2B7CB

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Elongation factor 1-alpha
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b7cB00
2VQFF 4B3RF 4NXMF 3R3TA 1LOUA 4LF8F 1CQMA 2F4VF 4DR3F 4GKKF 3T1HF 4DR7F 1XNRF 1N33F 4DR6F 1B64A 1HNZF 2BXJA 1HR0F 5AJ3F 4AQYF 4DR1F 1F60B 4DV1F 4DUYF 1IBLF 1N32F 4JI6F 4DV3F 4JI5F 1XMOF 2UXDF 4LF5F 4JI8F 5BR8F 4JYAF 1IBKF 5IWAF 3OTOF 2VQEF 2KJVA 3T1YF 1XMQF 2UXCF 1N36F 4DV7F 1CQNA 1HNXF 1IBMF 1G7CB 4LF7F 1QJHA 4X65F 4KHPF 1FJGF 4DV6F 2UUAF 4X64F 1IJEB 2HHHF 2BVZA 4JI0F 5LMUF 1IJFB 4GKJF 4DR5F 2ZM6F 4LF9F 2YY3A 4JV5F 4B3TF 2UXBF 4LFCF 1J5EF 4DV4F 3ZZPA 4JI4F 1RISA 4JI7F 1G1XA 1VMBA 4DR4F 4LF6F 4LFAF 1GH8A 2J5AA 4DR2F 2RJZA 2KJWA 4YY3F 2E5LF 4B3MF 4OX9F 4DV0F 4DV5F 2UUBF 2B7BB 1FKAF 4DUZF 1I94F 1XNQF 2UUCF 4LF4F 4JI3F 1HNWF 4JI2F 4NXNF 5LMNF 4K0KF 2UU9F 4X66F 2B7CB 4X62F 4DV2F 4YHHF 4B3SF 4LFBF 1N34F 4JI1F
chains in the Genus database with same CATH superfamily
3NGKA 3GV8B 3SCKE 4B3RF 1G3OA 4OFZA 2UUBJ 4LRCA 4CO3A 1JKHB 1UEUA 4RW6A 3QGGA 4UOGA 1BGXT 4N8OA 3C6UA 1SL1A 2E5LJ 2KG1A 1FD2A 3KLIA 4KB7A 4NEYA 3B4MA 4A47A 2JL9A 1VBYA 3ILJA 2WRMA 4RUCA 4DPYA 1M5VC 3FZBA 1VK8A 4HH1A 1VRTB 4DR6F 1FVQA 1JNZB 3OSNA 4B9LA 4WP3A 2A1BA 2N4DA 1B4SA 4DPTA 2RDJA 1H2UX 2FZCB 2HLUA 2X1BA 4JOUA 4ECZA 2PMHA 3SZ2A 1U6ZA 1GFWB 4RNHA 1U1RA 4DPUA 1SVDA 3PO5A 1EJ7L 2FD2A 2V67A 4RU2A 2CNKB 1KFDA 2Y3YA 1JNRB 1S4EA 2VFRA 3V4IB 5L1KA 1YIJS 4XO0A 2WSEC 4DQIA 1AZSA 1N0VC 3DLEA 3QMQA 3I5BA 1NSQA 1S7IA 2E1PA 4ZPWR 5AE3A 3RUBL 3CD6S 3IRWP 3AFGA 2Y1JA 4OHWA 3SQGB 4LJMA 3KG1A 1YJWS 4DX7A 1MG7A 5E3PA 2PT0A 2BRLA 4LRFA 1GX6A 3MMBB 4FPIA 1NJZA 3KUEA 1CC7A 3A12A 2YTCA 2NUUG 1TKDA 4P9SA 1S9EA 1JLCA 4NCBA 2J7WA 1V6HA 2W9AA 1HNXJ 3I96A 2GV1A 3BR8A 1VQ8S 4LF7F 4AL5A 1S79A 1FE4A 2ATCB 2B8QA 2OEMA 3GFYA 4HTJA 1ZTTA 4X4PA 4EMDA 1S57A 3CJ3A 2ADBA 1L3UA 2HIQA 1VQLS 3C16A 1LWCB 1U49A 1KTQA 1VHIA 4K2XA 2PIIA 1HNVA 2A2DA 4OLOA 2BX6A 5GAGU 4A8MP 2F65A 3V81B 1KC8T 1REGX 3KLEB 3MOZA 3QAEA 3PW7A 2FJAB 1LWXA 3H5YA 2KL8A 3RBDA 3NNCA 1MSWD 2LEBA 3AXKA 3IBFB 3IR5B 4TXSA 3W7BA 4DL2A 3EVMA 1FJEB 4FF1A 2G9OA 4WE1B 2XM3A 1NHVA 1S12A 4OI6A 1JLEB 1FO1A 5A6PA 1OY9A 2AJFE 3TW0A 2ZH9A 1WDTA 1U4BA 2VZ9A 3RTVA 4M5MA 4RNFA 2CJAA 3GR1A 2BKPA 3NLCA 3R97A 4OYXA 1HPZA 3LALA 2R8KA 3VQSA 4EU0A 3D9BA 4V19X 5KT6A 4FDFA 3CB4A 1JLAA 1KBRA 2L9DA 4ENOA 1F5CA 1ZPWX 3M9OB 2VDIA 2B0GA 2H65B 2J0XA 3FFIA 2DYAA 3GMGA 4WTYA 2AYGA 2DISA 1X4BA 1UVIA 5CYQA 4V1Ak 1SQGA 4GKJJ 2D3ZA 2E1RA 2AX0A 2G0JA 4HHJA 1PG5B 4QWCA 3TAQA 1SXLA 1FXLA 5IV4A 5GAHI 1NRKA 4QOTA 1VIXA 2DNGA 2KI2A 5AXLA 2IVMA 3GIRA 2XNQA 4ZIVA 3BGFA 5EN1A 3D1HA 1S72S 1J2VA 2MTLA 2KXFA 4RW9B 4QWBA 3N4WA 3OUYA 4NXNF 2WBMA 1U1NA 3GJTB 2UUAJ 1C0UA 3NGSA 4C8NA 2PMWA 2AJ1A 1S1XB 5HQLA 4FF2A 1TAUA 1KONA 2VFTA 1CJUA 1MWYA 3KK3A 1C0TA 4JV0A 1NH7A 4KT0C 3GV5B 2DIVA 3KDNA 2BRKA 3FSYA 1P1LA 3JQMA 3MTKA 1QD1A 3BN7A 3C66A 3H42A 4GVBB 4KKOA 3RW6A 3R5DA 1IKXB 2QLWA 3KXDA 4M63A 1FXDA 2EXUA 2MKSA 5HLFA 1UFWA 3M8QA 1X5PA 3PACA 4O3QA 4EUVA 1XK8A 4B3MJ 3D6MB 1QVFR 5EX0A 2GVZB 2HBQB 3ZZTA 2KXHA 1UVMA 3J7AN 4MK9A 4K4UA 2GW8A 4K5RA 3G8QA 3G6XA 4GO5X 1O0PA 5ETQA 1TKTB 1OPIA 5HJXA 2CQIA 5C42B 5IXUA 4TY8A 3I87A 2PD1A 3FMWA 3RR7A 2H5JB 2MLYA 5KG5A 4B9VA 4WPAA 3LP2B 1HNZF 3A3NB 3DYAB 3A1YG 2R3VA 1U45A 4RNMA 2BE7D 3GFZA 2UVVA 2W4DA 5T7LA 4ZK7M 1SJQA 3GFHA 1WHXA 4L3NA 3D6TB 1VR6A 3CMQA 3Q8QB 3MOJB 1QSLA 2MHEA 2OPPA 1GXLA 3NS6A 4J5OA 3TUPA 4F4WA 4OV6A 5ETKA 4LF1A 3W8PA 4ID5B 1HBNA 3ZTOA 4RBTA 3FFIB 5BR8F 1RU1A 3R8YA 1CVJA 1BUXA 1MMLA 2UV8G 2X7IA 3R5CA 2A18A 1NUEA 3I0SA 4YB5A 3K5OA 3EPIA 1HD0A 4DSIA 3TA0A 1HPZB 3TJ8A 2XS2A 3N28A 3H0PA 4S0MA 2W8LA 2LMIA 2VG7A 4F26A 3ICLA 2WONB 3PNIA 4B3OB 1N52B 4I67A 2BEFA 1Q53A 4ER8A 5J1NA 2B43A 2YNGA 3DHXA 1YSJA 3KK2A 2COLA 3GIMA 3EGZA 1ZAXA 1IQZA 4DDFA 2CWKA 4WE1A 3T19A 4AD6A 2AWZA 1ZYQA 1HYSA 1KTVA 1LNQA 4HYKA 2HS0A 3EZUA 3KJNB 3O3LA 2Z4PA 3EICA 4FNIA 3PY8A 5AXMA 4QU6A 2R9LA 5KFVA 3E3XA 3L95X 3A13A 4X64F 4KY3A 2NZ4A 3W2VB 3IC1A 3N79A 4YP3A 2B4UA 2YQ1A 5HAOA 1KEKA 2ASDA 1F2GA 2DNQA 3D6HB 2B5JB 2OP5A 2QMXA 1H74A 4R0EA 5L38A 1T05A 2R7XA 2ZVSA 1GMUA 2HQDA 2IC3A 2VBXA 1T05B 2Q6CA 3HI9A 4MYTA 5MLCV 5L1IA 2QRRA 3B6BA 5ETTA 4WK1A 2MQLA 2VUGA 5J1EA 2UXBF 3I6PA 4LFCF 1HIYA 1FEEA 2LXUA 4PQUB 1S1UA 2HGMA 5HP1A 4O4GA 2RE1A 1JQGA 5DQIA 3K7RA 2ZH7A 4JI7F 3E51A 3LUYA 4CDIA 1URRA 2ZEJA 1Q0NA 3HHNB 4DR4F 3CJ8A 1N33J 1N5TA 4ZPDA 1T9VA 1XWLA 2NUHA 1EQMA 3UO0A 2K3KA 5B0AA 1VQ6S 4B3OA 3LPEA 2J6SA 4V19J 1VQSA 3CDAA 3VVTA 4ZLJA 2VG7B 3H2VE 3D0HE 4RUBA 4CI0B 2CNOB 3Q8YA 4YR0A 4DV5F 1TK8A 3NG8A 3GYXB 4ECQA 1CEZA 2B7BB 2FLNA 5A2QU 1QSSA 2E5JA 2F8EX 3IMQJ 4JUZA 4DUZF 3OTEA 3V6DB 3RGIA 2Y0SD 1U1QA 4LF4F 2ROGA 1CJVA 5LJ3Y 1CLFA 2EEYA 4Y2AA 3CCLS 2DNRA 4X4NA 4TKTA 2MKCA 3RRKA 2OEJA 1U6BA 2YKPA 4LBHA 4IFYB 3DCAA 2NXEA 4NLVA 1H73A 3UVJB 5I3QA 4A8WA 4WZMA 2CZ9A 4UY8T 4RU9A 1RYRA 2DPIA 2D3O1 2HHQA 4LF8F 1APSA 1RT5A 2GZOA 3KLIB 3MPUB 4I6AA 3QIPB 4A8OA 3X1LB 2UXCJ 3C6UB 3CIMA 1UW4A 3SV4A 4GKKF 4MIWA 3T1HF 1FRIA 2G0CA 1R0BG 