4X4VA 3BDEA 1L3TA 3SEOA 1WACA 3R7NB 4ED3A 2RKIA 4LF6F 3AY0A 1YJTA 1FTCA 2B9YA 4RNHA 4OJHA 1RTIB 4OQJA 2E9TA 4ED1A 2E5GA 1S9EA 4YB6A 1NPKA 3N4WA 4EO8A 1YRUA 3EVMA 3Q8PB 4LRCA 1UZHA 2CPJA 3I0RB 5CYQA 1WC0A 4HACA 4FVCA 2DGSA 1S9FA 4P2MA 4QR0A 3AD8C 1FRMA 1H7XA 1M5OC 4ZHRB 1DLOA 1QUVA 5CYJA 4EMDA 5AXKA 2HNDA 2DH7A 3GZ7A 2ZKTA 1V3RA 4E0DA 4QPXA 1LWFB 3QJJA 1F1BB 1L3KA 5IC6B 1KQGB 3ISND 1BQMB 1UL3A 1HBMB 3A1YG 2IVMA 1KONA 2ZC3A 1G4CA 2QFJA 4KJIA 4IOAQ 4NXNJ 2BVZA 4LF5F 3V6HA 2P8IA 3W9JA 3H2VE 4LR9A 4KV8A 4QIWD 2DRBA 3R2CJ 2MQ8A 2A10A 1RWKB 2HK2A 1AXQA 4DX5A 1FEHA 3JQMA 4WWSA 2P9CA 3TRGA 5J2MA 5FLXU 2YVSA 3JTPA 3IWNC 1HQUB 3JAMU 2UVWA 1JLCA 2LU2A 4FXVA 1XJWB 3I96A 5KFLA 9ATCB 1LWEA 2ZWOA 2J7KA 1T9VA 5ETTA 4F4YA 1SL0A 2ROEA 2JEFA 3MECB 3QT6A 5ETPA 3MPYA 3W2WB 4DX8H 2U1AA 2CNNB 1FD2A 3MMCA 2LQJA 3OBIA 2H1YA 2BMBA 3Q83A 2VICA 3CCES 2UVRA 1Y5LB 3QAUA 1U8SA 3AQPA 5KOXA 2XBPA 4GKJF 2OELA 3T3FA 4CTAA 4RLEA 5E33A 1U4BA 5HLFB 2YNIB 5J2NA 4WZMA 3MAAB 4JYAJ 2NLWA 1NO8A 4I6YA 1CVJA 2XS5A 1N32J 2K8GA 2DHAA 3TEGA 3VCDA 5F0UA 2QFIA 2WVCA 2FVRA 1HMVA 4U8YA 3ENWA 4HTIA 4OYAA 2ZH8A 3R7SB 3NGUA 4EI2A 4IR9A 5L1JA 4LVOP 1FWPA 3W64A 4IRCA 3L9ZA 1NMEB 4QR1A 3QGIA 4I2PA 1HPZA 3QPIA 5CD4H 1Q78A 1FXDA 1HHTP 5KG2A 4OX9F 2AWZA 3T19A 1U6ZA 1S1VB 1ZPVA 3N01A 4K59A 3PVXA 1N6QA 4R0JA 2ZM6J 1HW8A 1O51A 1N48A 3ENAA 4DV1J 3ZFVA 1DAXA 1NJZA 5F8HA 3OR1B 4DV0J 2EG1A 6FD1A 2DEIA 3ZO7A 4FF3A 8RUCA 2HHXA 4J9MA 1LEOA 5AE3A 2CQHA 4D3HA 1HYSB 3EZ5A 1RAJA 3R1LA 3TA2A 4X4UA 2DPIA 4V19X 2ZBRA 4RNMA 3OHBA 3PX6A 5EN1A 5JUMA 3D1OA 2MGZB 4DCOB 3BZQA 2WCXA 7FD1A 2ZKUA 4O0NA 1BUXA 3R5BA 3GYNA 5D0RA 5CCLA 1HKAA 2C2MB 3PYDA 2ILYA 1CJKA 1FVQA 1XMOJ 2WVEA 2ZD1A 2Z8QA 1X5SA 1IKVB 2NREA 4LF4J 3UR3C 5B7WA 2WW4A 5C2GA 1CBKA 2DXEA 4YFUA 2BJ9A 1FA0A 1IQTA 2J8AA 2HQIA 2BJEA 4WFXA 1PGZA 3IR7B 1X4DA 1V3SA 2PI4A 1BQNA 3G82A 2HLUA 2CIMA 3CDWA 3M8PB 4RBVA 3OVSA 2W01A 1JJCB 2H4YB 1B7YB 5HL7Q 2N3OA 2NPFA 1BWVA 2DBBA 1J2VA 4DPTA 4P7VA 3EUNA 2OAUA 1HBUB 4NWBA 1UTAA 5HK4A 4MT1A 1KHWA 4DPYA 4MYTA 2DNKA 2CZ9A 2LDIA 1P9QC 4HL9A 5FD1A 4C0HA 5CH7B 3OFEA 3DOLA 3HM9A 2Q79A 2J0XA 2KM8B 2WSFC 1N5SA 3JXOA 3T1AA 4RL1A 5GMDA 1G3OA 2CQDA 2PEHA 3MCMA 4MKVA 4KHMA 3KDOA 3TARA 3FQKA 2UXBJ 3MFIA 4U7UD 3UVJA 1HI1A 3QNWB 2XMUA 3QT5A 1WKLA 3TP2A 3JSRA 3DYAB 1NPPA 1RWWB 4JI1J 4F36A 3BYPA 4ZVQB 4NEYA 4DUZJ 2QC3A 3T9ZA 2AJ0A 4DQQA 5GAGI 4JV5J 4LFCJ 3WC0A 1I3OB 2Y1LB 1G2EA 2NSBA 1Q95G 3NNAA 3CMAS 3P8BB 2JLEA 4P72A 3TA0A 1SIWB 4I2QB 5AT1B 1CJVB 3I5BA 1S0NA 4ECVA 3SV4A 1GMWD 4RO0A 1NSQA 1HBNB 5HATA 1IBMF 4P9SA 1N52B 1WKKA 1VCTA 4UUXA 5B0DA 2BQ3A 1PAEX 4R0EA 5MAOA 3HI9A 1PIEA 3JYTA 4DR4F 3KJVB 1AB8A 2DITA 3O8WA 4ZIVA 3NBPA 1F5CA 3GU0A 4FDFA 2Z30B 1CJUB 5RUBA 4ZPBA 5KFJA 5CXTA 2JX2A 2MY7A 4RUCA 4MIAA 1S4FA 1RHRB 2FC9A 3S8SA 4CRJA 4PXEA 4C98A 1LW0B 4FKYA 1K73T 3H7HB 4MIBA 1M1GA 3H8YA 2K3KA 2RU3A 2FLPA 1A9NB 3CC7S 4LSNA 1YVFA 2VH7A 4OZNA 2KT3A 5HSPA 2XO7A 4OJGA 1OSDA 1WKJA 4Y6IA 1EB0A 4WKRA 2C2RA 3UN5A 3PKYA 2DR8A 2NUHA 2MLYA 3Q24A 1WG1A 3TQ1A 4B9TA 1YZ7A 1LQ9A 2RKIB 3AJ1A 2F4VJ 1DQ9A 3N6MA 1TP7A 1VQNS 1S9EB 2N7YA 3B4MA 2XEXA 3RZAA 2HQCA 5KFEA 1VIOA 4HACB 5IQ6A 5L1IA 4DV7J 1FDDA 2PFDA 3CEDA 2MSTA 3MUTP 4PABA 3KJQB 3LAMA 2AJ1A 4C8OA 2V4JA 1CLFA 1DLOB 3WX8A 2EFOA 3M9OB 1KSPA 2HNDB 2NYIA 3EXYA 3EM1A 2XSFA 2HYIB 2FZCB 4ECQA 4HR2A 1HI0P 5IT0A 3G87A 2I5JA 2FHOB 2EK1A 1X4CA 3DN9A 3M6VA 4FYYB 4KV8B 2M3DA 4J90A 1G7CB 4F4XA 3R97A 1NJXA 3ZZPA 2UXCF 2W7AA 3CO9A 3QWUA 3BH6B 4JI3J 4EUVA 1TVRA 5J2MB 1NK6A 2UUAF 1KFSA 5LM7E 1JLCB 3HDSA 1L3VA 2E1RA 2HG4A 5A8RA 1HQEA 1Y3KA 5DM7Q 1OSCA 4KGZB 2HNZA 1NRKA 5F8MA 4CT8A 2B4OA 1M0SA 2RS8A 3AJ2A 3CB4A 3D6MB 2CVIA 3G86A 5SUHA 5D6GA 2O01C 3MMCB 3H5SA 3UD5A 4OJ1A 2OGUA 4P52A 4UOFA 1P9YA 2R8GA 3GG0A 1HL6A 5KFGA 2AMCB 3ZTOA 4CTAB 2M8HA 2RSQA 5A2QY 1FO1A 4OHZA 2XY7A 4TU7A 1MU2A 5J2NB 2Q43A 2ALZA 5HBMA 3N9UC 5GAEI 1T3NA 1OY9A 3NGRA 3X3UA 3HHLA 1KD1T 3H0PA 1YIJS 1X9SA 3KLFB 4DR7J 5A0YB 2CA9A 4C3LA 1R0AB 2JEJA 2V69A 3UN2A 5EDWA 1CG2A 3RU0A 4QJVA 1RT6A 3R5JB 3TO8A 2HFOA 4C3KA 1K1QA 2HFUA 3HKWA 4ICLA 2D1CA 1XMQF 2J7WA 1HPZB 3ZZYA 2HQDA 2BV3A 2NR0A 5KFDA 3I9V9 4PWUA 4DX7A 3LPYA 1YK9A 3EVOA 3BDPA 5H9EJ 1TL5A 4PXBA 1LK7A 1N6QB 1PJ5A 2MQNA 4KB7A 4ZLNA 3QRPA 3THTA 2HNYA 5DG9A 1XR5A 3OL7A 4J9UE 3J7ZT 1RAFB 2YX7A 1MLAA 3M7VA 4KY3A 2RDJA 