2B7EA

First ff domain of prp40 yeast protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
GAMEAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Prp40 FF1 domain and its interaction with the crn-TPR1 motif of Clf1 gives a new insight into the binding mode of FF domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords Pre-mRNA processing protein PRP40
total genus 21
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2b7eA00
2B7EA 2K85A 2KISA 4FQGA 2KZGA 2DOFA 2KIQA 2LKSA 2KFDA 2L9VA 2DOEA 2DODA 2CQNA 1UZCA 2E71A 2JUCA
chains in the Genus database with same CATH superfamily
2DBBA 3DEEA 3L7WA 1FIPA 2GOMA 2EFNA 3R0JA 2A07F 3PO2J 3OYJA 2XVCA 1TWAJ 1T56A 5J4YA 3EUHA 1OYIA 3L2WA 2E36A 1AWCA 4NC7A 1HDDC 1AKHA 4I01A 3GTMJ 1ZKGA 2VE9A 4BE2A 4QLCU 2VLAA 2MSYA 3WGGA 4FHTA 2D1VA 2H1KA 1P92A 2CWEA 3P9KA 4I2OA 2L7KA 1ZG5A 1YITI 3E3VA 2P0WA 3M1EA 3P9IA 3RPUD 4XONA 5LHHA 2EH3A 4JYKA 3HOTA 3PSIA 4A3IJ 2Z99A 3W6JB 3E7LA 1ZG3A 1VQKI 2YU9J 2IBDA 3HHHA 3A03A 3C3WA 2DFIA 2Y0SA 1WI3A 2DJNA 3DBRB 4FISA 2K9NA 2CRGA 3H0GJ 2K3FA 4RAYA 2VL8A 3ISPA 3GTKJ 1R6RA 2BXZA 2VKDA 3IKVA 3ZN1A 3IRQA 1OISA 3ZQFA 2UUZA 2R5YA 2P8TA 2LKPA 2ZMEC 2Y9ZA 2NRAC 2ELJA 1TP4A 2DK8A 5M5WJ 2R7WA 1IRFA 3LSHA 1LEBA 1S29A 4MIMA 4KN7X 2DYRH 2VBZA 1X4PA 1Z3XA 3EUHC 5H2FC 3GTJJ 2ZJQF 2IEKA 1HQCA 1U78A 1Y8RB 4M9XA 2EBIA 3TW6A 4WXCA 4XLNF 1ON2A 2PMUA 2XB5A 3ZQLA 1TQIA 1TNSA 4HX7A 2UXNA 1ETVA 4C2TA 3KP5A 2X4HA 2RKHA 3U2RA 2KKOA 4R79A 2XHKA 3RI4A 4OOIA 4ZYEA 3V7CA 3OYKA 2HFHA 3CCMI 2VI6A 3OYFA 1JJ8C 2DT5A 3ZQHA 3MKWB 2B63J 1ZAOA 1MJBA 3H1CA 3SZPA 2FQ3A 4EJTA 1IJWC 4XRSA 2A6TA 2F5VA 1C0WA 1MW7A 1OCPA 3JCUC 2DYSH 2ID3A 1HKSA 3ZMVA 3WODF 4G7HF 2D1HA 3E5XA 1IW7F 3S32A 2BHZA 1QPIA 2QQBA 4H0EA 4CZZA 2EIJH 1XGSA 1RUNA 