2B7CB

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Elongation factor 1-alpha
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b7cB00
4JI4F 4LF8F 1XNQF 2ZM6F 2E5LF 2UXDF 1G7CB 4DV5F 2HHHF 1J5EF 2BVZA 3R3TA 3OTOF 1IJEB 4JI0F 1F60B 2RJZA 4DV4F 4GKKF 4JI3F 4LF7F 4LFCF 1G1XA 4JV5F 2KJWA 1VMBA 5IWAF 4JI1F 4DV7F 5BR8F 4LF6F 4LF5F 1RISA 3T1HF 1N34F 4YHHF 1CQMA 4DV2F 1B64A 4DUZF 1N32F 4K0KF 4AQYF 4DR4F 1QJHA 4DV1F 4DR5F 4NXMF 4B3RF 2BXJA 4KHPF 1I94F 2UXBF 2UU9F 3T1YF 4DR6F 4LF9F 4X64F 4OX9F 1XMOF 4JI7F 1LOUA 4JI6F 1IJFB 1IBLF 1HNWF 1CQNA 5AJ3F 4JI8F 5LMUF 1HNXF 4GKJF 4LFBF 4DR3F 1IBMF 4B3SF 2J5AA 1N36F 4B3TF 2VQEF 2KJVA 4DR7F 1FJGF 4X62F 1HNZF 4DV6F 1FKAF 2UXCF 1XNRF 2B7CB 4JI5F 4JYAF 1GH8A 4DUYF 4LFAF 4NXNF 2UUBF 1XMQF 2YY3A 4DV0F 3ZZPA 4DR2F 4X65F 4DV3F 1N33F 4LF4F 2F4VF 1IBKF 2UUCF 5LMNF 4JI2F 4X66F 1HR0F 4DR1F 2B7BB 2UUAF 4YY3F 2VQFF 4B3MF
chains in the Genus database with same CATH superfamily
4C3MA 2CAJA 1RT4B 2FZCB 4DPUA 5HQ8A 1VS3A 1N0UA 1EZZB 2D3OR 3PW4A 4M63A 1HQUA 4UTGA 2UXDF 2HWHA 3OLBA 3L9ZA 3C14B 3ZNUA 4AQYJ 4DX8H 1LW0A 4CT8A 1HFEL 3V4MA 1GFWB 1F6TA 4W98A 5KT3A 4MJKA 1UETA 1QE1B 2FHKA 2MZTA 4Q2LA 2AGQA 4LF7F 4ZLJA 2CWXA 3QO9B 3U7JA 4USWA 1FX2A 2CNOB 3UD3P 5I42A 2MEWA 5C7PA 3JAMU 1QTMA 2QYCA 4DV6J 2KZMA 1FRJA 2CPZA 1NM2A 4RJVA 1KSPA 2YWFA 1VQ8S 3I5CA 2BKNA 4ED3A 2OIHA 1NH7A 1TL4A 3Q22A 4I0WA 4PYAA 1U2RA 3POTA 4ZVFA 3TANA 1Q5YA 2JLGA 1HBUB 4ZP7A 1B64A 2V63A 4X4RA 4MYTA 3WHIA 3TOQA 4UOCA 2YTCA 2RVJA 3M6XA 2CQCA 2HFSA 1SXLA 2YNHB 5E5NA 1WOSA 2RMLA 4F4AA 4RNOA 3CJ5A 4Y28C 1XMQJ 1T05A 3H5XA 3MUMP 2M8DB 3MFIA 3MUTP 3AODA 3DNCA 3S6EA 4TY8A 3T41A 3BBBA 1N4LA 1N0VC 4KPYA 5THWA 4B3MJ 3QGHA 4NLPA 2AJFE 5D78A 5DM6Q 2V68A 3VAIA 1FJGJ 5HVHA 4GVLA 2WRMA 5KG6A 5KFOA 1TQLA 2I5JB 5HQMA 2UVRA 2PE8A 3TWZA 4FF3A 3H5UA 3W5XA 3KHHA 2EXUA 4LRDA 2G2YA 2HIYA 2KT3A 5HMXA 4ID5B 2V9WA 2DGSA 3ISND 4OZNA 4OX9J 2BABA 1IKVA 3G82B 3GB0A 3OTCA 2HNDB 4FYDA 1HBOA 3L09A 2FJAB 4NYZA 1HNWF 5H9FK 4MTPA 2W9BB 1OWXA 1UVMA 1S6PA 4YR2A 2WCXA 4M8LA 2MQNA 3R6LB 4DFPA 1HQEB 3U02A 1HQUB 4LBHA 3D0GE 4ID8A 1RHKB 1S99A 1RWWB 2WSFC 1T95A 5J1EB 2N3LA 4DR3F 1PKUA 2DTJA 3E01A 2APOA 4CDIA 3K7RA 1NHKL 2ALZA 3W64A 3D6MB 2CPEA 5ETNA 1YRXA 1JLEB 1WWHA 3OR1A 1RWOB 4IO9Q 3LH2S 4OX8A 3VCDA 4R8UB 3GFXA 1FKOA 1SCJB 5BXIA 1DTTA 1VCTA 2CQ1A 2DNLA 4IFVB 5HATA 2FVRA 1FJGF 4F3OA 2RUGA 1RTHA 1XQIA 2HWIA 2PA3A 2ZFHA 5F9NA 3FRYA 3CC7S 2VG6A 3AXKA 4Y6IA 1U49A 1KLNA 3RGIA 4J7CA 4NL5A 3SSRA 1TKZA 2KT5A 3JAMY 1FRMA 2YNGB 2GAHC 2NR0A 3JSMB 3RG6A 4HVZA 3GJRB 3D28A 4NYPA 1DRZA 3LP0A 2QLWA 3WC2A 1N32J 4F2RA 1KVJA 4RW4A 4WXWA 3VALA 2XZWA 2ZH6A 4QW8A 2GQQA 3D1QA 2PDAA 3A12A 4KE5A 1TMJA 2DCLA 3PEJA 4EZ6A 2UV8A 1LWEB 3ISZA 3VV2B 1FNXH 2C28A 2C3PA 4V1Ak 4ANEA 5IWAJ 1FFWB 1RT6B 2L48A 2CQ3A 3FKBA 1E6VB 3QT6A 1FRXA 2RD5C 3JQKA 4KFBA 4BS2A 2DKOB 4RBVA 1VHFA 2B4PA 3DFEA 4KH0B 1S1WB 4QR0A 3UN5A 2WAQD 1KS2A 3HKZD 4PG8A 2DD8S 4Q43A 3KHLA 2R2SA 1RAFB 1HBMB 2UUWA 3ZXWA 1R0AA 2B51A 1B3TA 3QMQA 1MMDA 2DK2A 5KFNA 2ZH3A 1RWPB 2E7XA 3V4IB 2DY9A 3PCOB 5CYJA 1S6QA 5D77A 2YPZA 2VKZG 1LNQA 3QSIA 3OW2R 4IG0B 1CJTB 1H38A 4HR2A 2BJDA 2ILYA 3A8IA 2KJWA 3NBPB 1CJVA 4LR8A 2XHWA 3W1YC 1EETB 4KIAA 4QIWD 1FT8A 4GMKA 2GJ2A 2KM8C 1PBAA 2HZCA 1P27B 3GJQB 3WDOA 1S6OA 4B17A 3QFHA 4EK2A 2MJNA 5K20B 4W90B 2Z56B 4YHHF 4ZPBA 2JWNA 4FZVA 4K4XA 4K2JA 4N7TA 2QGFB 2LA4A 4CM2A 2V6AA 5KT5A 1FD8A 2BJ1A 4J9PA 1CC8A 1FD2A 1Q4RA 1KP6A 2QL9B 3O3LA 4DBQA 3R1LA 5A8RB 3HX9A 1U0HB 2HGNA 2HVZA 4NXMF 2BACA 3O2IA 1HW8A 2GMHA 1WF2A 1UTAA 4LSZB 2IVFB 4WFAQ 3DHWC 4UOGA 4NOHA 2N4CA 3RB6A 2WVCA 4QWAA 3LPEA 2UXBF 2YNGA 1KR4A 3CCES 1ITPA 4LF2A 4ZVRB 4WZQA 2RKIA 2Q1LA 2EFNA 4XTTA 2UUAJ 1HI8A 4PQUB 2VU5A 4QIFA 3B6BA 1BUXA 4PXBA 3G86A 5HBMB 4O0IA 4GVBA 5LMNJ 3PACA 4PXCA 2OPRB 1S1WA 4TY9A 3DXBA 4IH7A 3MECB 1OQ6A 5KFRA 4DHVA 2BJ3A 3LW5C 1JLCB 4YUDA 4OZ1A 5KFBA 3J7A1 2I1RA 3BF4A 2OSRA 1FKOB 3I87A 5B0GA 3TNVA 1APSA 1SV5A 5D0HA 3ZZOA 3T5KA 1PCAA 3C2PA 2JEGA 3D2WA 2VG7B 3JSBA 3VQSA 3DGPB 4ZN3A 3HO1A 3IM8A 2CPIA 3GSDA 3PFEA 3Q8VA 4P7TA 1T9VA 2FHJD 5J2NA 2HYIB 4PUOA 3SYZA 4NLUA 2DIUA 1S1TB 1BY9A 2JZ5A 4IDKA 4J9SA 2OTJS 1S9EA 2VDIA 2R2UA 3DLLQ 1CC7A 3DI6B 3Q8UA 5KFIA 2XMTA 1LKZA 2B5JA 4GVBB 4ZCKA 1AT1B 3AJ1A 2KH9A 1NK4A 1KD1T 4JB8B 2QLBB 5I3QA 2ZD1B 3EYZA 4NI2A 3L95X 5LSRA 4GRSA 2M3DA 2KJVA 1HA1A 2H48B 2HLUA 2KHDA 3R27A 1X9SA 2K1RB 2XLIA 2DYAA 1T94A 4UQTA 3OFHA 2AYBA 2BUNA 4X62F 4YB1P 1R0AB 1LWFA 4ZKAA 3OL7A 1BQXA 2DCUB 3K5PA 1SL0A 2AEFA 2HWTA 1F3FA 1P8GA 2OFGX 1BQNB 2UXCF 1AFIA 1K0TA 5EUHA 3QRPA 1Z1ZA 1U24A 3SQOP 1RTIB 2DISA 1RT6A 1LQ9A 3TARA 1V3SA 1OS5A 3M8ZA 3OPKA 2MGZB 2LCWA 2HNZA 5CCLA 4BHQA 4J9RA 4ES1A 2ZJRQ 5HROA 1IR1A 2R8GA 2Z2ZA 2PEBA 4CM0A 4LREA 4DV3F 3V6DA 1NKBA 4IRCA 2GVDA 4DQPA 2YKOA 2DITA 2ZJQQ 5LL6d 3OXLA 1IWGA 2C2KB 2JDJA 2JEIA 2DO0A 4NLQA 3NOCA 1TAQA 2HK3A 5DM7Q 1VQSA 1U2CA 4DCJB 1NMEB 2PI4A 4ZLLA 3D0HE 4DQRA 1GMVA 3H8YA 1JXVA 4OZ3A 1PYOB 3OQ2A 3KLGA 3T5JA 3V6KA 2EFGA 1SB6A 2W4DA 5BYQA 4QPTA 4LF8F 4DX6A 3GR0A 5D4NA 2IM1A 