2B7EA

First ff domain of prp40 yeast protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
GAMEAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA processing protein PRP40
publication title The structure of Prp40 FF1 domain and its interaction with the crn-TPR1 motif of Clf1 gives a new insight into the binding mode of FF domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 21
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2b7eA00
2DOFA 2DODA 2KIQA 2DOEA 2CQNA 4FQGA 2K85A 1UZCA 2KISA 2LKSA 2KZGA 2L9VA 2E71A 2JUCA 2KFDA 2B7EA
chains in the Genus database with same CATH superfamily
1HCRA 1IUYA 1SC7A 2HQNA 3UNGC 2QM3A 2EFQA 3AKZA 3L2CA 5EZGA 2LFBA 1UHMA 1IO2A 4DOZA 4I01A 1IRFA 2HU9A 3HBLA 3R61A 5KAFC 1VZ0A 2H8WA 1F43A 1QNTA 1WZ2A 2K5CA 5L3EA 5FKKA 1JT6A 3H5RA 1W5SA 3LSJA 4JX4A 4XLHA 4A3DJ 2DQLA 5HLHA 3ABLH 4ESFA 2VONA 1S29A 2X85A 4A3LJ 3DTIA 4U7BA 1MKMA 5LLQA 4RS8A 1X2NA 1DU6A 3P7NA 3F23A 2OCCH 2O5RA 4L18B 3RKYA 1LFUP 1J7KA 4HYEA 3HTSB 1P92A 3OYHA 2VOPA 4KT6A 1X3WB 1MSFC 1XD7A 1KYZA 1R49A 1F1ZA 3PJRA 3EETA 5J8FA 1Y8QB 2O8XA 1IJWC 2HVRA 1ACIA 2VJIA 3JRCA 1HDPA 2JSCA 4XKCA 3VSLA 3KETA 3UKGA 2X6OA 1MZBA 1LQ1A 3KZIC 4KDPA 2CU7A 4UUSA 2CGPA 2VBYA 1H9TA 1E2XA 2D2WA 1SD7A 1R5HA 3FMRA 4EQQA 2ZMEC 2DLLA 1TW2A 2ZC2A 4A5NA 4EJOA 4LK0F 3D5LA 3H9JA 3CCUI 5CQEA 3B02A 2KFDA 3DU6A 3CUOA 3VPRA 3WODF 3S2DJ 1YW7A 2VJJA 1YITI 3GF2A 1W1WE 1ZKGA 2VBZA 3LL7A 3FZVA 3RIRA 3CZ6A 2HVSA 1IDYA 2VJ4A 1RKTA 4BEHA 2CV0A 3GYHX 3RQ4A 2DA6A 3OIPA 3DEEA 5DM7F 2ZB9A 1HF0A 3AG3H 4IZZA 1ITYA 1GXQA 3BG7A 1YS7A 4V2FA 2E71A 5EEAA 2KL4A 2QBYB 4X1EA 1W7PA 1RIOH 3PUBA 1A31A 2VJ5A 4EV0A 3PO3J 2GA1A 2YS9A 1AKHB 1N75A 3AFHA 3KLNA 4BL0B 3FHZA 1P7JA 2PN6A 2FQ3A 2IT0A 4XKBA 3S1NJ 2ZCWA 1STZA 2V1UA 4HEA2 1I6XA 1WCMJ 2L9VA 1JGSA 3REOA 4IQJA 2M9HA 1WPKA 4FHTA 1Z6RA 3FDYA 3OS1A 2R0QC 2PMUA 2NRAC 1UZCA 2KISA 4NC8A 2W24A 4Y33A 4XRSA 3L2RA 3ZMUA 2A07F 2XRLA 1O3QA 4CA0A 4LK1F 5TRDA 2F48A 5JVGF 1EH7A 3B6AA 4F91B 4CHUA 1LFPA 2P8TA 3U21A 1LDKB 2OF7A 4BYYA 1HA8A 3OIOA 2JA6J 2NS8A 4OIPF 3BG6A 1KU9A 2IBDA 3WTUC 1USSA 3ROUA 1A36A 2R7XA 2G9WA 2L9RA 4A3CJ 2V9VA 5D5WB 2VQCA 1A04A 3VYSB 3N97A 3C18A 1UJ8A 2PJRA 4BE2A 1I50J 3QP5A 4PSWA 2FEZA 2YUSA 4A3KJ 1SFXA 1S7EA 1ONVA 2DMNA 4A12A 3H0GJ 1G3SA 2L4MA 3ECHA 3LSRA 1ZQ3P 4XR6A 1ZLJA 4AYBN 1QGPA 3AG4H 3BZCA 5HDGA 2L7MP 2X4HA 2CG4A 3TQNA 2M45A 3WGIA 1HSTA 2JVGA 3K69A 4HZFA 4XMYA 4YELA 5LEJA 1Y0NA 4XSXF 2KDOA 4XLEA 2JZYA 1U9OA 1JKPC 3KP5A 2DODA 4AYBA 1GV2A 1R1VA 3ZQCA 4HBLA 3LWFA 1XCVA 2IGMA 2CW7A 2PBIA 3DP7A 4NC7A 3CJTB 2XF5A 2HZDA 1HOMA 3H3UA 2EV5A 1D0YA 3CMMA 5CYVA 3SXYA 1JUMA 2B7EA 1MBKA 2JN6A 3DF8A 4RB2C 2IVMA 2UV1A 3OSGA 4XK4A 2L7FP 3BJAA 1BI0A 2HPIA 5DD8A 3ZQGA 2VLAA 3S3MA 1QPMA 2K9LA 2MBFA 1DU0A 4ZYEA 2FXAA 4LLNA 1CF7B 1JXSA 2ISZA 3OYLA 2ECCA 2M30A 3H5NA 4DGWB 2LREA 1KU7A 2JMWA 3W6VA 2FU4A 4D7MA 5IPAA 3OS0A 1ZARA 3S93A 4IQ4A 1L0OC 3QU6A 4HSTA 2DDAA 1BC8C 3MD2A 1WHUA 3CTAA 3D5SC 5A2QK 3IP4B 3NWTA 1J59A 1WKMA 4XLPF 2HYJA 1E0EA 3U2RA 2LNBA 4MTEA 2FOKA 1NK2P 2QBYA 4IHSA 1B59A 1FBQA 3SEQA 1IV8A 1R22A 5IT3A 5KCMA 3KE2A 4BDZA 2P5LC 2LR8A 3F6VA 3G1OA 5TISC 1P4AA 1HKQA 1N77A 2WY8Q 3HG9A 4M73A 4RAYA 2LF8A 3HRUA 1R71A 2OQGA 3E6DA 2W48A 3F3XA 1G8XA 2OD5A 4L9NA 1Z9CA 3CC2I 1KGSA 2LF7A 1GDTA 3EUAA 1U2WA 3S14J 4YEJA 1ETKA 5EG0A 3FXKA 3FWEA 2ESHA 4L9VA 2FRHA 2EA2A 2VXZA 2GIZA 4BU2A 5M5XJ 3VB2A 4IHVA 2DOFA 2KIMA 2P0WA 2E1CA 3V7CA 3WU2C 3A1YA 4YIIA 4G6QA 4CSWA 2KT0A 1RC9A 4FX0A 4KJZA 3GTJJ 1N25A 3BG3A 1OYWA 5BQTA 2QQAA 1D8JA 5E18F 1WJ5A 4ETSA 2HGCA 1R1UA 1FYMA 3C1DA 2IEKA 4B47A 4OIQF 4QIWN 1QZEA 3JRIA 1H89C 5AIPA 4AIDA 5HS7A 1BJZA 5DEQA 1XGNA 4KIFA 4M6YA 2CO5A 1YJWI 3CCSI 4RAGA 1FBSA 3SZTA 1R5GA 2BHZA 2P7VB 4A3IJ 1Z05A 3WE2A 4P5OA 3SFZA 2DT6A 2FQ4A 3F9KA 1K7AA 4KMUX 2Z5UA 3ML6A 2YSRA 5ILSA 1NH3A 2W84A 1GVJA 3IAS2 2HQAA 2R7OA 2DDBA 3HSEA 3S15J 4IL6C 4E7KA 2GAUA 4M3DA 4B8XA 1OCTC 3FMQA 3OIQA 4UVCA 1QPIA 3P9IA 3QYEA 4G94A 3R0AA 3MWMA 4IRGA 3M8FA 1IW7F 2NOGA 4M9XA 2ZXHA 4U7DA 5DS9A 1WJBA 5D5UB 2FNAA 4EGZA 2LP0A 3RPQA 5DCMA 1YLFA 2ADUA 2BY0A 3F8MA 4B4CA 3GMEA 1R6RA 2PMZN 1SVLA 1K78B 2KMUA 4YRVA 3IV5A 2MGQA 3PNYA 2AXLA 2O8KA 4BE1A 4CCJA 1X4PA 3PSFA 4IPAA 2HNHA 2LBFB 3OYMA 2CV2A 2HQRA 4DYRA 2RDPA 4MIMA 3DTEA 3FM5A 3RTRA 5E17F 2XASA 3WTYC 4M6VA 3C2HA 2PMZA 1R4NB 2B0LA 3BTJA 2NVTJ 4A93J 3CMYA 5KK1A 1UG0A 1R1TA 2XGEA 2A5WA 3EUHA 3BJOA 3IUOA 4B3XA 3RPUD 4HF2A 1FWZA 3I58A 3LAPA 1ETVA 4B44A 4A3MJ 1S8NA 4HQEA 3S2HJ 2CWEA 5EGOA 3HOTA 3KP7A 4CYDA 1YJNI 4PJLA 3WE3A 5FO5A 3BZ6A 4IXAA 4Y15A 3AG2H 2R7FA 1OCCH 1PYVA 2PQ8A 1M1EB 4RAFA 3MKLA 1ZGJA 2WWYA 2R7QA 2H1LA 1XC5A 3K2ZA 3E6CC 4EM0B 2J5OA 4DBRA 3RDIA 1XGOA 5ILVA 4FTHA 2LY9A 2M87A 2V9PA 3QPTA 2HI3A 4M72A 3O3KA 3F72A 3O8GA 2JVHA 4CCNA 1X4OA 3G4SI 2K4BA 1SMTA 1W36D 2W82A 1WJDA 1OYYA 4RAZA 4M6XA 1KQ8A 3QOPA 4G6DA 2BXYA 2KIFA 2IS2A 1O3SA 1MW7A 4CH7A 2HS5A 3W6JB 1XCBA 2HDWA 3G2BA 2VPRA 3A02A 1A6QA 1YG2A 1TP4A 2IS1A 3RZDJ 4Y3OA 1YO5C 4DW6A 3GUDA 3J80Z 2TDXA 5HLTA 5HS9A 2M3AA 3LQRA 4N4NB 3KEQA 4P55A 1AHDP 2ZJRF 2ECBA 3W2WA 4MTDA 1BI2A 2KDZA 4UHTA 5HNFA 2JA8J 1VQ6I 1R5ID 1V3FA 5B5EC 2DTRA 3GVAA 3WTZA 2E2JJ 1SEUA 2ID6A 4P1WA 3G73A 4DNCA 3CO7C 1BOAA 2RC4A 1CGPA 3HXLA 5FKMA 3ASOH 5E1WA 2JWTA 2QEXI 2HQ5A 3E5XA 1JHFA 2XB0X 2IA2A 3FM3A 4ESBA 3DCFA 1I3AA 5D4RA 2VODA 2P7CB 2LD5A 4O3MA 3SHFA 1V4RA 2M1BA 3K10A 3JSPA 1UG2A 3CCEI 2CQ7A 3SQNA 1T6SA 2M34A 2WA0A 1ZR2A 5M3FJ 5B1BH 4H0EA 2GXBA 4BQOA 2ICWG 4I0AA 2E5NA 1BR2A 3TP3A 2EZKA 2E5ZA 3PIOF 2E1NA 3IAM2 4IHXA 2F4MB 3HRSA 2F2EA 4LITA 3ZGKA 1P2FA 4LFUA 4EM1A 2OTJI 3BC8A 4LIVA 3RZOJ 1WVRA 3ZMZA 3ONQA 1VFCA 1TNSA 4IF4A 1DQUA 1YYVA 2OAZA 2K9MA 4I02A 2OJED 2RV8A 3FHNA 2K40A 4R1HA 4DJAA 3KYCB 3M1CA 1T2KA 2HWVA 2R7UA 2DN0A 1I3QJ 3ZQFA 1MGTA 2LBFA 4EJTA 3OYFA 3GTGJ 2MD0A 5D5XB 2VBXA 4B3AA 5L3FA 1MNMC 1OJLA 5HODA 3BR5A 4CXFA 5IT9Z 2X51A 4HPQA 2P5KA 3S8PA 1V5EA 2A61A 3BT9A 4RB1A 3TL4X 5E3MA 3GLXA 3PNTA 2X1DA 3I64A 3A01A 2H27A 2MLGA 1S9HA 4FE7A 2V79A 5LHIA 1WRJA 4U88A 5M3MJ 4HRIA 2P5VA 1SD4A 3HPHA 2F5EA 5KAIC 1PP8F 1IN4A 5GTHC 3T1BA 2DW4A 3A0HC 2BZTA 4UNOA 