1U1OA 4URQU 5C42A 4RW8A 2DGQA 3P4UB 4RU2A 1SH2A 4N56A 3ZZTA 4PYDA 2CPHA 4C8NA 3PO4A 1YRXA 2ASJA 1VLOA 2HIYA 4ZLLA 4QIGA 3PEJA 5AXMA 4LFBF 1YBTA 3MPVA 2QL5B 2RH3A 2V68A 3DM2B 1U26A 5D0EA 2CQ2A 4MIWA 1IKYA 2UZAA 4DXLA 1SI9A 4NOHA 4PEOA 4AFFA 3CCTA 2DCUB 4IFYB 2WONB 3F44A 4WTYA 1CJKB 4ECYA 2V2QA 2AGOA 1HBOA 5HMYA 3QWPA 3LALA 3ETOA 1OS5A 2Y8WA 3UE2A 4YR2A 4OHXA 4G1QA 1VQ5S 4DUYF 1M1HA 3DRYA 2FJBB 2AIRB 3W60A 2YNHA 5ETRA 4QU6A 1N5YA 1B0VA 1S48A 3IGNA 3CJRA 4UOHA 3FUYA 4L75A 1S10A 3RR8A 3G82B 3EICA 1EX8A 3ZNUA 2E1MC 4GO5X 1WEXA 3CJ0A 2VBXA 1Q8BA 2H3EB 4QQBA 5DZ6A 2ZUAA 4NZ6A 2BUNA 1FKPB 4KQZA 3ELHA 3B8HA 1DJ0A 1X4AA 2GS8A 4G1IA 2VFVA 4B3OB 3L7UA 3GE9A 4ZKAA 3WQPA 3DOLB 3TX8A 2A6OA 5ETOA 1NUEA 3MR3A 1FK9A 1MNEA 3MEEA 5EUHA 2HFSA 3MEDA 3E3XA 3FZ2A 5DJBA 2UUWA 2G2OA 1RQ0A 1F9FA 1TL7A 4DR1F 3S6EA 4B02A 2UV8A 4CLFA 4RW7B 3ZNJ1 3VAMA 3TR5A 3W61A 4FYDA 4ZVPB 2DH9A 3QT8A 4CM2A 4RUHA 3SCIE 1QVFR 2XGPA 4PCQA 3C6TA 5L8RC 2CG4A 5L9XA 1IBKF 2UUTA 1LXJA 4M5GA 2PEBA 1RAIB 8ATCB 1RWNB 1XMBA 2XMMA 3KMSA 8AT1B 2RD5C 1PBUA 5D3GA 2RS2A 2QSWA 4Q0BA 3IBFB 2YKMA 4YR3A 2E5JA 3JYTB 2B9WA 1RTHB 4NA2A 4YY3J 3NAIA 2JSXA 1FF2A 1FX2A 2QLWA 3D54A 3QRQA 3MM9B 2F4VF 2CQIA 1LOUA 1ZA2B 2X1AA 3LANA 2W1BA 2HHQA 3BBBA 2ASDA 4JV1A 3L3CA 4CO4A 4EZ9A 4O23A 2MZ1A 5L1KA 4DV7F 2Z58B 2JEIA 3MM7A 1KQSR 3P5TL 5DRKA 2AW0A 3K5OA 4H4MA 4P2SA 3GV5B 1SH3A 4JI7J 2VONA 1FRLA 3FK4A 1WD6A 4YB5A 2QJ3A 1FDAA 3W65A 4FYVB 4ZP9A 4M95A 4LSNB 3KG1A 3CIZA 4OHVA 1WEZA 1HD1A 2FJWA 2DRDA 4I7FA 4NI2A 1ZOTA 4KYZA 3FCVA 2FJEB 3GCXP 2UXDF 1KRPA 3KLVA 1SUQB 3FNNA 4N7TA 3SBMA 7FDRA 1SJQA 5JJBA 3U02A 2C2DA 5EWFA 4JI3F 5BR8J 3NXZA 1F3FA 3A8KA 2E1CA 2FY1A 3M32A 1DQ8A 1OIAA 1TKXB 3KUGA 1Q82T 4DL0C 3KG0A 4ZMMA 1U0HB 3KWMA 3EPGA 4UTGA 4WFNQ 2ACMA 1R3NA 2XB2D 4ERDA 2V4JB 4BS2A 2YNGA 3KHRA 1RHMB 1M90T 1FHTA 3SSSA 4RBTA 4LSLA 4FPRA 3T1HJ 3AB2B 3OTOJ 4U9RA 2CDQA 2I5JB 4OYXA 4J9SA 4U96A 3HSDA 2ATLA 2W2MP 1YITS 3BJYA 3FMWA 3HSGA 2OEJA 2OMLA 3CCUS 2XLIA 2CXEA 5KG0A 3BKTA 2FJAB 4H54A 4DR5J 2MJUA 2MLXA 1TVRB 4R25A 3CDUA 4FYXB 1GXLA 4P2FA 4MMOA 3T5LA 2MTLA 2VFSA 1Q86T 4DS4A 5A8RB 4LBHA 1R43A 1HQEB 2DNQA 2DRAA 2HNZB 3LW5C 2HRTA 1XWLA 1JLFA 1WF1A 5LT5A 4PKDB 4I64A 2WAQD 4TYAA 3V4IA 1K8AT 2UVVA 3G8SA 2KI2A 4ZCLA 2A0FB 2GFFA 2LDYA 5HANA 5C24B 3SMZA 4B3SF 2LMIA 2MKIA 3JQJA 2MKHA 2LFVA 3I4HX 4ITSA 3SDEA 3QT7A 1QTNB 4BWMA 3EX7B 3BKFA 2CJBA 1MU2B 3SCJE 4CH1A 5EWEA 4KKOB 1KR4A 3BR9A 1KOOA 1N8RT 5HBMB 5HQ8A 1BD6A 2M70A 1XR6A 2HGMA 2W2PP 4ZP7A 5AXNA 2E9RX 3Q2TC 5GVQA 4OX8A 4CLYA 5D0GA 4YHHJ 2EFPA 4NLQA 2AJ2A 4PAAA 4H4KC 1LW2A 4J9PA 4ZDNA 4KGKA 2LQBA 3OR2B 3V6JA 1IR2A 1N88A 1J5EF 4ICLB 3PJWA 3Q8VA 5I3QA 2RQMA 1RBLA 4DL6A 4LREA 1RA7A 4URGA 3MHYA 2FQQB 4MK7A 4WBFA 2RNEA 2K06A 2BXJA 3MTKA 2X1GA 1UW4A 4L73A 4Q43A 3M8QB 3W5XA 4F25A 3CPWR 2J0SD 4Y2AA 1JNZB 3FSYA 2CJAA 5DDOC 5C25A 3J7Z5 1XN9A 2G2YA 2KT5A 4KGMA 2RJZA 4KE5A 2FC8A 5ETSA 1ELOA 1VMBA 4M63A 2VG5A 4RW8B 2QSFA 3Q22A 1TK5A 2DT9A 3H42A 3AA8A 2AGPA 4X4QA 3SCLE 3IM8A 3PX4A 2CJKA 2HHVA 2BACA 4MH8A 4X84A 1WOOA 3SFUA 4NLGA 1IKYB 4WYLA 5A8KA 2GMJA 2YKAA 2UUCF 1SV5A 1U1PA 1HBOB 1S12A 1FJCA 2Z2ZA 2BRLA 5AE1A 3CCWA 5FIIA 3G6VA 2MQMA 2YNHB 3AQOA 2Y1JA 1MROA 3RAQA 1HWIA 4ID5A 3UDCA 2GC8A 1U6BA 1C1CA 1U47A 2G0CA 1Q8KA 4QOTA 3UQSA 1RYSA 1W7WA 1MN9A 2P6SA 4DU8A 2FVSA 3CCLS 2ZDOA 5KT3A 1LWCB 1RAAB 2VL1A 2CPDA 2CYYA 1RACB 3CCMS 2CFXA 4CLUA 1RK8A 1HWJA 2F1FA 1YG0A 1ZAVA 2ZH5A 1U45A 3C15B 1AYEA 4O3PA 2IYIA 2OEKA 1NSAA 1TFWA 1GMWA 2ZHBA 4TQRA 3OVBA 2VPYB 3A3NB 4LF7F 1O8BA 1RCOB 2KO1A 1FK9B 4RNOA 1U7LA 5I42A 3MEEB 2CPFA 1JWWA 3OXGA 3FRYA 3NKYA 2D3O1 4A8SA 3M8YA 3OFFA 3D9BA 1SJ1A 1U49A 3R6GB 4LIRA 2MZSA 3DRRA 4X66F 1ZA1B 1TL7B 2R2RA 1RT3B 2DIUA 2VQEJ 4C8MA 1B64A 4PXCA 4RZRA 3GLJA 4DV3J 2DR6A 2ZBQA 5G4DA 4TYBA 1DURA 4Z37A 2G4BA 1JX4A 5CD4A 4NASA 4OHYA 4YDXA 4U67Q 4F3OA 2AEFA 1BMQB 1L3SA 3CJ8A 2WVDA 2PA8D 3GSIA 3PW5A 2E7XA 1ROFA 3IR5B 3KXDA 1LWXA 5D3GB 5JXSA 2M9KA 3ENQA 4Q0BB 2YKMB 5KFNA 4XPCA 3W9HA 1X4HA 3T5HA 1YI2S 3J80Y 1Q8LA 3CE8A 4ED8A 1UKUA 4B3TJ 4MAKA 1IR0A 4L6V3 4IKAA 5BR8F 1KVIA 2J8SA 2E5IA 2NXEA 1ICEB 1H6KX 2C2ZB 2EPIA 3I56S 1B0TA 5K5MA 3MURP 1IN0A 2CQ1A 1N36F 2ZH4A 3EDQB 4NMXA 3MM7B 2EI5A 3QZ7A 4USIA 4H4MB 1HD0A 5KFBA 3Q86A 1X5PA 1RBAA 4N5SA 3UD4P 4WK3A 2DIVA 2HVHA 4ELTA 4NXMF 2M2BA 2V63A 2BM1A 4NL5A 