2QMWA 4CRJA 2E5LF 4DU8A 1IBCB 1TUVA 4Q45A 3MI7X 2OELA 5KFTA 4CZCA 2UVUA 2O5DA 3RRGA 4NRUA 1U6ZA 2HNYA 4OI2A 4M5GA 3IRWP 3AAWB 1S1UB 2NSCA 3MWBA 2XLJA 2M8HA 3CF5Q 1F9EB 3OL9A 1FRIA 2F65A 1CPZA 2VBWA 2MZ1A 4NLYA 1WTFA 3NNCA 2RJZA 2ZE2A 2RHQB 3BPSP 4ZPDA 5B0DA 3PIPQ 3NGRA 2DGQA 3CVKA 2NUUG 2CWKA 1NK8A 1L3SA 1BWVA 1S77D 1YJRA 1N52B 1SC4B 1B7YB 4ZA1A 4DV7F 2FJWA 5LOQA 2ZUAA 3CJRA 2DT9A 2XMMA 2OFHX 5F41A 3G2XA 3D9BA 3BQ0A 2N7YA 3KLEB 3R7NB 5KFYA 4DMZA 3TA0A 1RBOB 2J9CA 4KB7A 5KFJA 4OFZA 4LVNP 3MM6A 4ZPTR 1QJHA 1SL1A 3TUZC 2KTQA 3GE9A 5C25A 3NCRA 2VUGA 4HHJA 5DDPC 4TYAA 2D3UA 5EWGA 3GQCA 1RABB 4PWDB 1YBAA 3G4SS 1NJIT 1B4SA 1VLYA 1ZM2A 1DBDA 2Y1LB 4NLGA 2ZC3A 3E8OA 1GTEA 1B0PA 2FYXA 3EVMA 3IAM9 3PXGa 3S8SA 1YITS 1K1SA 1ZPWX 2B6AB 5A0YA 1JWWA 5CYMA 3FEXB 3W3SA 5BJRA 3AJDA 4F4KA 3E01B 3M8PA 4YS2A 3QWPA 2YX4A 3R5GA 2BZ2A 2WBRA 3Q8SB 4UY85 1AXQA 3OXFA 3KLFA 2YBVA 1JJCB 2QC3A 2VL1A 2XM3A 1NPRA 3W60A 2MZRA 3BH7B 3HHDA 3SDEB 1TK5A 3AOBA 1AROP 2NZ4A 4YEAA 2DNMA 3T1AA 4C11B 4F3MA 3C46A 3ETMA 5E7OB 2AJ0A 5AE2A 3BGLA 2HHUA 3J80Y 4EI2A 5AJ3F 2MKHA 3THVA 2JSXA 2BW7A 2OSQA 5MLCV 4MMOA 2CIMA 2WW4A 2H54B 2D9PA 3BGRA 3BPDA 4LFBF 1LW2A 2XI2A 1UP1A 3ILIA 3TW0A 1BWEA 2E5HA 2EC2A 4PWUA 1VRUB 1KQFB 3MCOA 3HFVA 5T14A 4WIQA 1UMJA 5KFAA 2XB2D 5A8WB 3K2YA 1YRUA 2Z8QA 4PG6A 3X1LB 2M5YA 5HJXA 3VAGA 2R4FA 2AKWB 3I5BA 1N6QA 1KBRA 2HQIA 3MZIA 4CWBA 1HNZF 2IC3A 3AB4B 1UVLA 1DARA 2RNEA 2B7CB 2MHNA 3DYAB 4PYDA 4JI5F 3T6JA 3BV8A 1CLFA 1GH8A 4DWIA 1VIOA 2FB0A 4LIWA 1WJ9A 3KDNA 5H9FJ 3UN3A 4LFAF 2MLXA 3RB3A 3PO4A 2CJQA 3DDIA 2VJUA 4DN0A 4X4QA 4Z2XA 1XC9A 4S0MA 4FYVB 1RTIA 3BGFA 4I69A 3CD5A 4LF4F 2B8QA 2PD1A 2YVSA 4TLQA 1S1UA 5CZXA 1MSWD 1H3DA 3CB4A 1JLGA 3RUBL 4DSKA 3M6VA 3VAMA 2DJWA 4PXEA 1KFSA 1L3TA 1YX2A 4TLRA 3CCQS 4KJIA 3R7SB 2VBZA 2M7SA 1F5AA 3BEGB 3HZGA 2KKHA 4HH1A 4YMEA 1O6XA 2M70A 2QSFA 3CC2S 4FF1A 3J81Y 1NHUA 4NI2B 1R8BA 2GQCA 5E0OA 4FS1A 3N5FA 4GKKJ 4DJBA 2G4BA 3M8WA 1YI2S 1LW0B 2DNGA 3BSCA 3BM7A 3HZEA 3UNGC 4DFJA 1NZ8A 1S5ZA 4ANDA 3IMQJ 2AEJA 4F36A 2HFVA 2EKNA 3MTKA 3R3TA 4LR9A 3RR8A 3FZBA 5ETLA 1K9MT 2K2PA 2VG7A 2B6AA 5A0YB 3MF5A 2HNZB 4DFKA 1CS4A 2OPPB 3CJTA 4Q0BA 1HNVA 3H59A 1REVB 5IWAF 3KNGA 2CQ2A 5KFDA 5IT9U 3EGWB 2H5JB 4PZVA 4LF5F 2YWWA 3K17A 2UV8G 4Y34A 4DV4J 3O44A 3PVXA 2W2NP 4TYBA 4H4KA 1HL6A 3NOGA 4OJHA 3V2UC 4ZCMA 1TVRB 1N32F 3PW5A 1FX4A 4PG5A 4WFXA 3IP0A 4KGZB 4E0DA 3SCJE 4CLLA 4WU3A 4ECQA 1S4EA 4MAKA 5KFGA 2ROGA 4FDFA 2D74B 2L9NA 2YNIA 2Q3PA 5A76A 1U1KA 2F63A 5HMYA 2B43A 3IWLA 1RK8A 1X4EA 5HANA 4Y2KA 2U2FA 1T9WA 2D3O1 4IRKA 1BE4A 5HMZA 3P45B 5LXYA 4MKAA 3US5A 5K8PA 5DG8A 4DN9A 4GC7A 1XMOF 1DLOA 1FRLA 1U7LA 3PYEA 2R7SA 2CVIA 2JL9A 2N4DA 4L3NA 3H98A 1TL7B 3NY0A 4OYPA 1FJ7A 2HAFA 4GKJJ 4F7VA 3KLHB 2FGOA 1VQYA 3IM9A 2MLYA 1QUPA 4ZHRB 2JNJA 3JSMA 4G3IA 1X9MA 2VA3A 1V3ZA 2Q66A 3MEEA 3THPA 3G96A 1VQNS 1JLFA 2RIJA 1B0VA 1N5VA 4MH8A 2CJKA 2PN6A 4NLRA 1TKDA 2HQDA 3LUYA 2MQQA 4ZHRA 2FY8A 4K8RA 2FHMA 1U02A 2COLA 3J81U 4M5NA 1FTCA 4R5PB 4HACB 2E66A 1S1TA 1N36F 4ED7A 4FF2A 1QAJA 3H25A 2CG8A 4RR5A 4OX6A 2JVOA 2L9DA 2C3UA 3I0RA 2XCAA 1ZTTA 3AY0A 3AHPA 2KYXA 1YBUA 2QLXA 3HHNB 1ICEB 3TX0A 1SV5B 4R25A 4RNMA 4GO5X 2B56A 2JHEA 2VH7A 3JSYA 1WEYA 2CJXB 2GIFA 4JI8J 1JLAB 4P2FA 5KFKA 4LRBA 4JYAF 5C2CA 2Y1JA 2HW3A 3GV5B 5CQGA 5F3ZA 1Y7PA 2RDIA 4RW9B 4BC9A 1CJTA 1A6LA 2CPYA 5U47A 3L7UA 2DB1A 1TVRA 2RKIB 1VISA 1Y10A 3ZZPA 1XMQF 1PO6A 3KMQA 3MEEB 1H7WA 1MROA 3FZ2A 3CMQA 2BE2B 2F4VF 2B9EA 2GS8A 3V4IA 2OPSA 4QWBA 1L3UA 3D6HB 3P6YC 2K8GA 4B9NA 5DETA 4X66F 3TAMB 1F5BA 1S9EB 2DGXA 1H73A 2E1MC 5IQQA 2QO3A 4KFBB 2V2VA 1NEEA 1RHRB 3JB9k 2H51B 1R8CA 4DL4A 1KLMA 2CQ4A 2U1AA 4K4YA 2KB2A 4F67A 5IM0B 6AT1B 4LRAA 4A8WA 3I56S 3MM9B 1LFPA 4AE5A 3QZ8A 4LF7J 3TVZA 1JJHA 2R3VA 1JLCA 1W2BR 4ES3A 2LMIA 4M5HA 4C3KA 4DG1A 2B9XA 3U1NA 3CCWA 3OVSA 2XMVA 5DZ7A 1T03A 4OV1A 2XS2A 1IM6A 2FLLA 4JUZA 5B0BA 4ETZA 3NP5A 2OMLA 1HBNB 3QSYB 5L38A 4ZVSB 1SJ3P 5GAGU 1FXDA 4KV8A 4LFCF 5A2QY 1SVDA 2P9CA 3IC1A 4YB7A 3ZZTA 4P71A 1LWCA 1M1GA 2IDLA 2PMWA 5D3GA 2EI5A 3HJVA 2XTJP 3ENQA 1X5OA 5KT2A 5HVGA 5BR8F 1JLGB 4PAAA 5JXSA 5SUHA 3BQ2A 2AWZA 3DM2B 5D0GA 1BLUA 4O44A 2H5IB 1RCOB 1CQMA 3A8KA 3BYRA 1NU4A 2ZITA 3M4XA 3DLGB 3M8RA 4F8RA 8AT1B 3UN2A 2B3TB 3UCGA 1Q8BA 1ZYQA 2CQPA 3ONQA 1RWXB 3SQGA 2BQRA 2M9KA 4ED4A 3BBFA 4X4TA 1WKJA 3KKFA 4WFBQ 3MEGA 1FNMA 1YZ6A 3GYGA 1RHJB 1H0HB 1TUGB 3EWGA 1R89A 4IRDA 2NCKL 1EETA 4WYLA 3N0VA 3N6NA 5ETOA 3OJUA 1BGXT 3L7PA 3BSNA 4F50A 3OTDA 1RU2A 4EBDA 1C0UB 3NLCA 2LFVA 3QGGA 4UQGA 3OXGA 2HHHF 4WTOB 2XGQA 1RT1A 3NEKA 4KSEB 5KT4A 2JEFA 3KLIB 4N8NA 5L9XA 4EUVA 1KVKA 4X64F 4DR1J 3ELHA 4ECRA 3CGIA 3D3CJ 1LOUA 2DRDA 3M30B 3RYLA 4JI6F 2W2OP 2IY5B 4HT5A 2FVCA 3KK1A 2EG1A 3MHYA 4Y2IA 1VHIA 2ACYA 3I4PA 1Y5IB 2QRRA 1OPIA 4X84A 2W7PA 3M30A 4KC5A 4IFVA 5ETTA 4K59A 1SKRA 1QAIA 2Q6BA 4E8UA 3Q2TC 1FWPA 1G6BA 1P6TA 4CLSA 4Q5VA 1S1VA 1Q1KA 1S59A 4UOHA 3K5LA 5CZVA 4NLSA 5D15A 3ZTPA 3N4WA 2O3DA 1HNXF 1QSYA 1IXKA 3GFZA 1Q7YT 5DS7A 1IBMF 3R2CJ 8ATCB 2QFJA 3GFHA 3DOMA 3CW2C 3HVAA 3KJQB 