2GFFA 3N5FA 2RDIA 2EKYA 4C6AA 1HW8A 5FLXU 1IBKJ 5IT4A 3LGNA 4GMKA 4I56A 1EAYC 2PC6A 3DRSB 4K7QA 3TQ1A 4ZLLA 5DGBA 2W24A 3K8VA 3ONQA 4KSEB 4RR5A 5AT1B 3JTOA 2CQ1A 3O5TB 2IRYA 1S0NA 1SC6A 3JTNA 3MUVP 1N5YB 2BOPA 3K17A 2ZHOA 1FHTA 4YUDA 4ZVPB 3GYNA 1D9DA 1RWNB 2XI2A 4GVBA 3EDRB 3K2YA 3A8EA 3WC0A 4B9UA 2GNKA 3BSCA 2IAJB 2BANB 4B08A 4B3TJ 3NWRA 1YBAA 2XNRA 3DN9A 1DAXA 3KUHA 3OVAA 2V4RA 2X3GA 3A8JA 3ZZOA 4WKYA 1C0UB 5J2MB 2VIHA 4DV3F 2WHOA 4X4OA 3DU5A 5LXRA 3M9NB 4DR5J 3SDEB 2YX1A 3FQKA 1KR4A 2BJ7A 2BW2A 4F04B 1HBOB 2HHHJ 3QT6A 3MF5A 3ZFVA 3W9IA 1Q81T 3T9NA 2MJUA 4O3NA 4RZRA 3LGMA 5IWAF 2M8DB 3QJJA 1GAOA 4RJVA 2NCKL 1DHMA 2DGSA 1HMVA 3AH6A 4KPCA 3FKBA 1L3VA 1JK9B 1IKWA 3GCWP 4D3HA 2KXNB 5KFHA 2QL5B 3LANA 3RAXA 2PMZD 1JJ4A 3TWZA 2VA3A 4C8LA 3WIVA 2R7RA 1PBAA 2JOQA 3L7UA 3LP0A 1AYEA 3OR2B 4F7VA 3PYDA 5LMNJ 1RHKB 1RAIB 1U09A 2ZE2A 1JLFA 2UZAA 1S1TA 4J9UE 2HVZA 4BHQA 3QGIA 4JI3J 6FD1A 1VQPS 2YKQA 1JWWA 1D9FA 3J81j 5D0RA 4ETZA 2RKIB 3J7Z5 2OJ3A 2CPZA 2BVZA 4Y2KA 1NPPA 3GB0A 4IDKB 3ZO7A 2DXFA 4MT1A 4YB6A 1JXLA 3Q2SC 3QGPA 4C11A 1GTEA 3POTB 3CJ4A 3HZEA 1RTHB 5K8OA 3GONA 4DSJA 5HANA 4CO5A 1VQ9S 1WNEA 3U7JA 1HNVB 3V81A 2D3OR 4JV5F 2J0SD 1GMWD 2NQPA 2VBYA 1EHWA 4NYZA 3MEDB 4RBVA 3CC2S 2NYIA 5E3CA 2M88A 2RQMA 4A4JA 4P7VA 5FIIA 1LEOA 3M05A 4C9DA 3I9V9 4GVLA 3W2WB 4J7CA 4F4XA 4C48A 1Q7LB 3MFIA 1RA6A 4J9MA 2DHXA 3P96A 4PABA 4Z7YA 2K7JA 3CJ0A 3RB3A 3RBEA 2I8EA 1RWUA 1GX5A 2C2MB 3PG9A 4C3MA 5RUBA 1RCOB 4YY3F 2HFSA 1UETA 3IS9A 3M6XA 2ADCA 2XMMA 5LMUJ 1R8HA 4WFZA 1X60A 1T03A 2R7WA 2IJFA 2V9WA 2RAQA 2MQMA 2UVUA 4K4YA 4JI3F 3DI6A 3LOUA 1SBRA 2VL1A 4YHHJ 3WBZA 2WTFA 2I5JB 1KHVA 3DRPB 2ASYA 1S49A 4JV1A 4R8UA 2RS2A 3V6KA 1VLOA 3MMAB 5IQ6A 2CQCA 4M5HA 2XCPA 5EGYA 3DLBA 3ZTQA 1WACA 3J81U 1FESA 1W2BR 1RAOA 3RAMA 4FS1A 1FE0A 3E01B 4P52A 5GMEA 2J8SA 4ED6A 3DLGB 2M4MA 3MECA 3ETMA 1Y9OA 1NU4A 3MD1A 2OMOA 5C24A 2MGZA 4NLOA 1HWLA 1Q8LA 2ZWOA 5F8LA 3FNNA 3CO9A 2D9OA 2D3UA 3WQPA 2DO4A 1R0CB 1C1CB 1RI7A 2C42A 2J9DE 4DG1B 3PR5B 4LR8A 1Z2ZA 2MZ1A 3M9MB 2E1MC 2BZ2A 3HVTA 1UWAA 3NRBA 3QNWB 4G1QA 5L39A 4JI5F 4CLFA 3P5BP 2QZ8A 1JJHA 4RWWA 1SKSA 2KZMA 4RL1A 1R8AA 2BXJA 3ISZA 3ENQA 5D4LA 5HO4A 2O1PA 2G2OA 4WBFA 3KLGA 1E6YA 3TA1A 1IBLJ 2GIRA 1S6PB 2IM0A 1RADB 4ELVA 5G0RA 1J5EJ 2F63A 9ATCB 1R31A 5HROA 4XPEA 4MKAA 4DV1J 3CSKA 3W8GA 4BC9A 1K73T 2H54B 2GIQA 1FK9B 1FWLA 4JI6F 1DQ8A 2C1EB 2OLWA 3QT8A 2AEMA 4CM2A 1Y4ZB 3M8RA 3K57A 1T9YA 1FTRA 4I2PB 1VJQA 4NPOA 4ZP9A 3EVWA 3OT9A 2PFDA 3CW2C 4P2XA 3RYLA 3DLLQ 5D4NA 5DZ7A 1S48A 3PW5A 4U95A 4CLSA 5F0WA 2YXLA 2AQ4A 3IRXA 4IFVB 4ED2A 5EX3A 5BYRA 5KFGA 2LDYA 3WC2A 2IVFB 5K14B 1P6TA 4DLEA 4K4VA 2LCWA 2R7OA 1FKOB 2JZ5A 3AQOA 3CCWA 2WVFA 2C3UA 4M5NA 5FDLB 4URSA 4NLRA 3JYTA 4DQSA 2HZVA 4QCLA 1F0XA 2UXCF 4IG3A 3CDEA 2P6SA 2PEHA 4Y2IA 3CCMS 1IBMF 2FHMA 2W9CB 5CZVA 1TK5A 3QRPA 3D67A 1SV5A 4KGZB 4PXEA 5JMNA 2HK2A 4X62J 2KT2A 3MR6A 3LWMA 4IR1A 3T3FA 4FBTA 3X3UA 1T8EA 2BJEA 2F1FA 3DMJB 4ZP7A 4M1KA 1HFEL 1HNIB 3ULHA 2DPJA 2IM2A 4LF4J 2VC0A 2X3DA 5J2PB 2ZOMA 3HLUA 1UVNA 3BEGB 5DETA 5KT7A 1CG2A 4JI0F 4Y0FA 2BOAA 2HHSA 3W5XA 4F50A 2W01A 1L3TA 3G9CA 3O6QA 1EQ0A 2OHDA 2N7YA 3DLHA 3QRRA 3G2XA 4ZVRB 1KVKA 1IR0A 1CS4A 2IDLA 4N76A 1MNEA 2JLEA 3LW5C 2OD6A 2V4JB 4HR2A 4P10A 2HBYB 2OTJS 1KWMA 1NEEA 4WFYA 1BQMB 3LP1B 1JLQB 4WWSA 4WYWA 1K0TA 1WKKA 4WFBQ 1TMMA 2M7SA 4JI4F 4ZN1A 4JI7J 2FPHX 2FTRA 2V8PA 2AP6A 1TU0B 2BKNA 2OO4A 2IDEA 2F4FA 1WF2A 4EWTA 4XK8C 2MQPA 2DNKA 2YWWA 4RNNA 3PW0A 5DG7A 2ZZMA 4IO9Q 1FKPB 1TELA 3MHYA 2W1BA 2D74B 1W2IA 1K1SA 4NMLA 1DBDA 3BH6B 2CJBA 4ZJOA 1R0AB 1U0SA 3OPKA 1X9WA 4AT1B 4L75A 4F3QA 1HQEB 1SKWA 1RCXB 1QAJA 1PJ7A 1X4HA 4ZJLA 3ZTPA 1Q8IA 1PBUA 2HLTA 5DLGA 3NNAA 5K14A 4PWUA 2D7SA 5HK4A 4CH1A 5KFOA 3QBCA 3FEXB 1F9EB 4JI1J 3PHTA 3HDSA 3MEKA 2UU9J 5EWFA 2UU9F 3TJ9A 1UJ4A 2F9DA 4DFJA 1KN6A 2YNIA 3R9LA 1VC6A 1ZM9A 4ILRA 4LQ9A 1WG1A 3HHLB 3JAMY 4JI1F 2MKJA 4I68A 4Z2XA 2CJQA 4DV7J 4DQQA 4A8QA 2OELA 2AT1B 2EPIA 1Z4UA 4NA2A 5C2GA 4KPYA 2F4VF 4Q8FA 4IRCA 2V0NA 2VG5B 5IT9Y 4CO2A 2R2UA 4USTA 3TARA 2BM0A 4MFBA 1WKLA 5KFBA 1YI2S 3GWCA 4L73A 2GX8A 3J7A1 1LXJA 2MJNA 2VFSA 2DNNA 1T9XA 2R7UA 4TU9A 5BR8J 2O3DA 3TAMA 2K06A 1M1KT 1P1TA 2ZBCA 1IXKA 3V6JA 2WW4A 4PYAA 2FJXA 1CJKA 1RHUB 2FVPA 1NH8A 2R7TA 3FVYA 5H9FK 1S9GA 6FDRA 2CFXA 1VLYA 2RMLA 3VR1A 3I56S 1FX2A 3DDKA 2FVSA 1U48A 3ZZZA 4OZ0A 4CLTA 2CUYA 4M95A 3EGVA 4ILMA 4ECVA 2L48A 2YKNB 1AFJA 3RG6A 3VAFA 4I2QB 4K4SA 3BYRA 3IP0A 1IR2A 2AMCB 3KG0A 2IPOB 1RAGB 4FXWA 3M2RA 5BJRA 3VZIA 1HQEA 5HMYA 4LF2A 1Q95G 1KS2A 3BPDA 2XC9A 3HPOA 4JYAF 4HHUA 1SC4B 5KFKA 3EDQB 3MM7A 2P6TA 4G6VB 4HI1A 2LKZA 4OHVA 2AYBA 4ZVOB 2MYFA 4L76A 4QIVA 2R8HA 1GXTA 2IYIA 3DGPA 2KFYA 4DV6J 3G6VA 2XMUA 4UZCA 3QRQA 5CD4H 1CULA 2Z2MA 2VQFJ 3MMCA 5I3UA 2V8GA 1BHNA 2P9CA 3W2WA 1RU2A 1WOSA 2F5GA 5JVHQ 1NK9A 2Q3PA 4K50A 2EFOA 2XG8A 2HHVA 1IVZA 1R7IA 1UFKA 3PXGa 4RUAA 1VHFA 3MEDA 4YR2A 3PYEA 1BWVA 4PYDA 1KRPA 3HP6A 3C15B 4ZVQB 3QO9B 4PZVA 5B0DA 3R1HA 3GR0A 2J6TA 1B0VA 3SFUA 2XSJA 4BC7A 1NDKA 1REVA 2CQ2A 4CTAA 2W2PP 3BSNA 