4OYBA 4NI2B 2NXNA 5KT5A 1T03B 5L46A 2HWTA 3CJSA 3EWGA 2RQKA 3TAQA 1VRTA 3OPKA 3CSKA 4LF8F 1AA1B 1QLNA 4WP8A 1BLUA 2MKSA 3GFHA 2XLKA 3FZBA 4CO3A 3T6JA 3KLIA 3TX0A 5G0RB 4EBDA 4QPTA 3DMJA 1F2HA 4DV6J 2R8KA 4YB1P 5J2PA 2A2DA 2JRSA 2N4CA 2VPXB 3M32B 2ASYA 2Q1LA 3LUYA 2HS3A 4X65J 3UFCX 3IXQA 4DL2A 2O1PA 3DRSA 1NB7A 2ALYB 1X4FA 1BXNA 4WU2A 2AX0A 1H73A 3OLBA 3PDNA 2IPOB 2YNGB 1RP5A 4ALZA 3QLHA 1K1SA 3TYTA 4NYOA 3B82A 3FSXA 4ZLPA 1X9WA 3CJ5A 3HF5A 2PDAA 4LSLB 4X4TA 1NEEA 2MEWA 3BPDA 4NLUA 5HVGA 4ETXA 4LFAF 3K8VA 5DQIA 1HNXF 4PYAA 1YSJA 1RGVA 4LF9F 3OVAA 2IJFA 3FKBA 4WU3A 4DV2J 1IKWB 3TUZC 4P74A 5HN0A 2BR0A 2LLZA 2CPYA 1TMMA 3FFIA 3CJKA 2VHGA 4NE9C 4CT9A 4LBPA 4DQPA 4ZCKA 1V5IB 4DV5F 2JLGA 3FBFA 2QYCA 3KOAA 1SQGA 2EXUA 1LV5A 2Q6BA 3CCZA 3M9NB 5K20B 1I94J 4NLOA 1P1LA 2C3PA 2AYGA 1JLFB 4J9VA 4C8YA 4PG7A 3V4IB 2FTRA 5H9FJ 3BGRA 4WKYA 3NCPA 1DFDA 3C19A 1QAJA 4KH0B 4PG8A 3PO5A 4G65A 4UUWA 2BJ1A 1U1RA 2HGLA 2C2NA 2WSEC 3OD2A 1VBXA 4WFBQ 3M2UA 3SDEB 3TW0A 3ZZUA 2GHPA 2ZH2A 5GAEU 2A3JA 1MMNA 3OLAA 3CXCR 4FYWB 3GSDA 3H20A 4ZP6A 3CT9A 5A76A 2ZBCA 1RTZA 3NOCA 2X7IA 2CPXA 1Z4UA 3UCGA 4OFZA 3UD3P 4B9LA 4ECRA 4DN9A 3SIPB 2OD6A 1LW2B 3PR5B 2VPWB 1SH0A 3G96A 2P5VA 5GMKa 5HVFA 3W1YC 4DV4J 1OQ6A 3DHXA 1RDRA 3CDAA 1FE0A 3RR7A 2WVFA 3CW2C 4OV1A 2VKZG 4WIIA 3BBFA 4DSIA 2B5JB 1ZPWX 2SXLA 1VC6A 3MD1A 4ZJOA 3C8YA 1NXIA 5J1EA 4B3RJ 1RAOA 1NDCA 2FPHX 2EW9A 6AT1B 3WDOA 4W90B 2E7WA 4ZVFA 4M1KA 2OP5A 3E01A 4TLRA 4KGXB 1HR0F 4KFBA 1TQLA 4QWBA 2QX0A 4U7UK 5C25B 5GMEA 2R8JA 1VQSA 1X4BA 2IA0A 5BYSA 5J1NA 3CCVS 1YLXA 1ZM9A 1PYSB 1PAUB 3H5XA 2NQPA 1QY7A 1VQ9S 2HMIB 3K5MA 1VOMA 2RDIA 3HZEA 1DBDA 4OYZA 3GIKA 3FC9A 2W7OA 4DJBA 3QSYB 3T41A 3ZZOA 1FKOA 2W24A 2NCKL 4ES1A 2J9EA 3MF5A 3TOQA 4C8KA 4Y2MA 5A8KB 3K89A 5L9NA 3PV8A 4JUZA 3BGOP 1D3WA 5KG5A 5F8GA 1SV5B 4NA1A 3IP0A 4MYUA 4F2SA 2DD8S 2FYXA 1WUUA 2DHHA 4E2FB 3QMQA 3R9LA 4BWJA 1W2BR 1I51B 4D3GA 1QUPA 4ZHRA 1MROB 2CAJA 4RKUC 2DGVA 4L76A 1RWOB 2WBMA 3GB0A 1LWFA 1C1CB 1IBLF 2E66A 2FY8A 3R8YA 1BQMA 4HEA9 1HBMA 4DV3F 4G3IA 3NLCA 1CS4A 3O44A 1SJRA 2UV8G 2FVPA 3JSMB 4C6AA 4QWAA 1HWUA 4ZPAA 3QGHA 2L9DA 1WC3A 3HO1A 2DXDA 3E51A 1FNXH 3GILA 2HHHJ 1GNKA 5LSOA 1RT4A 1UVMA 3U1MA 4EGLA 2V5HG 5LMUJ 4P6QA 1NJWA 1ZS6A 3LWMA 3RBXA 2JDJA 2HHTA 5CZVA 3ADAC 3K7RA 1UA1A 1GH8A 2XYGB 4ZVUB 4ZPCA 1QM9A 1FERA 3R6LB 1FJ7A 2ZHAA 1PC5A 1S6PA 4H4OA 1WHWA 3BF4A 2M5YA 3HHLC 4AXJA 4DL4A 2VODA 3DRRB 1TMJA 4OX6A 1F6TA 3W2WA 4QWDA 3DLGA 3NL0A 2GQCA 3QGPA 3IAS9 3H40A 3ZTQA 4KBIA 3Q0AA 4WIQA 3PY8A 1WG4A 3NS6A 4BDPA 1URRA 2GJ2A 1WTFA 3MM6A 1RT7A 4AL5A 3HFZB 5LJ3Y 2FZKB 1KVKA 3BO3A 1SKRA 2MB0B 3MAAA 4C3MA 4PZVA 3UR0A 4K8RA 3GV7B 2DXFA 2RRBA 2C3MA 5GAHI 2C1EB 4C8ZA 1R0CB 2E1AA 4C2MA 4X62J 3I82A 3UO0A 3DKDA 1U25A 5HROA 3PRBA 2WB4A 3L7PA 3P45B 3CD5A 3K2YA 1VK8A 1UVKA 3JS9A 2M52A 2EKNA 3PCOB 3FRZA 3IGVA 3RBEA 3RRGA 2B7BB 3UWTA 1GMVA 5K8PA 3VHQA 3NEKA 4X65F 2AU0A 4DS5A 2DR9A 3R2DJ 3O2IA 2AYEA 1FNMA 4UQTA 2WBRA 2WZ1A 3HJVA 2LXIA 3HX9A 1SB6A 1R27B 2CQBA 4Q2LA 4GKKJ 5DGBA 3MGJA 5HJYA 4A8QA 3OR1A 2AQ4A 4CDIA 3GWCA 3DRPA 3MEGA 3BKUA 1H3DA 2ILZA 2VF3A 3LF0A 3O5TB 3R27A 2AV5A 5AJ3F 2CJYB 5KG6A 2VQFF 4JI4J 2AEMA 3SCKE 2QA4G 3IG1A 2FJVA 1X5TA 2D9PA 4DSJA 2DVIA 4DZ6A 5MLCV 3EGNA 2KHDA 2OH2A 3BQ2A 3KLIB 4PWWA 3PTWA 5HO4A 2AT1B 1EJ7L 3Q23A 3DMJB 1AROP 4DR6J 1C4CA 2AZ1A 4KHRA 3D28A 5J2PB 1AT1B 4JI5J 3M30B 2KZZA 3ETMA 4PPDA 2CNKB 4CNZA 2IC3B 3DRSB 3V6DA 3W7BA 2ZE2B 2CQCA 3HD2A 1QE1B 4I6AA 4UY8T 1UP1A 2W25A 4B08A 2H5IB 3WHIA 4K0KJ 3VVUA 3QLHB 2FIUA 1XNQJ 3BREA 4C9DA 1YRTA 4A8OA 1FT8A 2Y0BB 3BO4A 3PYFA 3HT0A 1XTZA 1HNVB 2C2EA 3OJUA 2M4MA 2XI3A 2LVWA 2E29A 1NSKL 4BC7A 1HBUA 5T41A 3DU6A 1VFJA 3ICLA 3FFIB 2IDEA 1GQEA 3AXKA 3HFKA 2HWIA 4CWBA 1S6UA 2BANB 2B51A 2GAHC 2RMLA 1TU0B 3LQVA 2VJVA 2MYFA 4O4GA 2QT7A 5A8WA 2OEMA 4B9UA 1AUDA 1SIZA 3KK1A 1V3ZA 2PSZA 2W9CB 1TKDA 1WI8A 2RQCA 4MKBA 4NLRA 2YQ3A 4OYIA 2DHSA 2CQ3A 1XNRJ 4OZ5A 1NH7A 4USHA 4CLTA 2QIFA 1NHKL 1ZM2A 3M2UB 2GZOA 2I6WA 2V2ZA 4AL7A 4UT4A 3K5NA 3CDBA 5IOLA 3H59A 3D1QA 3K5LA 3EZUA 2AP6A 2V9WA 1T9TA 1UPPA 2G13A 2VBYA 3LP0A 2CPZA 2VUGA 2ADCA 4XDDA 1HBNA 4AQYF 2G9OA 1I1GA 4TY9A 4WPAA 2VU5A 1T9YA 5K8MA 3IR6B 2GVDB 3UNYA 4FKXA 4IR1A 4ECUA 2UUBF 2HHSA 3BSNA 3MD3A 5DLFA 5HVHA 3TUJC 3C6UA 3KJVA 1SJFA 5KG7A 2DNOA 5LOQA 2V4QA 4FS2A 2R2SA 1H74A 