3ZCOA 2F5DA 4EJUA 2FEZA 4DNCA 1IN5A 4L0ZB 3KX2A 2DT7B 2Y48A 3GO5A 3GW2A 1SVMA 3BG3A 4HNUA 5ERIA 4KITB 3OIQA 5F6FA 1BIAA 2M5WA 2IS1A 3HL2A 3BLYA 2XGXA 2Y69H 5FKLA 1GLNA 3QP6A 2OUMA 2F5CA 2X6OA 2YS9A 1ZHFA 1Y1WJ 3KP4A 4IRHA 5E20A 2WV0A 4AYBA 2HDDA 2G7UA 1AOYA 1MBFA 2K4JA 1QHHD 3F8MA 3OIPA 1JT6A 3WU1B 4I7HA 1VFCA 1U3EM 3HOSA 2GAUA 1LDKB 1QGPA 5CVRA 1FEXA 2M34A 1LJ9A 3RDIA 4MFEA 4N9HA 1H89C 3OYAA 5D4SA 1RNLA 1MBEA 3M7GA 4JQFA 2DMTA 1RESA 2RAEA 3TL4X 2GA1A 1SAXA 1HKTA 5ED4A 2NS0A 5AIQA 2XGCA 3SDGA 3G71I 2LG4A 1N75A 4M73A 4CCLA 4ZYGA 1XMKA 2FXAA 3ZOBA 3FHNA 2G9WA 3LQRA 4ENJA 2AHQA 4OMZA 3ZN0A 2JPBA 4HLXA 1UHWA 5LD2C 1X58A 3HGYA 4QPOA 4KUMA 2ME0A 4V19K 4HBLA 1JT0A 3QU3A 3L09A 2MG4A 2L0KA 1E0EA 3RKQA 1FSHA 2E5ZA 4CYCA 1MNEA 3K2ZA 2NXNB 1ZREA 2F4IA 1XGNA 4YELA 5FD6A 1LDDA 3F8NA 2ME6A 1HSJA 4BXFA 2IW5A 4U0YA 2DA4A 1SD6A 2KP6A 1K4TA 1U0JA 2LTPA 5LHIA 1XTAA 1IXRC 3G2BA 2DK5A 5F04A 3KYDB 3C2BA 2L4MA 2XRNA 1D5YA 4QIWN 3GZNB 4WF2A 4Y52J 4FTHA 3BY6A 2L54A 2MC4A 3PFIA 3TO9A 3X2QH 3DF8A 4B1RA 3T5XA 1Z77A 3PIPF 4XR6A 5IP6A 4DYRA 4BE1A 2CV0A 1IV8A 2X6XA 2WWYA 2ICWG 1H9GA 3KEOA 4DBRA 5J8FA 2EB7A 2BE5F 3G6EI 4PJNA 2KJBA 3QWLA 3JW4A 3P5JA 3IC7A 1WRJA 3LSKA 4RGRA 4AM3A 4Y7NJ 3I71A 2M87A 3BWGA 3HOUJ 3WTYC 4LOCA 3EETA 4HV6A 2LNBA 4XLFA 2JK3A 5FKOA 3OYCA 1TWCJ 2M7BA 1FP2A 5F0CA 4A3JJ 3M07A 4BYYA 2K9LA 3CUQA 3TDUC 3R61A 2GXGA 2E7WA 1MJ9A 4PSXA 5KK1A 3E6CC 5D4RA 1X1DA 3CP2A 3W3CA 5JHFA 3PQKA 2VJIA 3QODA 2H8WA 3EYIA 3CJNA 2FNPA 2O3FA 5FGMA 1Y8QB 1T33A 2Z3YA 2XAFA 3K4LA 2L9RA 2DMUA 2FA5A 4IPAA 1H9TA 3HSEA 3DKYA 1B9MA 1N77A 4AYBN 1J09A 2E7XA 1BR1A 1X19A 4HA8A 4ON0A 1B72A 3LA3A 2HZDA 3BPXA 2Q8KA 3LQQA 3TOBA 4EJWA 3BTJA 4NB5A 1B72B 3R0AA 1T98A 1N78A 2EV6A 2CSOA 1G8XA 2K9QA 3VSKA 4EVIA 3ZMZA 