2QEXS 4GKJF 4MK7A 2IHR1 1MLAA 2FVCA 4NASA 4ZCLA 1ZBTA 3PM9A 2YY3A 3OR1A 4LR9A 5C25B 2MKYA 4QR0A 4DMZA 4JI6J 1NBEB 3AHPA 1FDAA 2KB2A 1QUPA 2VBWA 3CO0P 2XWXA 4QWDA 3MURP 3RRGA 2HBRB 4LQ3A 3FZ2A 4IOCQ 1KSPA 1LV5A 2QFIA 2KM8B 3CC7S 2VG6A 4W98A 1JLFB 4USJC 1N5VA 1YZ7A 4FVCA 1ULRA 3AJ1A 3R6GB 4EO6A 1FT8A 5B0CA 3KMSA 1B3TA 4DSLA 3L4BC 4P6QA 1RT6B 4YN3B 2IBOA 2GVDB 3DOKB 3Q8VA 5FDLA 2JEGA 3SCJE 4J9NA 2KDOA 1VQMS 1X4FA 2WZ1A 1IKYA 2L08A 2XYHB 1LKZA 2FHKA 1HMVB 4CLPA 4YDDB 3DGPB 3UN2A 3HHDA 1E6VB 4PUOA 5F8MA 1SPBP 1YBUA 2YWGA 3I32A 2EFQA 3J80Y 4DL3A 4PRFA 2B9WA 2QL9B 2YH1A 4EO8A 1WDDA 1FKAF 2DKOB 2ACMA 2YKOA 3QPIA 3AB4B 2JH3A 2MQQA 4IH5A 2CA9A 1FNOA 1VC0A 3FDSA 1S6QA 2L9NA 1HHSA 1RABB 1X5OA 3GLJA 3MPWA 3N6LA 1IKVB 2BACA 4QQBA 4C97A 5CABA 2YKNA 3JSRA 2B7CB 3VTIA 2BMBA 3KJVB 4LF7J 1NO8A 3Q8PB 3PW4A 2FVQA 2HMIA 2OSRA 4LREA 1RWVB 4Y3CA 2VC1A 3G82A 1RSCA 4PAAA 3CCTA 2NPFA 4QPXA 1KNZA 2HSEB 1TV6B 1N5YA 1OS5A 1D0EA 3DXSX 2E9RX 2QX0A 1EARA 3Q8RB 4DLGA 2OIHA 1D09B 3NAHA 4KE5A 4M5LA 4M5IA 5L8RC 4YY3J 3OL9A 2J0QD 3UWTA 2H1YA 4ZVFA 1I51B 4PQAA 5DO2A 4YMEA 4ZVGA 3MMAA 4TU8A 3KLVA 1QTNB 4U8VA 5HVFA 2DCLA 1B0TA 1G2EA 3CD0A 4OZ2A 4U7UK 3M32A 1EETB 1LWEB 2NSCA 3THTA 4NZ6A 5GADU 4CP5A 2BJ1A 5F8IA 4W90B 1DQ9A 4QIGA 4MK8A 3PDNA 5KFDA 2BE9B 3HHLA 3MM6B 1RZMA 3UVJA 3HF5A 4K4TA 4QU7A 4M5DB 2H4WB 3ELHA 2KHDA 4M5JA 2KT5A 1FRXA 2DIUA 3IWLA 2J9DA 2ZBRA 5EHHA 1TKXB 2J9EA 1XMOF 4OX7A 3RW7A 1U1PA 2QV6A 3VQTA 5BYSA 1HKAA 1SC1B 1F2HA 4E0DA 2CZ4A 4NEZA 3HMJG 3PJWA 1N4LA 3HHLC 3KHRA 4C3LA 1PAEX 1JX4A 3IBCB 4CT8A 2ZHAA 4EZ9A 3JSYA 3UR3C 2KJVA 4ZS6A 4G1PA 2IM1A 3D66A 3UDEA 4QYZK 3CDUA 4DS5A 1RT3A 4FKYA 1NK4A 2HWHA 3AA9A 4WIIA 4DZDA 5LSRA 3K0JA 1NNDA 1ZZFA 2ROPA 2IRXA 2Y8YA 4DL0C 4EI2A 4NCGB 2FVRA 4B3RJ 1VYAA 2EFVA 2MZTA 2V4QA 1UAWA 2PI4A 3K89A 4G3IA 3MEGA 3F41A 3SFGA 1RT1A 3BS9A 3DRYA 3JXOA 1SL2A 3BGOP 4ECSA 1KLNA 1HNWJ 4AYBD 3CUNA 1JJ2R 1TUGB 2FC9A 3DLKA 5IWAJ 2NYHA 3KUGA 2H5EA 2ZDOA 1FEHA 1VFJA 2MDAA 3HD2A 2QA4G 1VQKS 1RHRB 2V69A 1NXIA 4J9QA 1BQXA 1DTTA 4HT5A 1VCTA 4DL5A 1T9UA 2IC3B 4DR5F 2B6AA 5D6GA 4I4BA 4PCQA 4R5PB 4ZIWA 3J80U 3U1NA 2B5JA 3T41A 4U67Q 1U0HA 2CPJA 4A8XA 4Q8EA 4Y65A 1Q79A 1ICEB 4Q43A 3OFGA 3N0VA 1WOPA 4OYOA 3AODA 4F36A 1Y5LB 4HEA9 2CQ0A 5CQGA 1U25A 4F3MA 4DV4F 3MUMP 3FGVA 3PEHA 1RYSA 1RQ0A 4KGMA 4NZ7A 1UPPA 3RZAA 2LQJA 3S1TA 1TZ0A 1Y3KA 3SIPB 3MM5B 3TP2A 1T3NA 3C2PA 1MU2B 4DPOA 3T5JA 1S6UA 1HBOA 1N6QB 3D5MA 3KWMA 4CO0A 3SSRA 2A2CA 2ERRA 1NMEB 2HZCA 3T1HJ 3SDEA 4GKKJ 3BF4A 1VI7A 5EUHA 3CD7A 1NPKA 2DGWA 2BJ9A 3QAUA 3THPA 4ES3A 1DLOA 4IFVA 5I4MA 2OMLA 3JQJA 3IR6B 2RF2A 1RLDA 1UA1A 5H1SV 4IH6A 5B08A 2C22A 1HBNB 1X0PA 4PG6A 2QFJA 3EGWB 3IWXA 1S0MA 2ZVIA 2RT3A 3BN4A 2L9WA 1FK9A 3OV7A 4L3KA 3CJ5A 4X66F 1MWZA 3NP5A 1J5OB 3AAWB 2HQFA 2CVEA 5GVQA 3W65A 1N34F 3HCXA 3PTWA 4OI3A 3J7ZT 2HNYA 1S6PA 2LXIA 5IFMA 4DWIA 1E6YB 3OBIA 1CQMA 1X7VA 2VDHA 3H98A 2CPIA 4DV5J 4EK2A 5HSPA 1UJ5A 1NK5A 3OVBA 3UFCX 4QW8A 4QYZJ 1NK7A 3LGHA 4TY8B 1RT5B 4NOHA 3ZNJ1 4DR7F 1TKTA 2HNYB 2A6MA 4TVAB 4DG1A 5CCLA 3CNQP 1KDNA 1UWBA 4DOZA 1U8SA 3KKFA 4DR4J 1N33F 2L3MA 5A0YA 3A4TA 3W60A 2D1CA 4P2MA 2X1FA 3GYGA 3H4BA 3U1MA 2AJ4A 2V68A 3JS9A 2FC8A 1HR0F 5D15A 4DR1F 3E01A 1NK8A 5JVGQ 3T6BA 2C2DA 1EIYB 1NB7A 3HKWA 3J7YI 2RF2B 5GADI 3H5XA 2UXBJ 1QSYA 4EYHB 2V8HA 2H5IB 3LH2S 1NKCA 2VONA 3GJSB 1BC6A 3CJRA 3DOLA 1S1WB 1FDNA 2R4FA 3VZHA 2CRLA 4A48A 4BS2A 1PO6A 5KFAA 4OI0A 3OUYB 2VASA 3DI6B 1NAQA 2PEBA 2QMUB 4OZJA 3NGRA 4EGLA 4IOBA 2KRBA 4WFAQ 1S97A 5LXYA 1QE1B 1N0UA 1N48A 1Q86T 4PWDA 2DGXA 1N6QA 3DGVA 4X64J 2BQ3A 4DSFA 3C3LA 3S7RA 4DPXA 2UUTA 3MM5A 1MMNA 2DR8A 4KBIA 4OYMA 4DFKA 1D1UA 1NKBA 2BQUA 1HLWA 5D0EA 5IT9U 3G8TA 4KTQA 2MQ8A 2H48B 3PYGA 1W25A 1SJ1A 4I64A 4YFUA 3W5ZA 1KQKA 3BZQA 3KK1B 3D2WA 2DNZA 1QDUB 2HS4A 4ZMMA 4ELTA 3MTJA 3CCUS 3J81Y 4ECXA 2QL7B 4OHZA 2BM1A 4N56A 7AT1B 1UP1A 2DHAA 1YK9A 5ADZA 3OTOJ 1JLEA 2IA0A 4J9PA 4F25A 5CAAA 3PZPA 4OZ1A 2BYCA 4ED4A 4PG5A 1H98A 4OJ3A 1KLMA 2LEPA 1FCAA 2YNFB 3L9ZA 2NPIA 2DH7A 5KFYA 1TAQA 3POTA 1TFWA 2A10A 1XQIA 3EUNA 1WHWA 4QR1A 1KLMB 4PXCA 3CVKA 4WU2A 3CCQS 2CAJA 2N3LA 1YJNS 2YX4A 1YX2A 3CT9A 2RKIA 3UD5A 5AE2A 2P2CB 3QZ7A 2XGQA 4LFAJ 3ZTSA 3KK2B 4USVA 1B99A 4NX9A 2ZZTA 1GXUA 4IKAA 3SCIE 4J9OA 2ZE2B 2EBGA 5AJ3J 2M3DA 4CLWA 4JP8A 1U26A 3OR2A 2XB2D 5KT2A 4L72B 1YDLA 5FLXY 3SXLA 1HI0P 4USHA 4LFAF 1P8GA 5B0BA 2CDQA 2XULA 3PYFA 4K5SA 1BXNA 2B4OA 3N01A 4HL9A 2XMJA 3GIKA 2E7VA 2XHCA 5HL7Q 2C28A 4OX9F 1FNXH 2UVWA 4B3MF 1N8RT 1NDPA 1OQ3A 2V2ZA 3BJYA 3PKYA 3BM7A 4P74A 5KG2A 2NXUA 4IO1A 4IR9A 1LXNA 1CBKA 2XLKA 4AL7A 2B3TB 1VRQC 2VV5A 1HWUA 1U7LA 3A3OB 4JI2F 5KFWA 5T7LB 1Q8BA 1LWEA 1EETA 2OD4A 2ROEA 4K8RA 4K0KF 3CCRS 4AL6A 5A76A 1ZM3A 4YB7A 5A2QY 4FYVB 4CT9A 3V4IA 3TOQA 1XNQJ 2IM3A 1ZETA 2D41A 3BDPA 5JJBA 2AJ2A 1LOUA 2OGUA 2QT7A 3IA0A 1S6OA 3GIIA 2I9SA 4YB1P 3R1LA 2IRUA 4F02A 3H20A 3M8QB 3KHGA 2CPYA 3L7PA 2G2ZA 1UWBB 1F3VA 1N5QA 2W4PA 3OD2A 3TO8A 4XPCA 5HJYA 2HHUA 4OYZA 5ETVA 3CCVS 2FJVA 2O67A 3PKMA 1XC9A 2XSFA 3FEYB 4UY85 2AX1A 3QSIA 2RD5C 1G4CA 