1W7PB 1ON1A 3OR1C 3J7ZI 1ETOA 5K7FA 3PQKA 4I0BA 2KIUA 4B48A 1J09A 5JR3A 2H8RA 4NDLA 4II2A 1W0TA 4CCKA 4RB0A 1RR8C 5FLVA 5LGUA 4KUMA 5EZHA 2VKDA 3BR0A 1BC7C 3QAHA 3WU1B 4Y17A 2DOEA 4ZYAA 2MH9A 3R6SA 2H1KA 1WJFA 4ZYGA 2KQRA 1I39A 1F5TA 2MC3A 4ZC3A 3OWTA 3HOXJ 3E7LA 1VQ4I 2DU9A 1WSUA 2ZJ2A 4DZPA 5K5OA 2DCEA 2FBHA 1K61A 4J01A 4E4HA 4UY8I 1U9NA 3WG9A 2GWRA 3KP3A 1TTYA 3I56I 3IWFA 3BPVA 4LB5A 1Y0UA 1OR7A 2QCOA 2RNGA 4MQ9F 3F8FA 2BE5F 3A03A 3LMMA 2VIXA 1K79A 3ZPLA 4OMYA 2XKOA 4I09A 3RPUA 4PUSA 2QENA 4IRHA 3ESWB 2N8GA 2XF6A 4HG2A 2NS7A 3K0LA 2PJRB 4PFPA 4BNCA 4C30A 2G7HA 4JK1X 3QPSA 1SVOA 2EV0A 1OYIA 3ELKA 5JLXA 3L2WA 2DI3A 1DGRM 2M5WA 3CMEI 2IRFG 2EIJH 4ZTJA 3BPXA 3S1RJ 3BQYA 4B43A 2WV0A 3W2AA 3J7AY 1T98A 2MG4A 2VASA 3S16J 5GAEJ 2K02A 1Z3XA 4XLNF 3I55I 3K70D 2R7TA 2O6GE 2ZJPF 1OCZH 3G71I 5FGMA 4YFXF 4BQAA 2LLKA 5F1RA 2GOMA 2K4JA 3DBHB 2V26A 2ZSHB 3TOBA 5F6FA 2BV6A 3VDXA 4ZH4F 5F27A 5E20A 4OIOF 3HTUA 4FCYA 4HX8A 2MC4A 5J8CA 4HF1A 4M71A 2AO9A 1J5YA 3JTHA 3BJ6A 3HGYA 1JE8A 1RUNA 4BAYA 1BW5A 3BROA 2Y31A 2OCEA 4XLCA 2EILH 5IYBJ 3BP8A 5J47A 1FOYA 3PO2J 2M0MA 3F0CA 2Q1ZB 4BKXA 3I54A 1FP2A 3DEWA 3O8HA 1BA5A 4BXFA 1WWXA 1YTYA 3VSKA 3CF5F 2MABA 1LVKA 3BY6A 4EJVA 5D8LB 1K4TA 2MSYA 2XGXA 3M9AA 5EJCA 1FNNA 2V7FA 1PDNC 2PX9A 1MMNA 2LY2A 2NAZA 4WF2A 2DK5A 3IL2A 3HZJA 1OQYA 1BIBA 4RB3C 3F22A 4FETA 2DJIA 3K4BA 3PM1A 1FIPA 1TNTA 1XG1A 2CUZA 3PFIA 3GFLA 4N4OB 5FJ8J 2STWA 1G3YA 2Z99A 3CDHA 2XPUA 3GZNB 3J81Z 1YJ9I 3ULQB 1IN7A 3LSMA 4CO8A 5KNLA 1USTA 2ESNA 4EMSA 1OFCX 4HNTA 2FOWA 3GXOA 2Z16A 3K4NA 1JUSA 2K9SA 4PJNA 3DV8A 1D5YA 2HEOA 4JYKA 3LA7A 2JQ7A 2MD5A 4BY1J 2LRDA 3F6OA 2P6TA 2A5YB 5DUIA 4G7HF 2K7LA 3KP2A 1FEXA 2FA5A 2HPMA 5IT9K 4F52A 5ERIA 3CP2A 2GIVA 2EV6A 1K4SA 3EUHC 2PJPA 3KLOA 4UUTA 4AIHA 4WXHA 3H92A 3FXRA 2CW0F 4XRFA 2X6WA 3H5AA 2VT2A 4KMFA 1TLHB 2OV7A 3CJRB 3MEXA 3PQJA 4RM2A 1V5GA 2H6BA 1IUFA 4MEYF 2CRGA 2W7NA 4M74A 3WTWC 4A0XA 1B6AA 5KHDA 4FT8A 5F0CA 4U0YA 1BIAA 3GTLJ 4FE4A 4UB6C 1UFMA 3P9KA 4MQVA 5EG0B 3HDDA 2M8GX 4L9JA 2DYSH 3SZGA 4QTRA 1WI3A 3GFJA 4E7SA 1BOBA 5B1AH 3U1DA 1XPXA 3CDLA 1Y39A 1R4MB 2BY2A 3HOYJ 3DEUA 1MBHA 3W3CA 1MD0A 3FKIJ 1K6OA 2IW5A 2WY7Q 3ERMA 2OU2A 3JTGA 4V19K 2B63J 2OQRA 2EFNA 3TDZC 1VQOI 2A6EF 2PEXA 3TKYA 1TWAJ 1B72A 1SVMA 2Z1DA 3CCJI 2MLKA 5DM6F 2K9NA 5FRMA 2L7KA 3JRAA 1FJLA 5CLSA 2L01A 3GLLA 4JX6A 4OAYA 1MMDA 4RMNA 2EFWA 2YU9J 4D1QA 1MJBA 3EYYA 1XB4A 5C4JJ 3TW7A 3L1PA 2P4WA 3CESA 1AU7A 3E0JB 1FSHA 2JUGA 4A69C 1LE8A 4HLYA 1TT5B 2EFPA 3L00A 4DBQA 2PMHA 1JJ6C 2M7AA 1QHHD 2XAQA 5FD5A 2VB6A 3SZPA 2VPLA 3E1SA 2LVSA 1Y8RB 5E3NA 4ENKA 3F8BA 3RCOA 1QBJA 5FLXZ 1KONA 2WB1N 3LSIA 4LIUA 2A6HF 1JJ8C 4Y7NJ 5J4YA 4Y52J 3FXMA 5D4SA 2Y0SN 3R0JA 2LH9A 2EA4A 1HW1A 2DA2A 4HV6A 2K3PA 5M5YJ 5DCMB 3DBRB 4BBSJ 1Z6TA 3FXLA 3HHGA 2WB1A 3WHBA 2W4SA 5BMZA 5J1UA 3SJMA 1V5FA 1BI3A 3ABKH 1ETWA 2Y0SA 4ZJZA 1RZ4A 4Q5SF 1WJCA 4FASD 1W5CC 4CCMA 3ECOA 3QYFA 4X0GA 3ZCOA 3JAMZ 4LJZF 5LD2C 2M7BA 5BPDA 3M4OJ 4QWQA 3T8RA 3QQAA 1TT0A 5CKTA 5ICGA 4IKFA 3BR6A 4RGXA 2W57A 2VC0A 4W1UA 5J1RA 2QKMB 2JA5J 5GADJ 3M8JA 3IRQA 2R5ZA 3OSFA 3U9GA 2OA4A 4CYCB 2R7VA 1ZGAA 5FD6A 1LVAA 4UV8A 1O4XA 5EGOB 3CUQB 3M1EA 3HSRA 2HXOA 3ABUA 2XUBA 1ZN2A 2Q2EA 1MDMB 3HJEA 1MBJA 3VYRB 1Y6IA 4XRMA 1FP1D 1K6YA 2DQRA 2C6YA 4AM3A 2XSJC 1B8IB 2NS0A 4BXXJ 3K6GA 4I99C 3RKXA 5BNGA 2D5VA 1NG6A 5ICCA 1KYWA 1SFUA 3OYGA 5TJJA 4E6KG 2QSGX 1QZZA 1R58A 4ZYDA 3MKZA 3HUGA 5F0HA 2R7RA 2LK2A 2OPTA 3I0TA 2KJBA 4RM3A 3VYUB 3LA2A 5CPRB 1Q1VA 4G7OF 2XAFA 2RQPA 3KZZA 2EPFA 3IC7A 4E70A 3KP4A 2KRFA 3NWSA 4LLGF 2V1DA 3C2GA 1IRZA 1HQCA 3TO6A 3EPZA 2CUJA 3MMYB 3TOAA 5EDNA 3I4NJ 1T38A 1OCRH 4PJ0C 1O7FA 3GCMA 2XPVA 4HF0A 4C3JJ 4F3QA 2R7WA 1IGNA 3S1QJ 3NRVA 5L3DA 4RLQA 3QOEA 1MNDA 5BS6A 6PAXA 1NTCA 1Y56A 3KX2A 2BVLA 5L3BA 4HX7A 5FKNA 2ZBKA 2DPDA 2MH2A 1X2MA 5DCFA 1UAAA 5J6XA 1J2XA 3BR3A 4KN7X 3JRHA 2FMLA 3LSPA 1A35A 2OTLI 2EZHA 4PK4A 1MMSA 4L0ZB 1FMWA 2CQKA 4WCGA 3GTQJ 1MBEA 2AQEA 3DQVC 1FZPB 1YQAA 2EBIA 3H3ZA 3OYDA 5F1JA 4DIQA 1OR7C 1Z77A 2L4AA 3FISA 2E7WA 2KJCA 3OL4A 4F92B 1FPQA 4BE0A 1D8KA 4KIGA 2DTZA 3HOSA 4GYIA 3LQQA 3PSIA 5C3EJ 1H8AC 3V8KA 3IH3A 3BG5A 1Z67A 3FBNB 5FFXA 5HVQC 3FKJA 5GAHJ 2L5QA 1YX5A 3HSFA 2NVUB 5ED4A 1RUOA 4GO1A 2TRTA 2DPUA 1Z21A 1BJAA 1UMQA 4B1RA 2K3FA 2GBYA 5DD4A 1JHHA 3D0SA 4UB8C 2RN7A 2DBBA 2DOAA 1J0RA 1P7IA 2QYOA 2JA2A 1QRYA 1OKRA 2DA5A 2X9DA 2X48A 4G6TB 3ZQ7A 2DK8A 4RGRA 1JKRC 1HXDA 1QU3A 3KP6A 4U87A 4I76A 1W36C 4A3GJ 4P96A 5DTDA 1XS9A 5LHHA 3ZXSA 5FKOA 1F4KA 4E7LA 1VTNC 2EZLA 3BWGA 4KFCA 2P6SA 4O5VA 2CMPA 3CP8A 1FOXA 3T5XA 2V9KA 4EEFG 2IA0A 2KIQA 2UUZA 1PUFA 2MYSA 2CFXA 2PG4A 2DA7A 1ETXA 1X1PA 3BQZA 3KPHA 3C7JA 2G0EA 4YFKF 2IGNA 4LG0B 1BM9A 3BR1A 2CQNA 1DDNA 4AWXB 2DFHA 2JJ7A 4CYCA 2E7XA 1XMXA 1RETA 3BDDA 1OISA 4LGWA 1IXRC 3CUQA 3V8JA 2CV1A 2ZFUA 2F5VA 2KLOA 3A01B 2IJLA 1E3PA 1P4WA 3LSGA 2EWNA 1QZYA 4KN4X 1MDMA 1EF4A 2Z9OA 2HOTA 3K1NA 4XSZF 1LB2A 3V8LA 4PGGA 3JAMK 1B8IA 2ME0A 1JUPA 2A69F 1HKSA 4KT5C 5JHFA 2DMQA 4NQWA 3DKXA 5LBQA 1D3YA 1EKEA 1POGA 1FTZA 3SEZA 3W6KB 2FSWA 3GZ5A 3HPGA 3OS2A 4S0HB 2CH0A 2DFIA 2O3FA 3OOUA 4EM2A 1LDJA 2HOAA 1IC8A 4FQGA 3BLYA 3DKYA 3CCLI 3ZR8X 1BN5A 1MH4A 3OYKA 4BXUA 2NOJB 4H4KC 1T56A 1SAUA 4C2MJ 4ON0A 3VOEA 4PGHA 3H9GA 1RESA 2CUEA 2E36A 5EEGA 1WQ2A 4S05A 5E3LA 4MFEA 4CCOA 1HDDC 2QWWA 4LB6B 5JI6A 3J7AO 2A05A 3E97A 1PUEE 3K4JA 4IX7A 1XTAA 5FROA 3OYAA 1FY7A 1OCPA 3JREA 4C2TA 3ZRGA 1U8BA 5BPIA 3TBIA 5EYRA 3FX3A 2HDCA 5H20A 5E8IA 4ZZDA 2NNYA 3HOZJ 3AL0C 2CQQA 3A4CA 3IHUA 2ZFWA 2QKLB 2XAUA 4IOCF 3GTOJ 3G6EI 4CUGA 2HOEA 3KYDB 2VI6A 2Y9YA 2R4GA 5JVTA 3CCQI 2FD5A 4OIRF 4C9YA 1G59A 4ABZA 4X6AJ 3TP0A 2RREA 2FE3A 1HKTA 3OYIA 1YIJI 4BHCA 2L3DA 1T39A 1VQNI 3ABTA 1Z91A 4F7ZA 2RNJA 4L9TA 2NVXJ 3DFGA 4WK8F 4A5MA 4O6JA 3ZN1A 1VF9A 2XAHA 1TBXA 2VKEA 3RYPA 5CVVA 5HLIA 4ZDOA 2Y9ZA 4U0VA 1TQMA 4II3A 1ZAOA 3RKQA 5HDKA 1ZK8A 2RGVA 1FIAA 3MKWB 1O7LA 2ZXIA 4CCLA 1J75A 3F8NA 2E2IJ 5EF6A 2VUMJ 3MVPA 1Z1DA 2L02A 4BJ5C 4XOTA 3G1MA 3VODA 3LOCA 5GP9A 2CSOA 5E1XA 4MEXF 4U0WA 3PIPF 3SFIA 1Y1WJ 2PFBA 2LOOA 2W85A 2GZWA 2Y2ZA 2BYVE 3O6BB 3G1LA 4B09A 4M9ZA 2WAFA 2ZXWH 