4EEFG 2R4GA 3BCBA 1IAWA 3CJRB 3IL2A 2VQHA 3BQZA 2CO5A 4KJZA 3H36A 2JUGA 2P5LC 2XUBA 4XKWA 5DS9A 3GMEA 2FX0A 2O7OA 4H4KC 3SEZA 3Q0UA 2GBYA 1JTXA 1V54H 1JXSA 4I98B 2V1UA 1IV6A 3K1PA 2Q2EA 3K4CA 3GTOJ 1UCRA 2QLZA 3S1NJ 1XN7A 4RA2A 1OPCA 1W1WE 3LNQA 3I0TA 2O8KA 2NVQJ 1OLTA 1P2FA 3FXKA 1U8BA 1QZEA 2LBFA 3VDXA 3HJEA 5TRDA 2VQGA 2DOFA 1R22A 4LLGF 4UB8C 5FD5A 3TGNA 3DP7A 3O6BB 3PNYA 3A4CA 4XM3A 1XMAA 5F64A 5DD4A 3ZXSA 2X1DA 2LMDA 4XOTA 2MD5A 4TV7A 2LFBA 1T38A 5EG0A 4NQWB 2DDAA 1YYVA 3QOPA 4JX6A 4KT6A 1VQMI 4A3GJ 3FXRA 3E6BA 1FMWA 3RQ4A 2C6YA 4AWXB 2H94A 1WHUA 1EH7A 1J9IA 2HQ5A 5E79C 1PJRA 3ABUA 3S3OA 1BBYA 1YW8A 3O2PE 3ZR8X 4C3IJ 1KU9A 5BQTA 2LYCA 3AL0B 2IVMA 2FBIA 2QQ8A 1SMTA 4NHJA 2CQKA 3E0JB 1FJLA 3FKJA 1IF1A 1O57A 1O7FA 1IN8A 1MMAA 3FXOA 4I76A 4ZDLA 2IGOA 4IQJA 1VF9A 5FO5A 2PLYA 5IT9K 1FX7A 3CDLA 2XPVA 1FSEA 1X3ZB 4P5OA 3V7RA 4IOAF 2CJJA 4LIVA 2DFFA 2MD0A 4CCMA 3FKIJ 4RGUA 3MN2A 3UNGC 2ZXHA 2HXIA 3I9V2 3CMAI 2DQRA 1J59A 2XRLA 2R7UA 3IWFA 2GIZA 2GXAA 2OJED 2IGNA 2Y0MA 1FYKA 1WJBA 4A5NA 2BV6A 2OQGA 4M74A 1PP8F 3CJTB 2EZHA 1YLFA 1QNTA 3BPVA 2CG4A 3M8EA 1U2WA 4M3BA 2JN6A 3U9GA 1T39A 4PGGA 3VSLA 4KMUX 1T6SA 5ILVA 1YFHA 3E1SA 3JRHA 4G94A 2Y75A 1S7AA 2VONA 1FTZA 2ECCA 2J5PA 1RPWA 3DXJF 3S2HJ 3RZOJ 2XC7A 2DCEA 4BQOA 4LK1F 4O5VA 2L2OA 1KGSA 4FASD 2VB6A 2DMQA 1FP1D 1MBKA 2HPMA 4Q4ZF 5A2QZ 4Y17A 3LAPA 1Z0XA 1R5ID 3OMYA 1QU3A 3JTHA 2CUJA 2VXDA 4A3LJ 3F0CA 2ZC2A 2UWMA 2ZFUA 3FIWA 3K1NA 2LBFB 1XG1A 3EYYA 1QO0D 1BL0A 5LRSA 2EV5A 1BC8C 3VYUB 3JR9A 3DV8A 2R7FA 2LH9A 2Q2EB 2ECBA 2RNJA 2X48A 1HXDA 2OZUA 1E3OC 3J7AY 2XV4S 3L2CA 2VBWA 1YTYA 2FU4A 4KIBA 3HKZN 1GDTA 5E3MA 5L3CA 3JRBA 3RPUA 2NNYA 5ICCA 1MBGA 3I55I 5FRNA 2XSJC 4UVBA 4FX4A 2JA8J 1MGTA 3V8JA 2M4KA 2Z33A 3AG3H 3CDHA 3HC7A 1R36A 