1WI8A 2D69A 2DVIA 1YTYA 5A8KB 4OZ5A 3TEHB 2NXCA 3NGDA 1HBUA 2XMTA 4TLRA 4DUYF 2ZOGA 2CPHA 2ZNZA 1HR0J 3LF0A 1KKHA 1PAUB 3P3DA 4H54A 2Y1RI 5CYQB 5F3TA 4Z7CA 3KLHB 1E6VA 1NKEA 1XBWA 3PIPQ 4C8MA 6AT1B 4LRDA 5KFLA 1KQGB 5LSLA 3RRHA 2E9ZA 3AB2B 3GPAA 2RRNA 3MWBA 2SXLA 5H9EJ 4CLZA 3GG1A 5HMWA 2QMWA 4DR7J 2HHTA 2B9YA 3CEDA 1NB2A 3DOKA 1UZDA 2WSCC 2FZGB 2NR0A 1A6LA 2FJDB 1JXVA 1J27A 5MAOA 5D3GA 2VFVA 4H4MA 1RLCL 4D3GA 4ED8A 1HNXF 1Y00A 2O01C 2JLFA 1LWFB 4U8YA 3TI0A 4X65F 1EKSA 4WF9Q 2GHPA 3KMQA 3H59A 1RJJA 3NCPA 1RE1B 3NOGA 3ILLA 4ETXA 5DQHA 3LAKA 1IWAA 3OSPA 4FXVA 2XS7A 1HWKA 4CTAB 4ZCIA 5KFJA 3E8OA 2YX7A 4PQUA 3BR9A 2ZBPA 1ZS6A 2RHSB 1RAEB 4DF4A 1LWCA 2ABYA 4N5SA 2AGPA 1JLGA 3TA2A 4U96A 1Z2LA 3OXGA 3CJKA 1D8ZA 3BSOA 4FBUA 4LF5J 1RTJA 1VK3A 4TQRA 2OPQB 4ANEA 3BO3A 4LF9F 2GQCA 3SQOP 1FFGB 3D68A 4DZ6A 5HI7A 1WSVA 2VB6A 1K44A 5B0GA 3WHIA 1FRMA 2MLXA 5DJBA 4X4QA 2OFHX 1CULB 4WCEQ 2XZTB 4ZCKA 5B09A 1NCLA 1YJVA 1WG4A 2QG9B 4AXJA 1OWXA 1ZM4A 5KFEA 2MXYA 2EFPA 4YDXA 4J9LA 2JEJA 2RILA 2GGPB 1SCJB 1UW9A 2DHHA 2MHNA 4OQJA 3D0IE 4ZKAA 1IQTA 3BPSP 2E66A 1XR6A 4F3OA 2YNGB 3MCOA 4DI6A 2WVEA 5KG0A 2VQFF 2CDRB 3DC2A 1RT4A 2XYGB 1QE1A 2ZD1B 2OKQA 3PX0A 2E9TA 3CCJS 1L3SA 2R7SA 2CPFA 1RT3B 2BJ3A 3FBBA 3M2RB 2DBBA 4FN5A 4ES2A 2ZITA 4OLPA 2WAQD 1T94A 1Q5VA 3THVA 1HQUA 4ZOSA 1H3DA 3TYTA 2KZZA 3DOLB 2NXNA 2C2NA 8AT1B 4B17A 1RHMB 4N8NA 1OYDA 3OXLA 4K4WA 4KAIA 4B9SA 3BQ1A 3NMRA 4WZQA 4ALZA 2MKIA 1PKUA 1GK8A 3IN5A 2E5GA 4DV2J 4PWWA 4YR3A 5A8RA 1FDDA 1RAFB 5IT0A 3LQVA 4KHPJ 3SCLE 2GQQA 1RWPB 5ETMA 4YOEA 2ZNYA 4ZPTR 2YBVA 4O3SA 3FQLA 2XTJP 1NM2A 3WX8A 5F8NA 1X5SA 4I7FB 3AXMA 2M9KA 4OYAA 2GCFA 1PYSB 4Q2MA 3MZIA 2LFVA 3QT5A 1XNRF 3R2CJ 2MKKA 2W8KA 2I38A 4OHYA 4PG8A 3WX4A 2GJFA 2W25A 3BGUA 3R5JB 5HMZA 4Y2CA 2ASLA 3OL7A 4Y28C 3UQSA 1Q7YT 5FJ4A 1NDCA 1TL3B 2CJXB 1XMOJ 2KG0A 2VBZA 2KHCA 1TV6A 2VOOA 3R27A 3DLJA 3IO1A 5DDOC 5B0FA 4AQYF 3G82B 2BDPA 3R5GA 4OMFG 3IAS9 1YGYA 3D0GE 1CJUB 1Y7PA 2ZJPQ 3NGUA 4PXDA 3T5HA 4RWXA 2ATLA 4KIAA 3G4SS 5IM0B 1VS3A 2AYEA 2ZH8A 3HO1A 5CH7B 2V34A 4LF5F 3ISNC 5DLFA 4WK3A 2F8HA 5I42A 1YJUA 3C19A 4L74A 4MH8A 2KVIA 3PCOB 3VF0B 2L41A 3K5LA 1HA1A 3GJRB 5F9LA 1SQEA 5F8HA 2A0FB 3D3BJ 3WZ0A 4E8UA 4Q44A 5K8MA 3CIZA 2XLIA 2R7QA 3GE9A 2I1RA 3ZXWA 4ZJQA 3TZYA 4IRKA 3KOAA 1LK7A 1CQNA 1IKYB 4EBCA 1T02A 1HWIA 4F4ZA 5KFXA 2VPZB 2CQ3A 2GVDA 2RNEA 4OJGA 3T5LA 2EFNA 4UW2A 4NLTA 2AD9A 4IG0B 2CJ9A 2B6AB 4O3RA 1F3FA 3PRDA 2HBZB 5DZ6A 3IAM9 1GMWA 4ECRA 1LQ9A 1SIZA 2UUCJ 3IWNC 3OFFA 3US5A 1IJEB 2B8PA 1WEYA 1D3WA 2DB1A 2RH3A 2W2NP 1WD6A 2P5VA 2EWHA 1RXOB 4KQZA 4MJKA 3A3PB 2GC8A 5H9EK 2IVYA 2LQ5A 3OR1B 2Q1LA 3DLKB 2ZKUA 4JI5J 3KDOA 2LQ8A 2IFXA 1RT1B 3PRBA 3Q23A 3I31A 2XEXA 2FGCA 2JJ4D 2HEKA 3QO9A 4TY9A 4O0NA 3HZGA 3KLFA 5DM6Q 3W64A 4WP8A 3CWJA 2HWTA 4DX6A 4Q45A 4UUWA 3FSIA 2Q79A 4FNHA 1H72C 3CJQA 2G2YA 4RO0A 4DHVA 1FRKA 3EYZA 1ROFA 2AYMA 4CNZA 5DG9A 4IQXA 1S9EB 3HJVA 1LK5A 3IRXB 2F8MA 3Q8UA 3CMES 1FX4A 2HQIA 2YKMB 4OJ1A 3R5BA 5F9NA 3VAGA 1M0SA 1EB0A 1PC4A 2KJWA 4NLXA 4R25A 4DCJB 2Z2LA 4CLUA 3AT1B 1TUWA 3HFKA 3MM8B 4DV0F 4DN9A 5CYJA 2YNHA 2GAHC 4CYUA 5DDRC 1ZZNA 4M5DA 5E3AA 5E5NA 1OY8A 4P2FA 5HQ8A 4J91A 4ZVSB 2K7KA 2QN6B 5G0RB 3U02A 3V6HA 2FYXA 7FDRA 1U1OA 1P9YA 3NCRA 1YG0A 3GIJA 3PJ9A 2H3EB 1IN0A 1V9OA 4QIFA 1AZSB 1BQNB 2QE5A 4HT7A 5DDQC 1U8WA 1VGYA 4JI2J 4B3SF 3PIOQ 1X31C 2KYZA 5E3RA 1QY7A 2DNOA 2HNZA 3HVTB 2G0IA 4G1QB 1H7WA 4ATNA 2ZH6A 4MTPA 3DKDA 4FP9A 2MQNA 4HH0A 4GO7X 1C1CA 1WC4A 4WXOA 2VPYB 2FJWA 2XY7A 3NL0A 5GAEU 2R2SA 2QC3A 3IGNA 2ASJA 1LW2B 2C2KB 4DR3F 3PVXA 3TAMB 5B7WA 1UCNA 3DOMB 3DLGA 1MN7A 1NSKL 3PO4A 3LWLA 4RKUC 4F0KA 4YS2A 1NJIT 3F56A 2HFUA 3CE8A 2WVBA 1FI4A 1YJ9S 1S4FA 1JLBB 4QIEA 3AD7C 2HMIB 2Q66A 4JYAJ 4MFBB 2WB4A 4G1IA 3W9HA 5KG3A 2VG5A 4PR6A 1ACMB 1R8BA 1O51A 4DCOB 1IKVA 5AJ3F 2I5JA 3ZTRA 1RWKB 1HNZJ 1F60B 3M8ZA 3NS7B 4ZITA 5IZHA 2BQRA 1WELA 1T03B 2F7VA 1QAXA 3OQ2A 1CC8A 3MPDA 3QFWA 4YQWA 3VCDA 2DJWA 2J7UA 4H4KC 5FD1A 2CQ4A 1H7XA 4AXIA 3HT3A 2ZM6J 4QYRA 3IS9B 4CM0A 4HACB 4FF4A 2UXDF 1NZ8A 3RB4A 1S0OA 1T11A 3MAAB 2HRYA 4MAKA 1WEXA 2OH2A 1HL6A 2DGOA 3BDEA 2B9XA 3FBCA 2CQBA 4OYPA 5KFTA 3UW1A 4NA3A 1X0FA 2PFFB 4IH7A 4RW8B 3OTOF 4O3OA 3KJQB 4UUXA 4JBCA 2Z0GA 2DT9A 5T41A 4C0BA 2F4VJ 3G8SA 1R0AA 2EG1A 4DV7F 1RDRA 2RRBA 3CJ2A 4USWA 4W4MA 3KLFB 1M5KC 1RT7A 1Q16B 3IR7B 1FKPA 3K5PA 4GC7A 1WI6A 4CQ1A 1QJHA 4ITSA 2JDJA 2FHJD 3DM2A 3HHKA 2ZH4A 3CMAS 1FJGF 5E2QA 2C3YA 4NI2A 5C25A 3UNGC 1AXQA 4J9VA 2QTWA 4C11B 3OLBA 3SI8A 1BQMA 3LP1A 1REVB 2E44A 2GQ2A 4IDKA 3VV2B 4C98A 2ZWPA 4X4UA 2LQ9A 3C15A 1ZOTA 1CS4B 1LFPA 1KOHA 2CXEA 1YRXA 1TP7A 3QLHB 4GC6A 1M1HA 2XWYA 4E98A 2YWEA 3C14B 1XTZA 1OQ6A 2OAUA 2DR7A 4DL7A 1IM6A 2RDDA 3LP0B 3ZZRA 2DNMA 2Z56B 1S5ZA 3HX9A 5L9XA 3TEGA 4F0MA 5M2UA 3BO2A 3NKYA 4LUBA 5J2QA 1RTDA 3MMCB 2DY9A 5IC4B 5I3UB 2RVJA 2UUWA 3ZZPA 2VKRA 3UDCA 3DMJA 3IM8A 3HD1A 5T14A 3R7BB 2B9EA 3EVOA 1IBCB 1HI1A 1RKIA 5DGAA 4JI4J 1Y10A 3ENWA 4DS4A 1M1GA 3HSJA 3OHAA 2FLPA 4KC5A 4DN0A 2W9CA 3AY0A 3MM7B 2C2RA 1SH3A 2AIRB 5IOLA 2HQ3A 