4RBOA 2QZ8A 2CYYA 2KRCA 4CICA 1W7PD 1HLVA 3OYNA 5HOOA 3BTIA 2JT1A 4DZJA 2E19A 3DKWA 1T08B 3I71A 1X1BA 1X1CA 3WGHA 3CC7I 5FKLA 2BY3A 5CVRA 1F36A 3B73A 2QSFX 4EGYA 1MH3A 1VQ5I 5ILUA 2L0KA 2UXXA 2DT5A 3QU3A 2L9NA 4LG0A 4XLFA 4ITVA 4UV9A 1B1BA 3I53A 1QVUA 3ZMTA 3CMAI 2R93J 1MBGA 1SD5A 4BBRJ 3CO6C 2BW3B 2V6EA 3K4MA 1U3EM 3QWLA 1T95A 3H35A 1DGWY 1BR4A 1Z7UA 3FIWA 3V42A 2HKOA 5IP6A 1C0WA 1OCOH 1ZREA 2IP2A 1GUUA 1YFHA 5L3CA 3DLAA 3LNQA 1QQIA 4XLAA 1KU3A 4A3FJ 2RAEA 1JGGA 1ON2A 5LEKA 3DPTA 1VQLI 2DMTA 4A3BJ 2WAEA 1FT9A 1L3LA 1S3JA 4DYCA 1JTYA 2O0YA 1IV6A 2ELKA 2BEOA 3NARA 1G3WA 3WG7H 3BCAA 1LKXA 4GRIA 2XF7A 2DA3A 2XIGA 2FBIA 4XL9A 3IKVA 4NC6A 3S2WA 3H1CA 4S04A 2V1XA 3M7GA 2ZNYA 3W2VA 1LNWA 2MA3A 2XKPA 4BQQA 3L2UA 3JRFA 2QUFA 1LPQA 3CCMI 1QO0D 3BZKA 1ZRCA 5LGTA 2IXSA 1RPWA 2EH3A 2LY1A 3KEYA 3ZMDA 2COMA 2FBKA 3AL0B 3CD6I 2V1NA 2GLOA 3K9TA 9ANTA 3DLLF 4J00A 1FC3A 1MSEC 2YR2A 1XSXA 1D1AA 4PFOA 1B9MA 5H6QA 1R9TJ 4RGUA 4BUPA 4A0YA 2X6XA 3O2PE 2NVYJ 2E1MB 2R7SA 3L09A 4XN3A 3LFUA 4E7HA 4DQ2A 2JA7J 2XV4S 4LMYA 3S17J 3I3LA 1UHWA 1MJAA 4G7ZF 2GA2A 4PJJA 1V54H 1B72B 3K7AJ 3CC4I 5E1ZB 4XN0A 4XKVA 5DDGA 2JK3A 2LKPA 2LKSA 3J80K 1IXCA 4D5CA 3T0YA 3S32A 2ISYA 3BCBA 2VOOA 5JLWA 1P9QC 3BG9A 3I59A 4WWCA 1EV7A 1X3UA 1X3ZB 1IN6A 4XOPA 3HIFA 3JCUC 3H0DA 2CFOA 2IAIA 3AAFA 2R92J 3CJQB 3ZMSA 5LRSA 1LE8B 3FXQA 1T0FA 4G9YA 1K83J 1OMIA 3VEPA 4BJTA 4E7IA 2MW8A 3GWZA 4OINF 2L7ZA 4GDFA 3B6CA 2M2EA 4OU0A 4Z2YA 3CF2A 1P6RA 3LAJA 2JSPA 2E34A 3HL2A 4CZCA 4A2UA 4XKWA 2P81A 2QLZA 5J4VA 2HFHA 2XPWA 1W0UA 3CDIA 2FUG2 3I4PA 4A0ZA 2ZXJA 4I6ZA 3QRFF 1VQMI 5D6FA 1JT0A 3I4MJ 2IA1A 2YPRA 3CQZJ 1O3RA 4N9HA 5D6EA 1LUJB 1ERDA 4ENNA 2LYCA 3SDGA 1ZYRF 3SYTA 4GXOA 4IO9F 1YOVB 1ZRDA 5K5RA 3EYIA 1IF1A 4C3HJ 2VXDA 3RKWA 2KPMA 1JTXA 3F21A 5C44J 1SFOJ 4G8XA 2JTVA 3ZQQA 1I5ZA 1XDUA 4BHBA 3IH4A 2GXAA 2BVMA 1MMAA 1LEAA 1W4MA 1DPRA 4Y4RA 4ESJA 4MFDA 1GT0C 2XHKA 1FYLA 1H9GA 2R5ZB 1ZG1A 1QHGA 3HM5A 4ZYHA 1H88C 4NB5A 4ZDPA 4BHPA 2GM4A 2DA4A 3N05A 4WXCA 1REPC 3HB9A 1LFBA 4YIFA 3CCVI 2MFZA 2CQXA 2Q2EB 2BW3A 2F5CA 5HNHA 2GQQA 3KCCA 5CVIA 2EIMH 5A2QZ 1DPUA 2DMPA 2LTPA 2A68F 2EQRA 3GO5A 4OOIA 1VQKI 1KQ0A 4E7ZA 3NAUA 4LLLA 3OOPA 4RDUA 1APLC 3K4KA 2O7OA 1Y1VJ 3ZQIA 2VKVA 2VN2A 4MLOA 4OAZA 1ZG3A 2OUMA 4IHYA 1LEBA 4W97A 1NHAA 4L5IA 1GXPA 3HUGB 5L3GA 2R7DA 2JPBA 3CUQC 1HC8A 2FNPA 4HA8A 3L2QA 1EJ9A 1FOWA 5FB2A 3RQIA 1D1CA 2DJNA 2JRTA 2CS3A 1TQPA 3MZ8A 2OBPA 3RSNA 2H09A 5J40A 1IG7A 3BTLA 2XB5A 2B9SA 4HAMA 1D0XA 5CVUA 3HHHA 3GX4X 3IWZA 4XORA 4YG2F 5GTIC 4HDVA 3D5RC 3CCYA 1U5TB 3ZQLA 1WJAA 4MGRA 3H9QA 4AVPA 3R4KA 2NYXA 4A6EA 5FLMJ 1FYKA 3Q9VA 3OMYA 2IS4A 4AVZA 3L7WA 3MZYA 4Z6YA 2Z3YA 1ZHFA 3MAJA 1YS6A 1PVEA 1BI1A 4IHTA 3T8TA 2D1HA 2FX0A 4P9UA 4GFBA 3ZP5A 2IPQX 1YE9A 2JPCA 1YRNB 2DT7B 4EJUA 4BY7J 4BACA 1IZ1A 2NNNA 4A3JJ 3E5QA 2KP6A 4M3FA 2KRHA 5JHUA 1P4XA 2BBYA 2ZNZA 2JRMA 2ZKZA 1O3TA 1SAXA 3JRDA 2FMYA 3CJNA 1GVDA 3DXJF 3CLOA 4XNFA 4QPQA 4CGZA 2HR3A 4F93B 3DU5A 3FMSA 3MZHA 5CVJA 1U6GA 5F04A 1SANA 2I8DA 2AXTC 2M4GA 3Q5FA 4ENMA 1Z7LA 1ZR4A 5TGTA 2EINH 3VFZA 2ZSIB 5IOZA 1XMKA 2JUCA 2D1VA 3PL8A 1FTTA 2Z33A 4JP0A 1E3HA 4MHGA 4WX9A 1H0MA 4BS9A 3E3VA 4XICA 1BL0A 4A6DA 4RLFA 4UVAA 1ENHA 1VQ7I 4KIBA 2ZMEB 1RR7A 5ICEA 5HLGA 3OYJA 4HNUA 3ERED 1JI8A 2M0CA 1TWCJ 3BTCA 2KZGA 3I5UA 4HLXA 3FXJA 1VQ9I 1IN5A 2V6CA 5K7HA 2OC6A 4UUVA 4YFNF 3E6BA 3HEFA 4XBFA 2VE9A 4TV7A 1A6IA 1PUFB 1ETYA 2E35A 3WTTC 2K9QA 3TO9A 2GXGA 4PZJA 2QQ9A 2EZIA 3C3WA 2AS5F 1F9NA 3QP6A 2ME6A 2O61A 2DFFA 3WGGA 4MO7A 5D5VB 5CQGA 1ZGWA 4FX4A 4GCVA 3KYLA 3GTPJ 4D9JA 3A2KA 4ENJA 1BW6A 2QSHX 3EUKL 3TGNA 1X19A 4CZZA 1E3OC 2XSDC 2RQQA 3WHCA 1I6HJ 1YHQI 2BXZA 4I98B 2DXIA 3HGGA 4Q47A 2LC2A 4M3GA 5AONA 4LG3A 4NQWB 5J1YA 3OYCA 3RI4A 1OLTA 3J81K 2ETHA 2L2OA 2XROA 2Y75A 4XRSG 1QVTA 3H3VK 1X1DA 2L54A 3ZQHA 4XM3A 2VQGA 2NXNB 3MQ0A 5IYDJ 3S1MJ 4BDYA 3L2VA 4IHWA 2KHMA 4KYWA 2EIKH 4FISA 5E79C 1UCRA 4R79A 4MNUA 3COAC 2W00A 1B9NA 1S5LC 4KNYA 4D7NA 3ASNH 5ICFA 1U5TA 2RKHA 1IDZA 1TZLA 2ZO4A 3ZN0A 1AKHA 3LSKA 4RGSA 1LJ9A 2DYRH 1PP7U 4KA4A 2STTA 3DPLC 1ULYA 4I2OA 4ZDLA 1ETQA 1V55H 1XMAA 4BQNA 2QQ8A 5IOYA 3FXOA 5BOXA 2VQLA 1WH7A 2G7UA 1S6LA 2HTJA 5B66C 1YX3A 3LSTA 4PCQA 1LDDA 3L9FA 4CDGA 3I9V2 1YRNA 1IAWA 3GEZA 3DPUA 4OWRB 3GBGA 2ZJQF 4QSHA 4ASNA 3HYIA 5KVRA 1XGSA 1FSEA 2RVCA 2M4KA 3M8EA 3P9CA 4XIDA 3E5UA 1MMGA 4EVIA 3WU0A 2E2HJ 3HOUJ 4IVNA 2DO7A 1R23A 1XGMA 2WADA 4DYQA 3HKZN 1G3TA 3JR9A 1ODDA 1NG7A 2CUFA 3V4GA 3N4MA 1DP3A 1ZLKA 1TWGJ 4L0YB 2HOSA 4KICA 3Q3SA 4ZZLA 2Z2SB 3G3ZA 1Z0XA 4OMZA 3KEOA 2BGCA 3HKZA 1E17A 1RRJA 4Q4ZF 2XVCA 2ID3A 4HNVA 4M3BA 5DUKA 2KKOA 3C2BA 3E6MA 5GAGJ 1X1AA 1T0FC 1YW9A 5CJ9A 2YU3A 1I1SA 2W1OA 2XRNA 3QODA 1AWCA 2ZMEA 5FFZA 1SFEA 1WH5A 2VC1A 1TWFJ 3WTXC 2QF7A 3TMOA 4P9FA 1VNDA 2LDUA 3U1KA 5E3OA 5FRNA 2NVQJ 1AOYA 1GV5A 2K85A 5FLXK 3Q9SA 3LFKA 3JRGA 2F5FA 4Y13A 2HYGD 1J9IA 1SD6A 2I10A 3KZYA 3HC7A 1KQ9A 3R60A 3FK7A 2IGKA 1HW5A 3MKYB 1MIJA 1KZHA 1MJ9A 3ISPA 2LKXA 1AA7A 5LFAA 4D0PA 3J7YJ 1WI9A 1XX5A 2LG4A 3AG1H 2VKHA 1ZG5A 4K2EA 2EFOA 1GLNA 1VI0A 2HDDA 2KZVA 4UXNA 1TW3A 2F4IA 1BR1A 2EK5A 2CW8A 2UZKA 1CF7A 3RJPA 1Z3YA 2VL8A 5IY5H 1X58A 4LOCA 2R5YB 1QA6A 4C2UA 1XSVA 1Q1HA 1NK3P 3K2AA 3S3OA 1U78A 4AUXA 4M3EA 5GPCA 2DAOA 3DBLB 2M8EA 5GPAA 2Y48A 2ELHA 4EATA 3DWLE 3EDPA 3NQOA 3PNVA 2LMDA 1EH6A 2X1CA 4C3IJ 3X2QH 4KITB 2A3SA 4HX4A 2K27A 2F6CA 4XQFA 5HS8A 1T8IA 3LSHA 1I27A 1XSDA 1ZTRA 5EEHA 1U0JA 4AIJA 4N9IA 2A6TA 4HSRA 3CLQA 3VWBA 1DP7P 1HSJA 2HYFA 2XGDA 1N78A 4RA2A 4WXDA 2IS6A 3OYBA 3LA3A 4R8HA 3TO7A 2EJRA 2Y30A 1D0ZA 2AQFA 5D8KB 2IGOA 2HXIA 1SFKA 4EJWA 4IOAF 5K1YA 2YX4A 4QPOA 1R00A 5K5QA 3K4LA 2XDVA 2E1OA 4NBQA 2WTEA 3FF5A 4NHJA 2BOLA 3MN2A 3M07A 2D45A 3Q0WA 3KFWX 2F4OB 4KISA 5B3SH 2UWMA 2W25A 2FF4A 3P5JA 1GHCA 3GFIA 1W5TA 2I5UA 2Y69H 3QYBA 1HW2A 1G4DA 1UELB 3FK6A 3FXUA 3MCZA 4IRIA 3I59B 2E1MC 2VQHA 1UHSA 2HTSA 2UXNA 1WFXA 2XGCA 2YX7A 5F0FA 3ZMVA 2F5DA 2Q0OA 3EQLF 3D1NI 3OR2C 2L9SA 3RYRA 4IEJA 3NEUA 2WBMA 4L5JA 2QGUA 1S7AA 4D5FA 1MNEA 3HOVJ 4V2GA 2XAJA 2COBA 4JBAA 1G2HA 3VYTB 1JKQC 2WAQN 3OL3A 3ABMH 2VT3A 5H6RA 1SMYF 2OZUA 2HKXA 4JQFA 