3NWGA 3D2WA 2V50A 3TZXA 4ZP8A 1CJUA 1MMLA 4USVA 4JB8B 2A2CA 2OD4A 4PQUA 5KT7A 1CSJA 4IYQA 1VQYA 1J5OB 5J1EB 2BA9A 2GX8A 2P6TA 1R8BA 1PKUA 1KLNA 2G2ZA 1LW0A 2MZQA 4KFBB 5D0HA 5LL6d 2BEFA 2HRUA 3LP1A 1OWXA 1VR6A 2GVZA 5GADU 3OXFA 1SJ4P 2NZ4A 4I0WA 2IDLA 1EIYB 3D3BJ 3IO1A 1TL3A 2PT0A 5F41A 2HKEA 4LT6A 5C2CA 3VR1A 1N0UA 4DPUA 1B0PA 1FKOB 1S1TB 4RX6A 3GFYA 2ZH7A 2FZGB 3KLGB 4DR3F 2G0IA 1VQKS 2F9DA 1QAIA 1SKUB 1DARA 3I87A 4FZVA 3GIIA 1RA6A 1L5UA 3CJ3A 1NBEB 3R5GA 4HH0A 1U2RA 2C3OA 3J7YI 2LQ8A 4Y0FA 3M8ZA 3MUVP 4A8XA 4NCGA 5KG3A 4KH1B 2HQFA 4GVBA 4WXOA 4B3MJ 2CADA 3I6PA 3IFEA 2W8LA 1NK9A 2MZRA 2E5HA 1CS4B 4EBCA 5HJXA 1H2TZ 4IH7A 1T94A 4AUKA 5CYMA 3KJNB 1YGYA 2A18A 1Z2ZA 5IM0B 3B4DA 4IG0A 4K4ZA 4I4BA 2ZUGA 3VTIA 1RT4B 1WNEA 1HNZJ 4PWDA 2O67A 1T7PA 2QMXA 1Q0NA 5E3PA 4TVAB 1XK8A 1FEEA 3ILLA 1MG7A 2CDRB 2N4DA 1R0BG 5LSLA 1ACMB 2XMTA 4I68A 2CUYA 2ATCB 1M5HA 3QQCD 3NMAA 4LMZA 1S6PB 4H4OB 1NAQA 4QWCA 3US5A 5LJ5Y 4O3RA 1T3OA 4K4WA 1S59A 1I5OB 1RI7A 2LEBA 2DISA 3DLGB 5LMNJ 3A3PB 2OPSB 1W2IA 1EHWA 1EP4B 2GO8A 2YKPA 4FF2A 2H5EA 4IH6A 4CLZA 2NXJA 2FLOA 3BGLA 4A48A 2QL9B 4Y2KA 3MM6B 1RT7B 4JI2J 1PJ6A 3KK3B 4X4OA 3PKMA 4LIWA 2FJDB 1WELA 4ECTA 4C97A 1OY6A 3D68A 3DLKA 4QIFA 2VKRA 4P2XA 4M8LA 2IA6A 4B9SA 4WYWA 3EE3A 2QL7B 2L3MA 4K5SA 3EYZA 4IOCQ 3KLFA 1U1KA 1R7IA 1AFJA 5A0YA 1N5TA 1R0AA 3GQCA 4JI4F 3K58A 3A12A 2EKYA 3TUIC 5HROB 2UU9F 1AFIA 3WIUA 3EMTA 3S01A 2MDAA 4DBQA 3ZZ0A 2DNHA 1B70B 1XC9A 2QYGA 1C4AA 4MK9A 4I6WA 4DSEA 3F73A 2VOPA 1N34F 2HVIA 3WIVA 2XYHB 2OFGX 1D9FA 4F3QA 1YJRA 2EC2A 1PBAA 5HQMA 1SL1A 1FVSA 3DFEA 2VJUA 2PO4A 2Z57B 1PG5B 3IWXA 4X64F 4ZVRB 2BYCA 1VHIA 4M5MA 3DRPB 1H38A 4JV0A 3MEGB 4ZPWR 3RRKA 1NKCA 2QA2A 1UCNA 2HZAA 5IT9U 2BW7A 3IG1B 2MJNA 2MQOA 2MHNA 1VK3A 2HZCA 4EBEA 3GJSB 4DR2F 1S4EA 1SJ3P 2IJNA 2IM0A 3DM2A 3D66A 2XG8A 4KHPJ 2RHQB 3IS9A 3V6KA 2F3JA 1TZ0A 4IFYA 2WONA 1NH8A 2MSSA 2VA2A 2JLFA 1RWVB 1JJ4A 2LQ9A 3DDIA 4ECWA 1NJIT 3V6DB 1W25A 4X4RA 3IA0A 1HNIA 1OYEA 3I31A 1NK7A 4UY85 3AT1B 4X4NA 3MWBA 4ZN1A 4WTOB 1RAHB 4YDDB 3IRXA 2D3OR 5L39A 3D7SB 1NB2A 5KFQA 1KKHA 1KFDA 2R7RA 3QBCA 3CCRS 5CQGA 4FXWA 5ETLA 4F0MA 3T1YF 1DTQA 1REVA 5KFTA 3W62A 3LH2S 2AX1A 1QSYA 1PILA 1FCAA 3C66A 4HHHA 1S57A 1RABB 1FKPA 4JOUA 2AKWB 2O66A 1Q81T 4NRTA 3M6XA 4K4YA 1RZMA 2C42A 1T9WA 2IMOA 3EGWB 4B3OA 5L1LA 4OL8A 3HLUA 3NNCA 1X8DA 1B3TA 4O4GB 5M2UA 1K44A 4USUA 1YWXA 2I1RA 5A8WB 2J6SA 3RAMA 1ZM3A 3GONA 2KT2A 5KAKA 3KK1B 4C0BA 1UPMB 4KR0B 2EEYA 2XYPB 2R2TA 1F5BA 5LXYA 4OI4A 4DZDA 1VYAA 3M1VA 3EDRB 4RW7A 1S99A 4S0MA 7AT1B 2C2OB 1TK0A 4ZVEA 4ELUA 2CPEA 2VPZB 5KT4A 1OY8A 2R7XA 4K4UA 4OYOA 2AYMA 1TAUA 4USMA 1LK5A 4U7CA 2HLTA 2IIHA 1Q1KA 5EX3A 1JXLA 1U1MA 4RNFA 2J0WA 2LCWA 3LP0B 4B9NA 1PC4A 5IFMA 6FDRA 2NYHA 2E5LF 1RXOB 1HNWJ 5THWA 3QSIA 3RB3A 1H7WA 2XZDB 1RTHA 3DLLQ 3C6UB 2VC1A 1Y5IB 2YKOA 1HHSA 4IO1A 1IBCB 1UEVA 3W5YA 1VQMS 4NLTA 3KJFB 1N5QA 3MM9A 1VQ4S 1X4GA 5T7LA 4QBUA 3PNIA 1TL1A 1ITPA 4PQUB 2ZHOA 3AOCA 1Q5YA 4YP3A 4GVLA 4W4MA 2VA3A 3THPA 2JVRA 2F9JA 4RJVA 4JBCA 5H9FK 4KIAA 2BZ2A 3P5BP 2XHWA 4CLPA 2F40A 3IM9A 4DOZA 5B0FA 5A6PA 2BX6A 4LF6J 2C28A 4L72B 4QR2A 2MKKA 1YJ9S 2KXNB 3V81B 1P8GA 1TUGB 4FNHA 2VG6A 1DTTA 4F4KA 5ETMA 2EG2A 1JJ2R 3LP1B 1KS2A 2GVZB 4QCLA 2K2PA 2V94A 4J9KA 4GMKA 4MKYA 1Y4ZB 3CNQP 4PPZA 2CVEA 1TL3B 4NXNF 2G1DA 1C0TA 3Q8YA 1J27A 2W9BB 2BJ7A 1DZ5A 1TUWA 1SUQA 3GIMA 3GR0A 4DSLA 3U7JA 4WK1A 1VLYA 2BJ3A 2KXFA 1HWKA 4ZVGA 3TZYA 2NXUA 4USKA 3TEHB 1TKXA 5F3TA 3A4TA 5J1PA 4LF5J 3N6NA 4ZPTR 3HVWA 4NYZA 2GAGC 1U0HA 2CNOB 4R5PA 3OSPA 4WFYA 1HQ2A 3MR2A 4DCJB 4NCGB 1S0MA 3HFVA 1D0EA 2HBRB 4GVBB 3R5AA 2ZH1A 2FLLA 5HMWA 5T14A 1R89A 1JK9B 3MAQA 2FVQA 3OTEA 4CZCA 3D5MA 5CYMB 2ZEJA 4OYMA 1LXNA 2PN6A 2GGPA 3J7A1 3EVWA 3SSRA 2B8PA 4IG0B 1EZZB 1P1TA 1RT2A 3W8GA 3K0JA 4JYAF 4PWDB 1P6TA 2IFXA 3O1LA 2KG1A 2ZJQQ 1JLGB 5CAAA 3QGGA 1N32F 4ILMA 4N8OA 4N76A 4GKJJ 2H51B 2ZH3A 1YJWS 4GRSA 5B0EA 1U6FA 1YQHA 4F4AA 3I0SA 1VIXA 2IY5B 2J0QD 3HMJG 1TKZB 2BABA 4YQWA 4LSZB 1RHKB 2V8HA 2CG8A 2XWXA 5C24A 5KG1A 3HZGA 1SQEA 3LGHA 2R7SA 4IH5A 2G1HA 1S6QB 1SKSA 1YHQS 1CULA 3I32A 4RR5A 2DO4A 4RU9A 5IT4A 3SXLA 2LEPA 2B0GA 2L9WA 2D9OA 2D74B 3HD1A 3UW1A 2YWKA 1H2VZ 4Y65A 3BSAA 3ZZRA 2IVFB 2ZM6F 5GAHU 1RT5A 4PG5A 4KKOA 3CWJA 3SFGA 3PFEA 4DV1F 3DLKB 5DDRC 4ELVA 4UOGA 1Y11A 2QLFB 3CC2S 4ZVHA 4DV0F 4OX9J 