4KHMA 3NGDA 1UVIA 5AXLA 4NZ6A 1OSDA 4ZVPB 4B9UA 2BQ3A 2QFIA 5CHCB 1O8BA 1FI4A 3UDEA 3HSZA 1YZ7A 1HBOB 1M90T 4OX7A 1CBKA 4QIEA 1KFDA 2GQ2A 4RWWA 4C3LA 4K4WA 4ERDA 3CDWA 1XNRF 5AE1A 1XERA 1X4HA 4K2XA 5GAHU 1NB2A 3KTQA 3KOAA 1VOMA 1D3WA 3B78A 3ZTQA 2PT0A 3EDRB 3Q8YA 3IR7B 4OV6A 3X3UA 2OAUA 1KTVA 1HD0A 1WOPA 1HNIA 3ZZ0A 4CNZA 5GMEA 1WC1A 1JXLA 1REGX 2GAGC 1YJ9S 4U7UD 3H0PA 1R8PA 1EKRA 1RXOB 2IYIA 3PG9A 2IA6A 2UVVA 3FCVA 1T11A 3T1HJ 5EHHA 5H1SV 2UUCF 4C8KA 4DX7A 4JI7J 3BSOA 3CCRS 2FQQB 1BD6A 2IC3B 4J9VA 3RB4A 1UVNA 3NS5A 3SI8A 2M52A 3FDSA 3GTYX 4CH0S 2M4MA 5KOXA 3TI0A 4YY3J 5I3UB 2W9BA 1ZA2B 2JEJA 5AXMA 1M0SA 5L1KA 2BANA 1S1VB 4FPRA 2BQUA 1RTDB 3K57A 2VC0A 1UZHA 1SJ1A 1XR6A 4RNHA 4P2XA 1UPPA 5KFSA 3RW6A 2B4UA 3MM5A 3QJLA 3QAEA 3CCLS 2D41A 1RHUB 3ILOA 1I51B 5HAOA 2ZBRA 2EKYA 1RZMA 3AQPA 2BVZA 2CA9A 3O6QA 3ZZYA 4AXJA 7AT1B 3FCHA 6FD1A 3MPUB 4K7QA 1QVFR 1IJEB 3MM6B 3H90A 4JI0F 5IT9Y 2BOAA 2VC1A 5E3AA 4BWJA 4JI3F 3ZTOA 3BGOP 3A13A 3MMAA 2E9RX 4C9DA 5LJ3Y 3O5TB 1KOOA 2HEKA 3I82A 4PCQA 5B0EA 4OHZA 5I3UA 1Q78A 1SJRA 1YLXA 1UCNA 1IQZA 1RI7A 1LK5A 1UKUA 2ZBCA 3BYPA 3JQMA 2YKNA 4ITSA 4NCGA 4AL6A 2NXCA 2DVIA 3DOMB 4TU7A 5HLFB 3QJJA 2RRNA 4MT1A 5F8MA 1S10A 1R0CB 1N34F 3ITHA 1RT5B 2YWKA 3A3NB 2Z2YB 4Y3CA 2O1PA 3KUEA 3L3CA 2EBGA 2BW2A 3EJMA 5KFQA 3GP9A 4QZVB 1EQMA 3W63A 2G13A 2XO6A 1JLBA 4HACA 4B3RF 1NPKA 1B70B 2AJ1A 2G9OA 2HBZB 1KHVA 3B8HA 2HURA 5CA5A 1KQGB 4YDDB 4ZVEA 4Y2AA 3IS9B 1U1PA 1FF2A 1HKAA 3CJ3A 1JMTA 2R7QA 5KTQA 2VFTA 3ICLA 4F4XA 3FFIA 2V5HG 5GMKa 2GNKA 1HWLA 4P2SA 5CCMA 1FXRA 1KKHA 2OEKA 1HBNA 4P10A 4U6PA 2WVFA 2V94A 4JI7F 3BREA 4WFNQ 2UUCJ 4K4ZA 2JFDA 1UAWA 1NH8A 1WSRA 3CDEA 2R7WA 4W4MA 2EEYA 5IC6B 1UEUA 1A0OB 2XSJA 2NQPA 5LMUJ 1MU2A 3IRXA 3IFEA 2R7TA 2V69A 2ZKTA 2YH1A 1VIXA 5DZ6A 2GVDB 2GC8A 1NK6A 1FNOA 1SIWB 3A8JA 2ASJA 2B4VA 1S0MA 3R5CA 1H74A 2AQ4A 1ZAWA 1NRKA 1WC3A 1X60A 1YWXA 3I32A 1EB0A 4JBCA 2HG4A 4PXDA 2BE7D 3UE2A 3G9CA 4FXVA 2FTRA 2OPRA 4MFBA 1AB8A 4NLXA 4USVA 3HJFA 4O3OA 2HGLA 2NXUA 1KQKA 4BC7A 1EAYC 5DJBA 4UZBA 1N34J 2J8AA 3NXZA 1SQEA 3FBCA 4LUBA 4TN2A 3FFIB 3H2UB 3N6MA 4WU2A 3HHEA 3HHLD 1WF0A 2AW0A 5F8IA 1N5QA 1U4BA 4YB6A 2R7UA 1I94J 2JC1A 1VBZA 4KHPJ 1UVJA 2BE9B 4OIXA 3JQJA 4CLPA 5F9LA 2D7SA 1FA0A 1GEHA 1EARA 1GMWA 1SKWA 2R8KA 1JLAA 1VQMS 3A1YG 4NA2A 2C2DA 4JI0J 4DR4J 4QU7A 1U0SA 3MM9A 5DLFA 2HK2A 3M1VA 4R0EA 4IQXA 4OI0A 1AZSA 4DQQA 3H42A 5LXRA 4YR3A 2Y1IA 1SL2A 4DU7A 2VIHA 5KG7A 3Q86A 3TUJC 4QYZJ 1ZA1B 2BEFA 4DR1F 2W4PA 4P72A 5I3PA 2DGOA 2ZWPA 4D3HA 2JLEA 1DTQA 2V2KA 4OHWA 3EPIA 4J9QA 2LA6A 2VD3A 1LV5A 4YY3F 3PFOA 1E6YA 2AYEA 3PJ9A 5K9FA 3FCWA 2ZH2A 1RT7B 3CJKB 1AUSL 1LK7A 2C3MA 1WTBA 1FXLA 2GMLA 4O3QA 4WCEQ 4B08A 2JVRA 1ZPVA 3Q89A 4KHRA 3D67A 1NXIA 3SFGA 4F4ZA 3M32A 3EMTA 3M8QB 5HI7A 1U47A 4FXDA 4RO0A 1JKHA 1FVSA 1RWNB 2GIQA 2ILZA 4UW2A 3ZTRA 3CCUS 4J37A 4ETXA 5RUBA 3WZ0A 4CT9A 4R8UA 5J2NB 5C42A 4JI4J 5ETQA 2DNRA 1N54B 1KQSR 1SKSA 3LF0A 2CUYA 2W4CA 4KGMA 3GCWP 2B4OA 2QLJB 2EPIA 3N28A 3P96A 4QR1A 4BDPA 4C8LA 3TX8A 5E3QA 2P5VA 1U1RA 2C2MB 3MD1A 4N47A 4FBUA 2XGPA 2FLPA 3QBCA 2ZVSA 4QWEA 3S7RA 2CDRB 2H9ZA 2VA2A 1SQFA 3FC9A 1WKLA 1S6PB 2QG9B 4IFYB 3TZXA 3IR5B 3K58A 1HR0J 4ELVA 3TYTA 4IOCQ 2FPHX 4ZVQB 3NS7B 1X5TA 1Y9OA 2RUSA 4RW8A 2XS7A 2ATLA 2KT2A 1U6FA 1IBMJ 4WKRA 4X4PA 4C6AA 4HI1A 4C8NA 4K4SA 3EVWA 1VRUA 2DHHA 4KBIA 4ZMMA 1T3NA 1VLOA 4ELUA 3JSRA 1IKYB 1BQMB 3DMJB 1RGVA 1DTQB 2CJBA 3T9NA 1U0HA 3GG0A 1U1LA 3CD6S 5ADZA 3QIDA 5M2PA 1DLOB 1W7WA 5CAAA 1PJ6A 5J2PB 1NSKL 2OP5A 4IG3A 4LSLB 4YDXA 2O01C 1X8DA 4WE1A 2NYIA 2V8PA 2VV5A 3DHXA 3I55S 1XTZA 5E3CA 2ABYA 1XJWB 1HMVB 1OYDA 3AFGA 1O5JA 4X64J 1KTQA 2DR5A 1C0TB 3PJXA 2YX7A 3LOUA 3FSIA 2EBEA 1HQEA 2IRXA 2YWEA 2C3YA 1PC4A 4CLZA 2CJYB 2AHOB 1TKTB 2E1CA 4L75A 2V8DA 2MKYA 4O3NA 3GSIA 1N5YB 3VAFA 4J91A 3MMAB 4Q2MA 3RU0A 1N5SA 2HNDA 2GZOA 2IBOA 3DLEA 1R6VA 1RTJB 3MR7A 4G1PA 4JI8F 4NLDA 4RUAA 2NXJA 3OVBA 2FLOA 3PDNA 2Y8YA 3M8SA 2RF2B 3MAAA 1SUQA 4O4GB 2J5AA 4DPYA 3JS9A 3PJWA 4OYAA 3BGRB 2DHXA 1RTHB 2X1BA 3OFGA 3BN4A 3SBMA 5H9EJ 3S01A 2HQGA 4OL8A 1VR6A 2QL5B 3AJ2A 3MR3A 3GLJA 5DLGA 3W9JA 1N36J 4Q8EA 2HHVA 5HP1A 1WG5A 5BR8J 3LP1B 1TKXA 3OR2A 4F0HA 5B0CA 4OYOA 4ZJQA 1AYEA 2QA4G 1FKAF 2C2NA 2ASLA 4NRTA 1HI1A 1WKKA 2W25A 1D9DA 2UU9J 2LLZA 2YNIB 2QN6B 4KGXB 4C0OC 1NJZA 3ZFVA 3KK2B 3LQVA 4U7CA 3IN5A 2AJ4A 1FFGB 2UVWA 4U95A 3QRRA 1GT8A 2QA1A 3L4BC 4TKTA 3VQTA 4OYBA 2YY3A 2Z57B 1WHWA 2BJ8A 4DX5A 5L46A 4DV0F 1NK0A 3T5LA 1IUJA 5DDOC 2XSFA 3TEGA 5CD4H 4DUTA 5A8WA 2AYGA 1RWUA 3BO2A 4FBTA 2HMIB 2N7CA 1RWVB 1RLCL 4WK3A 1YJWS 1FEHA 4JI2F 1XMOJ 2QV6A 4CLUA 3MFHA 2DR9A 3DRYA 2XULA 3M8YA 2UZAA 4ALZA 2F8HA 1RWMB 1SUQB 4HH0A 2IA0A 3WX8A 3F56A 1U1NA 1R3NA 3HM9A 4CH1A 1Q86T 2KXNB 3DDNA 4FKXA 4DQSA 4JV5J 3ADAC 2VFSA 3AD7C 3NS6A 2R9LA 2E5JA 2LKZA 2VONA 4WFZA 1ZS6A 3DCAA 3DRRB 5A8KA 4C2MA 3P3DA 1G7CB 4O3PA 3FEYB 3H7HB 2WHOA 2LU2A 2E7VA 5KG4A 3OVAA 5DGAA 3SDEA 2F4VJ 2QX0A 4RPFA 3BH6B 1VQ7S 1YIJS 3H5SA 2CPDA 3W61A 3W2VA 1J5EJ 3RBZA 2PMHA 3PHTA 1F60B 2GCFA 2RSQA 4M5JA 1HLWA 4NCGB 3SQGB 