3HOWJ 4AD9A 3OYEA 3K1PA 2K86A 1XN7A 2LSOA 3IKTA 2O9LA 1R7JA 4AU7A 2R3SA 5AIQA 2WAQA 2AHQA 5LRRA 5IP9J 1ZELA 3F8CA 4HDUA 2BHYA 1B4AA 2OZ6A 3ZOBA 2Y0MA 1MBFA 2H94A 1U8RA 1TWHJ 3DTKA 1RI7A 4HQMA 3MFKA 4AIKA 2PLYA 4HOBA 1HBXG 1R36A 1O57A 5F64A 2X6YA 4PDKA 5F08A 3JW4A 1VQ8I 4LD5A 3S3NA 3M3YJ 3TDUC 4UUSB 1G6NA 1FLIA 1FX7A 3UR3C 4I7HA 4JOMA 5IP7J 1A5JA 2ELJA 5J3LA 5H2FC 2ACJA 2R7ZJ 2WC2A 1D1BA 3BOQA 1TC3C 2QVOA 2J5PA 3BR2A 4G12A 3TEDA 1JKOC 2DMUA 2XC7A 1K78A 1KA8A 4UVBA 3CCRI 2CJJA 3IRRA 1IXSB 1YI2I 2V4JC 1PJRA 2HVQA 1FBUA 2WV1A 1YW8A 1UB9A 3K4CA 2E60A 5E8GA 5M5WJ 4BGDA 4IJAA 2R5YA 1TL8A 1CQTA 3QPLA 1EH8A 3IH2A 2EB7A 3OV8A 4ANJA 3PUFA 1IRGA 1T33A 4PJMA 4N0BA 4YIRX 3FBIB 4BH9A 2VBWA 4BEHB 1EA3A 1S72I 3GTKJ 1WJEA 4A3EJ 1FMVA 4HV5A 4M9SA 2BY1A 4NUBA 4AC0A 3PFYA 4XONA 2TCTA 2VE8A 3GFMA 3K70C 1I1GA 4NNJA 1D5VA 4E7JA 2QA4I 1DUXC 1OPCA 4JX5A 3KIOA 3WTSC 5IYCJ 2X1EA 2DFEA 5LGNA 1TQIA 2H6CA 3OY9A 3HRMA 1IRXA 1VQPI 2O03A 4GYGA 5LHGA 1ZH5A 4PSXA 4Q48A 3GZ6A 4J19A 3V7RA 3Q0VA 2QQBA 4QLCU 1IN8A 5HDNA 1FOKA 1ORKA 3V7SA 2XAGA 3JSOA 1YIOA 1RNLA 3H36A 3JRBA 3A0BC 1S7OA 1KU2A 3SDBA 4GGGA 3GW2A 1RKWA 3K1MA 4F55A 3WTVC 1XDSA 1WGXA 2GOXB 1ZRFA 2FJ1A 2DA1A 1BBYA 5DV5A 3HRTA 5JFRA 3TW6A 4ZTFA 3QPHA 5C4XJ 2PI0A 3Q0UA 3GTMJ 5K7ZA 5DYMA 4BJ6C 2HZTA 1U5TC 4L5EA 2Q8KA 2X0LA 4HW0A
chains in the Genus database with same CATH topology
2DOFA 2DODA 2KIQA 2DOEA 2CQNA 4FQGA 2K85A 1UZCA 2KISA 2LKSA 2KZGA 2L9VA 2E71A 2JUCA 2KFDA 2B7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOF A;  2DOD A;  2KIQ A;  2DOE A;  2CQN A;  4FQG A;  2K85 A;  1UZC A;  2KIS A;  2LKS A;  2KZG A;  2L9V A;  2E71 A;  2JUC A;  2KFD A;  2B7E A; 
#chains in the Genus database with same CATH topology
 1HCR A;  1IUY A;  1SC7 A;  2HQN A;  3UNG C;  2QM3 A;  2EFQ A;  3AKZ A;  3L2C A;  5EZG A;  2LFB A;  1UHM A;  1IO2 A;  4DOZ A;  4I01 A;  1IRF A;  2HU9 A;  3HBL A;  3R61 A;  5KAF C;  1VZ0 A;  2H8W A;  1F43 A;  1QNT A;  1WZ2 A;  2K5C A;  5L3E A;  5FKK A;  1JT6 A;  3H5R A;  1W5S A;  3LSJ A;  4JX4 A;  4XLH A;  4A3D J;  2DQL A;  5HLH A;  3ABL H;  4ESF A;  2VON A;  1S29 A;  2X85 A;  4A3L J;  3DTI A;  4U7B A;  1MKM A;  5LLQ A;  4RS8 A;  1X2N A;  1DU6 A;  3P7N A;  3F23 A;  2OCC H;  2O5R A;  4L18 B;  3RKY A;  1LFU P;  1J7K A;  4HYE A;  3HTS B;  1P92 A;  3OYH A;  2VOP A;  4KT6 A;  1X3W B;  1MSF C;  1XD7 A;  1KYZ A;  1R49 A;  1F1Z A;  3PJR A;  3EET A;  5J8F A;  1Y8Q B;  2O8X A;  1IJW C;  2HVR A;  1ACI A;  2VJI A;  3JRC A;  1HDP A;  2JSC A;  4XKC A;  3VSL A;  3KET A;  3UKG A;  2X6O A;  1MZB A;  1LQ1 A;  3KZI C;  4KDP A;  2CU7 A;  4UUS A;  2CGP A;  2VBY A;  1H9T A;  1E2X A;  2D2W A;  1SD7 A;  1R5H A;  3FMR A;  4EQQ A;  2ZME C;  2DLL A;  1TW2 A;  2ZC2 A;  4A5N A;  4EJO A;  4LK0 F;  3D5L A;  3H9J A;  3CCU I;  5CQE A;  3B02 A;  2KFD A;  3DU6 A;  3CUO A;  3VPR A;  3WOD F;  3S2D J;  1YW7 A;  2VJJ A;  1YIT I;  3GF2 A;  1W1W E;  1ZKG A;  2VBZ A;  3LL7 A;  3FZV A;  3RIR A;  3CZ6 A;  2HVS A;  1IDY A;  2VJ4 A;  1RKT A;  4BEH A;  2CV0 A;  3GYH X;  3RQ4 A;  2DA6 A;  3OIP A;  3DEE A;  5DM7 F;  2ZB9 A;  1HF0 A;  3AG3 H;  4IZZ A;  1ITY A;  1GXQ A;  3BG7 A;  1YS7 A;  4V2F A;  2E71 A;  5EEA A;  2KL4 A;  2QBY B;  4X1E A;  1W7P A;  1RIO H;  3PUB A;  1A31 A;  2VJ5 A;  4EV0 A;  3PO3 J;  2GA1 A;  2YS9 A;  1AKH B;  1N75 A;  3AFH A;  3KLN A;  4BL0 B;  3FHZ A;  1P7J A;  2PN6 A;  2FQ3 A;  2IT0 A;  4XKB A;  3S1N J;  2ZCW A;  1STZ A;  2V1U A;  4HEA 2;  1I6X A;  1WCM J;  2L9V A;  1JGS A;  3REO A;  4IQJ A;  2M9H A;  1WPK A;  4FHT A;  1Z6R A;  3FDY A;  3OS1 A;  2R0Q C;  2PMU A;  2NRA C;  1UZC A;  2KIS A;  4NC8 A;  2W24 A;  4Y33 A;  4XRS A;  3L2R A;  3ZMU A;  2A07 F;  2XRL A;  1O3Q A;  4CA0 A;  4LK1 F;  5TRD A;  2F48 A;  5JVG F;  1EH7 A;  3B6A A;  4F91 B;  4CHU A;  1LFP A;  2P8T A;  3U21 A;  1LDK B;  2OF7 A;  4BYY A;  1HA8 A;  3OIO A;  2JA6 J;  2NS8 A;  4OIP F;  3BG6 A;  1KU9 A;  2IBD A;  3WTU C;  1USS A;  3ROU A;  1A36 A;  2R7X A;  2G9W A;  2L9R A;  4A3C J;  2V9V A;  5D5W B;  2VQC A;  1A04 A;  3VYS B;  3N97 A;  3C18 A;  1UJ8 A;  2PJR A;  4BE2 A;  1I50 J;  3QP5 A;  4PSW A;  2FEZ A;  2YUS A;  4A3K J;  1SFX A;  1S7E A;  1ONV A;  2DMN A;  4A12 A;  3H0G J;  1G3S A;  2L4M A;  3ECH A;  3LSR A;  1ZQ3 P;  4XR6 A;  1ZLJ A;  4AYB N;  1QGP A;  3AG4 H;  3BZC A;  5HDG A;  2L7M P;  2X4H A;  2CG4 A;  3TQN A;  2M45 A;  3WGI A;  1HST A;  2JVG A;  3K69 A;  4HZF A;  4XMY A;  4YEL A;  5LEJ A;  1Y0N A;  4XSX F;  2KDO A;  4XLE A;  2JZY A;  1U9O A;  1JKP C;  3KP5 A;  2DOD A;  4AYB A;  1GV2 A;  1R1V A;  3ZQC A;  4HBL A;  3LWF A;  1XCV A;  2IGM A;  2CW7 A;  2PBI A;  3DP7 A;  4NC7 A;  3CJT B;  2XF5 A;  2HZD A;  1HOM A;  3H3U A;  2EV5 A;  1D0Y A;  3CMM A;  5CYV A;  3SXY A;  1JUM A;  2B7E A;  1MBK A;  2JN6 A;  3DF8 A;  4RB2 C;  2IVM A;  2UV1 A;  3OSG A;  4XK4 A;  2L7F P;  3BJA A;  1BI0 A;  2HPI A;  5DD8 A;  3ZQG A;  2VLA A;  3S3M A;  1QPM A;  2K9L A;  2MBF A;  1DU0 A;  4ZYE A;  2FXA A;  4LLN A;  1CF7 B;  1JXS A;  2ISZ A;  3OYL A;  2ECC A;  2M30 A;  3H5N A;  4DGW B;  2LRE A;  1KU7 A;  2JMW A;  3W6V A;  2FU4 A;  4D7M A;  5IPA A;  3OS0 A;  1ZAR A;  3S93 A;  4IQ4 A;  1L0O C;  3QU6 A;  4HST A;  2DDA A;  1BC8 C;  3MD2 A;  1WHU A;  3CTA A;  3D5S C;  5A2Q K;  3IP4 B;  3NWT A;  1J59 A;  1WKM A;  4XLP F;  2HYJ A;  1E0E A;  3U2R A;  2LNB A;  4MTE A;  2FOK A;  1NK2 P;  2QBY A;  4IHS A;  1B59 A;  1FBQ A;  3SEQ A;  1IV8 A;  1R22 A;  5IT3 A;  5KCM A;  3KE2 A;  4BDZ A;  2P5L C;  2LR8 A;  3F6V A;  3G1O A;  5TIS C;  1P4A A;  1HKQ A;  1N77 A;  2WY8 Q;  3HG9 A;  4M73 A;  4RAY A;  2LF8 A;  3HRU A;  1R71 A;  2OQG A;  3E6D A;  2W48 A;  3F3X A;  1G8X A;  2OD5 A;  4L9N A;  1Z9C A;  3CC2 I;  1KGS A;  2LF7 A;  1GDT A;  3EUA A;  1U2W A;  3S14 J;  4YEJ A;  1ETK A;  5EG0 A;  3FXK A;  3FWE A;  2ESH A;  4L9V A;  2FRH A;  2EA2 A;  2VXZ A;  2GIZ A;  4BU2 A;  5M5X J;  3VB2 A;  4IHV A;  2DOF A;  2KIM A;  2P0W A;  2E1C A;  3V7C A;  3WU2 C;  3A1Y A;  4YII A;  4G6Q A;  4CSW A;  2KT0 A;  1RC9 A;  4FX0 A;  4KJZ A;  3GTJ J;  1N25 A;  3BG3 A;  1OYW A;  5BQT A;  2QQA A;  1D8J