3M8RA 3AXMA 4B9MA 2KJVA 2C3YA 5F8IA 2YQ0A 2QRRA 2COLA 3VAIA 3L4BC 5B09A 3KHHA 3BPSP 1YJUA 1TR0A 4CLKA 1B4SA 3OR2A 3EZOA 3ILJA 3CTRA 2CZVC 1HA1A 4QW8A 1Z1ZA 3BB5A 2DH8A 4DI6A 2PE8A 1XMOF 1QDUB 3A13A 2BRKA 1N56A 1AW0A 1M1KT 1S97A 1UJ4A 4LF4F 4J9QA 3RRHA 4KSEB 2GJIA 1F9HA 4O44B 2YWGA 3RTVA 3W9IA 1VQOS 4J9LA 4NCAA 3M8QA 1RTJA 1M5VC 3N0VA 2DNYA 5U47A 1VRUA 1URNA 3QFWA 4PG4A 1OPZA 4DWIA 4MJKA 4BC9A 2CWXA 1JKHA 4ZCMA 1S79A 2KH9A 1KQFB 2GQQA 1S7IA 2J7UA 4DQIA 4HHJA 1NK5A 1NU4A 1R8CA 4LQ9A 3NNHA 1VQ6S 3W63A 5SZTA 3NRBA 3BN4A 3HVTA 1FRJA 3SSQA 3WX4A 1WTBA 3IS9B 2OPQA 1HARA 1LFPA 4Y28C 2X51A 5E5NA 1RB0A 1RT1A 1HNIB 1FKAF 3N5BA 2GV1A 1FJEB 2ZH9A 4DX6A 2RRAA 4J7CA 3IRXB 3PRDA 1YJ7A 2UXBF 1VBZA 1CEZA 1SC6A 4A4JA 3N5FA 3NMRA 4M5KA 2CZ4A 3G6YA 3D0GE 1PCAA 2CJ9A 4DN0A 5AE2A 4GC6A 4JI1F 1DTQB 1REVB 1C2PA 1LWCA 4DUZF 3OFGA 3TNVA 3C46A 4LFCF 4JV5F 1OJ4A 5I3UB 3PW7A 4O3QA 2XS2A 1KHVA 4ZA1A 1S9GA 4WXWA 3C15A 3FBCA 1VQPS 4K7QA 1Q7YT 2QMWA 4NLVA 2E9ZA 2RHSB 1JB0C 2GA7A 2ZITA 4F4WA 2DYAA 2I8EA 1S77D 3M8WA 1N0VC 1F5AA 2HAFA 3ZTPA 3NS7B 1OQ3A 3R7BB 3AOAA 1DHMA 3OUYB 1IBMJ 1RT3A 2JC1A 3M1VB 2VB6A 4CP5A 1S72S 3BEGB 4Y3CA 4DR4J 4C11A 4ES3A 5EHHA 3SQOP 2KTQA 3QIPB 1F0XA 3Q89A 2YY3A 5DO2A 1CJTA 1NCLA 4U6PA 3IBCB 5D15A 3SYZA 3EPIA 4M5NA 1TK8A 2W4PA 2OTJS 2XTJP 3QYYA 3JTNA 2YX4A 3H5UA 3DOKA 2DO0A 3ZXWA 3MXHP 1WOSA 1Y7PA 1U8WA 4QYRA 2D7SA 2AHOB 3SI8A 2Z4PA 1T8EA 4M5HA 2V9KA 3FCHA 4QYZJ 5T7LB 2QE5A 3MUMP 3DHWC 1TL1B 5D4NA 2CQPA 2J76E 3PG9A 4ED4A 3OL9A 3KLHB 4YEAA 2OPPA 5ETNA 4NZ7A 2CQGA 2BKOA 2EWHA 4DPXA 3DU5A 2VZ9A 2FHKA 1UVIA 3MR5A 1GT8A 2HFZA 2R7QA 2L48A 3OT9A 4K4SA 3C14A 1L3UA 1VRQC 2EFVA 2Y1IA 3AJDA 4DPOA 1RHUB 2EBGA 2VG6B 3MI7X 1DTTB 2KFZA 2IJRA 3FVYA 3D67A 1NZ8A 4N47A 1ZBTA 3MCOA 4QWEA 3M2RA 1SC1B 1T03A 1XBWA 2IRUA 1C0TB 3AA9A 1NK4A 5D77A 5DQHA 2VBWA 3PHTA 5G0RA 2YTCA 1S1UA 2E7VA 1S1WA 2RU9A 2B8QA 3L7OA 2W4DA 4F4ZA 2HHWA 3J7YU 4E98A 4AXIA 4RW6A 1FRKA 1RSCA 4R5PB 2PGCA 2VFUA 3ITHA 1NNDA 2UXCJ 2H9ZA 3VALA 4DSKA 2GNKA 2LEAA 2D3ZA 3VF0B 2Y1RI 1S76D 2KM8C 4YS2A 1TV6B 1QAXA 4ZS6A 4CLLA 2QO3A 2UUAJ 5HAOA 3D0IE 4AE5A 1EETB 2V8PA 1SQFA 4CO0A 1JXEA 2XY5A 3SV3A 5JMNA 3KUEA 5BXIA 4DL7A 4AYBD 1R8PA 2V67A 3Q2SC 2EFQA 3OTDA 2GGPB 1IKWA 1RWXB 3VQSA 1ZETA 2AZ3A 1OO0B 2DNNA 3RG6A 4R8UB 1A6LA 4OYPA 1RT2B 2BQRA 1FFWB 2HVEA 2ZZMA 5D4PA 2O3DA 3UN3A 2DCLA 4LUBA 3VVTA 1O5JA 3P96A 1S1XA 2YQ1A 1VBKA 2ZFHA 3O3LA 5I4MA 4NLSA 3UCZP 4OI6A 4A47A 3LOUA 4NCBA 2FJXA 2F5GA 1HHQA 4DR7F 3LA0A 2XWYA 4E8UA 2Q3PA 3W2VA 4DCPB 2RF2B 3SQGA 4BHQA 3I0SB 1TUVA 2PMZD 2IAJB 3HJFA 1U09A 3R5CA 1U0SA 3K5PA 5KFUA 1JJHA 4UOCA 3MZIA 4WP3A 3IAM9 4RUBA 3LO3A 1MW7A 3DC2A 4F02A 1PO6A 2NZCA 5E3QA 2BJDA 1FRIA 4DHVA 4EWTA 1BY9A 3FBBA 1CULB 2HQ3A 3HULA 3PEHA 2PMHA 4OZ3A 1FXRA 4C0OC 1UJ5A 4IFVA 3TVKA 2DNPA 1WHVA 3I5AA 3W66A 2FD2A 3RYLA 3GR1A 4XTTA 2QA4S 1NK0A 4O0IA 2XMVA 1E6YA 1XMQJ 1RT5B 4ANCA 5KFIA 1IQZA 4WE1A 2YH1A 2XM3A 5KFPA 1JLAB 4DQSA 4EZ6A 1GX6A 3RW6A 2HIQA 1F60B 2F8HA 1Q4RA 2KFNA 3CJ2A 2HQGA 1RTDA 3MM8A 2OSRA 4WZQA 1T11A 3KLEA 3GMGA 2JH3A 2IM3A 3J7AN 1RU1A 4YUDA 1AZSB 4OLPA 1NHVA 3GFZA 1Q53A 3JQKA 3L09A 3QATA 2M0GB 2V34A 3TUPA 3O6QA 3UCUP 2B5JA 1UAWA 2FB0A 2AYBA 4LFBJ 1IKXA 2QMUB 5F8JA 3I9ZA 4ANDA 5KT6A 3MCSA 1GXTA 5EGYA 1ZYQA 4MFBA 2QEXS 2MZJA 3NWRA 4J9OA 1RTJB 2ZNYA 5KFXA 1O6XA 1VRUB 2B43A 3LWLA 1M5SA 4F2RA 4DUYJ 4NLYA 1GK8A 4YMEA 2FLNA 1H98A 1JKHB 2CPIA 3POTA 2HMIA 2B6AA 5B0BA 3UDVA 4ZCIA 3H2LA 1R8AA 1IJFB 3KUHA 3HVTB 4X2BA 3OL8A 3M2VA 4F50A 2OPQB 3H4BA 2ZVSA 4FBTA 1KVJA 4AT1B 4BLGA 3DLEB 3DLBA 1BQXA 1PYTA 2QLXA 2XY6A 4ILRA 4I67A 5B0GA 3B6BA 1RT1B 1N33J 2LKZA 1D8YA 3D6FB 5EX0A 1WC4A 4ED2A 1R6YA 2RVJA 2AGQA 2RB7A 4DLGA 3KDNA 1FE4A 5IC4B 5CABA 3EGZA 4B9VA 2QLBB 4JI6J 2XQCA 2Q6CA 4J5OA 4O4RA 3ET6B 1S5ZA 5A2QU 4F26A 3Q8QB 3A8EA 1V5VA 1D9AA 2LP4A 3JSMA 3ZC4A 3VGUA 2R7TA 3BS9A 2XNRA 4DR1J 4ZPVR 3LPEA 1FNOA 1S9GB 2WB1D 4PXDA 1R8HA 3JB9k 2GCFA 2RILA 2IRYA 4L74A 1S0VA 2DGTA 1VC5A 4HT7A 2BE7D 2D3UA 1RKIA 2LXUA 2V2KA 4A8KA 2Z2YB 4OHWA 5E41A 1IBKJ 4IQXA 2Z56B 4YY3F 2CQ4A 2VV5A 2NXCA 4TY8A 1VQ7S 1FJGJ 3QAEA 2BE2A 2HVZA 3BV8A 2DNGA 2W8KA 5GAGU 3IWLA 4ED5A 2JOQA 5AXLA 3DCAA 1FWKA 4CCHA 1IUJA 3MPDA 5F0WA 5FJ4A 2KL8A 3KFWX 1UFLA 4C11B 4WCEQ 5HP1B 4ED0A 3KHLA 4JI0J 2C2KB 2U2FA 1WC6A 1U24A 1DQAA 2XMWA 3CDEA 4JI7F 3JTOA 1ZH5A 1CJTB 