4DV4F 4EYHB 4A8FA 3CJ2A 4LF5J 1S6UA 1HHQA 4WIIA 1YVFA 4I2PA 2ZUGA 1ELOA 3S1TA 4O44B 4PWDA 3HVTA 3HT3A 3VAHA 1QY7A 5E33A 1NK7A 2LECA 5KFHA 2HZAA 1XWLA 5GADU 3Q8QB 2MQOA 4LR7A 3TAMA 2IM0A 1JLQB 3W2WB 2C2OB 1Z2ZA 3TJ8A 1QVGR 3PR5B 4DV2F 1U1MA 3HMJG 4X65J 1OYEA 5A6WA 2CQ0A 4DR2J 4K0KF 1RTJA 2EFPA 4L72B 1H6KX 4DDFA 1EIYB 3PX4A 4ZOSA 2BKPA 4FVCA 2VHGA 2BANB 2GHVC 3K5NA 1RA7A 1RACB 3GIMA 2J7UA 1NKEA 3NMAA 1IVZA 4IO1A 3TJ9A 4DG1B 4DL0C 3OUYA 4F4WA 5LJ5Y 3H40A 1SC6A 3MEGB 4KYZA 4OYMA 3UPFA 4OI6A 4DR6F 1WD6A 1X31C 5J1NA 2RU3A 2R2RA 1ULRA 3OTEA 2WBMA 3C16A 1FKPA 3QPIA 2WVEA 4B3TJ 2ATCB 4HI2A 3HDSA 2K7JA 8RUCA 2ZHAA 2F3JA 3V6HA 3HSJA 2ZEJA 2JH3A 1R6YA 5GADI 2XY6A 2F9DA 1X4FA 4A8MP 2J76E 4P9SA 1RT2B 4O3RA 2A2CA 2MJUA 3CNQP 1RP5A 3ZTSA 4U8YA 3U27A 4DSEA 2PC6A 1HR0F 1VQLS 2BE2A 4J9UE 1T7PA 1B7FA 1I3OB 1QE1A 3KJFB 3QIPA 2XY5A 1Q53A 2HS0A 3CMAS 4F0KA 1B99A 1KC8T 4JI5J 4ZLNA 1XIQA 3R5BA 1MW7A 4LRFA 5E2QA 2RB7A 1HNZJ 1TKTA 2XYPB 2XYGB 2IVYA 3J81j 2F5GA 1U8WA 3PRDA 1SPBP 3PV8A 4K50A 2KRBA 2Y1RI 1NDCA 3CD0A 3IXQA 3GYXB 1DY3A 1A9NB 3IG1A 2YKPA 2P8IA 4N8OA 2XNRA 1UFLA 4V19J 3CCTA 4ILRA 5B08A 1RADB 3BQ1A 4ZP6A 2AD9A 3UNYA 2H1YA 3OFFA 1MWZA 1FE4A 2ZKUA 2CPJA 2IAJB 4KO0A 2EK1A 3EE3A 4C48A 5AJ3J 3KNAA 1YBTA 2DNOA 5CYQB 3DMJA 2D1CA 4CIOA 1XNQF 4F04B 2RILA 2XZDB 4O4GA 2R42A 1H2TZ 4DR5J 2XMAA 3DRPB 3M32B 3M8QA 3I4HX 4DPOA 3ZZRA 3VAJA 2PI5A 4EYIB 4BBYA 2Y0SD 1WELA 2J6SA 3C15A 3JYTB 5FJ4A 2IBKA 1WEXA 2DHAA 2LEAA 3M05A 4ED0A 2FLNA 4QR2A 1LFWA 2E1RA 1L3KA 2MPUA 3NG8A 5FDLB 1ZTWA 1Q16B 1DQ8A 2M88A 2MSSA 2WOMB 4KKOB 4CH7A 3HVRA 2BOPA 3CTRA 3DLHA 2DPIA 3AD8C 4NCAA 1RT3B 2QLFB 5D4PA 4BCAA 1D8ZA 2DNHA 3PTWA 2OHDA 4YFUA 5HROB 1Y3JA 3Q8RB 4ED5A 1SJFA 1AZSB 4ATNA 4I67A 1VK8A 3LANA 2ZH9A 1RT3A 4OHYA 4QYRA 4WPAA 4DSJA 3M6UA 1GK8A 3QFWA 3H5YA 4PKDB 1D9FA 2VG5A 3CC4S 4E2FB 4ZN1A 4FVMA 1PJ7A 2BM1A 5HL7Q 4LFAJ 2OD6A 3BB5A 2B9YA 1TZ0A 4I7FB 1D09B 2EFVA 1JJ4A 4DV7J 2Q79A 3T5HA 4JV2A 1C1CB 5ETMA 1HI0P 4H4OB 2BJ7A 3RAMA 2VODA 3UO0A 3BGUA 3GZ7A 5ETKA 4FYXB 3LAMA 3OLAA 1QAYA 3QLHA 3UCZP 1KRPA 1RJJA 2B0GA 3P5BP 4OZ5A 2HFOA 5EX0A 5I4MA 2MMYA 1DAXA 4I1TA 5A8RA 1JLBB 2RS2A 1DTTB 2N3OA 5EX3A 4WWSA 5KG3A 2R7VA 1ZBTA 4LFBJ 5B0FA 2E5LJ 3CJQA 1AA1B 1ZAXA 3I0SB 4ECTA 1S48A 4M94A 3EXYA 2HRYA 3TZYA 4QIVA 3VGSA 2X51A 4NEZA 2E9ZA 2ZZMA 1HD1A 4LF9F 3MCMA 1TAUA 4IG0A 1WDTA 1U26A 4WK1A 3JYTA 4C8OA 2ZBPA 4H4OA 1N56A 2AV5A 2ZD1A 5IFMA 1WHVA 2M0GB 4NLOA 3SFUA 2HVEA 1Z4UA 1TFYA 3WX4A 4QW9A 4CI0B 2CQHA 5GMDA 2HRTA 3OL8A 1GXUA 4ILLA 3BS9A 2ZH5A 1IKXB 1V3RA 2CYYA 2UXCJ 3DU6A 1XMBA 2FC8A 1JLEA 2KYZA 2WVBA 3OR1B 3QT8A 1QDUB 3RJMB 2XQCA 1NK5A 4USMA 3R5JB 2HQFA 3H2VE 4UOFA 3CCMS 2MQLA 2KFZA 3H4DA 3W2VB 2ZDOA 5F8JA 1T3OA 3DDKA 2VQEF 3HD1A 1WSVA 3SIPB 1NLKL 3LP0B 1TL3A 3FNNA 5B7WA 4YN3B 4QWDA 2F40A 3TJAA 4LF9J 4C8YA 2DRAA 1NO8A 3DRRA 4DPTA 5A8KB 3F44A 3G6ES 4F4YA 4WZMA 3KK3B 1Q7LB 2QEXS 1SQGA 2HHQA 2UUTA 1HYSA 1TV6B 1S12A 2QA4S 2DGTA 2RS8A 2RQMA 3DRPA 2NUHA 1LXJA 4DUYF 3IS9A 1IWAA 1TL7A 4ZJOA 5H9EK 4O0NA 2JRSA 1JIHA 4J9LA 4DF4A 4WP8A 4ZK7M 5C24B 2E7WA 4RNFA 1DHMA 4NWBA 2VASA 1HNVB 3P4UB 5DQIA 1VDHA 3M9MB 2VICA 4N77A 4OLOA 1V5VA 3R7BB 4RBTA 4RW6B 1WI8A 1FKPB 4HTIA 5CD4A 3J7YI 4QQBA 1UA1A 3EZOA 5LMNF 3PY8A 4DL6A 1CVJA 3GR1A 2RQ4A 3QRQA 4RLEA 5KFWA 3UD4P 4CYUB 2KZZA 1TTHB 3UDLA 4CTAA 3CJ0A 2B7BB 5DQHA 1K47A 2UUAF 2W9CB 1H7XA 4I68A 3M2UA 3ULHA 1MU2B 3IRXB 4IOBA 5ETVA 1S9GB 2E5GA 2EWHA 1NSPA 1UEKA 2Z58B 2CNLB 4DL7A 2MQMA 2ADBA 2UXBJ 5CYMB 2ZC4A 3ET6B 3GMGA 3OFEA 1X0FA 4C0BA 1X4CA 1S1XA 2FJXA 1NDPA 5HN0A 4ZITA 3RRKA 3MM7B 1VC6A 2HFUA 2EFQA 1NAQA 3EM1A 1NJWA 1RAIB 3CJ4A 1R8HA 2GO8A 5L8RC 4ZLPA 3C19A 1VI7A 1LWXA 2ZOMA 1XR5A 5HO4A 2GV1A 2J7WA 5CYQA 1FERA 1RBAA 3PYDA 2FVSA 2E5IA 2V4JA 1ZM4A 3OT9A 3HULA 3QWUA 4G65A 3LGHA 3TRGA 3FSYA 3RB0A 2DHSA 1R31A 1BHNA 4HDGA 3FQLA 4MK8A 3UDCA 2MZJA 1XR7A 3V81B 2XG8A 4NLVA 1C0UA 2IPOB 4OZ2A 4X62J 2FJVA 4IKAA 4KY3A 2G2OA 2DGWA 1QAXA 3KFWX 5EWFA 1SKUB 1YJUA 4ICLB 2HVHA 3M2UB 4ILMA 4A8YA 3NMRA 2CJ9A 4U8VA 1D0EA 5KFVA 4U9RA 2BRLA 2ZE2B 2WW8A 3POTB 1T9XA 4LIRA 2V4QA 4WF9Q 3DLGA 1CJUB 1Y00A 2B8PA 2ZVIA 3GPAA 3OTBA 3V6JA 3GG1A 2ZWOA 3QQCD 3LAKA 4H54A 4OJ1A 3UVJB 3IWNC 3D68A 5D8HB 2HNYB 5BYSA 4OI4A 5MAOA 2P6SA 4M5LA 1U2FA 2NPFA 1S4FA 1QSSA 4CQ1A 3DGVA 5F0UA 5AT1B 5EWEA 1UJ5A 2AU0A 2HHXA 4N76A 2HMIA 3K89A 3HPOA 2PGCA 3NNHA 1S1XB 1G4CA 3G8QA 5L1LA 4HLBA 4R0JA 4ZP9A 5A6PA 3W9HA 1WG1A 2NLWA 2ROPA 5JJBA 1FDBA 2J0WA 2YQ3A 4AT1B 3EGNA 5C5JA 4M95A 2HVIA 2KO1A 1L3VA 2FUG9 2PEHA 2GVZB 1S9GA 2E1PA 3MMCA 1M1KT 3R5AA 4W92B 1RHQB 1N5TA 4F26A 5CABA 1U48A 1PIEA 2Z2MA 5F8LA 5KFCA 3I5AA 1NNDA 1R8AA 1IKWA 1GAOA 2D9OA 3DOKA 1Y3KA 3CEDA 4IG3B 4USKA 2ASYA 3HI9A 5DDRC 4X65F 3V81A 2A0FB 1JQGA 2YKQA 3MAHA 4NMLA 4NCBA 2HLTA 2GMJA 3C8YA 4I2QB 4ZVGA 4DCOB 3MECA 4B3TF 1CULA 4LSNB 5J2MA 2F8EX 4UUWA 4URQU 4ZVTB 3U1MA 3W2WA 4N56A 2OGUA 4YHHJ 4ECUA 5B09A 1KN6A 2WZ1A 1D1UA 2K06A 3MAAB 3QZ7A 4DR7F 4QU6A 4DR6J 1YDLA 2GIRA 5K14B 3Q83A 4HTJA 2QYGA 5K8OA 1RKIA 1FDNA 1PYSB 2J9DE 4HDHA 2KVIA 4M5MA 