A;  5E18 F;  1WJ5 A;  4ETS A;  2HGC A;  1R1U A;  1FYM A;  3C1D A;  2IEK A;  4B47 A;  4OIQ F;  4QIW N;  1QZE A;  3JRI A;  1H89 C;  5AIP A;  4AID A;  5HS7 A;  1BJZ A;  5DEQ A;  1XGN A;  4KIF A;  4M6Y A;  2CO5 A;  1YJW I;  3CCS I;  4RAG A;  1FBS A;  3SZT A;  1R5G A;  2BHZ A;  2P7V B;  4A3I J;  1Z05 A;  3WE2 A;  4P5O A;  3SFZ A;  2DT6 A;  2FQ4 A;  3F9K A;  1K7A A;  4KMU X;  2Z5U A;  3ML6 A;  2YSR A;  5ILS A;  1NH3 A;  2W84 A;  1GVJ A;  3IAS 2;  2HQA A;  2R7O A;  2DDB A;  3HSE A;  3S15 J;  4IL6 C;  4E7K A;  2GAU A;  4M3D A;  4B8X A;  1OCT C;  3FMQ A;  3OIQ A;  4UVC A;  1QPI A;  3P9I A;  3QYE A;  4G94 A;  3R0A A;  3MWM A;  4IRG A;  3M8F A;  1IW7 F;  2NOG A;  4M9X A;  2ZXH A;  4U7D A;  5DS9 A;  1WJB A;  5D5U B;  2FNA A;  4EGZ A;  2LP0 A;  3RPQ A;  5DCM A;  1YLF A;  2ADU A;  2BY0 A;  3F8M A;  4B4C A;  3GME A;  1R6R A;  2PMZ N;  1SVL A;  1K78 B;  2KMU A;  4YRV A;  3IV5 A;  2MGQ A;  3PNY A;  2AXL A;  2O8K A;  4BE1 A;  4CCJ A;  1X4P A;  3PSF A;  4IPA A;  2HNH A;  2LBF B;  3OYM A;  2CV2 A;  2HQR A;  4DYR A;  2RDP A;  4MIM A;  3DTE A;  3FM5 A;  3RTR A;  5E17 F;  2XAS A;  3WTY C;  4M6V A;  3C2H A;  2PMZ A;  1R4N B;  2B0L A;  3BTJ A;  2NVT J;  4A93 J;  3CMY A;  5KK1 A;  1UG0 A;  1R1T A;  2XGE A;  2A5W A;  3EUH A;  3BJO A;  3IUO A;  4B3X A;  3RPU D;  4HF2 A;  1FWZ A;  3I58 A;  3LAP A;  1ETV A;  4B44 A;  4A3M J;  1S8N A;  4HQE A;  3S2H J;  2CWE A;  5EGO A;  3HOT A;  3KP7 A;  4CYD A;  1YJN I;  4PJL A;  3WE3 A;  5FO5 A;  3BZ6 A;  4IXA A;  4Y15 A;  3AG2 H;  2R7F A;  1OCC H;  1PYV A;  2PQ8 A;  1M1E B;  4RAF A;  3MKL A;  1ZGJ A;  2WWY A;  2R7Q A;  2H1L A;  1XC5 A;  3K2Z A;  3E6C C;  4EM0 B;  2J5O A;  4DBR A;  3RDI A;  1XGO A;  5ILV A;  4FTH A;  2LY9 A;  2M87 A;  2V9P A;  3QPT A;  2HI3 A;  4M72 A;  3O3K A;  3F72 A;  3O8G A;  2JVH A;  4CCN A;  1X4O A;  3G4S I;  2K4B A;  1SMT A;  1W36 D;  2W82 A;  1WJD A;  1OYY A;  4RAZ A;  4M6X A;  1KQ8 A;  3QOP A;  4G6D A;  2BXY A;  2KIF A;  2IS2 A;  1O3S A;  1MW7 A;  4CH7 A;  2HS5 A;  3W6J B;  1XCB A;  2HDW A;  3G2B A;  2VPR A;  3A02 A;  1A6Q A;  1YG2 A;  1TP4 A;  2IS1 A;  3RZD J;  4Y3O A;  1YO5 C;  4DW6 A;  3GUD A;  3J80 Z;  2TDX A;  5HLT A;  5HS9 A;  2M3A A;  3LQR A;  4N4N B;  3KEQ A;  4P55 A;  1AHD P;  2ZJR F;  2ECB A;  3W2W A;  4MTD A;  1BI2 A;  2KDZ A;  4UHT A;  5HNF A;  2JA8 J;  1VQ6 I;  1R5I D;  1V3F A;  5B5E C;  2DTR A;  3GVA A;  3WTZ A;  2E2J J;  1SEU A;  2ID6 A;  4P1W A;  3G73 A;  4DNC A;  3CO7 C;  1BOA A;  2RC4 A;  1CGP A;  3HXL A;  5FKM A;  3ASO H;  5E1W A;  2JWT A;  2QEX I;  2HQ5 A;  3E5X A;  1JHF A;  2XB0 X;  2IA2 A;  3FM3 A;  4ESB A;  3DCF A;  1I3A A;  5D4R A;  2VOD A;  2P7C B;  2LD5 A;  4O3M A;  3SHF A;  1V4R A;  2M1B A;  3K10 A;  3JSP A;  1UG2 A;  3CCE I;  2CQ7 A;  3SQN A;  1T6S A;  2M34 A;  2WA0 A;  1ZR2 A;  5M3F J;  5B1B H;  4H0E A;  2GXB A;  4BQO A;  2ICW G;  4I0A A;  2E5N A;  1BR2 A;  3TP3 A;  2EZK A;  2E5Z A;  3PIO F;  2E1N A;  3IAM 2;  4IHX A;  2F4M B;  3HRS A;  2F2E A;  4LIT A;  3ZGK A;  1P2F A;  4LFU A;  4EM1 A;  2OTJ I;  3BC8 A;  4LIV A;  3RZO J;  1WVR A;  3ZMZ A;  3ONQ A;  1VFC A;  1TNS A;  4IF4 A;  1DQU A;  1YYV A;  2OAZ A;  2K9M A;  4I02 A;  2OJE D;  2RV8 A;  3FHN A;  2K40 A;  4R1H A;  4DJA A;  3KYC B;  3M1C A;  1T2K A;  2HWV A;  2R7U A;  2DN0 A;  1I3Q J;  3ZQF A;  1MGT A;  2LBF A;  4EJT A;  3OYF A;  3GTG J;  2MD0 A;  5D5X B;  2VBX A;  4B3A A;  5L3F A;  1MNM C;  1OJL A;  5HOD A;  3BR5 A;  4CXF A;  5IT9 Z;  2X51 A;  4HPQ A;  2P5K A;  3S8P A;  1V5E A;  2A61 A;  3BT9 A;  4RB1 A;  3TL4 X;  5E3M A;  3GLX A;  3PNT A;  2X1D A;  3I64 A;  3A01 A;  2H27 A;  2MLG A;  1S9H A;  4FE7 A;  2V79 A;  5LHI A;  1WRJ A;  4U88 A;  5M3M J;  4HRI A;  2P5V A;  1SD4 A;  3HPH A;  2F5E A;  5KAI C;  1PP8 F;  1IN4 A;  5GTH C;  3T1B A;  2DW4 A;  3A0H C;  2BZT A;  4UNO A;  1W7P B;  1ON1 A;  3OR1 C;  3J7Z I;  1ETO A;  5K7F A;  3PQK A;  4I0B A;  2KIU A;  4B48 A;  1J09 A;  5JR3 A;  2H8R A;  4NDL A;  4II2 A;  1W0T A;  4CCK A;  4RB0 A;  1RR8 C;  5FLV A;  5LGU A;  4KUM A;  5EZH A;  2VKD A;  3BR0 A;  1BC7 C;  3QAH A;  3WU1 B;  4Y17 A;  2DOE A;  4ZYA A;  2MH9 A;  3R6S A;  2H1K A;  1WJF A;  4ZYG A;  2KQR A;  1I39 A;  1F5T A;  2MC3 A;  4ZC3 A;  3OWT A;  3HOX J;  3E7L A;  1VQ4 I;  2DU9 A;  1WSU A;  2ZJ2 A;  4DZP A;  5K5O A;  2DCE A;  2FBH A;  1K61 A;  4J01 A;  4E4H A;  4UY8 I;  1U9N A;  3WG9 A;  2GWR A;  3KP3 A;  1TTY A;  3I56 I;  3IWF A;  3BPV A;  4LB5 A;  1Y0U A;  1OR7 A;  2QCO A;  2RNG A;  4MQ9 F;  3F8F A;  2BE5 F;  3A03 A;  3LMM A;  2VIX A;  1K79 A;  3ZPL A;  4OMY A;  2XKO A;  4I09 A;  3RPU A;  4PUS A;  2QEN A;  4IRH A;  3ESW B;  2N8G A;  2XF6 A;  4HG2 A;  2NS7 A;  3K0L A;  2PJR B;  4PFP A;  4BNC A;  4C30 A;  2G7H A;  4JK1 X;  3QPS A;  1SVO A;  2EV0 A;  1OYI A;  3ELK A;  5JLX A;  3L2W A;  2DI3 A;  1DGR M;  2M5W A;  3CME I;  2IRF G;  2EIJ H;  4ZTJ A;  3BPX A;  3S1R J;  3BQY A;  4B43 A;  2WV0 A;  3W2A A;  3J7A Y;  1T98 A;  2MG4 A;  2VAS A;  3S16 J;  5GAE J;  2K02 A;  1Z3X A;  4XLN F;  3I55 I;  3K70 D;  2R7T A;  2O6G E;  2ZJP F;  1OCZ H;  3G71 I;  5FGM A;  4YFX F;  4BQA A;  2LLK A;  5F1R A;  2GOM A;  2K4J A;  3DBH B;  2V26 A;  2ZSH B;  3TOB A;  5F6F A;  2BV6 A;  3VDX A;  4ZH4 F;  5F27 A;  5E20 A;  4OIO F;  3HTU A;  4FCY A;  4HX8 A;  2MC4 A;  5J8C A;  4HF1 A;  4M71 A;  2AO9 A;  1J5Y A;  3JTH A;  3BJ6 A;  3HGY A;  1JE8 A;  1RUN A;  4BAY A;  1BW5 A;  3BRO A;  2Y31 A;  2OCE A;  4XLC A;  2EIL H;  5IYB J;  3BP8 A;  5J47 A;  1FOY A;  3PO2 J;  2M0M A;  3F0C A;  2Q1Z B;  4BKX A;  3I54 A;  1FP2 A;  3DEW A;  3O8H A;  1BA5 A;  4BXF A;  1WWX A;  1YTY A;  3VSK A;  3CF5 F;  2MAB A;  1LVK A;  3BY6 A;  4EJV A;  5D8L B;  1K4T A;  2MSY A;  2XGX A;  3M9A A;  5EJC A;  1FNN A;  2V7F A;  1PDN C;  2PX9 A;  1MMN A;  2LY2 A;  2NAZ A;  4WF2 A;  2DK5 A;  3IL2 A;  3HZJ A;  1OQY A;  1BIB A;  4RB3 C;  3F22 A;  4FET A;  2DJI A;  3K4B A;  3PM1 A;  1FIP A;  1TNT A;  1XG1 A;  2CUZ A;  3PFI A;  3GFL A;  4N4O B;  5FJ8 J;  2STW A;  1G3Y A;  2Z99 A;  3CDH A;  2XPU A;  3GZN B;  3J81 Z;  1YJ9 I;  3ULQ B;  1IN7 A;  3LSM A;  4CO8 A;  