1VIOA 2AEFA 3FEZA 3J7YU 3OJSA 4YEAA 1S1VB 1WC0A 3JYTB 1GNKA 3C6TA 1F9FA 2GHVC 4DL4A 4I2QA 4NLYA 4RW8A 5J2MA 4B9NA 1DFDA 2HFNA 4JI0J 2POKA 4KV8A 2HS3A 4B9TA 1YHQS 1L5UA 2BANA 2HGLA 1FA0A 2PN6A 4LIWA 1FF2A 1UFLA 1XR5A 2OPSA 1IR1A 4UOHA 1EZZB 2JC0A 3R2DJ 4I2PA 1AA1B 1MN9A 1TL7A 1YRTA 2JVOA 4K2JA 3M2VB 2CIMA 4O44A 3GP9A 4X66J 1WTFA 3ILOA 3F73A 4MKBA 1TL3A 3RAQA 4X62F 2IMWP 3P5TL 5KT5A 4LFBF 3LTOA 1HW9A 2HURA 2GIFA 1RTIA 3UD4P 2YQ0A 1IBMJ 1KVIA 4QJVA 3SSQA 3IBWA 3IM9A 1SUQA 1L3KA 2MLZA 5E3QA 5CD4A 3KHHA 3FC9A 2DNHA 2YWKA 2ZUGA 4KH0B 3VAKA 3CPWR 2VHGA 4J9KA 1JLBA 3DDIA 2CJYB 5BXIA 4ICLA 1R3NA 3K58A 3M8WA 4PPDA 2X1GA 3CF5Q 4DF8A 2HHXA 2HFVA 5C2CA 2JSXA 3DOMA 1CJTB 1B64A 1D8YA 3B78A 1LW2A 3QWPA 1WSRA 4RPFA 5C24B 2MGZB 2GHWA 2ZHBA 1WOOA 4OV1A 4ILLA 1NSAA 2XYPB 1W7WA 4O4RA 2VJUA 4NYOA 1O8BA 3M4XA 1ZPVA 3AOCA 4DV1F 4DV4J 4RUHA 4KO0B 3PR4A 3IGVA 2FHJA 3BV8A 4NRUA 1KHWA 2DXEA 1X4DA 3D1QA 5G4DA 5J2NA 3LAMA 3UR0A 1BQNA 1IBLF 1NHUA 2XCAA 1EP4B 4NLDA 2AJQA 3R6LB 2YWHA 2J7KA 3HFZB 1DY3A 2G13A 5L1JA 3VAMA 1FJ7A 2KO1A 3C8YA 5IS2A 1U1LA 4CYUB 2AJ0A 4ECYA 3DDNA 1X9MA 3MM9B 2YNHB 3M6UA 1GMVA 1XMQF 4DU8A 1I3OB 1QUVA 3H5SA 3EZOA 4NLQA 2XLJA 1YRUA 3BO4A 2LECA 5ETLA 1PYOB 5KFFA 1VRUB 1U2CA 3CDWA 5D4OA 2YPZA 4DFMA 3NEKA 2XZDB 1JLQA 4KYZA 3SMZA 4LVOP 8ATCB 5HP1B 3NNHA 2V4JA 2HAIA 2I0XA 2LU1A 3HVWA 1MW7A 3DRRB 3IFEA 3M1VA 2IJRA 4I6YA 3BB5A 4NLUA 2GMLA 5GMDA 3TX0A 4F4KA 3GSIA 4TQSA 2C3PA 5AXNA 2DK2A 2XI3A 4HVZA 3OXFA 3CJKB 4C7QA 3EZ5A 2VODA 2YVSA 2V2VA 4ZP8A 3T1AA 4U7UD 4QWAA 1N54B 4ANDA 3LPYA 1QLNA 1H2VZ 2J8AA 1T9TA 2R7VA 2DNYA 1TVRB 1N88A 3FCHA 5KT4A 2DO0A 5J2PA 2HHPA 3AOAA 1XJWB 4TYAA 5LMUF 4JI8J 1RAJA 2O5DA 2BR0A 7FD1A 2PO4A 4ZVHA 5I3PA 2EKNA 5ETNA 2X51A 3BGLA 3T9ZA 2GMHA 3I4PA 4OL8A 5JUMA 1MROA 2J76E 2C2OB 2RQ4A 4P71A 3CCSS 1AT1B 4UT4A 4NA1A 1K8AT 4WFXA 1RISA 2DRDA 2WONA 3D28A 3O1LA 4H4MB 2X1AA 4HTIA 1PSDA 3OHBA 2VICA 2AV5A 1NJWA 4K4XA 3CXCR 1DTQA 4LRAA 1RBLA 4ELUA 4R0JA 3VAHA 2V2KA 3TZXA 3HSZA 4X4SA 3I0SB 4TYBA 5HBMB 2F3JA 4OYIA 3MR3A 1W26A 3NOCA 4PG4A 4DR2F 5D77A 4OJHA 3TRGA 3BBBA 2LEAA 3MCNA 2K1RB 2LLZA 2VOPA 4RBUA 4BLGA 3LO3A 1H6KX 2V5HG 2RRAA 3VAJA 4ZN3A 2G1DA 3L09A 1RWXB 3IG1B 4H4OA 4PG7A 3M6WA 4K59A 1WKJA 5HROB 2JLGA 4FS2A 2JWNA 5GAHU 4NZ0A 2VD3A 5LMNF 3H2LA 2KM8C 2FB0A 3EXCX 4OX6A 1TR0A 3MCMA 4EYIB 2UV8A 3VGVA 2UVRA 1BY9A 2EBEA 2HVEA 2IAJA 5C42A 3RBZA 1AW0A 2BBEA 5F3ZA 1FTCA 3QFHA 4J90A 3RBXA 5E7OB 1FD8A 3OL6A 2G4BA 2RUGA 2V50A 3S6EA 2VH7A 1X4CA 2PSZA 2DXDA 2WK4A 3D3CJ 3G87A 5ETSA 3I5AA 5IC6B 2HQCA 4AE5A 2R8IA 4C8ZA 2Z30B 1WHVA 3DRSA 4I1TA 2LDIA 5HVGA 4KKOB 1D9AA 1YZ6A 3NY0A 1V3RA 4N7TA 1KD1T 4LT6A 3TVKA 2CG8A 2DR5A 4I7FA 1C0TB 2C3MA 1RACB 4IOAQ 1LW0A 2HG4A 2V6AA 2HPUA 3Q89A 4OZNA 5CHCB 4BWMA 3SBMA 1KQSR 1Q8KA 3T5KA 2Y1IA 3QIPA 2DD8S 1UPMB 1RBAA 2FLOA 2OEKA 3I9ZA 1NJYA 4MKYA 4FF3A 2ZDPA 5HQMA 5CA5A 5LL6d 4WFNQ 4CLKA 1C4AA 2CVIA 1C4CA 3QWUA 3W63A 1OMSA 4EFAC 5HMXA 1U1KA 5LM7E 1I1GA 3CCES 4IFYA 3D1OA 4TLQA 2JC1A 1R6YA 3BSAA 1VJWA 5HN0A 2WVDA 5D4PA 3NBPB 2G1HA 4KRWA 3ILIA 3O8WA 1CJVB 3G86A 4NE9C 1JXEA 1A7GE 3EMTA 4WJBA 2N3OA 3NMAA 1F5BA 1VQOS 1R6VA 4CLLA 3SV3A 4OYBA 4ED1A 1TQLA 2R2TA 1IBKF 2KN4A 2HRUA 4FYWB 4AFFA 4LIRA 1WF0A 1PILA 2ZC3A 1FWPA 2NSBA 1BE4A 3W66A 4DPWA 1RT2A 4LBIA 3BGRB 1UMJA 2GS8A 3CCZA 5ITHA 2F9JA 2ZD1A 1YQHA 1N36F 4LF8J 1RGVA 5D78A 3NS5A 1U24A 1CPZA 2GJIA 5E41A 2CZVC 4RW4A 3MEEA 1X4EA 5LJ5Y 1WF1A 2Y0BB 5M2RA 1GT8A 3JAMU 2JNJA 4DV6F 3H5UA 4U9RA 5KG7A 5CZXA 1RTHA 1NK0A 2B4VA 1M5OC 5KFIA 3UPFA 1WC3A 4O4GB 2VQEJ 3T1YJ 1S1UB 3SYZA 1O6XA 1U1MA 2KFZA 2DITA 1WEZA 3MGJA 2GO8A 1FERA 4DX8H 4Q0BA 3G6ES 2B4PA 4ECUA 3CJTA 3HJFA 2CWXA 3NWGA 4C4WA 2CADA 3C16B 2OPQA 1AUSL 1IJFB 2I6WA 4CRJA 2WOMB 5KG4A 3RB6A 1S1TB 2Z2ZA 3FJ2A 4O0IA 2RQCA 1ITPA 3VVUA 5JXSA 1TTHB 2DNLA 4J37A 4URGA 5L9NA 2GA7A 1WORA 1S99A 2JVRA 4CLYA 2QIFA 4CWBA 2MB0B 1N32J 1FJCA 4MMOA 1WWHA 3HKZD 3G96A 2FDNA 1KFSA 2MSTA 3KK1A 3QATA 3UCGA 1VC5A 2PGCA 2LYVA 2CNLB 1AROP 3TUJC 4ZA1A 2KYXA 3HSDA 2BJ8A 2N4CA 3OFHA 1HYSB 2HFOA 2XMWA 1NDLA 2ALYB 4UOCA 5K5MA 2YQ3A 1FWKA 2Y8WA 1A9NB 1UA0A 2CQHA 4RW4B 1LWFA 4P72A 4CO4A 1WUUA 4I69A 3M6VA 2WBRA 1TK0A 2U1AA 4LFCJ 2YWFA 3SQGA 4PWDB 2DGQA 3VWSA 4XIUA 1R43A 4O3PA 1RP5A 4IUFA 3HVAA 4UZBA 2M5YA 1WHYA 4CH7A 2WB1D 4NLWA 2ZC4A 3DXBA 4TN2A 4OHXA 1IWGA 1SL0A 1V5VA 2BW7A 1OPZA 2HAFA 2EK6A 4HDGA 1I94F 1OSCA 2QSFA 4USKA 1JJCB 3FRYA 2DHSA 4ID5A 1Q4RA 1Y0HA 1TUVA 2RSQA 2YPYA 3RU0A 2VU5A 4K4ZA 1T95A 1DZ5A 5AXKA 2XQCA 1NK6A 3AD8C 1UVKA 4ECWA 1T7PA 3A8KA 3FUYA 3MAHA 5K20B 1I94J 1HBUB 4KGKA 4Q2LA 4BDPA 1CSJA 1TKZA 2CQDA 3R3TA 1OO0B 5F41A 5A8KA 2QA4S 4Y6IA 3KG4A 1OIAA 2DR6A 2FUG9 3DYAA 2AF6A 2QYGA 3LA0A 3LP2A 3N5BA 5KFNA 2CNNB 1LW0B 3DFEA 2HW3A 3MXHP 4DSKA 5EWEA 3W62A 5ETOA 3M7VA 2BKOA 2BE2A 1TKZB 2F40A 4M8LA 2R8GA 4CCHA 2RQKA 5IV3A 3FRZA 3VGUA 4F4AA 5F8GA 1UTAA 2Z2YB 4ZCMA 3OW2R 1VQ5S 2K8GA 1J5OA 4DQPA 2C2ZB 2ZOFA 4KHMA 2EC0A 2UXDJ 1TL4A 4ZVTB 4N77A 5HLFB 2ZFHA 2DEJA 2WCXA 2YH0A 4ZPVR 2XMAA 2VF3A 1UJ6A 2IJNA 5KG6A 3V6DA 1K47A 1VQYA 2NLWA 