3DI6A 1XQIA 2KKHA 2BKNA 4TLQA 3FBEA 2HK3A 3FJ2A 2IVYA 5CYQB 3VWSA 1UETA 1KC8T 3BR8A 3UI3A 1CC7A 3DOKB 4KTQA 2F65A 1K0TA 2W4CA 4CO1A 2FGCA 2WRMA 2B4UA 3EJMA 2LECA 2X1BA 1GFWB 2DJWA 4UF4A 1YKWA 3CJTA 2PIIA 1VS3A 3VV2B 3GJTB 1DRZA 4HKQA 3AOBA 1RLDA 4WP9A 2OPPB 2QG9B 2UXDJ 5HMXA 1NDLA 1IWAA 3EGVA 4Y2IA 1SC4B 5KFOA 3C14B 5KFHA 2EFNA 3CF5Q 3G71S 1K47A 5K8OA 1V6HA 4C48A 3CCJS 2IM2A 3T1HF 3OTOF 2XS7A 2UP1A 2Q66A 4CYUA 2RAQA 2O5DA 2HS4A 2CJQA 3C2PA 3M2RB 3PYGA 1LWEB 2K7KA 3RBZA 2YPZA 2K7JA 3BO2A 3A8JA 2RIJA 1EARA 1D1UA 2R42A 5J2QA 3GV8B 3AD7C 1S1UB 2P9GA 4Q8EA 4DR5F 1S1WB 3C3LA 1QSLA 2AEJA 1M5KC 1E6VA 1I6JA 2KYZA 4U8VA 3PIPQ 3M30A 4DFPA 2DGOA 1RAEB 1WWHA 4RW6B 3DGVA 3A3OB 4F8RA 2IC3A 2OLWA 1QAYA 2ZE2A 3ITHB 1QE1A 3BGUA 2N82B 3E8OA 3CCQS 3FGVA 2FHJD 3MPWA 1H72C 1U2CA 2XLJA 1KN6A 1IM4A 4CH7A 4TKTA 4KGVB 3HHKA 2I9SA 3BH7B 3NGKA 1HMVB 2PA3A 3FQLA 1HNVA 3J81j 2R7VA 4OV6A 4CH0S 4K4XA 1S49A 3UDLA 1FX4A 2V8DA 3CIMA 4I1TA 2DNLA 5I3PA 1OPIA 1WC1A 4RW9A 2ZBPA 2VDHA 2H65B 2MQQA 2KHCA 4I2PB 1WF0A 4B3SJ 2VDIA 2FDNA 3M6UA 1S1XB 3PYEA 2ZOMA 2MMYA 5BYQA 1WSRA 4RUAA 2BANA 3HT3A 4V19J 1EQMA 5IV3A 2HHUA 2V2VA 1RISA 1H2UX 1SPBP 1MSWD 2QN6B 4BBYA 4BCAA 4YHHF 4RW4A 1T0TV 3W2VB 4G1PA 3I5CA 3SQGB 3PW0A 1U48A 2W9CA 2RE1A 2V4RA 5K14A 2ZDPA 1UWAA 3HP6A 3AFGA 3CCSS 1QD1A 2RUGA 4XPEA 4LF1A 2J9CA 1R31A 1FDBA 1LKZA 4CIOA 2R7UA 2ASLA 2R8HA 4IFVB 2BOPA 1ZAXA 2FGOA 2XHCA 2L9NA 4Q7AA 1MWZA 3NY0A 1FWLA 1J5EJ 1UA0A 1E6YB 1X0PA 3TI0A 1RBOB 1WDDA 5DDPC 3N79A 1Y5NB 1XERA 4WE1B 2AF6A 2R8IA 2ZD1B 5DQGA 2MKJA 1OYDA 3RGIA 2CQ0A 1BGXT 4OI1A 2BKPA 2GVDA 2VFRA 1RTDB 3S1TA 4F0HA 3MM8B 3KLEB 2OTLS 5IWAJ 2HURA 4ED7A 3MM5A 1NLKL 1BQNB 1QSSA 2IYGA 5HI7A 1KWMA 2DKOB 3OW2R 1RHJB 1SCJB 3EXCX 4TN2A 1SKWA 1ZZFA 3H98A 2OIHA 1J5OA 2BM0A 3CD7A 1N33F 1IKXB 4A8MP 4ZPDA 2IRXA 4X4PA 3MAHA 3P49B 2DNRA 4MFBB 1CC8A 5DM6Q 1FD8A 4Q44A 3OJSA 2UUCJ 2Y3YA 4JI6F 4CNYA 2F4FA 1RE1B 4OX7A 5DDQC 4XK8C 2XI2A 4NLPA 2H48B 2V8GA 1T9XA 3IBWA 2IHR1 4ILLA 5D4LA 3RAXA 2LA6A 4LBIA 2GMLA 1UW9A 2OO4A 1WHXA 3POTB 2B6AB 3OXLA 3UVJB 3QIDA 3CMES 2QTWA 3U1LA 4TXSA 4ZOSA 1S1TA 3G4SS 4NRUA 2PFFB 3KNAA 2VFTA 3M2VB 3OL6A 1WDTA 3KLGA 3MDFA 1BHNA 3L95X 5ETKA 2J6TA 3R1HA 1REGX 1RJJA 1C1BA 2YKQA 3RB6A 3NGTA 1KTQA 2DGWA 2ZZNA 1S7HA 5FDLA 2B7CB 3F56A 3G2XA 4DF4A 2HRYA 3UPFA 2RT3A 2JFKA 2NS1B 1FJGF 4LF7J 2VQEF 4YR0A 2KRBA 4JV2A 2WTFA 4RBUA 4NLXA 4WFAQ 3BM7A 4DPWA 3MCNA 4A8FA 3BSOA 3S7RA 3AAWB 3NOGA 2RQ4A 3PHEA 3WC2A 5IM0A 3QZ8A 3NBPB 3GFXA 4JI0F 2GIRA 1NKBA 1Y00A 4X66J 2MPUA 3K57A 3NAHA 1NK8A 3U27A 4EK2A 2AJ4A 2LXFA 4NA3A 3ONQA 1PYOB 1D09B 1KEKA 1U1QA 4K2XA 2V8VA 4YOEA 3TAMA 4O3NA 1RYRA 5M2RA 2JJ4D 3HVRA 3A8IA 4NZ0A 4FF1A 2R7WA 1UFKA 4U95A 3HPOA 5C5JA 1GTEA 1U02A 4IDKA 4TY8B 5ETQA 3LP2A 4B3TF 1VC0A 3X1LB 2B4PA 2BE2B 3PFOA 4WF9Q 2EC0A 3D1HA 2W2NP 2OPSA 4ZJLA 2CWKA 3ZTSA 1WG5A 1EP4A 1WOPA 2JHEA 5CZXA 1UFWA 3BGFA 2ZVIA 5M2PA 2UVUA 3PR4A 2JC0A 5JVGQ 1EKRA 2OUGA 2PMWA 1AUSL 3I4PA 3KK3A 2GIQA 3DI6B 4OZ0A 4RNNA 2BE9B 3KK2A 2Y9HA 2DNZA 5LXRA 3VAKA 2XZWA 1N36J 4Q45A 3VZHA 3H5YA 5B0AA 4DL5A 1GMUA 2DB1A 3V2UC 4EYHB 3NGDA 2MKCA 4EO6A 2XMKA 1VQLS 4NXMJ 3R3TA 2JZ5A 2IBOA 1MN7A 1T95A 4DV6F 2YWEA 4DL3A 4OZ1A 3OHAA 1WI6A 3JSBA 1TTHB 4LF8J 3C16A 3IMQJ 2H5JB 2YNFA 1X4EA 5IZHA 4ZLJA 2MKYA 5DGAA 2F7VA 4HI2A 3TJ8A 5L38A 3N6LA 4DG1A 3G6XA 3T5JA 2HBQB 4DDFA 2IMWP 2X3GA 4CLSA 4Z7CA 4CYUB 3FEXB 4F7VA 4HVZA 4DV2F 1R6VA 3HVAA 1UVJA 3DXSX 1SVDA 1JMTA 5J2QB 3OV7A 3MFHA 2QLJB 1C0UA 3MMJA 2XMAA 4IRDA 4KT0C 1E6VB 2BJ8A 4KO0A 4F3MA 4LFAJ 3MTJA 1HNXJ 3UDEA 3TZZA 1RKJA 4Z2XA 4LF9J 4NMLA 4ENOA 1YDLA 4FBUA 3CJQA 3H90A 2QA1A 4K5RA 3KYLA 1I94F 4NYPA 4QYZK 2P9EA 1D9DA 1T05A 4M94A 1Q16B 2XCAA 1RADB 2WOMA 3VAJA 4DV5J 2Y0SD 3P6YC 3HHLB 4Z7YA 3KMQA 1IJEB 4OZ2A 2W9AA 2AD9A 1RT6B 4OI3A 1HWLA 2DTJA 4RW9B 3MMBA 3QFHA 3B54A 1W26A 2ABYA 3FCWA 3HSZA 3RB4A 1VGYA 2NSCA 2JVOA 1UEUA 3J80U 3J81Y 4IG3A 5K9FA 4L3KA 4RW4B 1GAOA 3DXBA 2MQPA 1T02A 2N7CA 1U1LA 5IWAF 3MPUB 3DOMA 1B99A 3DGPA 3VZIA 1TKTA 2I0XA 2HNYB 5K14B 4F0KA 4IO9Q 4K4TA 2F63A 2F8MA 1LFWA 3CVKA 4DV4F 3TANA 1UVLA 4L3NA 5C42B 1RU2A 3U1NA 4DMZA 2VBZA 4UZBA 1UVNA 5GADI 4B3RF 2K1RA 3V4MA 2XC9A 3VAGA 3RBDA 2J5AA 1ZTWA 2VD3A 4ZVOB 5HMZA 4TQSA 3Q8RB 5EWGA 2I2YA 2KVIA 1QTMA 4PG6A 1ZZNA 4IOBA 1PSDA 3DNCA 5IQQA 1ZTTA 4AD6A 4G1QB 4NEZA 2DPJA 2OSQA 3TVZA 3RB0A 4V1Ak 2PC6A 1HR0J 1UMJA 1GXUA 2L08A 2YKNA 1N5YB 3MMAA 3ISNC 2HHPA 2N3LA 3ZZZA 3VGTA 3MM5B 1H0HB 4P7TA 2XSJA 1IVZA 1MWQA 2DGXA 2LQ5A 5D8HB 4LR7A 1ZM4A 4EEYA 1WC5A 4FPIA 4WJBA 3D4JA 1WF2A 5KG4A 1ULRA 3PRVA 1VI7A 1IWGA 2VG7A 1O0PA 3V81A 3ULHA 4ZIWA 2KZMA 2ZWPA 4QW9A 2GIFA 4USJC 3MEKA 5KFSA 2HS0A 1RHQB 4ED6A 5IXUA 2XULA 1NJYA 1VQ8S 2JFDA 4PUOA 4OZJA 3MEDB 2DK2A 2EVZA 4EU0A 3FDSA 4LJMA 2W9BA 1JLBA 4HTJA 4HDGA 4CO2A 4YN3B 2HHHF 2YBVA 1FFGB 1IBLJ 5KFZA 2XMJA 2A1BA 5LMUF 4M5DA 4J9NA 1FESA 1C1BB 3C6TB 3AD9C 1NDPA 2MZTA 1YTYA 3D0HE 3GYGA