5KNL A;  1UST A;  2ESN A;  4EMS A;  1OFC X;  4HNT A;  2FOW A;  3GXO A;  2Z16 A;  3K4N A;  1JUS A;  2K9S A;  4PJN A;  3DV8 A;  1D5Y A;  2HEO A;  4JYK A;  3LA7 A;  2JQ7 A;  2MD5 A;  4BY1 J;  2LRD A;  3F6O A;  2P6T A;  2A5Y B;  5DUI A;  4G7H F;  2K7L A;  3KP2 A;  1FEX A;  2FA5 A;  2HPM A;  5IT9 K;  4F52 A;  5ERI A;  3CP2 A;  2GIV A;  2EV6 A;  1K4S A;  3EUH C;  2PJP A;  3KLO A;  4UUT A;  4AIH A;  4WXH A;  3H92 A;  3FXR A;  2CW0 F;  4XRF A;  2X6W A;  3H5A A;  2VT2 A;  4KMF A;  1TLH B;  2OV7 A;  3CJR B;  3MEX A;  3PQJ A;  4RM2 A;  1V5G A;  2H6B A;  1IUF A;  4MEY F;  2CRG A;  2W7N A;  4M74 A;  3WTW C;  4A0X A;  1B6A A;  5KHD A;  4FT8 A;  5F0C A;  4U0Y A;  1BIA A;  3GTL J;  4FE4 A;  4UB6 C;  1UFM A;  3P9K A;  4MQV A;  5EG0 B;  3HDD A;  2M8G X;  4L9J A;  2DYS H;  3SZG A;  4QTR A;  1WI3 A;  3GFJ A;  4E7S A;  1BOB A;  5B1A H;  3U1D A;  1XPX A;  3CDL A;  1Y39 A;  1R4M B;  2BY2 A;  3HOY J;  3DEU A;  1MBH A;  3W3C A;  1MD0 A;  3FKI J;  1K6O A;  2IW5 A;  2WY7 Q;  3ERM A;  2OU2 A;  3JTG A;  4V19 K;  2B63 J;  2OQR A;  2EFN A;  3TDZ C;  1VQO I;  2A6E F;  2PEX A;  3TKY A;  1TWA J;  1B72 A;  1SVM A;  2Z1D A;  3CCJ I;  2MLK A;  5DM6 F;  2K9N A;  5FRM A;  2L7K A;  3JRA A;  1FJL A;  5CLS A;  2L01 A;  3GLL A;  4JX6 A;  4OAY A;  1MMD A;  4RMN A;  2EFW A;  2YU9 J;  4D1Q A;  1MJB A;  3EYY A;  1XB4 A;  5C4J J;  3TW7 A;  3L1P A;  2P4W A;  3CES A;  1AU7 A;  3E0J B;  1FSH A;  2JUG A;  4A69 C;  1LE8 A;  4HLY A;  1TT5 B;  2EFP A;  3L00 A;  4DBQ A;  2PMH A;  1JJ6 C;  2M7A A;  1QHH D;  2XAQ A;  5FD5 A;  2VB6 A;  3SZP A;  2VPL A;  3E1S A;  2LVS A;  1Y8R B;  5E3N A;  4ENK A;  3F8B A;  3RCO A;  1QBJ A;  5FLX Z;  1KON A;  2WB1 N;  3LSI A;  4LIU A;  2A6H F;  1JJ8 C;  4Y7N J;  5J4Y A;  4Y52 J;  3FXM A;  5D4S A;  2Y0S N;  3R0J A;  2LH9 A;  2EA4 A;  1HW1 A;  2DA2 A;  4HV6 A;  2K3P A;  5M5Y J;  5DCM B;  3DBR B;  4BBS J;  1Z6T A;  3FXL A;  3HHG A;  2WB1 A;  3WHB A;  2W4S A;  5BMZ A;  5J1U A;  3SJM A;  1V5F A;  1BI3 A;  3ABK H;  1ETW A;  2Y0S A;  4ZJZ A;  1RZ4 A;  4Q5S F;  1WJC A;  4FAS D;  1W5C C;  4CCM A;  3ECO A;  3QYF A;  4X0G A;  3ZCO A;  3JAM Z;  4LJZ F;  5LD2 C;  2M7B A;  5BPD A;  3M4O J;  4QWQ A;  3T8R A;  3QQA A;  1TT0 A;  5CKT A;  5ICG A;  4IKF A;  3BR6 A;  4RGX A;  2W57 A;  2VC0 A;  4W1U A;  5J1R A;  2QKM B;  2JA5 J;  5GAD J;  3M8J A;  3IRQ A;  2R5Z A;  3OSF A;  3U9G A;  2OA4 A;  4CYC B;  2R7V A;  1ZGA A;  5FD6 A;  1LVA A;  4UV8 A;  1O4X A;  5EGO B;  3CUQ B;  3M1E A;  3HSR A;  2HXO A;  3ABU A;  2XUB A;  1ZN2 A;  2Q2E A;  1MDM B;  3HJE A;  1MBJ A;  3VYR B;  1Y6I A;  4XRM A;  1FP1 D;  1K6Y A;  2DQR A;  2C6Y A;  4AM3 A;  2XSJ C;  1B8I B;  2NS0 A;  4BXX J;  3K6G A;  4I99 C;  3RKX A;  5BNG A;  2D5V A;  1NG6 A;  5ICC A;  1KYW A;  1SFU A;  3OYG A;  5TJJ A;  4E6K G;  2QSG X;  1QZZ A;  1R58 A;  4ZYD A;  3MKZ A;  3HUG A;  5F0H A;  2R7R A;  2LK2 A;  2OPT A;  3I0T A;  2KJB A;  4RM3 A;  3VYU B;  3LA2 A;  5CPR B;  1Q1V A;  4G7O F;  2XAF A;  2RQP A;  3KZZ A;  2EPF A;  3IC7 A;  4E70 A;  3KP4 A;  2KRF A;  3NWS A;  4LLG F;  2V1D A;  3C2G A;  1IRZ A;  1HQC A;  3TO6 A;  3EPZ A;  2CUJ A;  3MMY B;  3TOA A;  5EDN A;  3I4N J;  1T38 A;  1OCR H;  4PJ0 C;  1O7F A;  3GCM A;  2XPV A;  4HF0 A;  4C3J J;  4F3Q A;  2R7W A;  1IGN A;  3S1Q J;  3NRV A;  5L3D A;  4RLQ A;  3QOE A;  1MND A;  5BS6 A;  6PAX A;  1NTC A;  1Y56 A;  3KX2 A;  2BVL A;  5L3B A;  4HX7 A;  5FKN A;  2ZBK A;  2DPD A;  2MH2 A;  1X2M A;  5DCF A;  1UAA A;  5J6X A;  1J2X A;  3BR3 A;  4KN7 X;  3JRH A;  2FML A;  3LSP A;  1A35 A;  2OTL I;  2EZH A;  4PK4 A;  1MMS A;  4L0Z B;  1FMW A;  2CQK A;  4WCG A;  3GTQ J;  1MBE A;  2AQE A;  3DQV C;  1FZP B;  1YQA A;  2EBI A;  3H3Z A;  3OYD A;  5F1J A;  4DIQ A;  1OR7 C;  1Z77 A;  2L4A A;  3FIS A;  2E7W A;  2KJC A;  3OL4 A;  4F92 B;  1FPQ A;  4BE0 A;  1D8K A;  4KIG A;  2DTZ A;  3HOS A;  4GYI A;  3LQQ A;  3PSI A;  5C3E J;  1H8A C;  3V8K A;  3IH3 A;  3BG5 A;  1Z67 A;  3FBN B;  5FFX A;  5HVQ C;  3FKJ A;  5GAH J;  2L5Q A;  1YX5 A;  3HSF A;  2NVU B;  5ED4 A;  1RUO A;  4GO1 A;  2TRT A;  2DPU A;  1Z21 A;  1BJA A;  1UMQ A;  4B1R A;  2K3F A;  2GBY A;  5DD4 A;  1JHH A;  3D0S A;  4UB8 C;  2RN7 A;  2DBB A;  2DOA A;  1J0R A;  1P7I A;  2QYO A;  2JA2 A;  1QRY A;  1OKR A;  2DA5 A;  2X9D A;  2X48 A;  4G6T B;  3ZQ7 A;  2DK8 A;  4RGR A;  1JKR C;  1HXD A;  1QU3 A;  3KP6 A;  4U87 A;  4I76 A;  1W36 C;  4A3G J;  4P96 A;  5DTD A;  1XS9 A;  5LHH A;  3ZXS A;  5FKO A;  1F4K A;  4E7L A;  1VTN C;  2EZL A;  3BWG A;  4KFC A;  2P6S A;  4O5V A;  2CMP A;  3CP8 A;  1FOX A;  3T5X A;  2V9K A;  4EEF G;  2IA0 A;  2KIQ A;  2UUZ A;  1PUF A;  2MYS A;  2CFX A;  2PG4 A;  2DA7 A;  1ETX A;  1X1P A;  3BQZ A;  3KPH A;  3C7J A;  2G0E A;  4YFK F;  2IGN A;  4LG0 B;  1BM9 A;  3BR1 A;  2CQN A;  1DDN A;  4AWX B;  2DFH A;  2JJ7 A;  4CYC A;  2E7X A;  1XMX A;  1RET A;  3BDD A;  1OIS A;  4LGW A;  1IXR C;  3CUQ A;  3V8J A;  2CV1 A;  2ZFU A;  2F5V A;  2KLO A;  3A01 B;  2IJL A;  1E3P A;  1P4W A;  3LSG A;  2EWN A;  1QZY A;  4KN4 X;  1MDM A;  1EF4 A;  2Z9O A;  2HOT A;  3K1N A;  4XSZ F;  1LB2 A;  3V8L A;  4PGG A;  3JAM K;  1B8I A;  2ME0 A;  1JUP A;  2A69 F;  1HKS A;  4KT5 C;  5JHF A;  2DMQ A;  4NQW A;  3DKX A;  5LBQ A;  1D3Y A;  1EKE A;  1POG A;  1FTZ A;  3SEZ A;  3W6K B;  2FSW A;  3GZ5 A;  3HPG A;  3OS2 A;  4S0H B;  2CH0 A;  2DFI A;  2O3F A;  3OOU A;  4EM2 A;  1LDJ A;  2HOA A;  1IC8 A;  4FQG A;  3BLY A;  3DKY A;  3CCL I;  3ZR8 X;  1BN5 A;  1MH4 A;  3OYK A;  4BXU A;  2NOJ B;  4H4K C;  1T56 A;  1SAU A;  4C2M J;  4ON0 A;  3VOE A;  4PGH A;  3H9G A;  1RES A;  2CUE A;  2E36 A;  5EEG A;  1WQ2 A;  4S05 A;  5E3L A;  4MFE A;  4CCO A;  1HDD C;  2QWW A;  4LB6 B;  5JI6 A;  3J7A O;  2A05 A;  3E97 A;  1PUE E;  3K4J A;  4IX7 A;  1XTA A;  5FRO A;  3OYA A;  1FY7 A;  1OCP A;  3JRE A;  4C2T A;  3ZRG A;  1U8B A;  5BPI A;  3TBI A;  5EYR A;  3FX3 A;  2HDC A;  5H20 A;  5E8I A;  4ZZD A;  2NNY A;  3HOZ J;  3AL0 C;  2CQQ A;  3A4C A;  3IHU A;  2ZFW A;  2QKL B;  2XAU A;  4IOC F;  3GTO J;  3G6E I;  4CUG A;  2HOE A;  3KYD B;  2VI6 A;  2Y9Y A;  2R4G A;  