3KK3B 2PA3A 3HT0A 2CQGA 4MIAA 3TAPA 1S1XA 1N32F 1SJFA 1HBMA 1RBOB 2U2FA 2P9EA 3PHEA 3GTYX 1RHJB 4UTGA 4DFPA 1UKUA 2DH9A 1QM9A 3OVSA 3QQCD 2CPDA 1WC6A 1TFYA 2ZUAA 2P8IA 3I5CA 3NCQA 1FNMA 2VQEF 4P2SA 4DR3J 3T1YF 1VQ7S 4GRSA 1C2PA 4F0HA 3AQPA 2JHEA 1Q82T 2XBPA 2OTLS 4JB8B 2CYYA 5KOXA 4C8YA 1G7CB 2RU9A 1DTQB 2DCUB 3FSXA 1WJ9A 2LP4A 5H9FJ 4OI1A 4Y00A 2EFGA 5J1EB 2H4YB 2E7XA 5A8WB 4U7CA 1N36J 3HFVA 3ITHA 2UUAF 1I5OB 2HYIB 2WOMA 2LA6A 1MROB 4IYQA 2ZH3A 4PPZA 3GG0A 2KKHA 1PGZA 3P6YC 2AZ1A 2ZH5A 1ZM2A 5HATA 5LSOA 3W2VA 2E29A 1TL1B 1NZAA 2PDAA 2DRAA 5E33A 2QLJB 3WIUA 4E2FB 3ZNUA 2AW0A 3QJPA 4ED3A 1XN9A 3OFEA 1EKRA 1YWXA 3KLEA 2YNFA 4WYLA 2KT3A 2QGFB 3MEGB 3R5AA 4FVMA 1TVRA 2PE8A 5KAKA 3QJLA 3GQCA 5GMKa 1S9FA 3MEEB 4ZPBA 2AU0A 2FJBB 1ZAVA 4ZPAA 5A6WA 2FIUA 4NCGA 1J5EF 3G6YA 2XZWA 2HKEA 3KNAA 4B9MA 4KGXB 2BA9A 1AB8A 1M5SA 1VISA 3DNCA 2W9BA 3BGRA 2C3OA 4ZVEA 2MZJA 3DRRA 3UI3A 3H4DA 4NLGA 4A8KA 4CO1A 3D6FB 1XEZA 1YKWA 4BBYA 3QZ8A 1HHTP 1V3SA 1N56A 2JEFA 3CC4S 4LMZA 2J9CA 1YVFA 2J5AA 4G65A 3K5NA 1KOOA 1VRUA 1GH8A 2UP1A 3AJ2A 3MMBA 3V5RA 1YBTA 2M70A 1TKXA 2MZQA 3NBPA 1XR7A 4PKDB 5DQGA 5LT5A 3MM9A 3PRVA 3S8SA 3CD5A 3MAQA 2OPPB 2QO3A 5E0OA 2WSFC 2A3JA 3ZZUA 3HK2A 3N9UC 1VBXA 2UUCF 4OZ3A 3TUZC 1P27B 2BABA 2HVIA 3KJFB 1OSDA 4QIWD 1HQ2A 1VDHA 1EP4A 3M32B 3QGHA 4PEOA 3AJDA 3DLEB 1HBMB 1S1WA 1ZTWA 2ZZNA 2HVHA 2MMYA 3KNGA 1B0PA 3UE2A 2GAGC 4Q7AA 4ZLNA 4YHHF 2XO7A 1URNA 3ET6B 4U6PA 1H2TZ 2ZJQQ 1BLUA 1RHQB 3QYYA 1SC3B 3GJQB 4M5KA 2Z57B 3OTCA 4ZP6A 2XHWA 2DR9A 1T9WA 4P75A 2GVZA 3MPYA 4DL6A 2KFNA 2A6OA 1GTHA 3TJAA 2HHWA 5A0YB 3TNVA 1CJTA 1YJRA 3TZWA 3D54A 1IKXA 1HARA 1S7HA 4DR2J 2O66A 2BE2B 3I55S 1SQFA 4ICLB 3UD3P 3AOBA 3ZC4A 1VQNS 3UCZP 3JSMB 3MUTP 4ED5A 2XMKA 1YJTA 4KR0B 4KHRA 1NJXA 4WP9A 1SUQB 2NXJA 4LR7A 1JKHA 2ILZA 3FCVA 3HSGA 4RW6B 4F4YA 3TUIC 5J1PA 3EGNA 3MR5A 4RW9A 4TU7A 4EEYA 1FXRA 3IG1A 5A8WA 1Z1ZA 2MY8A 4I0WA 2MPUA 4NLPA 1F6TA 1BWEA 3ENVA 1RA7A 3DU6A 4JV5J 3OTBA 4AQYJ 2K1RA 3IXQA 2IA6A 4OX8A 2PI5A 3H7HB 2DGVA 2ZH2A 1TL7B 4O44B 4JI8F 4DR6J 1ZA1B 2NREA 2OPSB 2FQQB 4MIBA 1SJ4P 1YITS 2AGQA 1JLAB 1XNRJ 1DLOB 1KP6A 2R2RA 3UN3A 3AA8A 4M5GA 1DURA 2B51A 3BKFA 3BYPA 3H25A 5L1LA 1S1VA 3V2UC 2DNPA 2IIHA 5BYQA 1RK8A 2YKAA 1S76D 4RNOA 1MU2A 1C1BA 1GQEA 2AKWB 1O5JA 3BKUA 3MCSA 4IQMA 2LQBA 5KFRA 3M8YA 1WC5A 3PJXA 4FKXA 4KHPF 4Q5VA 1WTBA 4L6V3 2W2MP 2CPEA 2R42A 3UDLA 3GILA 2ZH1A 3P8BB 4KFBA 1DRZA 3PFEA 2N82B 1XMQJ 2ACYA 5DRKA 1VBZA 4LSLA 2APOA 4WIQA 4FZVA 1IM4A 1X4GA 1Y11A 5K9FA 2LA4A 3VGTA 5J2QB 2HHHF 3H90A 1RWWB 5LOQA 1U0HB 2M8HA 2QLXA 4F2RA 4QW9A 4R5PA 1XIQA 3W9JA 3C14A 3M30B 4CIOA 1DTTB 2KU7A 3PX4A 4DV3J 3QLHA 1ZH5A 1QAIA 1UVLA 3ENAA 2Y1LB 4A8FA 3VHQA 2DHGA 1FVSA 4Q0BB 4B3TF 2MKHA 1JLCB 2NS1B 4C8OA 3Q8SB 2GJ2A 3U27A 4LBPA 3GV7B 5KG1A 4QR2A 3OJUA 1PYTA 2HVDA 5EDWA 2AZ3A 1B70B 1RT7B 2E7WA 2QA2A 4USUA 3TX8A 1H38A 2JFKA 3KTQA 2QLFB 3UN5A 1B7FA 3B54A 4Y2MA 1M5HA 3OTDA 3ZZYA 1NLKL 4RW7B 1RT2B 3P45B 4LF9J 5U47A 2XGPA 3VAIA 2DRBA 2HGNA 3EXYA 4AUKA 4C0HA 3BH7B 5J2NB 1RWMB 1TMJA 2RUSA 4HKQA 4F8RA 3JSBA 4ECTA 1DJ0A 2EVZA 4LFBJ 2DY1A 3VALA 2J6UA 1V3ZA 1RWOB 2E5HA 1LFWA 1S9GB 2GO9A 1AFIA 4DXLA 4DX5A 1CJKB 2IBKA 2DH8A 4X65J 4CZCA 2EW9A 1VRTA 3MM6A 4KGVB 4ED7A 4DUZJ 2IMOA 4M94A 3K59A 1G6BA 4NRTA 4RX6A 5DS7A 3R7SB 2VPXB 4NXMF 3DHWC 2FY8A 3MDFA 3JTPA 2ZJRQ 3TZZA 3P4UB 2W7OA 1NHKL 3MD3A 4NWBA 1RKJA 3ETOA 3AD9C 1AUDA 4FXDA 3TANA 1SKUB 2W4CA 2RIJA 3N6MA 4B02A 3PX6A 3RB0A 4ERDA 4MKVA 1UEKA 1RTIB 2CG4A 5KT3A 2W2QP 1P9QC 4ES1A 3K8WA 2E1CA 4USIA 2YNIB 1RAHB 1R89A 2XO6A 4LSZB 3Q24A 4X2BA 1T3OA 4Y34A 3W3SA 2ZBQA 4HDHA 5F8JA 4DU7A 1SB6A 4DUYJ 2HNZB 4P7TA 2ZBIA 5CCMA 3KJVA 5KFSA 4F2SA 3HHEA 2RB7A 3I0RB 4WKRA 4ED0A 4DJBA 5M2PA 4DCPB 3C6TB 2QYCA 3CGIA 3M8PA 4WXWA 1S6QB 3OLAA 3K5MA 3MR7A 3M2UA 3TQEA 3CTRA 1NPRA 4H4OB 4URQU 2K2PA 1Y5IB 1Y3JA 2QA1A 1M90T 2HWIA 3CDBA 3O2IA 4KJIA 1K1QA 1X5TA 1FRHA 2K3IA 3S01A 4ANCA 5GAGI 2OPRB 5CXTA 4LVNP 1MWQA 4LSNA 5CYMB 3CULA 4BCAA 3MM8A 4NCAA 1B7YB 3HXMA 5DM7Q 4PUOB 3PFOA 2MY7A 1RB0A 3B4DA 8RUCA 2FZKB 1FJGJ 4XDCA 5HBMA 5IQQA 3BBCA 4QZVB 3TVZA 1JIHA 2Q43A 1RTDB 2R8JA 4QBUA 2V8VA 1RT6A 1U2RA 3GU0A 4FYDA 1XMBA 1V5IB 1YJ7A 3SSSA 4X4TA 4K0KJ 3M30A 4OI2A 5ETRA 1OY6A 4FPRA 3KHLA 1A0OB 1F5AA 2VG6B 3Q83A 4DUTA 3MPVA 3E2EA 2HK3A 1UEVA 4ZPCA 1U2FA 5KOWA 2XY5A 3PV8A 3QIDA 3W1YC 5KFUA 4N41A 2KH9A 4LSLB 2DGTA 1HNIA 2V2QA 2KRRA 2FGOA 5SZTA 1H0HB 4OX9J 5SUHA 1X8DA 2XMVA 2ZM6F 4KFBB 4NI2B 4RLEA 1PIEA 1M5PC 2XSJB 4UQGA 4W92B 3DM2B 1SV5B 2HNDB 3G71S 3HULA 4O23A 1C1BB 4LF6J 2MSSA 1N5SA 1PC5A 1F9HA 3L7OA 4NMXA 4IG0A 1FFSB 3OL8A 4HI2A 1UVJA 1FKOA 2GMJA 3M1VB 3W61A 3Q0AA 4KH1B 1UZHA 1QAYA 1R8PA 2OI2A 2KVQE 3TR5A 4LF6F 1EX8A 3D7SB 1HI8A 5EWGA 5AE1A 1T0TV 1RUSA 1U6FA 4OZLA 3M8SA 2W7AA 3EE3A 2RJZA 5HVHA 3MAAA 1U47A 2HRTA 5ETPA 1S10A 2HQGA 3H8YA 2OUGA 1U02A 2RS8A 4LSNB 2AHOB 2QLBB 5CYMA 3NAIA 1VOMA 2M0GB 5K8PA 4NL5A 3B8HA 5F0UA 1F1BB 4FYYB 4HHHA 1SI9A 5D8HB 1PJ5A 4WTOB 5KTQA 5I42B 3BQ0A 3M2UB 2BUNA 4N47A 2HIYA 4UOFA 3BKTA 4B3SJ 2AEJA 3M8PB 5KFQA 3FMBA 