chains in the Genus database with same CATH topology
2V9KA 2DR8A 4QYZJ 5FDLB 5KFWA 2NUHA 5T7LB 2QE5A 5E3CA 5DLGA 3MUMP 3DHWC 3PJXA 3Q24A 3K7RA 1TL1B 1UA1A 1WG1A 5D4NA 2CQPA 1GH8A 3TQ1A 2J76E 2ACYA 4ZPCA 1QM9A 1FERA 4B9TA 1LQ9A 2RKIB 3AJ1A 4EFAC 4DQRA 3OL9A 1FJ7A 2ZHAA 1PC5A 1DQ9A 3KLHB 1S6PA 3N6MA 1WHWA 4H4OA 3BF4A 4YEAA 2M5YA 3HHLC 1TP7A 2JWNA 1VQNS 2OPPA 4AXJA 1S9EB 2CQGA 2EWHA 2N7YA 4NZ7A 3DU5A 4DL4A 2VODA 2XGQA 3B4MA 3DRRB 2VZ9A 2XEXA 2FHKA 1UVIA 3RZAA 4OX6A 3MR5A 1GT8A 2HFZA 2R7QA 2L48A 3W2WA 3CJ4A 4QWDA 3DLGA 5KFEA 3CD0A 3NL0A 2GQCA 4K4SA 3QGPA 1VIOA 3IAS9 3H40A 1L3UA 4KBIA 3Q0AA 5IQ6A 2EFVA 2Y1IA 3KG4A 5L1IA 4DPOA 3PY8A 1FDDA 3CEDA 2EBGA 2ZOFA 2M88A 2MSTA 2VG6B 3MI7X 4PR6A 3MUTP 1DTTB 4DFKA 1WG4A 2KFZA 2HWHA 3FVYA 3NS6A 4BDPA 4FF4A 1URRA 2GJ2A 3LAMA 1WTFA 2AJ1A 4C8OA 2V4JA 1KLMA 1CLFA 1DLOB 2EFOA 3QO9A 4N47A 1ZBTA 3M9OB 4QWEA 2W7PA 1KSPA 2HNDB 3MM6A 5KFFA 1RT7A 4AL5A 2NYIA 3EXYA 2XSFA 3M2RA 5LJ3Y 2D41A 1JLGA 2HYIB 1T03A 3TAMB 4ECQA 3CD6S 1XBWA 2IRUA 1XR7A 1HI0P 4YB7A 3BO3A 1SKRA 1C0TB 5IT0A 2MB0B 4G6VB 3AA9A 4B17A 2WK4A 1NK4A 2I5JA 1HFEL 5D77A 2FHOB 4PQAA 4C3MA 5DQHA 2EK1A 2VBWA 3UR0A 4UW2A 1X4CA 2ZJRQ 1YJVA 5G0RA 3GV7B 2YTCA 4X62F 1S1UA 2RRBA 1S1WA 2C3MA 2HPUA 2RU9A 3DN9A 3M6VA 5GAHI 3L7OA 3JSYA 4IDKB 1TKZA 4C8ZA 4KV8B 2W4DA 2M3DA 4F4XA 1G7CB 4F4ZA 2WHOA 1NJXA 3ZZPA 1S6OA 2E1AA 2UXCF 2HHWA 2W7AA 3LP2B 3CO9A 3J7YU 4E98A 4C2MA 3QWUA 4DSFA 4AXIA 3I82A 4RW6A 1U25A 4EUVA 1FRKA 1TVRA 2EBEA 5HROA 3PRBA 2WB4A 3L7PA 2J9DE 5J2MB 1S6QA 4I7FB 4R5PB 2PGCA 1NK6A 2VFUA 3CD5A 3K2YA 2BBEA 1VK8A 3ITHA 1NNDA 1UVKA 2H9ZA 3VALA 2M52A 2UUAF 2GNKA 1KFSA 4DSKA 2LEAA 2D3ZA 1JLCB 3CGIA 4X4SA 3CUNA 3FRZA 3HDSA 3VF0B 1L3VA 3IGVA 2E1RA 2Y1RI 3RBEA 3RRGA 2HG4A 1S76D 5A8RA 4NX9A 2KM8C 2B7BB 3UWTA 1HQEA 1XEZA 1Y3KA 1TV6B 1OSCA 3PIOQ 3T5KA 5K8PA 5DM7Q 1QAXA 2HNZA 1NRKA 4MTPA 4ZS6A 2QO3A 2DHGA 5F8MA 4X65F 4IUFA 4CT8A 2B4OA 2AU0A 3HHNB 4DS5A 2DR9A 3D0IE 1M0SA 3O2IA 2RS8A 3AJ2A 2AYEA 1FNMA 4LVNP 1EETB 4UQTA 4AE5A 4KAIA 3CB4A 4CO0A 3HXMA 1JXEA 2XY5A 3SV3A 2Z2LA 2CVIA 4GKKF 3KK2B 1MMDA 2MXYA 2WBRA 1TFYA 3G86A 5SUHA 3UNGC 5D6GA 4AYBD 4DL7A 2MQLA 1R8PA 2LXIA 3HX9A 2VC0A 1SB6A 3Q2SC 2EFQA 2O01C 3OTDA 2GGPB 2HAIA 3MMCB 4C4WA 3H5SA 1IKWA 1R27B 3VQSA 2CQBA 4OJ1A 4Q2LA 1ZETA 1OO0B 2DNNA 2IM1A 5DGBA 4OJ3A 1A6LA 3MGJA 4R8UB 2R8GA 3GG0A 4A8QA 5KT2A 1RT2B 2BQRA 3OR1A 2AQ4A 1Y3JA 2ZZMA 1HL6A 3GWCA 3DRPA 5KFGA 3MEGA 1M5PC 5D4PA 2O3DA 1H3DA 2ILZA 2DCLA 2M8HA 4CTAB 4LUBA 3SZ2A 2RSQA 4HH1A 3LF0A 1O5JA 3O5TB 2AV5A 3P96A 3R27A 1S1XA 1ZAWA 2ZFHA 5A2QY 5AJ3F 1FO1A 4OHZA 3O3LA 1FDNA 4XDCA 5KG6A 2VQFF 2B4VA 5I4MA 4NLSA 3UCZP 4TU7A 1MU2A 4OI6A 2XY7A 3SCKE 5J2NB 3LOUA 4A47A 3M8SA 2Q43A 2GO9A 3IG1A 2QA4G 2FJVA 2FJXA 4NCBA 4LQ3A 1X5TA 3M6WA 2ZH6A 4DR6F 2ALZA 2D9PA 4DSJA 2DVIA 4DR7F 5HBMA 2XWYA 3N9UC 4E8UA 5GAEI 3EGNA 5MLCV 1T3NA 2Q3PA 4JI5F 1G1XA 3W2VA 2KHDA 3T9NA 3BQ2A 2OH2A 4I69A 2R4FA 1NKEA 3KLIB 5HO4A 3X3UA 3HHLA 2RF2B 3SQGA 4BHQA 3Q23A 3DMJB 3I0SB 1KD1T 1TUVA 2PMZD 2IAJB 1AROP 1YIJS 1X9SA 3E2EA 3HJFA 1U09A 1C4CA 3R5CA 3K5PA 3KLFB 4KHRA 3D28A 5J2PB 5A0YB 5KFUA 1JJHA 4UOCA 2YNFB 1QJHA 3MZIA 4C3LA 1R0AB 3M30B 2JEJA 2KZZA 3IAM9 1CG2A 5EDWA 4O44A 3LO3A 3RU0A 1MW7A 4PPDA 4QJVA 1RT6A 4K0KF 3DC2A 2LA4A 1SXLA 4CNZA 1PO6A 2IC3B 2FHJA 2R7OA 5LSRA 3DRSB 5E3QA 3TO8A 4DG1B 2BJDA 1FRIA 3V6DA 4DHVA 4URSA 2HFOA 4EWTA 5CA5A 3Q8SB 1BY9A 3W7BA 4C3KA 2ZE2B 2CQCA 4NLWA 1QE1B 2HQ3A 4I6AA 4UY8T 1UP1A 5CHCB 1XNQF 2W25A 4B08A 1K1QA 3PEHA 1D8ZA 2PMHA 3HKWA 4ICLA 1JLQA 2D1CA 1FXRA 1XMQF 4C0OC 1UJ5A 3QLHB 2J7WA 4IFVA 3TVKA 5B0CA 1HPZB 2DNPA 4DLEA 1WHVA 2FIUA 3ZZYA 2BV3A 3I5AA 4F02A 2FD2A 3RYLA 3GR1A 3BREA 1Z2LA 2QA4S 2NR0A 2YH0A 3VAHA 5KFDA 1NK0A 3I9V9 4C9DA 4PWUA 1YRTA 4A8OA 3LPYA 