1I5OB 4TU8A 5GAHI 2H4WB 1Q8IA 1T9YA 5M2UA 2D3ZA 2OEMA 3KG4A 1EKSA 3DI6A 3ZZUA 5L39A 4NXNF 1HNWJ 1KVIA 2AEMA 5EDWA 3TR5A 4DR2F 3W9IA 2HBYB 1PSDA 3BSAA 3OD2A 3MDFA 3TA2A 5KG0A 4FNIA 4CLKA 2YWHA 1Q8LA 2W2MP 4L3KA 4CTAB 4DV2J 2G1DA 1S76D 4DZ6A 3PNIA 2IRYA 4PABA 5HP1B 2P2CB 2ZZTA 1GXTA 3DLKB 1NDKA 1GMWD 2FJEB 1JXEA 5J2QB 1RWKB 2V4JB 3CE8A 2JJ4D 4NEYA 1BQNA 2IIHA 1W26A 3BO3A 4B3MF 4WXOA 1TL1B 2QTWA 3CWJA 3HHLA 3JTPA 3KUGA 5HBMA 5C25B 5IQ6A 5HMWA 5DG9A 2MXYA 1S57A 4NX9A 3GIKA 2G2ZA 2QMXA 1XBWA 4A8XA 5ETSA 3CULA 1R7IA 2OPQB 3QT7A 3ZNJ1 3GFYA 4J9KA 2IJRA 4UZCA 2VKRA 4F3QA 7FD1A 3G71S 3ET6A 5D6GA 3FGVA 4FPIA 4NZ7A 3LO3A 1HARA 1WI6A 3UW1A 5KG1A 2RQCA 2BMBA 5JVGQ 2CG4A 3BR8A 5G4DA 2FVPA 2L9WA 2KRRA 4AYBD 4F0MA 4RZRA 4Y0FA 3KK2A 1T03B 3P49B 2VBXA 3LPYA 1PC5A 4OI1A 4OQJA 3TO8A 4I6AA 4K4TA 3ZO7A 4JV5F 2DXEA 1VMBA 2HKEA 3NCQA 1UA0A 1XNQJ 1TKXB 2CADA 3OR2B 2RDDA 2DRBA 4B9SA 1RAGB 4EEYA 4DSLA 1KNZA 1UW4A 5C42B 2VOOA 1CSJA 4QJVA 3GJSB 1OY6A 2DH9A 1OMSA 2H5EA 2CZ9A 2MKJA 3TZWA 2J8SA 5KFXA 4ENOA 2KM8B 3PRVA 3R1HA 1AUDA 5IXUA 4KAIA 1JKHB 5KFFA 3QLHB 2E1AA 2L3MA 4JP8A 4DV0J 4EBCA 4AQYF 4UY8T 2VQFF 3NNAA 1J27A 2F7VA 3R97A 2QT7A 4C7QA 4DR3J 2UXDJ 1EHWA 1TV6A 1ROFA 4KV8B 2I8EA 4L73A 2KG0A 3VAKA 2AJQA 1RLDA 4NXNJ 1YK9A 1VJQA 1UZDA 2YX1A 1X5PA 2J0QD 3CIMA 5F8HA 3M2VA 1VBKA 1IR0A 1WNEA 3TVKA 4A8QA 6FDRA 4ECVA 3I0SA 1E6VA 5GAGI 3FMWA 4OX9F 4DR7J 4XPCA 3NCPA 4XO0A 4X4UA 1UW9A 3J80U 1BMQB 2LDIA 4TQSA 1SIZA 2CPHA 1SI9A 2HSEB 1HW9A 3I0RB 3GIJA 2FDNA 2MGZA 3P5TL 2WTFA 4LT6A 3IAS9 3MPWA 4RUCA 4ECZA 1N48A 2C2EA 4PG4A 5HLFA 3BBCA 1O51A 2AZ3A 2Q6CA 1VBYA 4PG7A 4J9NA 1R43A 4X4VA 2IM2A 5JUMA 4C4WA 2BKOA 1ZETA 1GXLA 2A10A 4PQUA 2HQCA 2HPUA 1JLFB 1RBLA 3RW7A 3AA9A 3G6VA 3FEZA 2ZH7A 3RRHA 2KN4A 3FUYA 3EDQB 3QATA 1OY9A 2DNQA 4OYXA 3LGNA 3J7Z5 5IT4A 2ZH8A 4DL5A 2HBQB 3M2RA 2Y9HA 1TL1A 3BR9A 3D3BJ 1G2EA 1S7IA 1UWBB 3K5OA 3GV7B 1N88A 1Q0NA 4B3SJ 1WACA 2NXNA 1NB7A 4G1QA 3MPDA 3DLKA 2NS1B 3KG0A 2IRUA 3NRBA 2YH0A 2XC9A 1OJ4A 2AF6A 3C16B 4DV6F 4PUOB 3GONA 1T0TV 4A48A 3BDPA 3ETOA 5KT7A 1K8AT 2YKMB 2PFDA 3PX6A 1RKJA 1UEVA 5K8MA 4ED6A 3KWMA 1Y5NB 1ZM9A 2F1FA 3ZZZA 1F1BB 4Q8FA 4OI3A 1CJVB 5FDLA 2C2RA 3GJTB 2KU7A 2L08A 2VPXB 3FBBA 1URRA 2AT1B 2W9AA 1TMMA 3R6GB 1IM4A 2IM3A 1U1QA 4CO5A 4ZCLA 1KHWA 1T02A 1TELA 3QJPA 4ZIVA 3NGTA 3MXHP 3MTJA 4QIGA 1V5IB 5IOLA 3KLVA 2F4FA 2NSBA 4FKYA 1M5PC 2JFKA 4JI4F 4BLGA 1G3OA 5J2QA 1AW0A 3GILA 4B3OA 1CJUA 1TU0B 3R8YA 3N01A 4Y2MA 2I6WA 3KMSA 2HHTA 1Q82T 3LP2A 3DOKB 2J6TA 1DFDA 2NPIA 2XI3A 2C3OA 3GU0A 1NJYA 2X1FA 1RT5A 2J6UA 3OTOF 4OYWA 2XZTB 2CKWA 2IYGA 4P2MA 4QWCA 3T3FA 3PW0A 4IH5A 4NA1A 4DLEA 1FDAA 2YNHA 4F2SA 1KWMA 3CCSS 2Z4PA 2WOMA 4KKOA 5HVFA 3H4BA 3I31A 1CJKB 1GNKA 3D4JA 3P8BB 5K5MA 2CZVC 2OJ3A 1G1XA 2ZJPQ 1N6QB 5EGYA 4RU9A 2RRAA 1VQPS 1XEZA 4OHXA 3WIUA 5LSOA 1PG5B 3C15B 3IGNA 3G82A 3EXCX 1SC3B 2IVMA 2W01A 4CLFA 4ER8A 3EPGA 1GX5A 2HS3A 2I0XA 1RYSA 2AX1A 4X4OA 5J1PA 1C1BA 3VVTA 2BRKA 4Y00A 4DUZF 3N5BA 1RUSA 2W24A 4KGVB 2GX8A 4CLWA 3KHRA 3FVYA 4DR4F 1W25A 1VQ9S 2BJEA 2X1GA 2OPPA 1P1LA 2BBEA 4AXIA 2XEXA 2BXJA 2GJFA 3IA0A 4MK9A 1BXNA 3HHKA 3PR4A 4KHPF 3A3OB 1YRTA 2LDYA 5CH7B 5IC4B 3SXLA 3MEKA 4DUYJ 1WC4A 2VB6A 1I94F 1FHTA 2LEPA 2HQ3A 2FC9A 1UL3A 4NXMJ 2VOPA 1J2VA 3KLFB 2MZSA 1FK9B 4RUHA 3BJYA 4RX6A 2VFRA 1S7HA 4L6V3 2D69A 3EX7B 2VJVA 2H4YB 3LTOA 1MLAA 1SJQA 1UWAA 3CSKA 2NXEA 4HHHA 5F8GA 2OH2A 4EGLA 2DHGA 3MMJA 2CNKB 2WB4A 2JC0A 1RHMB 5T41A 2VQEJ 1YKWA 2GHPA 3QIPB 4FS2A 1DURA 5JMNA 5C24A 2KXFA 2MKCA 4G1IA 2V2ZA 2FVQA 4ID5A 2DPJA 3HHLB 3L7OA 3VGTA 1CQNA 1LW2B 3IBCB 3W5ZA 4NMXA 1BC6A 2W8LA 3RAXA 1ZH5A 1QTNB 5L9NA 3QO9A 4CO3A 4USHA 2V4RA 2PA8D 3FBEA 4KR0B 2OUGA 1DJ0A 1WF1A 5LMUF 4P52A 1OO0B 3QGPA 1Q79A 1H2VZ 3MR5A 1N5YA 3SCIE 2W7AA 1TK0A 3EUNA 5GAEI 3GCXP 1IKWB 4UUXA 1U45A 1FO1A 3G8SA 4C8MA 5J1EA 1RA6A 3W7BA 3DYAA 3KG1A 2GVZA 2KXHA 3MMCB 5K8NA 4Q44A 3ILLA 4EZ9A 1H72C 5LT5A 3BO4A 4XAKA 1U09A 2NREA 1S0VA 1CEZA 4EBEA 4ED8A 1YJTA 2E44A 1RCXB 3QNWB 4B3RJ 2CFXA 3MR2A 5HQLA 2AGOA 3DM2A 3B54A 5F0WA 4DQIA 4ZPAA 5KAKA 3CCVS 1R27B 2Y3YA 3MOJB 2KI2A 2LXIA 4ECWA 2O67A 4Q7AA 3W8GA 1LWCB 2MQPA 1URNA 2JLFA 1IBKF 3DRSA 4C8ZA 3DLEB 3DN9A 4TXSA 4KRWA 4TVAB 4AL5A 4MYUA 2HVDA 3KK3A 5DO2A 4DFMA 1NK9A 4RKUC 3CDUA 1M5OC 3CJSA 3D1OA 1T8EA 4DL2A 2DXDA 4FYWB 4F02A 5T7LB 3I6PA 4OMFG 4ECSA 3OJSA 2DNPA 5KT6A 1UFKA 2F8MA 1O0PA 4IYQA 4YQWA 1H98A 2ZM6F 2YNFA 3DLBA 2X3DA 4XIUA 1QM9A 1UJ4A 2X3GA 5G0RA 4DV5F 3V6DB 4PRFA 2EC0A 1EJ7L 1C4AA 3DKDA 5IM0A 2MQ8A 4DL3A 2Z2LA 4EMDA 4RW6A 1S0NA 3ISNC 4OZ0A 2R7OA 3MEDB 3W62A 1U8SA 2A1BA 1OQ3A 2FGCA 3QGIA 4Z37A 3HXMA 4B3OB 2MKIA 5KFUA 2DBBA 4B9VA 1I6JA 1QLNA 4OLPA 1UWBA 1VYAA 2ZOFA 1WC5A 3HT0A 3UDVA 4OHVA 2JX2A 4C0HA 1WUUA 2R2TA 1R0BG 1MROB 1FEEA 4O4RA 4JI1F 4FXWA 3F0NA 3V5RA 3CD7A 1TFWA 4LF6F 2G0JA 1KONA 1RT1B 1YGYA 3GIIA 1LEOA 1S0OA 2DGVA 2ZBQA 1FWLA 4RW9A 3T1HF 4WYWA 3G6XA 1FCAA 2QA2A 2OD4A 3FQKA 2VZ9A 3QT5A 4O3SA 1TL5A 4MIAA 4A46A 2VG5B 2XCPA 3D66A 3TQEA 3OHAA 3E51A 4ICLA 1RT4A 2IJFA 3F73A 2VDHA 4DV1F 3TAPA 4EU0A 2KDOA 