4MLOA 5FB2A 2WV1A 2COMA 4E7SA 2E1MC 5E17F 4HRIA 1JGGA 1ZLJA 1B8IA 3M8JA 2XAQA 1CF7A 4OU0A 1W5SA 3BZKA 2PMHA 1J5YA 4L9JA 2MGQA 1KU7A 4IHSA 2QKMB 2H6BA 3VEPA 1K4SA 2P5VA 2BVMA 1Y0NA 1VNDA 2ZJPF 3UKGA 1TLHB 1LFUP 3IH2A 4V2GA 2Z9OA 1JUMA 4YEJA 1I50J 2EZLA 4U88A 4XMYA 4A3MJ 3QPTA 1X2NA 3SFZA 2VUMJ 3QYBA 2WB1A 3I56I 2LF7A 5CKTA 3HTSB 3OS1A 3E97A 2XGEA 3H3UA 2M2EA 1KQ9A 1SAUA 4BU2A 2FNAA 1O3SA 1UAAA 4GDFA 3H5AA 1IN7A 3WHCA 1WGXA 4MQ9F 3PM1A 1MSEC 1AHDP 1UG0A 3K70D 2DA7A 5EYRA 2JA6J 1X2MA 4E7ZA 1S6LA 2WTEA 2K4BA 1NH3A 3QU6A 1QBJA 4CCOA 2E35A 3B6CA 1MMDA 3S16J 4EMSA 5K5RA 1VQ5I 1XB4A 4RB3C 2CW7A 5D8LB 5HOOA 3D5SC 1ETWA 1MZBA 4OAYA 4BQNA 4DYCA 1U5TC 1W4MA 2M3AA 2NYXA 2P6TA 2PMZN 2ZBKA 4GYIA 4EV0A 1ON1A 2VASA 1D1CA 1SMYF 3C7JA 2GXBA 3CMEI 1HW2A 3OOUA 1JUPA 4MHGA 3SHFA 4L5IA 3CMYA 2JWTA 4JBAA 1OCRH 1WFXA 5E8GA 2GZWA 3HHGA 1TQMA 1KU3A 2D45A 4C2UA 3F21A 3L2RA 3MKZA 3CC4I 4CYCB 4R8HA 1YIJI 3KZZA 3KYLA 2JA7J 2A5WA 3F72A 1VZ0A 2FBKA 3ABLH 5A2QK 3ZPLA 4ZTJA 2QENA 3BR0A 4QWQA 2VXZA 1ETKA 3L2UA 1XS9A 4EGYA 5CYVA 3WTWC 2O9LA 3AL0C 3DFGA 2K3PA 5K5OA 5EEAA 2DO7A 1LFBA 4KICA 4IXAA 1K78B 1YS7A 1BW6A 1OCCH 1QPMA 3VFZA 2A6EF 1ZRDA 4I6ZA 1G4DA 4IVNA 2DDBA 4EATA 2KLOA 3FDYA 5JFRA 5M5YJ 4F55A 3E6DA 3H9GA 2A69F 2IP2A 2MBFA 4PUSA 1B4AA 1G3YA 3IV5A 4U7BA 3SYTA 1MNDA 1T2KA 3AAFA 4BBRJ 4UV8A 3RKYA 3KPHA 2YSRA 3QAHA 3CF2A 4RAGA 5HLGA 2PBIA 3WTXC 1IZ1A 3OR2C 5GTIC 4RMNA 1W7PB 4UNOA 1DPUA 1I5ZA 3F8FA 1X1AA 3ERMA 1MMSA 4IZZA 3RZDJ 1R1UA 2AXLA 1QZZA 2EFOA 4LMYA 3HOVJ 4II2A 3GTGJ 4AD9A 4Q5SF 3BC8A 2LKSA 2ZNZA 4JP0A 5J40A 4RM2A 5BPDA 2WY7Q 2ZMEB 3VB2A 2OBPA 4X6AJ 1WJAA 2RQPA 3JRAA 3NRVA 5H6RA 4CSWA 5C3EJ 4IHVA 3MKLA 3VYTB 4M3DA 2X6WA 1T8IA 3KP3A 2GIVA 4G6DA 4KYWA 4KIFA 1NK3P 1ACIA 3FMQA 3F8BA 5KVRA 4XN0A 