1FT8A 2XMVA 4O0IA 1E6YA 1RT5B 3BO4A 3BDPA 5KFIA 1IQZA 1XTZA 1HNVB 2RRNA 2C2EA 4WE1A 2YH1A 5H9EJ 1TL5A 3OJUA 4FXDA 2M4MA 4HT5A 4PXBA 1LK7A 2PD1A 1N6QB 2XI3A 5KFPA 1JLAB 2LVWA 4DQSA 2E29A 4EZ6A 1GX6A 2MQNA 4KB7A 1C0UB 3THTA 4BC7A 5KFCA 3RW6A 1HBUA 2HIQA 1F60B 2HNYA 2F8HA 1Q4RA 2KFNA 1A7GE 3CJ2A 4KO0B 5DG9A 1XR5A 5E0OA 1RTDA 4Q2MA 3OL7A 3MM8A 3NCQA 5T41A 2OSRA 4WZQA 3J7ZT 3KLEA 2JL9A 2KFYA 2YX7A 3GMGA 1Q7LB 1VFJA 3DU6A 3GIJA 3ICLA 3FFIB 2RDJA 2JH3A 3HKZD 3PXGa 1U1OA 4URQU 1GQEA 4CQ1A 2IM3A 3HFKA 4CI0B 5C42A 4RW8A 2DGQA 1WEYA 4RU2A 4RWXA 2HWIA 1SH2A 4N56A 1KOHA 1S6UA 3ZZTA 1T05B 2BANB 2B51A 3IN5A 2CPHA 4C8NA 3PO4A 4YUDA 2DR5A 2GMHA 1YRXA 2WSCC 3P3DA 2RMLA 3LQVA 2ASJA 3MR6A 2MYFA 4O4GA 2QT7A 4OLPA 1NHVA 3GFZA 4QIGA 2WOMB 1UWBA 5A8WA 4B9UA 3PEJA 1CQNA 4QIVA 5AXMA 1Q53A 4LFBF 3L09A 2M0GB 5F8LA 3MPVA 2RH3A 1HW9A 2OPRA 3DM2B 3O6QA 3UCUP 2B5JA 1U26A 2CQ2A 4MIWA 1S0OA 1AUDA 4Q8FA 1SIZA 1UAWA 1SL2A 3KK1A 1X0FA 2FB0A 1V3ZA 2AYBA 2PSZA 1IKYA 2UZAA 2W9CB 1SI9A 1Y0HA 4NOHA 4AFFA 1XNRF 1TKDA 3IC1A 1WI8A 2RQCA 3CCTA 2DCUB 1IKXA 4IFYB 4MKBA 2WONB 5F8JA 3F44A 3I9ZA 4NLRA 4WTYA 2YQ3A 5FLXY 4ECYA 4XO0A 3FSIA 4ECXA 3W3SA 5KT6A 2KJWA 2AGOA 1HBOA 5HMYA 3MCSA 1GXTA 3QWPA 4DEZA 2DHSA 3LALA 3ETOA 4C7QA 5EGYA 1OS5A 2CQ3A 3DRXA 3JAMY 1ZYQA 4OZ5A 4MFBA 3UE2A 4OHXA 4YR2A 1NH7A 5H1SV 4G1QA 4USHA 5I3UA 1JNRB 2QEXS 2MZJA 1VQ5S 4DUYF 2QIFA 4XAKA 4J9OA 4K4VA 3MMBB 2POKA 3DRYA 1ZM2A 1RTJB 2ZNYA 3DDNA 3DDKA 4Q5VA 2FJBB 3M2UB 2YNHA 4QU6A 5KFXA 4PRFA 1VRUB 2B43A 1N5YA 1B0VA 1S48A 5BJRA 3IGNA 3LWLA 1M5SA 3THVA 4AL7A 4F2RA 1S10A 3K5NA 4NLYA 2F8EX 3RR8A 3CDBA 4YMEA 3H59A 3VAFA 2FLNA 1H98A 1JKHB 2YX1A 3D1QA 3K5LA 3EZUA 3F41A 2B9XA 2KXHA 2AP6A 4QIEA 2V9WA 2CPIA 1QVGR 5F9NA 3POTA 2E1MC 2HMIA 2G13A 2B6AA 2VBYA 3LP0A 4IG3B 2CPZA 2VUGA 4GO5X 5B0BA 4ZCIA 1WEXA 3QJLA 2ADCA 4XDDA 3H2LA 5F9LA 1HBNA 4AQYF 3CJ0A 2VBXA 1Q8BA 4QQBA 1R8AA 2G9OA 2ROGA 1IJFB 1NZAA 1I1GA 4TY9A 3HVTB 4X2BA 3OL8A 5K8MA 3IR6B 4NZ6A 1TKTB 3M2VA 4F50A 4K50A 3H4DA 2BUNA 4IR1A 1FKPB 4ECUA 2OPQB 2UUBF 2HHSA 4KQZA 3H4BA 3MD3A 2ZVSA 3BSNA 5KFMA 3OUYA 3B8HA 1DJ0A 2KB2A 5DLFA 4FBTA 1KVJA 1JLEA 1X4AA 3DLEB 3TUJC 3DLBA 3C6UA 3KJVA 1SJFA 1BQXA 5KG7A 2DNOA 2V4QA 2QLXA 2VOOA 4G1IA 4FS2A 2VFVA 2R2SA 4HLBA 2XY6A 4ILRA 4I67A 5B0GA 4B3OB 2VG5B 1RT1B 2LKZA 3GE9A 1D8YA 4ZKAA 3NWGA 5EX0A 3D2WA 3DOLB 3TX8A 4DFJA 4ED2A 1R6YA 2MY8A 1FRHA 2RVJA 4ZP8A 5E7OB 3MR3A 1FK9A 1MMLA 3G8TA 2AGQA 2RB7A 3QIPA 2R2UA 2FUG9 4DLGA 2K1RB 1FE4A 2A2CA 1MNEA 2OD4A 4PQUA 1APSA 3MEEA 5EUHA 5KT7A 1CSJA 3EGZA 1FXLA 4IYQA 1VQYA 3MEDA 1J5OB 4B9VA 1K9MT 5J1EB 2BA9A 3E3XA 3FZ2A 2Q6CA 4J5OA 4O4RA 4FNIA 1RTIA 2GX8A 2C22A 5DJBA 2UUWA 2P6TA 4O3SA 2KG0A 4N41A 4IQMA 1RQ0A 2APOA 1R8BA 4ATNA 4F26A 1F9FA 3Q8QB 3A8EA 1KLNA 1D9AA 3JSMA 4DR1F 4ECZA 4AL6A 2Z2MA 3S6EA 3I0RA 1LW0A 4B02A 5DETA 5KOWA 2MZQA 2UV8A 3G9CA 4GC7A 4KFBB 4RW7B 3VAMA 1K0VA 3TR5A 3ZC4A 4FYDA 2R7TA 5LL6d 2DH9A 4RUHA 3BS9A 2XNRA 3DLHA 3LGMA 4ZPVR 3SCIE 1QVFR 2HRUA 3LP1A 2XGPA 2R9LA 1FNOA 1S9GB 2WB1D 1OWXA 2YKNB 4PXDA 4PCQA 1R8HA 3MMAB 3JB9k 5GADU 2GCFA 3OXFA 2RILA 1SJ4P 2KU7A 2NZ4A 4ID5B 3C6TA 2XSJB 4I0WA 2IRYA 4ZK7M 5DG8A 5L8RC 2CG4A 3BSCA 1S0VA 2DGTA 5L9XA 3IO1A 3I55S 2ZOGA 1TL3A 1UJ6A 2HGNA 4HT7A 3PX0A 2PT0A 2UUTA 5F41A 1LXJA 2D3UA 4LT6A 3VR1A 1RKIA 2LXUA 2V2KA 4DF8A 1XMBA 3K8WA 2XCPA 2XMMA 3KMSA 4A8KA 4OHWA 1N0UA 3PACA 3PW2A 1B0PA 5E41A 1FKOB 1S1TB 3N28A 5E3RA 2RD5C 4IQXA 1GTHA 4RX6A 4F67A 3GFYA 4YY3F 2CQ4A 3KLHA 2VV5A 5D3GA 2ZH7A 1MWYA 2RS2A 5CZVA 2QSWA 1G6BA 1X7VA 1RWUA 4Q0BA 3KLGB 4DR3F 3B78A 4TY8A 2YKMA 1VQ7S 4YR3A 4FS1A 1VQKS 2F9DA 2E5JA 3QAEA 3JYTB 2B9WA 1RTHB 2BE2A 2HVZA 4NA2A 1QAIA 5IT9Y 1DARA 3I87A 4FZVA 2JEGA 2DNGA 3GIIA 2W8KA 3NAIA 5GAGU 3IWLA 2JSXA 4ED5A 2VG7B 1RA6A 1FF2A 2JOQA 1BC6A 2QLWA 5AXLA 3DCAA 4KC5A 3D54A 2CRLA 1KTVA 4B3MF 4CCHA 1IUJA 5F0WA 1L5UA 3VQTA 3CJ3A 5FJ4A 2OMOA 3KFWX 4HH0A 4ID8A 1UFLA 4C11B 1U2RA 2C3OA 3MM9B 4WCEQ 1HQUA 3J7YI 4WFZA 2F4VF 2CQIA 4HI1A 4Y0FA 1LOUA 3LAKA 5CCMA 3MUVP 4A8XA 4NCGA 2X1AA 3MOJB 1SBRA 3LANA 1Q8IA 5KG3A 5HP1B 5KFAA 5I42B 5DG7A 4ED0A 2HHQA 4WXOA 3KHLA 2EK6A 2U2FA 2ASDA 4JV1A 4PUOB 3I6PA 4ES2A 3L3CA 1U24A 1JIHA 3IFEA 4CO4A 1DQAA 2XMWA 4EZ9A 3CDEA 2PI5A 4JI7F 2B56A 4NPOA 4O23A 2MZ1A 3JTOA 2W8LA 5L1KA 1ZH5A 1NK9A 2MZRA 2E5HA 4DV7F 3DI6A 3MECA 2JEIA 3MM7A 3PW4A