5D0HA 1Q5YA 4ID8A 4C0OC 1Y5NB 3KLGB 5IM0A 1QTMA 1SJ3P 2JEIA 4C3KA 4NXNJ 3I0RA 3BQ2A 3JSMA 4KO0A 2LVWA 1OJ4A 4UQTA 1SH2A 3GCXP 4F67A 2QJ3A 2RU3A 3JQKA 1RTZA 3UNYA 3EM1A 1OYEA 1NSPA 2OSQA 1S0VA 3TVYA 3KFWX 4ZHRA 3MR2A 4DV0J 3Q2TC 1GEHA 2FJEB 2V63A 4ZHRB 3MECB 3EJMA 4QPTA 5C7PA 2QSWA 4J9SA 1HD1A 4X84A 2V94A 4X4RA 5GAEI 3T6JA 1BD6A 1FRJA 4XAKA 1R8CA 2W7PA 3FK4A 3MI7X 1BMQB 3ET6A 4UF4A 4DSEA 2EG2A 2OFGX 3GZ7A 2MEWA 2NZCA 4R8UB 3NXZA 4C2MA 1KQFB 3UCUP 2KTQA 2C2EA 3DRPA 4EBDA 3EWGA 5K8NA 3A8IA 4CH0S 3O44A 5C5JA 4A8YA 3SEOA 2Z58B 4DR1J 2XY6A 3UDVA 3ZZ0A 4OYWA 4WU3A 5A8RB 2E5IA 2FHOB 3N6NA 4DEZA 3M2VA 2DTJA 4LRBA 3KYLA 4J9RA 4TNOA 1YLXA 1IUJA 2M2BA 3B82A 2YKMA 3DRXA 5KFMA 3HVRA 2EI5A 4P73A 3EPGA 1PJ6A 4KV8B 5KFPA 1X4AA 4A46A 1R27B 3I4HX 3CJSA 1HQUB 5L46A 2M52A 4X4VA 3V4MA 4XTTA 2Q6BA 2D9PA 1WG5A 2LXFA 4A8SA 5KFZA 3QSYB 2BJDA 4RW7A 3JB9k 2W9BB 2ALZA 1RT4B 3QT7A 4IRDA 4JV2A 4NXMJ 1FRLA 1KVJA 4BWJA 2DEIA 2HFZA 3U1LA 3I82A 2CJKA 1N34J 3MFHA 2RHQB 4Z37A 2HNDA 4EBEA 1UL3A 2GGPA 3BREA 2MZSA 1XERA 2B56A 2IY5B 2W2OP 3FCWA 2HZAA 4EZ6A 2XS5A 1FFWB 1Q1KA 1SJRA 2Y9HA 5B0EA 3L3CA 1TL1A 4DBQA 4OIXA 2V8DA 1DARA 3WDOA 1FDBA 2ILYA 2DGUA 2CQPA 2MZRA 2CPXA 2AGOA 1RTJB 4XDDA 3Q22A 4C8KA 2V9KA 1HWJA 4QWEA 4OI4A 1JLGB 3ITHB 4NLSA 4MYUA 1QVGR 4I6WA 1SIWB 1MMDA 1PCAA 1WC1A 1JMTA 3NGTA 4CNYA 4PXBA 3R7NB 4H4KA 1JB0C 1IKWB 3P49B 2P9GA 4ZDNA 2WW8A 4ZVUB 5KFCA 5DDPC 2H51B 3EX7B 1ZAWA 2WVCA 3RR8A 1RAAB 1Q78A 5D0GA 2JFDA 2H9ZA 1HHQA 1G1XA 2VJVA 1VMBA 3FBEA 2FY1A 2VKZG 1K0VA 2E1AA 2OPRA 4USMA 3H40A 2VPWB 4NYPA 3F0NA 4ZLPA 2LU2A 3W5YA 3GSDA 3MMJA 3BBFA 3ADAC 3PEJA 2EK1A 4IG3B 2ZKTA 2BV3A 4DQRA 2FLLA 2VA2A 5THWA 2N7CA 5D3GB 1I6JA 1VQ4S 1ZA2B 2E5LF 3GFXA 2Z8QA 1K9MT 1TL5A 1SKRA 2UUBF 2CKWA 2MQOA 3D4JA 2VFUA 3C46A 3RJMB 3VGSA 2EC2A 3HM9A 1XNQF 1S59A 3FBFA 4HACA 2JRSA 3F44A 3H2UB 3KLHA 2I2YA 2PA8D 1HNWF 3ISND 1VBKA 4FYXB 1X9SA 2IYGA 1ELOA 5DG8A 2J0WA 9RUBA 4DV2F 1SH0A 2JX2A 1DQAA 1S77D 3PW2A 3HHLD 4HLBA 3Q86A
chains in the Genus database with same CATH topology
3NGKA 3GV8B 3SCKE 4B3RF 1G3OA 4OFZA 4CO3A 1JKHB 1UEUA 4RW6A 3QGGA 1BGXT 4N8OA 3C6UA 1SL1A 2KG1A 1FD2A 3KLIA 4KB7A 3B4MA 4A47A 2JL9A 1VBYA 2WRMA 4RUCA 1M5VC 3FZBA 1VK8A 4HH1A 1VRTB 4DR6F 1FVQA 1JNZB 3OSNA 4B9LA 2A1BA 2N4DA 2RDJA 1H2UX 2HLUA 2X1BA 4JOUA 4ECZA 2PMHA 3SZ2A 1U6ZA 4RNHA 1U1RA 3PO5A 2FD2A 4RU2A 1KFDA 1JNRB 2VFRA 3V4IB 5L1KA 1YIJS 4XO0A 2WSEC 4DQIA 1N0VC 3QMQA 3DLEA 3I5BA 4ZPWR 5AE3A 3CD6S 3IRWP 2Y1JA 4OHWA 3SQGB 4LJMA 3KG1A 1YJWS 5E3PA 2PT0A 2BRLA 1GX6A 3MMBB 1NJZA 1CC7A 2YTCA 2NUUG 1TKDA 4NCBA 1S9EA 1JLCA 2J7WA 1V6HA 2W9AA 4LF7F 3I96A 2GV1A 3BR8A 1VQ8S 4AL5A 1S79A 1FE4A 3GFYA 4HTJA 1ZTTA 4X4PA 3CJ3A 2ADBA 1L3UA 2HIQA 1VQLS 1LWCB 1U49A 1KTQA 4K2XA 2PIIA 1HNVA 2A2DA 4OLOA 5GAGU 4A8MP 3V81B 1KC8T 3KLEB 3MOZA 3QAEA 2FJAB 3H5YA 3RBDA 3NNCA 1MSWD 2LEBA 3IR5B 4TXSA 3W7BA 4DL2A 1FJEB 4FF1A 2G9OA 4WE1B 1NHVA 4OI6A 1JLEB 1FO1A 5A6PA 2AJFE 3TW0A 2ZH9A 1U4BA 2VZ9A 3RTVA 4RNFA 2CJAA 3GR1A 3NLCA 1HPZA 3LALA 2R8KA 3VQSA 4EU0A 4V19X 5KT6A 3CB4A 1JLAA 2L9DA 1F5CA 1ZPWX 3M9OB 3GMGA 2B0GA 2J0XA 2AYGA 3FFIA 4WTYA 2DISA 1X4BA 1UVIA 5CYQA 2D3ZA 2E1RA 2AX0A 4HHJA 4QWCA 1FXLA 3TAQA 1SXLA 5GAHI 1NRKA 4QOTA 1VIXA 2DNGA 2KI2A 5AXLA 2IVMA 2XNQA 3BGFA 5EN1A 3D1HA 1S72S 1J2VA 4RW9B 2KXFA 4QWBA 3OUYA 3N4WA 4NXNF 2WBMA 1U1NA 1C0UA 4C8NA 2AJ1A 1S1XB 4FF2A 1TAUA 1KONA 2VFTA 1MWYA 3KK3A 1C0TA 4JV0A 1NH7A 4KT0C 3GV5B 2DIVA 3MTKA 2BRKA 3FSYA 1P1LA 2OJ3A 3BN7A 3C66A 4KKOA 3RW6A 3R5DA 1IKXB 2QLWA 4M63A 5HLFA 1FXDA 2MKSA 1UFWA 3M8QA 1X5PA 3PACA 4O3QA 4EUVA 1XK8A 5D8HB 5EX0A 1UVMA 3ZZTA 4K4UA 2KXHA 4MK9A 2GW8A 4K5RA 3G8QA 3G6XA 4GO5X 1O0PA 1TKTB 1OPIA 5C42B 2CQIA 5IXUA 3RR7A 4TY8A 3I87A 2PD1A 3FMWA 4B9VA 5KG5A 3LP2B 1HNZF 3DYAB 3A1YG 1U45A 4RNMA 3GFZA 2UVVA 2W4DA 5T7LA 4ZK7M 1SJQA 3GFHA 1WHXA 4L3NA 3Q8QB 3MOJB 1QSLA 2MHEA 2OPPA 1GXLA 3NS6A 4J5OA 4F4WA 4ID5B 1HBNA 4RBTA 3FFIB 5BR8F 1CVJA 1MMLA 2UV8G 3R5CA 2A18A 4YB5A 3I0SA 3EPIA 3K5OA 1HD0A 4DSIA 3TA0A 1HPZB 2XS2A 3N28A 2W8LA 2LMIA 2VG7A 4F26A 3ICLA 2WONB 3PNIA 4B3OB 1N52B 4I67A 1Q53A 5J1NA 2B43A 2YNGA 3DHXA 1YSJA 3KK2A 2COLA 3GIMA 3EGZA 1ZAXA 1IQZA 4DDFA 4WE1A 3T19A 2AWZA 1ZYQA 1HYSA 1KTVA 4HYKA 3PY8A 2HS0A 3EZUA 3O3LA 2Z4PA 4FNIA 5AXMA 4QU6A 2R9LA 5KFVA 3E3XA 3L95X 4X64F 2NZ4A 3W2VB 3IC1A 3N79A 4YP3A 2B4UA 1KEKA 1F2GA 2ASDA 2DNQA 5L38A 2B5JB 2OP5A 2QMXA 4R0EA 1T05A 2R7XA 2ZVSA 2IC3A 2VBXA 1T05B 2Q6CA 3HI9A 4MYTA 5MLCV 5L1IA 2QRRA 5J1EA 4WK1A 2MQLA 2VUGA 2UXBF 3I6PA 4LFCF 4PQUB 1FEEA 2LXUA 1S1UA 2HGMA 5HP1A 4O4GA 2RE1A 5DQIA 3K7RA 2ZH7A 4JI7F 3E51A 3LUYA 1URRA 3HHNB 4DR4F 1N5TA 4ZPDA 1XWLA 2NUHA 2K3KA 5B0AA 1VQ6S 4B3OA 2J6SA 4V19J 1VQSA 3CDAA 2VG7B 3H2VE 3D0HE 4CI0B 4DV5F 1TK8A 4YR0A 3NG8A 3GYXB 4ECQA 1CEZA 2B7BB 2FLNA 1QSSA 2E5JA 2F8EX 4JUZA 4DUZF 3OTEA 3V6DB 1U1QA 2Y0SD 4LF4F 2ROGA 1CLFA 5LJ3Y 4Y2AA 3CCLS 2DNRA 4X4NA 4TKTA 2MKCA 3RRKA 1U6BA 2YKPA 4IFYB 3DCAA 4NLVA 4WZMA 4A8WA 5I3QA 4UY8T 4RU9A 1RYRA 2DPIA 1APSA 2HHQA 4LF8F 1RT5A 3KLIB 4A8OA 4I6AA 3QIPB 3X1LB 3C6UB 