5JVT A;  3CCQ I;  2FD5 A;  4OIR F;  4C9Y A;  1G59 A;  4ABZ A;  4X6A J;  3TP0 A;  2RRE A;  2FE3 A;  1HKT A;  3OYI A;  1YIJ I;  4BHC A;  2L3D A;  1T39 A;  1VQN I;  3ABT A;  1Z91 A;  4F7Z A;  2RNJ A;  4L9T A;  2NVX J;  3DFG A;  4WK8 F;  4A5M A;  4O6J A;  3ZN1 A;  1VF9 A;  2XAH A;  1TBX A;  2VKE A;  3RYP A;  5CVV A;  5HLI A;  4ZDO A;  2Y9Z A;  4U0V A;  1TQM A;  4II3 A;  1ZAO A;  3RKQ A;  5HDK A;  1ZK8 A;  2RGV A;  1FIA A;  3MKW B;  1O7L A;  2ZXI A;  4CCL A;  1J75 A;  3F8N A;  2E2I J;  5EF6 A;  2VUM J;  3MVP A;  1Z1D A;  2L02 A;  4BJ5 C;  4XOT A;  3G1M A;  3VOD A;  3LOC A;  5GP9 A;  2CSO A;  5E1X A;  4MEX F;  4U0W A;  3PIP F;  3SFI A;  1Y1W J;  2PFB A;  2LOO A;  2W85 A;  2GZW A;  2Y2Z A;  2BYV E;  3O6B B;  3G1L A;  4B09 A;  4M9Z A;  2WAF A;  2ZXW H;  4RBO A;  2QZ8 A;  2CYY A;  2KRC A;  4CIC A;  1W7P D;  1HLV A;  3OYN A;  5HOO A;  3BTI A;  2JT1 A;  4DZJ A;  2E19 A;  3DKW A;  1T08 B;  3I71 A;  1X1B A;  1X1C A;  3WGH A;  3CC7 I;  5FKL A;  2BY3 A;  5CVR A;  1F36 A;  3B73 A;  2QSF X;  4EGY A;  1MH3 A;  1VQ5 I;  5ILU A;  2L0K A;  2UXX A;  2DT5 A;  3QU3 A;  2L9N A;  4LG0 A;  4XLF A;  4ITV A;  4UV9 A;  1B1B A;  3I53 A;  1QVU A;  3ZMT A;  3CMA I;  2R93 J;  1MBG A;  1SD5 A;  4BBR J;  3CO6 C;  2BW3 B;  2V6E A;  3K4M A;  1U3E M;  3QWL A;  1T95 A;  3H35 A;  1DGW Y;  1BR4 A;  1Z7U A;  3FIW A;  3V42 A;  2HKO A;  5IP6 A;  1C0W A;  1OCO H;  1ZRE A;  2IP2 A;  1GUU A;  1YFH A;  5L3C A;  3DLA A;  3LNQ A;  1QQI A;  4XLA A;  1KU3 A;  4A3F J;  2RAE A;  1JGG A;  1ON2 A;  5LEK A;  3DPT A;  1VQL I;  2DMT A;  4A3B J;  2WAE A;  1FT9 A;  1L3L A;  1S3J A;  4DYC A;  1JTY A;  2O0Y A;  1IV6 A;  2ELK A;  2BEO A;  3NAR A;  1G3W A;  3WG7 H;  3BCA A;  1LKX A;  4GRI A;  2XF7 A;  2DA3 A;  2XIG A;  2FBI A;  4XL9 A;  3IKV A;  4NC6 A;  3S2W A;  3H1C A;  4S04 A;  2V1X A;  3M7G A;  2ZNY A;  3W2V A;  1LNW A;  2MA3 A;  2XKP A;  4BQQ A;  3L2U A;  3JRF A;  2QUF A;  1LPQ A;  3CCM I;  1QO0 D;  3BZK A;  1ZRC A;  5LGT A;  2IXS A;  1RPW A;  2EH3 A;  2LY1 A;  3KEY A;  3ZMD A;  2COM A;  2FBK A;  3AL0 B;  3CD6 I;  2V1N A;  2GLO A;  3K9T A;  9ANT A;  3DLL F;  4J00 A;  1FC3 A;  1MSE C;  2YR2 A;  1XSX A;  1D1A A;  4PFO A;  1B9M A;  5H6Q A;  1R9T J;  4RGU A;  4BUP A;  4A0Y A;  2X6X A;  3O2P E;  2NVY J;  2E1M B;  2R7S A;  3L09 A;  4XN3 A;  3LFU A;  4E7H A;  4DQ2 A;  2JA7 J;  2XV4 S;  4LMY A;  3S17 J;  3I3L A;  1UHW A;  1MJA A;  4G7Z F;  2GA2 A;  4PJJ A;  1V54 H;  1B72 B;  3K7A J;  3CC4 I;  5E1Z B;  4XN0 A;  4XKV A;  5DDG A;  2JK3 A;  2LKP A;  2LKS A;  3J80 K;  1IXC A;  4D5C A;  3T0Y A;  3S32 A;  2ISY A;  3BCB A;  2VOO A;  5JLW A;  1P9Q C;  3BG9 A;  3I59 A;  4WWC A;  1EV7 A;  1X3U A;  1X3Z B;  1IN6 A;  4XOP A;  3HIF A;  3JCU C;  3H0D A;  2CFO A;  2IAI A;  3AAF A;  2R92 J;  3CJQ B;  3ZMS A;  5LRS A;  1LE8 B;  3FXQ A;  1T0F A;  4G9Y A;  1K83 J;  1OMI A;  3VEP A;  4BJT A;  4E7I A;  2MW8 A;  3GWZ A;  4OIN F;  2L7Z A;  4GDF A;  3B6C A;  2M2E A;  4OU0 A;  4Z2Y A;  3CF2 A;  1P6R A;  3LAJ A;  2JSP A;  2E34 A;  3HL2 A;  4CZC A;  4A2U A;  4XKW A;  2P81 A;  2QLZ A;  5J4V A;  2HFH A;  2XPW A;  1W0U A;  3CDI A;  2FUG 2;  3I4P A;  4A0Z A;  2ZXJ A;  4I6Z A;  3QRF F;  1VQM I;  5D6F A;  1JT0 A;  3I4M J;  2IA1 A;  2YPR A;  3CQZ J;  1O3R A;  4N9H A;  5D6E A;  1LUJ B;  1ERD A;  4ENN A;  2LYC A;  3SDG A;  1ZYR F;  3SYT A;  4GXO A;  4IO9 F;  1YOV B;  1ZRD A;  5K5R A;  3EYI A;  1IF1 A;  4C3H J;  2VXD A;  3RKW A;  2KPM A;  1JTX A;  3F21 A;  5C44 J;  1SFO J;  4G8X A;  2JTV A;  3ZQQ A;  1I5Z A;  1XDU A;  4BHB A;  3IH4 A;  2GXA A;  2BVM A;  1MMA A;  1LEA A;  1W4M A;  1DPR A;  4Y4R A;  4ESJ A;  4MFD A;  1GT0 C;  2XHK A;  1FYL A;  1H9G A;  2R5Z B;  1ZG1 A;  1QHG A;  3HM5 A;  4ZYH A;  1H88 C;  4NB5 A;  4ZDP A;  4BHP A;  2GM4 A;  2DA4 A;  3N05 A;  4WXC A;  1REP C;  3HB9 A;  1LFB A;  4YIF A;  3CCV I;  2MFZ A;  2CQX A;  2Q2E B;  2BW3 A;  2F5C A;  5HNH A;  2GQQ A;  3KCC A;  5CVI A;  2EIM H;  5A2Q Z;  1DPU A;  2DMP A;  2LTP A;  2A68 F;  2EQR A;  3GO5 A;  4OOI A;  1VQK I;  1KQ0 A;  4E7Z A;  3NAU A;  4LLL A;  3OOP A;  4RDU A;  1APL C;  3K4K A;  2O7O A;  1Y1V J;  3ZQI A;  2VKV A;  2VN2 A;  4MLO A;  4OAZ A;  1ZG3 A;  2OUM A;  4IHY A;  1LEB A;  4W97 A;  1NHA A;  4L5I A;  1GXP A;  3HUG B;  5L3G A;  2R7D A;  2JPB A;  3CUQ C;  1HC8 A;  2FNP A;  4HA8 A;  3L2Q A;  1EJ9 A;  1FOW A;  5FB2 A;  3RQI A;  1D1C A;  2DJN A;  2JRT A;  2CS3 A;  1TQP A;  3MZ8 A;  2OBP A;  3RSN A;  2H09 A;  5J40 A;  1IG7 A;  3BTL A;  2XB5 A;  2B9S A;  4HAM A;  1D0X A;  5CVU A;  3HHH A;  3GX4 X;  3IWZ A;  4XOR A;  4YG2 F;  5GTI C;  4HDV A;  3D5R C;  3CCY A;  1U5T B;  3ZQL A;  1WJA A;  4MGR A;  3H9Q A;  4AVP A;  3R4K A;  2NYX A;  4A6E A;  5FLM J;  1FYK A;  3Q9V A;  3OMY A;  2IS4 A;  4AVZ A;  3L7W A;  3MZY A;  4Z6Y A;  2Z3Y A;  1ZHF A;  3MAJ A;  1YS6 A;  1PVE A;  1BI1 A;  4IHT A;  3T8T A;  2D1H A;  2FX0 A;  4P9U A;  4GFB A;  3ZP5 A;  2IPQ X;  1YE9 A;  2JPC A;  1YRN B;  2DT7 B;  4EJU A;  4BY7 J;  4BAC A;  1IZ1 A;  2NNN A;  4A3J J;  3E5Q A;  2KP6 A;  4M3F A;  2KRH A;  5JHU A;  1P4X A;  2BBY A;  2ZNZ A;  2JRM A;  2ZKZ A;  1O3T A;  1SAX A;  3JRD A;  2FMY A;  3CJN A;  1GVD A;  3DXJ F;  3CLO A;  4XNF A;  4QPQ A;  4CGZ A;  2HR3 A;  4F93 B;  3DU5 A;  3FMS A;  3MZH A;  5CVJ A;  1U6G A;  5F04 A;  1SAN A;  2I8D A;  2AXT C;  2M4G A;  3Q5F A;  4ENM A;  1Z7L A;  1ZR4 A;  5TGT A;  2EIN H;  3VFZ A;  2ZSI B;  5IOZ A;  1XMK A;  2JUC A;  2D1V A;  3PL8 A;  1FTT A;  2Z33 A;  4JP0 A;  1E3H A;  4MHG A;  4WX9 A;  1H0M A;  4BS9 A;  3E3V A;  4XIC A;  1BL0 A;  4A6D A;  4RLF A;  4UVA A;  1ENH A;  1VQ7 I;  4KIB A;  2ZME B;  1RR7 A;  5ICE A;  5HLG A;  3OYJ A;  4HNU A;  3ERE D;  1JI8 A;  2M0C A;  1TWC J;  3BTC A;  2KZG A;  3I5U A;  4HLX A;  3FXJ A;  1VQ9 I;  1IN5 A;  2V6C A;  5K7H A;  2OC6 A;  4UUV A;  4YFN F;  3E6B A;  3HEF A;  4XBF A;  2VE9 A;  4TV7 A;  1A6I A;  1PUF B;  1ETY A;  2E35 A;  3WTT C;  2K9Q A;  3TO9 A;  2GXG A;  4PZJ A;  2QQ9 A;  2EZI A;  3C3W A;  2AS5 F;  1F9N A;  3QP6 A;  2ME6 A;  2O61 A;  2DFF A;  3WGG A;  4MO7 A;  5D5V B;  5CQG A;  1ZGW A;  4FX4 