3OV7A 4DR5F 2OTLS 3D6TB 2FIUA 4A4JA 2CPFA 2VBYA 3M6WA 4I6WA 4DSFA 3CT9A 3LP2B 2QSWA 1XNRJ 4LSLA 1F0XA 3N6LA 3TUPA 1IKXA 2XHCA 2XYHB 4L74A 1JB0C 3AXMA 2DR7A 1M1HA 3D0IE 3EZUA 1QSLA 4QBUA 4XPEA 1BQMA 1TR0A 2Z0GA 2ZH1A 3IWXA 3M2VB 1C1BB 2DIVA 3T19A 2RF2A 1S72S 2CQBA 1PAEX 2OMOA 2ACMA 3QYYA 1VK3A 3BKUA 2PFFB 3KJVA 4DS4A 2LYVA 5ETPA 3MM7A 2WVDA 3TQ1A 1NJXA 1VFJA 4X4NA 1IBLF 2UP1A 4URGA 2A3JA 2V8VA 2F9JA 3UQSA 4KPCA 1C0TA 2J0XA 3ILJA 4B9MA 4MIWA 4IUFA 4DI6A 3VVUA 2YKMA 1FTRA 1WC0A 3SMZA 2X1AA 3G6YA 1NDLA 2GHWA 3AQOA 3NAIA 3NWRA 2DNKA 3KDOA 4FNHA 4I56A 4M5KA 1Y4ZB 3PKYA 4JI6J 2PSZA 1MN7A 2FJBB 2MYFA 4EFAC 3K8VA 2G0IA 1NZAA 2DEJA 4H4MB 2ZOGA 5AXKA 2XSJB 4NZ0A 3HHLC 5HJYA 2Z30B 3K0JA 5HSPA 4WTYA 2KL8A 2ZBIA 1M5KC 4NA3A 4U7UK 4V19X 4AUKA 2NYHA 5D3GB 2DH7A 2CRLA 4AD6A 3AOCA 2OKQA 4M5DA 1S79A 5DDQC 1S6QB 4DOZA 3CDBA 4EO8A 3VTIA 2W8KA 3FJ2A 5KG5A 5FLXU 3GV8B 3CJ8A 3LGMA 4O23A 3KLHA 3U1LA 2UUBF 3D1HA 3LA0A 3SCKE 1N33F 1FWKA 2FD2A 1F5CA 4Z7CA 1MN9A 4X4SA 4WP3A 2HRUA 1VRTB 2RAQA 3NGUA 4H4MA 1Q95G 4TU9A 1RU1A 1IQTA 4FF4A 2WONA 2X7IA 4WFYA 3MGJA 1OPZA 4J9MA 3C6UB 1FRHA 4ZVHA 5IV4A 2DGUA 3CO0P 5F3TA 2GGPB 3LWMA 3AB2B 4BWMA 2VPYB 5KFEA 2A2DA 3J7ZT 2VQFJ 3CCZA 2HFNA 4LFCJ 1B0TA 1MNEA 3FK4A 2LQ9A 1NKCA 4YOEA 1DQAA 1HIYA 4DLGA 5IV3A 1FJCA 3MM8B 3TVYA 2MY7A 2K7KA 3AOAA 3N79A 2DR8A 4IR9A 1J5EF 3DOLB 2DH8A 2VFUA 1ZZFA 4USTA 3DRSB 4M5DB 4MIBA 1C1CA 4P6QA 2V67A 3PO5A 2H65B 3PKMA 2FHOB 2WK4A 4QPXA 1A7GE 2M2BA 3E2EA 1RAAB 1S9FA 1GQEA 4B9TA 1MMNA 2RDJA 1WORA 1DZ5A 3SCLE 1WDDA 4KTQA 4IOAQ 4DXLA 4RW7B 3PZPA 1RTDA 1HWJA 1RDRA 2P9GA 2VFVA 3BKTA 4J5OA 1J5OB 1YJVA 2MKSA 5ETRA 5FIIA 4ZJLA 4X66J 1PBUA 4C11A 5IS2A 2CVEA 4CCHA 2IJNA 4JI2J 1T05B 5M2RA 3PX0A 4CO4A 4LVOP 4HHUA 4YP3A 3R2DJ 3FBFA 1JK9B 4JV1A 4WP9A 1YTYA 5KFLA 1JNRB 4PWWA 2HBRB 4QCLA 2FZKB 4QOTA 4MKVA 3UI3A 5BYRA 1RYRA 4IQMA 3PEHA 2R8IA 4JYAJ 1QUVA 3ENVA 5DRKA 3TUIC 3VZIA 2OPQA 2MY8A 5E3PA 4MKBA 3CMES 1HNIB 1X5SA 2I9SA 2RRBA 4LRCA 2UU9F 3T1YF 3IBWA 4NPOA 2Y0BB 2ZNZA 3G8TA 2BA9A 4ZP8A 1P9YA 2LQBA 3R5DA 5FLXY 4I2QA 1EX8A 2IAJA 4KO0B 4Q0BB 1ZAVA 1UVKA 1TP7A 4I2PB 5KOWA 2DNZA 4YB5A 4YR0A 1N33J 3H20A 3WIVA 4RL1A 5KFPA 3BN7A 1ZOTA 3DRXA 5D0RA 2EK6A 2OO4A 3N9UC 3D6FB 4URSA 3TZZA 1OY8A 3PW7A 4B9LA 2DNYA 3T1YJ 1YSJA 2ERRA 1F9HA 4CO2A 3M9OB 2DR6A 2O66A 1VQKS 3HFZB 1HPZA 4RW4B 2LVWA 4KT0C 3JTOA 2KHCA 2FHJA 4GKJF 5SZTA 3VGVA 2EVZA 3W65A 1WOOA 4P75A 3THTA 3MCSA 2V34A 3BZQA 4USJC 5JVHQ 4HYKA 3AD9C 2E9TA 2XWYA 2BV3A 1M5HA 2H3EB 2DO4A 3EICA 4NLTA 3WBZA 2YQ1A 1S97A 2QE5A 5E41A 4ZDNA 1IN0A 3VWSA 1RT2A 4C98A 9RUBA 3UCUP 2RU9A 3B82A 2J0SD 3EGVA 3FMBA 3MURP 2AMCB 3NL0A 2GA7A 1F3VA 7FDRA 3DC2A 2ALYB 1VBXA 4PPDA 1RQ0A 3KLGB 2GO9A 4RU2A 2G0CA 3FRZA 3W5YA 4DSIA 3O8WA 3KLEA 2VPWB 1VQ5S 3MPVA 1CJKA 3AT1B 3CCJS 2R8JA 3BKFA 2CQIA 1SH0A 3UFCX 2HHWA 2QL7B 4RUBA 2MKKA 1FFSB 4U96A 1HHSA 2W9CA 2YKNB 3M8PB 3SSQA 4DF8A 3D5MA 3FSXA 2ZNYA 5D4OA 3VZHA 2E29A 1Q5VA 1WC6A 2MDAA 2OI2A 2WSCC 1MG7A 1ZM3A 2EFOA 1UPMB 2CQDA 1Y0HA 2I38A 3LP1A 3PHEA 1FDDA 3B4MA 3A8EA 2HGMA 2ZHOA 3NAHA 3DU5A 2IDEA 2YWGA 1IKVB 1NPPA 3I9ZA 3F41A 4H4KC 4M5IA 3D54A 4XK8C 2W1BA 2ZH4A 1RTZA 2BM0A 3CIZA 2RH3A 5J2PA 4USUA 4NE9C 1I1GA 4DEZA 5KG2A 3J7AN 1NCLA 2DY1A 4FN5A 4HEA9 4X2BA 2YPYA 4DPWA 1MWYA 2K1RA 3W66A 4DV1J 2BR0A 1FRKA 2MHEA 1T9UA 1PJ5A 3MPYA 4NASA 4ANCA 1ZZNA 4ECXA 1V9OA 4K4VA 2XWXA 1V6HA 1YQHA 4LQ9A 4USIA 5IZHA 4ZVUB 1PYTA 4ZIWA 2LP4A 2ASDA 1VQ6S 2XS5A 1X0PA 2C2ZB 3GIRA 2UUBJ 1FE0A 3OL6A 1N8RT 3C14A 3NWGA 3HFKA 2C22A 1TL3B 4GKKF 2DXFA 4LF1A 2K3KA 1HPZB 4P7VA 4A8KA 3SSSA 2ZZNA 1U1OA 2AZ1A 2WSEC 3TEHB 1HMVA 2FJDB 2KG1A 3WQPA 4HT7A 1HBUA 3HLUA 3A3PB 5E3RA 1RISA 2WONB 1MMLA 4NYOA 2R8HA 3RBDA 1RAHB 4K4UA 1X4GA 4RW7A 4DPXA 2HHHJ 2C1EB 3M7VA 2JOQA 2LXFA 3CPWR 4LF4J 1VJWA 2YKAA 2QMUB 5DQGA 1IR2A 4ZS6A 4U67Q 4AL7A 5CXTA 1Q81T 1NBEB 1QD1A 2BX6A 1IKYA 1JLQA 2DEIA 1LWFB 4RBUA 1UJ6A 3KK1B 3MR6A 3EZ5A 4DV5J 1U6BA 3EGZA 2OPSB 1Y5LB 1W2IA 1Y11A 2WB1D 2YXLA 4PEOA 5I42B 3OBIA 4M1KA 2MLZA 3E3XA 1FJEB 1WEZA 4FP9A 2CNNB 4E98A 1X4BA 4F25A 5A2QU 2ZM6J 3KLIA 4JOUA 2POKA 2VPZB 3CDAA 3DOLA 3HKWA 4OYIA 3RZAA 4Y2CA 3TA1A 1P1TA 4ZPVR 4CLTA 4ELTA 1E6YB 3T9ZA 3TP2A 3C6TB 1SJ4P 3PYGA 2Q43A 1DQ9A 2KFYA 1IBLJ 1GX6A 3VGUA 2IHR1 4EWTA 5B0AA 1NUEA 5D4LA 1HWUA 4CO0A 1IBKJ 3UR3C 2A6MA 1LXNA 2LQ5A 4CYUA 4CP5A 2J7KA 3DGPA 1AFJA 4WE1B 2C42A 2IMWP 4C97A 1J5OA 3M1VB 1KLMB 2FZGB 2R7XA 3O1LA 4G1QB 4I4BA 3PRBA 1S49A 2NZCA 2MTLA 3RBEA 1X9WA 4K0KJ 1OIAA 4IH6A 3M2RB 3D7SB 1C2PA 3NGSA 1M5SA 2CDQA 4A47A 2BDPA 1WHYA 2ZHBA 4IR1A 3WC0A 2W2QP 5FD1A 1RAEB 3ENWA 5HK4A 1SBRA 3CXCR 1RT7A 3CJKA 1EP4B 2QJ3A 2DNNA 4I7FA 1VQOS 4IFYA 2HAIA 3A4TA 2B5JB 3I96A 2AX0A 3K8WA 3BDEA 3MM8A 2V8GA 4I64A 4J90A 4JV0A 9ATCB 5AXNA 4LF6J 1FK9A 2V8HA 1H2UX 3KXDA 1F2HA 3MAQA 3SV4A 4WJBA 4JI1J 3IBFB 2ADCA 1JNZB 2GGPA 4ED1A 3MMBB 4UF4A 4G6VB 4MK7A 3B4DA 2CQGA 3EVOA 4Z7YA 4PR6A 1KDNA 3M9NB 4HL9A 3TAQA 4ECYA 2XLKA 1UFWA 4RNNA 3G87A 2QZ8A 1RB0A 1NSQA 4P74A 2W7OA 2XMKA 4TNOA 5LSLA 2YQ0A 1VRQC 3Q23A 2LEBA 2CZ4A 3KHGA 1WG4A 4LMZA 