3CIMA 1UW4A 3SV4A 4GKKF 4MIWA 3T1HF 1FRIA 2G0CA 2GFFA 3N5FA 2RDIA 2EKYA 1HW8A 5IT4A 3LGNA 4GMKA 4I56A 2PC6A 3DRSB 3TQ1A 5DGBA 2W24A 3K8VA 3ONQA 4KSEB 3JTOA 2CQ1A 3O5TB 2IRYA 1S0NA 1SC6A 3JTNA 3MUVP 1N5YB 2BOPA 1FHTA 2ZHOA 4YUDA 3GYNA 1D9DA 2XI2A 3K2YA 3A8EA 3WC0A 4B9UA 2GNKA 3BSCA 2IAJB 2BANB 4B08A 1YBAA 2XNRA 3DN9A 1DAXA 2V4RA 3OVAA 2X3GA 3ZZOA 4WKYA 5J2MB 1C0UB 4DV3F 2WHOA 4X4OA 3DU5A 5LXRA 3M9NB 3SDEB 2YX1A 3FQKA 1KR4A 2BW2A 1HBOB 3ZFVA 3MF5A 1Q81T 3T9NA 2MJUA 4O3NA 4RZRA 3LGMA 5IWAF 2M8DB 3QJJA 1GAOA 1DHMA 2DGSA 1HMVA 3AH6A 1L3VA 1JK9B 1IKWA 2KXNB 4D3HA 5KFHA 3LANA 3RAXA 2PMZD 1JJ4A 2VA3A 4C8LA 2R7RA 2JOQA 3LP0A 3OR2B 1U09A 2ZE2A 1JLFA 2UZAA 1S1TA 4BHQA 2HVZA 3QGIA 6FD1A 1VQPS 2YKQA 1JWWA 1D9FA 4ETZA 2RKIB 3J7Z5 2CPZA 2BVZA 4Y2KA 3GB0A 4IDKB 4YB6A 1JXLA 3Q2SC 3QGPA 4C11A 1GTEA 3POTB 3CJ4A 3HZEA 1RTHB 5K8OA 4DSJA 1WNEA 4CO5A 1VQ9S 3U7JA 1HNVB 3V81A 2D3OR 4JV5F 2J0SD 2NQPA 2VBYA 4NYZA 3MEDB 4RBVA 3CC2S 2NYIA 5E3CA 2M88A 2RQMA 4A4JA 4P7VA 5FIIA 3M05A 4C9DA 3I9V9 3W2WB 4F4XA 3MFIA 1Q7LB 4J9MA 1RA6A 2DHXA 3P96A 2K7JA 3CJ0A 3RB3A 3RBEA 2I8EA 1RWUA 1GX5A 4C3MA 4YY3F 1UETA 3IS9A 3M6XA 2ADCA 2XMMA 1R8HA 4WFZA 1T03A 2R7WA 2IJFA 2V9WA 2MQMA 2UVUA 4K4YA 4JI3F 3DI6A 3LOUA 1SBRA 2VL1A 2WTFA 3WBZA 2I5JB 1KHVA 3DRPB 2ASYA 1S49A 4JV1A 4R8UA 2RS2A 3V6KA 3MMAB 5IQ6A 2CQCA 2XCPA 5EGYA 3DLBA 1WACA 1FESA 1W2BR 3RAMA 4FS1A 1FE0A 3E01B 4ED6A 3DLGB 2M4MA 3MECA 3MD1A 1Y9OA 1NU4A 2OMOA 5C24A 2MGZA 4NLOA 1HWLA 1Q8LA 5F8LA 3FNNA 3CO9A 2D9OA 2D3UA 2DO4A 1C1CB 1RI7A 2C42A 2J9DE 4DG1B 3PR5B 3M9MB 1Z2ZA 2MZ1A 2E1MC 2BZ2A 3HVTA 3NRBA 4G1QA 5L39A 2KZMA 4RWWA 2QZ8A 1JJHA 1SKSA 1R8AA 2BXJA 3ISZA 3ENQA 5D4LA 5HO4A 2O1PA 3KLGA 1E6YA 3TA1A 2GIRA 1S6PB 2IM0A 4ELVA 5G0RA 5HROA 1R31A 4XPEA 4MKAA 1K73T 3CSKA 4BC9A 2GIQA 1FK9B 4JI6F 3M8RA 1DQ8A 2OLWA 1Y4ZB 1FTRA 4I2PB 4NPOA 4ZP9A 3RYLA 1QVFR 3DLLQ 5D4NA 3PW5A 1S48A 5F0WA 2AQ4A 3IRXA 4IFVB 4ED2A 5EX3A 5BYRA 5KFGA 2LDYA 3WC2A 2IVFB 5K14B 1P6TA 4DLEA 4K4VA 2LCWA 2R7OA 3AQOA 3CCWA 1FKOB 2JZ5A 5FDLB 2C3UA 3JYTA 4URSA 4NLRA 4DQSA 4QCLA 1F0XA 2UXCF 4IG3A 3CDEA 2P6SA 2PEHA 4Y2IA 3CCMS 1IBMF 2FHMA 2W9CB 5CZVA 1TK5A 1SV5A 4PXEA 3LWMA 2KT2A 3MR6A 4IR1A 3T3FA 4FBTA 3X3UA 1T8EA 2BJEA 2F1FA 3DMJB 4ZP7A 4M1KA 1HFEL 1HNIB 3ULHA 2DPJA 2IM2A 2VC0A 5J2PB 2ZOMA 3HLUA 1UVNA 3BEGB 5DETA 5KT7A 1CG2A 4JI0F 4Y0FA 2HHSA 4F50A 1L3TA 3G9CA 3O6QA 2N7YA 3DLHA 1IR0A 4N76A 1MNEA 2JLEA 3LW5C 2OD6A 2V4JB 2OTJS 1NEEA 4WFYA 1BQMB 3LP1B 1JLQB 4WYWA 1K0TA 4WFBQ 2M7SA 4JI4F 2FPHX 2FTRA 2AP6A 2OO4A 2MQPA 3CXCR 3K57A 1WF2A 4EWTA 4RNNA 4XK8C 2ZZMA 2DNKA 3PW0A 5DG7A 4IO9Q 1FKPB 3MHYA 2D74B 1W2IA 1K1SA 4NMLA 1DBDA 2CJBA 1R0AB 3OPKA 1X9WA 1SKWA 4F3QA 1QAJA 1HQEB 1X4HA 1Q8IA 2HLTA 5DLGA 3NNAA 5K14A 4PWUA 2D7SA 4CH1A 5KFOA 3FEXB 3HDSA 3MEKA 5EWFA 2UU9F 1UJ4A 2F9DA 4DFJA 1KN6A 2YNIA 1VC6A 1ZM9A 4ILRA 4LQ9A 1WG1A 3HHLB 3JAMY 4JI1F 2MKJA 4I68A 4Z2XA 2CJQA 4DQQA 4A8QA 4NA2A 2EPIA 1Z4UA 4KPYA 2F4VF 4Q8FA 4IRCA 2V0NA 2VG5B 5IT9Y 4CO2A 2R2UA 2BM0A 4MFBA 5KFBA 1YI2S 3GWCA 2GX8A 3J7A1 1LXJA 2MJNA 2VFSA 2DNNA 2R7UA 4TU9A 2O3DA 3TAMA 1M1KT 1P1TA 2ZBCA 1IXKA 3V6JA 2FVPA 2R7TA 1NH8A 3FVYA 1S9GA 6FDRA 2CFXA 1VLYA 2RMLA 3VR1A 3I56S 3DDKA 2FVSA 1U48A 3ZZZA 4OZ0A 4M95A 4ILMA 4ECVA 2L48A 2YKNB 1AFJA 3VAFA 4I2QB 4K4SA 3KG0A 4FXWA 4ERDA 3PW7A 1KD1T 3M2RA 5BJRA 3VZIA 1HQEA 5HMYA 2XC9A 1KS2A 3HPOA 4JYAF 5KFKA 3MM7A 2P6TA 4G6VB 4HI1A 2LKZA 4OHVA 2AYBA 2MYFA 4QIVA 2R8HA 1GXTA 2IYIA 3DGPA 2KFYA 3G6VA 2XMUA 5CD4H 2Z2MA 3MMCA 5I3UA 2V8GA 2P9CA 3W2WA 1NK9A 5JVHQ 2HHVA 2Q3PA 4K50A 2EFOA 2XG8A 1R7IA 3PXGa 4RUAA 1VHFA 3MEDA 4YR2A 1KRPA 3HP6A 3QO9B 5B0DA 3R1HA 2J6TA 3GR0A 1B0VA 3SFUA 2XSJA 4BC7A 1REVA 2CQ2A 4CTAA 2QEXS 3BSNA 4GKJF 4MK7A 2IHR1 2FVCA 4ZCLA 1ZBTA 3PM9A 2YY3A 3OR1A 5C25B 4QR0A 4DMZA 3AHPA 1FDAA 2KB2A 1QUPA 2VBWA 3RRGA 2XWXA 4QWDA 3MURP 4LQ3A 3FZ2A 4IOCQ 1KSPA 1LV5A 2KM8B 3CC7S 2VG6A 1JLFB 4USJC 1N5VA 4FVCA 4DSLA 1ULRA 3AJ1A 4EO6A 5B0CA 1FT8A 3KMSA 4P6QA 1RT6B 2IBOA 5FDLA 3DOKB 2JEGA 3SCJE 4J9NA 2KDOA 1VQMS 1X4FA 1IKYA 2L08A 1LKZA 2FHKA 1HMVB 4YDDB 4PUOA 3HHDA 1E6VB 5F8MA 2YWGA 3I32A 2EFQA 3J80Y 4DL3A 4PRFA 2B9WA 2YH1A 4EO8A 1FKAF 2YKOA 3QPIA 3AB4B 2JH3A 2MQQA 4IH5A 1FNOA 1VC0A 3FDSA 1S6QA 2L9NA 1HHSA 1X5OA 3MPWA 3N6LA 3VAGA 4C97A 1IKVB 2BACA 4QQBA 2YKNA 3JSRA 2B7CB 3VTIA 3KJVB 1NO8A 3Q8PB 3PW4A 2FVQA 2HMIA 2OSRA 2NPFA 4Y3CA 2VC1A 4QPXA 3CCTA 1KNZA 1TV6B 1N5YA 1OS5A 1D0EA 3DXSX 2E9RX 4DLGA 3Q8RB 2OIHA 4KE5A 3NAHA 5L8RC 3OL9A 2J0QD 3UWTA 4ZVFA 4PQAA 5DO2A 4YMEA 4ZVGA 3MMAA 4TU8A 3KLVA 1G2EA 2DCLA 1B0TA 3CD0A 4U7UK 3M32A 1EETB 1LWEB 2NSCA 3THTA 4NZ6A 5GADU 5F8IA 4W90B 1DQ9A 4QIGA 4MK8A 3PDNA 5KFDA 3HHLA 3MM6B 4K4TA 4QU7A 3HF5A 4M5DB 2KHDA 2KT5A 1FRXA 2DIUA 3IWLA 2J9DA 5EHHA 1XMOF 1TKXB 2J9EA 4OX7A 3RW7A 1U1PA 2QV6A 3VQTA 5BYSA 4E0DA 2CZ4A 3HMJG 3PJWA 1N4LA 3HHLC 3KHRA 4C3LA 1JX4A 4CT8A 2ZHAA 4EZ9A 3JSYA 3UR3C 2KJVA 4ZS6A 4G1PA 2IM1A 3CDUA 4DS5A 1RT3A 1NK4A 2HWHA 3AA9A 4WIIA 5LSRA 3K0JA 1NNDA 1ZZFA 2ROPA 2IRXA 4DL0C 4NCGB 2FVRA 2EFVA 2V4QA 2MZTA 2PI4A 1UAWA