3QPHA 3QRFF 3DPLC 1WCMJ 1ZRCA 4RDUA 3T8RA 2V1XA 5EZHA 5JVTA 2W85A 2DODA 2KIUA 3FZVA 4AIDA 2R92J 3LA7A 4Q48A 4AIKA 1VQOI 1O3RA 3HZJA 2E2IJ 1RKTA 2G7HA 1LNWA 2EWNA 1S3JA 2FMYA 3BCAA 1V55H 1UB9A 4BE0A 1YHQI 4DGWB 5B3SH 2CV2A 4LIUA 3FBNB 4UHTA 4CYDA 4BBSJ 3G1MA 4M9ZA 2K02A 1DGWY 1Z1DA 4BACA 3TMOA 3OL3A 3JAMK 3LOCA 1XDSA 3SDBA 2PMZA 1A5JA 3GWZA 3H0DA 2EFQA 2JUCA 3CLQA 2HOSA 4IHTA 2DPDA 3EPZA 3V4GA 3MVPA 1KONA 1VI0A 2MLKA 1VQ8I 3QP5A 2HYFA 4A3KJ 5CVUA 3CZ6A 1DPRA 4IX7A 4BEHB 3A1YA 1IGNA 3K0LA 4BJ5C 3ZQGA 1T08B 1T0FA 5KAFC 2HQAA 2MH9A 4B47A 2VBXA 3B73A 2QQ9A 2JRMA 1ETOA 2JRTA 1X1PA 4B44A 3OYDA 5LRRA 1JKPC 1EJ9A 3WE3A 3GBGA 4A93J 2CMPA 1BR4A 4B09A 1F9NA 3QYFA 4LLNA 1LVKA 4PSWA 3W2VA 3TQNA 2VKHA 4BH9A 1B1BA 1WJFA 1IDYA 5IP9J 1ZGAA 4M3FA 3ZQ7A 4Z6YA 4NC8A 4BQAA 3A0HC 2Y9YA 1SFEA 3NAUA 1I6HJ 1ZTRA 3H9QA 1W5CC 2WAFA 4DOZA 5K1YA 2KIMA 1OMIA 1WSUA 1CGPA 3J7AO 1SD5A 3DBHB 4CZCA 3IHUA 4S05A 3FMRA 2LY9A 2EIKH 4HF0A 5C44J 3LSRA 1SEUA 1GHCA 4ZDOA 5D5VB 4IRGA 3HDDA 4PK4A 1FZPB 1JTYA 3OS2A 2M1BA 3OYLA 1OCOH 1IXSB 3FXUA 4A2UA 3IRRA 3K4KA 2F2EA 2BBYA 5HLHA 1DP7P 5DUIA 2B0LA 3KCCA 2ELKA 1PUFA 5EEGA 5E3OA 2W84A 2VJ4A 1J2XA 2EILH 4PJ0C 3TW7A 5L3BA 1Z7UA 1PYVA 2XIGA 2BY2A 3PUFA 2IPQX 1B9NA 5HS7A 2ZFWA 1POGA 3T1BA 3HOXJ 5K7ZA 3RJPA 1G2HA 5FLXZ 1QQIA 2EQRA 3IP4B 5HNFA 2M8EA 2DA1A 3IH4A 5AIPA 1PP7U 4KISA 3S1MJ 4IQ4A 4IOCF 3FF5A 2Y2ZA 4GXOA 4FETA 1A6IA 3GEZA 3AG4H 2JVGA 4CCNA 3OS0A 2IA0A 4X1EA 5FRMA 3S1QJ 3CUQB 1BW5A 4HG2A 2JVHA 3Q3SA 3I53A 1SFKA 2GOXB 3JSPA 1BI3A 3H3ZA 3WU2C 3O3KA 2A3SA 4BAYA 2IS6A 3LL7A 1IN4A 5LGUA 1A04A 2N8GA 2LVSA 2VN2A 4C2MJ 3HIFA 2W1OA 4BY7J 1WVRA 2VT3A 2R7OA 2VC1A 2KQRA 2VJ5A 3H5NA 3A0BC 1D0ZA 2VIXA 4CHUA 2H1LA 4NBQA 2KISA 2WY8Q 3V7SA 1J7KA 4BDYA 1XGMA 2EINH 3DTEA 