5GVQA 1FESA 4ZCIA 1C4CA 4B02A 4K5SA 1X4AA 2EW9A 3I9V9 1HYSB 3MD3A 4HKQA 2W2PP 2AYMA 3OHBA 1K73T 1JX4A 3KYLA 4N41A 4WKYA 4ED2A 1HBMA 1HWKA 2XMJA 4LJMA 4P73A 4ES2A 1F2GA 4CLYA 2HHPA 2LQ8A 3HD2A 4JI3J 4IDKB 1RE1B 2RQKA 5LM7E 3VHQA 4TQRA 4CO1A 3Q0AA 3SZ2A 1MWQA 4DS5A 5DG7A 2KFNA 2RHSB 3Q2SC 3R9LA 3J7YU 4AFFA 2V9KA 4OZLA 1VC0A 4Y65A 5KFZA 3KUHA 5AE3A 1Z2LA 3MMBA 5G0RB 1SC1B 4DZDA 3HK2A 2K3IA 1TK8A 2GJIA 1HHTP 2LXUA 1D8YA 1EQ0A 2XBPA 2SXLA 3RR7A 4LF8J 3MOZA 4KQZA 4NLWA 3RAQA 2XMWA 5T7LA 3C3LA 2P6TA 2A6OA 2V50A 4A8OA 2MB0B 2IFXA 3PIOQ 3HCXA 1OSCA 1YG0A 2GW8A 2PIIA 5DGBA 1T9TA 1JJ2R 4RW8B 5IT0A 1TKZB 2J9DA 2G1HA 2GFFA 4OJGA 3Q24A 1U25A 5L1IA 2VF3A 3H2LA 2RE1A 3OTOJ 4DV3J 3MUVP 2HZVA 5L1JA 1YJ7A 2N82B 5GAEU 4RWXA 2XY7A 1YJNS 1YHQS 3KJNB 2XO7A 2I2YA 2QIFA 2FY1A 4LBPA 1XN9A 3NGKA 3JXOA 1RAOA 2P9EA 4GC6A 2A18A 2XMUA 1HWIA 1KEKA 3C6UA 4MKYA 1LWEA 2IMOA 1TUWA 2ZDPA 3OSNA 3PW2A 3IG1B 1VQ4S 1KOHA 3UR0A 2LQJA 3LALA 1SH3A 3HVWA 4L76A 4LQ3A 3HF5A 4WBFA 1VRTA 1PGZA 3OUYB 5F8NA 3PM9A 4R5PA 1L5UA 4GO7X 5KFMA 2AP6A 5ITHA 1IJFB 3C6TA 3NBPA 4D3GA 1M5VC 1K1QA 3HSDA 1EP4A 2RT3A 1VGYA 4ZVOB 3W8PA 2V0NA 2V2QA 1CG2A 2KVQE 1XK8A 5K14A 3CO9A 3KJVB 1HNXJ 1NSAA 4KGKA 4KH1B 2ROEA 4EO6A 4XDDA 2VG6B 2EG2A 2PO4A 4I6YA 3GWCA 4MFBB 2CPXA 1VC5A 1CULB 2MZQA 4LSNA 3MM5B 4PQAA 1REVA 1F9FA 2I5JA 5J2MB 3K5MA 3K59A 3HVTB 1PAUB 2BYCA 3IR6B 4J9OA 1HQ2A 2OEJA 3MEDA 3ZC4A 5C2GA 3HP6A 4B3SF 5EN1A 1K44A 1P9QC 3AH6A 2XNQA 3HSGA 1GTHA 3UWTA 4DUZJ 4TY8B 4UT4A 2HHSA 1K0VA 4DCPB 3GYNA 2CXEA 2J9EA 3ITHB 1SH2A 4OYZA 2YNFB 2HFZA 1WHXA 2AIRB 4ZPCA 3VR1A 4PPZA 1PILA 3IO1A 2MSTA 2Y8WA 3Q8PB 1GMUA 2B9WA 3AA8A 3DLJA 1ACMB 4OJ3A 1X7VA 1D9AA 2PMZD 3ENAA 4CNYA 2CJAA 3IGVA 3T6BA 3JTNA 2HIQA 2LU1A 4XDCA 3RBXA 3VF0B 3SEOA 3RTVA 2L41A 4K5RA 5D0EA 1RAJA 4FYYB 1RSCA 3DXSX 4LBIA 1NHVA 4N5SA 3LWLA 2R7RA 4ZPWR 3SV3A 3OSPA 2BJ9A 3NKYA 1Q8KA 4QYZK 3UD5A 3MCNA 3UVJA 2AGPA 2AJ2A 2HS4A 3QAUA 1X4DA 4OZJA 1CS4B 3PYFA 1FVQA 3C66A 2OLWA 3CUNA 4A8SA
chains in the Genus database with same CATH topology
4C3MA 1RT4B 5HQ8A 1VS3A 1N0UA 2D3OR 3PW4A 4M63A 1HQUA 2UXDF 2HWHA 3OLBA 4DX8H 1LW0A 4CT8A 1HFEL 3V4MA 5KT3A 4MJKA 1UETA 1QE1B 2FHKA 2MZTA 4Q2LA 2AGQA 4LF7F 5I42A 3QO9B 3U7JA 3UD3P 1QTMA 2QYCA 2KZMA 1FRJA 2CPZA 1KSPA 2YWFA 1VQ8S 3I5CA 4ED3A 2OIHA 1NH7A 1TL4A 3Q22A 4I0WA 4ZVFA 1U2RA 3POTA 3TANA 2JLGA 1HBUB 4ZP7A 1B64A 4X4RA 4MYTA 3TOQA 4UOCA 2YTCA 2RVJA 3M6XA 2CQCA 2YNHB 1SXLA 5E5NA 5L9NA 4RNOA 2RMLA 3CJ5A 4Y28C 1T05A 3H5XA 3MUMP 2M8DB 3MFIA 3MUTP 3DNCA 3S6EA 4TY8A 1N4LA 1N0VC 4KPYA 5THWA 3QGHA 4NLPA 2AJFE 5D78A 5DM6Q 3VAIA 2UVRA 5KG6A 2WRMA 5KFOA 1TQLA 2I5JB 2PE8A 4FF3A 3H5UA 3KHHA 2KT3A 5HMXA 4ID5B 2V9WA 2DGSA 3ISND 4OZNA 2BABA 1IKVA 3GB0A 3OTCA 2HNDB 1HBOA 3L09A 2FJAB 4NYZA 1HNWF 4MTPA 2W9BB 1OWXA 1UVMA 1S6PA 4YR2A 2WCXA 4M8LA 2MQNA 1HQEB 3U02A 1HQUB 3D0GE 4ID8A 1S99A 2WSFC 1T95A 5J1EB 2N3LA 4DR3F 2DTJA 4V19J 3E01A 2APOA 2ALZA 3K7RA 1K0TA 2CPEA 1YRXA 1JLEB 1WWHA 3OR1A 4IO9Q 3LH2S 4OX8A 3VCDA 4R8UB 3GFXA 1FKOA 1DTTA 2CQ1A 2DNLA 4IFVB 2FVRA 1FJGF 4F3OA 2RUGA 1RTHA 2HWIA 2PA3A 2ZFHA 5F9NA 3FRYA 3CC7S 2VG6A 4Y6IA 1U49A 1KLNA 4NL5A 3SSRA 1TKZA 2KT5A 3JAMY 1FRMA 2YNGB 2NR0A 3JSMB 4HVZA 3D28A 4NYPA 1DRZA 3LP0A 2QLWA 3WC2A 4F2RA 1KVJA 4RW4A 4WXWA 3VALA 2XZWA 2ZH6A 4QW8A 2GQQA 3D1QA 2PDAA 4KE5A 2DCLA 3PEJA 4EZ6A 2UV8A 1LWEB 3ISZA 1FNXH 2C3PA 3SFGA 1RT6B 2L48A 2CQ3A 1SKRA 1E6VB 1FRXA 2RD5C 4KFBA 4BS2A 4RBVA 1VHFA 2B4PA 3DFEA 4QR0A 1S1WB 4Q43A 2WAQD 1KS2A 3HKZD 4PG8A 2DD8S 3KHLA 2R2SA 4AL7A 2UUWA 1HBMB 1R0AA 2B51A 3QMQA 1MMDA 2DK2A 5KFNA 2ZH3A 3V4IB 2E7XA 5CYJA 1S6QA 5D77A 2VKZG 3OW2R 4IG0B 2BJDA 2ILYA 3NBPB 2KJWA 2XHWA 1EETB 4KIAA 4QIWD 1FT8A 4GMKA 2GJ2A 2KM8C 2HZCA 1P27B 3WDOA 1S6OA 4B17A 2MJNA 4W90B 4YHHF 4ZPBA 2JWNA 4FZVA 4K4XA 2LA4A 5KT5A 4J9PA 1FD8A 1CC8A 1FD2A 1Q4RA 3O3LA 3R1LA 4DBQA 5A8RB 3HX9A 2HGNA 2HVZA 4NXMF 2BACA 3O2IA 1HW8A 1WF2A 2GMHA 2IVFB 4WFAQ 3DHWC 4NOHA 2N4CA 3RB6A 4QWAA 2UXBF 2YNGA 1KR4A 3CCES 4WZQA 2RKIA 2Q1LA 2EFNA 4PQUB 1HI8A 4QIFA 5HBMB 4PXBA 3G86A 4O0IA 3PACA 4PXCA 2OPRB 1S1WA 4TY9A 3DXBA 4IH7A 3MECB 1OQ6A 5KFRA 4DHVA 4YUDA 3LW5C 1JLCB 5KFBA 4OZ1A 3J7A1 2I1RA 3BF4A 2OSRA 1FKOB 3I87A 5B0GA 3TNVA 1SV5A 3ZZOA 3T5KA 3C2PA 2JEGA 3D2WA 2VG7B 3JSBA 3VQSA 3HO1A 2JEIA 2CPIA 3GSDA 3PFEA 4P7TA 5J2NA 2FHJD 2HYIB 4PUOA 3SYZA 4NLUA 2DIUA 1S1TB 1BY9A 2JZ5A 4IDKA 4J9SA 2OTJS 1S9EA 2R2UA 3DLLQ 1CC7A 3DI6B 5KFIA 2XMTA 1LKZA 2B5JA 4ZCKA 1NK4A 3AJ1A 2KH9A 1KD1T 3KOAA 5I3QA 2ZD1B 3EYZA 3L95X 5LSRA 2M3DA 2KJVA 1HA1A 2HLUA 2KHDA 3R27A 1X9SA 2K1RB 2XLIA 1T94A 4UQTA 3OFHA 2AYBA 2BUNA 4X62F 4YB1P 1R0AB 1LWFA 4ZKAA 3OL7A 1BQXA 2DCUB 3K5PA 1SL0A 2HWTA 2UXCF 1P8GA 2OFGX 1BQNB 1AFIA 5EUHA 1Z1ZA 1U24A 1RTIB 2DISA 1RT6A 1LQ9A 3TARA 1V3SA 1OS5A 2MGZB 3OPKA 1H38A 2LCWA 2HNZA 5CCLA 4BHQA 4J9RA 4ES1A 2ZJRQ 5HROA 2R8GA 1NKBA 3V6DA 4DV3F 4IRCA 4DQPA 2YKOA 2DITA 2ZJQQ 5LL6d 3OXLA 2JDJA 2DO0A 4NLQA 1TAQA 5DM7Q 1VQSA 2PI4A 3D0HE 4DQRA 3H8YA 3OQ2A 3KLGA 3T5JA 3V6KA 2EFGA 1SB6A 2W4DA 5BYQA 4QPTA 4LF8F 3GR0A 5D4NA 