A;  4GCV A;  3KYL A;  3GTP J;  4D9J A;  3A2K A;  4ENJ A;  1BW6 A;  2QSH X;  3EUK L;  3TGN A;  1X19 A;  4CZZ A;  1E3O C;  2XSD C;  2RQQ A;  3WHC A;  1I6H J;  1YHQ I;  2BXZ A;  4I98 B;  2DXI A;  3HGG A;  4Q47 A;  2LC2 A;  4M3G A;  5AON A;  4LG3 A;  4NQW B;  5J1Y A;  3OYC A;  3RI4 A;  1OLT A;  3J81 K;  2ETH A;  2L2O A;  2XRO A;  2Y75 A;  4XRS G;  1QVT A;  3H3V K;  1X1D A;  2L54 A;  3ZQH A;  4XM3 A;  2VQG A;  2NXN B;  3MQ0 A;  5IYD J;  3S1M J;  4BDY A;  3L2V A;  4IHW A;  2KHM A;  4KYW A;  2EIK H;  4FIS A;  5E79 C;  1UCR A;  4R79 A;  4MNU A;  3COA C;  2W00 A;  1B9N A;  1S5L C;  4KNY A;  4D7N A;  3ASN H;  5ICF A;  1U5T A;  2RKH A;  1IDZ A;  1TZL A;  2ZO4 A;  3ZN0 A;  1AKH A;  3LSK A;  4RGS A;  1LJ9 A;  2DYR H;  1PP7 U;  4KA4 A;  2STT A;  3DPL C;  1ULY A;  4I2O A;  4ZDL A;  1ETQ A;  1V55 H;  1XMA A;  4BQN A;  2QQ8 A;  5IOY A;  3FXO A;  5BOX A;  2VQL A;  1WH7 A;  2G7U A;  1S6L A;  2HTJ A;  5B66 C;  1YX3 A;  3LST A;  4PCQ A;  1LDD A;  3L9F A;  4CDG A;  3I9V 2;  1YRN A;  1IAW A;  3GEZ A;  3DPU A;  4OWR B;  3GBG A;  2ZJQ F;  4QSH A;  4ASN A;  3HYI A;  5KVR A;  1XGS A;  1FSE A;  2RVC A;  2M4K A;  3M8E A;  3P9C A;  4XID A;  3E5U A;  1MMG A;  4EVI A;  3WU0 A;  2E2H J;  3HOU J;  4IVN A;  2DO7 A;  1R23 A;  1XGM A;  2WAD A;  4DYQ A;  3HKZ N;  1G3T A;  3JR9 A;  1ODD A;  1NG7 A;  2CUF A;  3V4G A;  3N4M A;  1DP3 A;  1ZLK A;  1TWG J;  4L0Y B;  2HOS A;  4KIC A;  3Q3S A;  4ZZL A;  2Z2S B;  3G3Z A;  1Z0X A;  4OMZ A;  3KEO A;  2BGC A;  3HKZ A;  1E17 A;  1RRJ A;  4Q4Z F;  2XVC A;  2ID3 A;  4HNV A;  4M3B A;  5DUK A;  2KKO A;  3C2B A;  3E6M A;  5GAG J;  1X1A A;  1T0F C;  1YW9 A;  5CJ9 A;  2YU3 A;  1I1S A;  2W1O A;  2XRN A;  3QOD A;  1AWC A;  2ZME A;  5FFZ A;  1SFE A;  1WH5 A;  2VC1 A;  1TWF J;  3WTX C;  2QF7 A;  3TMO A;  4P9F A;  1VND A;  2LDU A;  3U1K A;  5E3O A;  5FRN A;  2NVQ J;  1AOY A;  1GV5 A;  2K85 A;  5FLX K;  3Q9S A;  3LFK A;  3JRG A;  2F5F A;  4Y13 A;  2HYG D;  1J9I A;  1SD6 A;  2I10 A;  3KZY A;  3HC7 A;  1KQ9 A;  3R60 A;  3FK7 A;  2IGK A;  1HW5 A;  3MKY B;  1MIJ A;  1KZH A;  1MJ9 A;  3ISP A;  2LKX A;  1AA7 A;  5LFA A;  4D0P A;  3J7Y J;  1WI9 A;  1XX5 A;  2LG4 A;  3AG1 H;  2VKH A;  1ZG5 A;  4K2E A;  2EFO A;  1GLN A;  1VI0 A;  2HDD A;  2KZV A;  4UXN A;  1TW3 A;  2F4I A;  1BR1 A;  2EK5 A;  2CW8 A;  2UZK A;  1CF7 A;  3RJP A;  1Z3Y A;  2VL8 A;  5IY5 H;  1X58 A;  4LOC A;  2R5Y B;  1QA6 A;  4C2U A;  1XSV A;  1Q1H A;  1NK3 P;  3K2A A;  3S3O A;  1U78 A;  4AUX A;  4M3E A;  5GPC A;  2DAO A;  3DBL B;  2M8E A;  5GPA A;  2Y48 A;  2ELH A;  4EAT A;  3DWL E;  3EDP A;  3NQO A;  3PNV A;  2LMD A;  1EH6 A;  2X1C A;  4C3I J;  3X2Q H;  4KIT B;  2A3S A;  4HX4 A;  2K27 A;  2F6C A;  4XQF A;  5HS8 A;  1T8I A;  3LSH A;  1I27 A;  1XSD A;  1ZTR A;  5EEH A;  1U0J A;  4AIJ A;  4N9I A;  2A6T A;  4HSR A;  3CLQ A;  3VWB A;  1DP7 P;  1HSJ A;  2HYF A;  2XGD A;  1N78 A;  4RA2 A;  4WXD A;  2IS6 A;  3OYB A;  3LA3 A;  4R8H A;  3TO7 A;  2EJR A;  2Y30 A;  1D0Z A;  2AQF A;  5D8K B;  2IGO A;  2HXI A;  1SFK A;  4EJW A;  4IOA F;  5K1Y A;  2YX4 A;  4QPO A;  1R00 A;  5K5Q A;  3K4L A;  2XDV A;  2E1O A;  4NBQ A;  2WTE A;  3FF5 A;  4NHJ A;  2BOL A;  3MN2 A;  3M07 A;  2D45 A;  3Q0W A;  3KFW X;  2F4O B;  4KIS A;  5B3S H;  2UWM A;  2W25 A;  2FF4 A;  3P5J A;  1GHC A;  3GFI A;  1W5T A;  2I5U A;  2Y69 H;  3QYB A;  1HW2 A;  1G4D A;  1UEL B;  3FK6 A;  3FXU A;  3MCZ A;  4IRI A;  3I59 B;  2E1M C;  2VQH A;  1UHS A;  2HTS A;  2UXN A;  1WFX A;  2XGC A;  2YX7 A;  5F0F A;  3ZMV A;  2F5D A;  2Q0O A;  3EQL F;  3D1N I;  3OR2 C;  2L9S A;  3RYR A;  4IEJ A;  3NEU A;  2WBM A;  4L5J A;  2QGU A;  1S7A A;  4D5F A;  1MNE A;  3HOV J;  4V2G A;  2XAJ A;  2COB A;  4JBA A;  1G2H A;  3VYT B;  1JKQ C;  2WAQ N;  3OL3 A;  3ABM H;  2VT3 A;  5H6R A;  1SMY F;  2OZU A;  2HKX A;  4JQF A;  3HOW J;  4AD9 A;  3OYE A;  3K1P A;  2K86 A;  1XN7 A;  2LSO A;  3IKT A;  2O9L A;  1R7J A;  4AU7 A;  2R3S A;  5AIQ A;  2WAQ A;  2AHQ A;  5LRR A;  5IP9 J;  1ZEL A;  3F8C A;  4HDU A;  2BHY A;  1B4A A;  2OZ6 A;  3ZOB A;  2Y0M A;  1MBF A;  2H94 A;  1U8R A;  1TWH J;  3DTK A;  1RI7 A;  4HQM A;  3MFK A;  4AIK A;  2PLY A;  4HOB A;  1HBX G;  1R36 A;  1O57 A;  5F64 A;  2X6Y A;  4PDK A;  5F08 A;  3JW4 A;  1VQ8 I;  4LD5 A;  3S3N A;  3M3Y J;  3TDU C;  4UUS B;  1G6N A;  1FLI A;  1FX7 A;  3UR3 C;  4I7H A;  4JOM A;  5IP7 J;  1A5J A;  2ELJ A;  5J3L A;  5H2F C;  2ACJ A;  2R7Z J;  2WC2 A;  1D1B A;  3BOQ A;  1TC3 C;  2QVO A;  2J5P A;  3BR2 A;  4G12 A;  3TED A;  1JKO C;  2DMU A;  2XC7 A;  1K78 A;  1KA8 A;  4UVB A;  3CCR I;  2CJJ A;  3IRR A;  1IXS B;  1YI2 I;  2V4J C;  1PJR A;  2HVQ A;  1FBU A;  2WV1 A;  1YW8 A;  1UB9 A;  3K4C A;  2E60 A;  5E8G A;  5M5W J;  4BGD A;  4IJA A;  2R5Y A;  1TL8 A;  1CQT A;  3QPL A;  1EH8 A;  3IH2 A;  2EB7 A;  3OV8 A;  4ANJ A;  3PUF A;  1IRG A;  1T33 A;  4PJM A;  4N0B A;  4YIR X;  3FBI B;  4BH9 A;  2VBW A;  4BEH B;  1EA3 A;  1S72 I;  3GTK J;  1WJE A;  4A3E J;  1FMV A;  4HV5 A;  4M9S A;  2BY1 A;  4NUB A;  4AC0 A;  3PFY A;  4XON A;  2TCT A;  2VE8 A;  3GFM A;  3K70 C;  1I1G A;  4NNJ A;  1D5V A;  4E7J A;  2QA4 I;  1DUX C;  1OPC A;  4JX5 A;  3KIO A;  3WTS C;  5IYC J;  2X1E A;  2DFE A;  5LGN A;  1TQI A;  2H6C A;  3OY9 A;  3HRM A;  1IRX A;  1VQP I;  2O03 A;  4GYG A;  5LHG A;  1ZH5 A;  4PSX A;  4Q48 A;  3GZ6 A;  4J19 A;  3V7R A;  3Q0V A;  2QQB A;  4QLC U;  1IN8 A;  5HDN A;  1FOK A;  1ORK A;  3V7S A;  2XAG A;  3JSO A;  1YIO A;  1RNL A;  3H36 A;  3JRB A;  3A0B C;  1S7O A;  1KU2 A;  3SDB A;  4GGG A;  3GW2 A;  1RKW A;  3K1M A;  4F55 A;  3WTV C;  1XDS A;  1WGX A;  2GOX B;  1ZRF A;  2FJ1 A;  2DA1 A;  1BBY A;  5DV5 A;  3HRT A;  5JFR A;  3TW6 A;  4ZTF A;  3QPH A;  5C4X J;  2PI0 A;  3Q0U A;  3GTM J;  5K7Z A;  5DYM A;  4BJ6 C;  2HZT A;  1U5T C;  4L5E A;  2Q8K A;  2X0L A;  4HW0 A; 
#chains in the Genus database with same CATH homology
 2DOF A;  2DOD A;  2KIQ A;  2DOE A;  2CQN A;  4FQG A;  2K85 A;  1UZC A;  2KIS A;  2LKS A;  2KZG A;  2L9V A;  2E71 A;  2JUC A;  2KFD A;  2B7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...