2IM1A 2QMWA 2E5LF 1TUVA 4Q45A 3MI7X 4CZCA 5KFTA 2UVUA 3RRGA 2O5DA 4NRUA 1U6ZA 2HNYA 4OI2A 3IRWP 3CF5Q 3AAWB 1S1UB 2NSCA 3MWBA 2XLJA 2M8HA 3OL9A 1FRIA 1CPZA 2VBWA 2MZ1A 4NLYA 1WTFA 3NNCA 2RJZA 2ZE2A 4ZPDA 5B0DA 3PIPQ 2DGQA 3CVKA 2NUUG 1NK8A 1L3SA 1S77D 1YJRA 1N52B 4DV7F 4ZA1A 3BQ0A 4DFPA 2DT9A 2XMMA 2OFHX 5F41A 1QVGR 2N7YA 3KLEB 5KFYA 4DMZA 3TA0A 2J9CA 4KB7A 5KFJA 4OFZA 4LVNP 3MM6A 4ZPTR 1QJHA 1SL1A 3TUZC 2KTQA 3GE9A 5C25A 3NCRA 2VUGA 4HHJA 5DDPC 4TYAA 2D3UA 5EWGA 3GQCA 4PWDB 1YBAA 3G4SS 1NJIT 1ZM2A 1VLYA 1DBDA 4NLGA 2ZC3A 3E8OA 1GTEA 1B0PA 3IAM9 3PXGa 3S8SA 1YITS 1K1SA 1ZPWX 2B6AB 5A0YA 1JWWA 5CYMA 3FEXB 3W3SA 5BJRA 4F4KA 3E01B 3M8PA 3QWPA 2YX4A 2BZ2A 2WBRA 3Q8SB 4UY85 1AXQA 3OXFA 3KLFA 2VL1A 2MZRA 3HHDA 1TK5A 3SDEB 1AROP 2NZ4A 4YEAA 2DNMA 3T1AA 4C11B 4F3MA 3C46A 5E7OB 2AJ0A 5AE2A 3BGLA 2HHUA 3J80Y 5AJ3F 2MKHA 3THVA 2JSXA 2OSQA 5MLCV 4MMOA 2CIMA 3BGRA 2D9PA 4LFBF 2XI2A 1LW2A 1UP1A 3TW0A 1BWEA 2E5HA 1KQFB 4PWUA 1VRUB 5T14A 1UMJA 5KFAA 2XB2D 5A8WB 3K2YA 1YRUA 2Z8QA 4PG6A 3X1LB 2M5YA 3VAGA 2R4FA 3I5BA 1N6QA 2HQIA 3MZIA 1HNZF 2IC3A 3AB4B 1UVLA 1DARA 2RNEA 2B7CB 2MHNA 3DYAB 4JI5F 1CLFA 3T6JA 1GH8A 4DWIA 1VIOA 2FB0A 4LIWA 5H9FJ 4LFAF 3RB3A 3PO4A 2CJQA 4DN0A 4X4QA 4Z2XA 1XC9A 4I69A 1RTIA 3BGFA 3CD5A 4LF4F 2PD1A 2YVSA 4TLQA 1S1UA 5CZXA 1MSWD 1H3DA 3CB4A 1JLGA 4DSKA 3M6VA 3VAMA 2DJWA 4PXEA 1KFSA 1L3TA 4TLRA 4KJIA 3CCQS 2VBZA 2M7SA 1F5AA 3BEGB 3HZGA 2KKHA 4HH1A 4YMEA 2QSFA 2M70A 3CC2S 4FF1A 3J81Y 1NHUA 5E0OA 1R8BA 2GQCA 4FS1A 3N5FA 4DJBA 2G4BA 1YI2S 1LW0B 2DNGA 3BSCA 3BM7A 3HZEA 3UNGC 4DFJA 3MTKA 3R3TA 3RR8A 3FZBA 1K9MT 2K2PA 2VG7A 2B6AA 5A0YB 3MF5A 2HNZB 4DFKA 2OPPB 4Q0BA 1HNVA 3H59A 1REVB 5IWAF 3KNGA 2CQ2A 5KFDA 3EGWB 4LF5F 2UV8G 4Y34A 3O44A 3PVXA 4TYBA 4H4KA 1HL6A 4OJHA 3V2UC 4ZCMA 1TVRB 1N32F 3PW5A 4PG5A 4WFXA 4E0DA 3SCJE 4WU3A 4ECQA 5KFGA 4MAKA 2ROGA 2D74B 2L9NA 2YNIA 2Q3PA 1U1KA 5HMYA 2B43A 3IWLA 1RK8A 1X4EA 4Y2KA 2U2FA 4IRKA 5HMZA 5LXYA 4MKAA 3US5A 5K8PA 5DG8A 4DN9A 4GC7A 1XMOF 1DLOA 1FRLA 1U7LA 2R7SA 2CVIA 2JL9A 2N4DA 4L3NA 3H98A 1FJ7A 3KLHB 2FGOA 1VQYA 4ZHRB 1QUPA 3JSMA 4G3IA 2Q66A 1X9MA 2VA3A 1V3ZA 3MEEA 3THPA 3G96A 1VQNS 1JLFA 2RIJA 1B0VA 1N5VA 4MH8A 2CJKA 2PN6A 4NLRA 1TKDA 3LUYA 2MQQA 4ZHRA 2FHMA 2COLA 4R5PB 1FTCA 2E66A 1S1TA 1N36F 4ED7A 4FF2A 1QAJA 3H25A 4OX6A 2JVOA 2L9DA 2C3UA 3I0RA 2XCAA 1ZTTA 3AY0A 3AHPA 2KYXA 2QLXA 4RNMA 1SV5B 4R25A 4GO5X 2B56A 2JHEA 2VH7A 3JSYA 1WEYA 1JLAB 5KFKA 4JYAF 2Y1JA 2HW3A 3GV5B 5CQGA 5F3ZA 1Y7PA 2RDIA 4RW9B 4BC9A 1A6LA 2CPYA 5U47A 2DB1A 1TVRA 2RKIB 1XMQF 1PO6A 3ZZPA 3KMQA 3MEEB 1H7WA 1MROA 3FZ2A 2F4VF 2BE2B 3V4IA 2OPSA 4QWBA 1L3UA 3P6YC 2K8GA 4B9NA 5DETA 4X66F 3TAMB 1F5BA 1S9EB 2DGXA 2E1MC 5IQQA 2QO3A 4KFBB 1NEEA 3JB9k 1R8CA 4DL4A 1KLMA 2U1AA 2CQ4A 4K4YA 2KB2A 4F67A 5IM0B 4A8WA 3I56S 3MM9B 1LFPA 4AE5A 3QZ8A 3TVZA 1JJHA 1JLCA 1W2BR 4ES3A 2LMIA 2C28A 4C3KA 4DG1A 2B9XA 3U1NA 3CCWA 3OVSA 2XMVA 1T03A 2XS2A 4OV1A 2FLLA 4JUZA 5B0BA 4ETZA 3NP5A 2OMLA 1HBNB 1SJ3P 5L38A 5GAGU 1FXDA 4KV8A 4LFCF 2P9CA 3IC1A 4YB7A 3ZZTA 1LWCA 5D3GA 2EI5A 3ENQA 1X5OA 5KT2A 5BR8F 1JLGB 5JXSA 5SUHA 3BQ2A 2AWZA 3DM2B 4UQGA 1BLUA 4O44A 1CQMA 1NU4A 2ZITA 3M4XA 3DLGB 3M8RA 4F8RA 2B3TB 3UCGA 1Q8BA 1ZYQA 2CQPA 3ONQA 2BQRA 3SQGA 2M9KA 4X4TA 3KKFA 4WFBQ 3MEGA 1FNMA 1H0HB 4IRDA 1R89A 4WYLA 1EETA 3BSNA 3N0VA 3N6NA 3OJUA 1BGXT 3L7PA 4EBDA 4F50A 3OTDA 1C0UB 3NLCA 3QGGA 3OXGA 2HHHF 2XGQA 1RT1A 4KSEB 5KT4A 3KLIB 4N8NA 5L9XA 4EUVA 4X64F 4ECRA 3CGIA 1LOUA 3M30B 3RYLA 4JI6F 4HT5A 2FVCA 3KK1A 2EG1A 3MHYA 4Y2IA 2ACYA 3I4PA 1Y5IB 2QRRA 1OPIA 4X84A 2W7PA 3M30A 4KC5A 4IFVA 4K59A 1QAIA 2Q6BA 4E8UA 3Q2TC 1G6BA 1P6TA 4Q5VA 1S1VA 1Q1KA 3K5LA 5CZVA 4NLSA 3N4WA 2O3DA 1HNXF 1QSYA 1IXKA 3GFZA 1Q7YT 5DS7A 1IBMF 2QFJA 3GFHA 3DOMA 3HVAA 4KHMA 1UVIA 3NGDA 5AXLA 4NZ6A 1OSDA 4B9UA 5CHCB 1O8BA 1HBOB 1M90T 4OX7A 4QIEA 1KFDA 2GQ2A 4RWWA 4C3LA 4K4WA 4ERDA 3CDWA 1XNRF 5AE1A 1XERA 1X4HA 4K2XA 5GAHU 1VOMA 1D3WA 3B78A 2PT0A 3IR7B 3X3UA 2OAUA 1KTVA 1HD0A 3ZZ0A 1HNIA 4CNZA 1JXLA 1YJ9S 1R8PA 2IA6A 2IYIA 2UVVA 5EHHA 5H1SV 2UUCF 4C8KA 3BSOA 3CCRS 1BD6A 2IC3B 3RB4A 1UVNA 3NS5A 3SI8A 2M52A 3FDSA 4CH0S 5KOXA 2M4MA 3TI0A 5I3UB 2W9BA 2JEJA 5AXMA 1M0SA 5L1KA 2BANA 1S1VB 4FPRA 2BQUA 1RTDB 3K57A 2VC0A 1SJ1A 1XR6A 4RNHA 5KFSA 3RW6A 2B4UA 3MM5A 3QJLA 3QAEA 3CCLS 2D41A 2DR5A 4NCAA 2EKYA 3AQPA 2BVZA 3O6QA 3ZZYA 4AXJA 3FCHA 6FD1A 1QVFR 1IJEB 3MM6B 4JI0F 5IT9Y 2VC1A 5E3AA 4BWJA 4JI3F 2E9RX 4C9DA 3MMAA 5LJ3Y 3O5TB 1KOOA 3I82A 4PCQA 5B0EA 4OHZA 5I3UA 1Q78A 1SJRA 2ZBCA 1IQZA 1RI7A 1LK5A 1UKUA 4NCGA 5A2QY 4ITSA 2YKNA 4AL6A 4KTQA 2DVIA 4N41A 4TU7A 5HLFB 3QJJA 2RRNA 5F8MA 1S10A 1N34F 3ITHA 1RT5B 2YWKA 4Y3CA 2O1PA 3L3CA 2EBGA 2BW2A 5KFQA 4QZVB 2G13A 1JLBA 4B3RF 2G9OA 2AJ1A 5CA5A 1KHVA 3B8HA 1KQGB 4YDDB 4ZVEA 4Y2AA 3IS9B 1U1PA 1FF2A 3CJ3A 4F4XA 1JMTA 2R7QA 5KTQA 2VFTA 3ICLA 3FFIA 2V5HG 5GMKa 2GNKA 1HWLA 4P2SA 5CCMA 1FXRA 4U6PA 1HBNA 4K4ZA 2V94A 4JI7F 3BREA 4WFNQ 2JFDA 1UAWA 1NH8A 3CDEA 2R7WA 1UEUA 2XSJA 2NQPA 2R7TA 1MU2A 3IRXA 3IFEA 2ZKTA 2YH1A 1VIXA 2GC8A 1FNOA 1SIWB