1XX5A 1HW1A 3SZGA 1OCTC 4D5FA 1R4NB 1BJAA 2BYVE 3HTUA 2KDOA 5F0HA 5IT9Z 4YFXF 1F36A 3FWEA 2K86A 1SFXA 5DCMA 2W25A 2M30A 4PFOA 1DQUA 2ZKZA 2OTJI 2X51A 5FKNA 4HEA2 2HU9A 1N25A 4MO7A 5EJCA 3RKXA 5HODA 1FC3A 4P1WA 1P7JA 2F6CA 1Z21A 1IXCA 4A3FJ 5FJ8J 3L00A 4X0GA 4MTEA 2J5OA 3RIRA 1LE8B 2P7VB 3CC7I 5TISC 2HPIA 2ZJ2A 3CCUI 4BL0B 1R5GA 3MZYA 2CW0F 3S8PA 3HOYJ 2E1NA 3EDPA 1WJCA 3CLOA 2I8DA 3L1PA 1FYLA 4AUXA 5CVIA 4ZYAA 2Q0OA 1JKOC 4N9IA 4LB5A 1MIJA 1U9OA 3K6GA 5FKKA 1BIBA 1EH6A 2L9VA 2F5FA 2NNNA 5JHUA 1JGSA 3BR6A 2XDVA 3K4BA 2AO9A 5L3GA 4J00A 4YIIA 2W57A 3HPGA 5K5QA 3F8CA 5C4XJ 4IF4A 4D1QA 3EUAA 3DPTA 2V26A 2ZO4A 2HXOA 3HOZJ 4EJOA 4F3QA 3LFUA 4XRMA 1HDPA 5B1AH 4ZYDA 4LFUA 1REPC 3G3ZA 2OZ6A 1F43A 3E5QA 1MDMA 3H9JA 1BI1A 4HDVA 1MH3A 4RGXA 4XL9A 2EIMH 5IPAA 4E4HA 3T8TA 4DQ2A 1P6RA 3ESWB 2BGCA 2MFZA 4BHBA 4XIDA 2O5RA 2MABA 3D0SA 5GADJ 5E18F 2HYGD 3HB9A 4I0BA 2EZKA 5D6FA 4FT8A 5BS6A 3HUGB 5IYDJ 4ZH4F 2E2HJ 2RDPA 2L7ZA 5F1RA 3JRIA 5DM7F 4A6EA 5K7HA 1Y56A 4EGZA 2HVRA 4PDKA 5FLVA 2NVXJ 2XKPA 3RTRA 3SQNA 1A6QA 1QHGA 2ISYA 2R7TA 4QTRA 3K70C 4NC6A 1DU0A 3GLLA 5JLWA 3OYNA 5IP7J 2OU2A 2DA2A 1EF4A 4U0WA 4W1UA 2E19A 3TP0A 2FD5A 4JX5A 1RIOH 2LP0A 2MH2A 3JRGA 1STZA 2E60A 2L9SA 3IUOA 2M8GX 5IT3A 3GTPJ 4P55A 1XSVA 4IRIA 4YRVA 2LOOA 4XORA 1S72I 1USSA 3A01A 5EEHA 2KHMA 2V6EA 1D1AA 3MQ0A 3DLLF 1YE9A 1ETYA 3NARA 4C30A 4BDZA 1P7IA 4ZDPA 5D5XB 4A0YA 3W6VA 3ABMH 2CUZA 3R4KA 1TZLA 1JHHA 4UUSA 3CF5F 3BROA 3KEYA 3HBLA 5GTHC 4M72A 4L0YB 1P9QC 4EM2A 2DAOA 2WA0A 4ZTFA 3KP6A 3HG9A 3REOA 2BVLA 2E1CA 4XKVA 3HSFA 5E1WA 1JKRC 3NEUA 5ICFA 2BY1A 4CDGA 3AKZA 4WX9A 3OYMA 1TTYA 3IWZA 3JTGA 2LF8A 4OIQF 3W2AA 5GAGJ 4NQWA 3TOAA 2AS5F 1UHMA 2I5UA 1TBXA 2WB1N 4RAZA 5KCMA 2A6HF 4E7IA 1ZR2A 2QWWA 4XLEA 5DYMA 1HOMA 1U5TA 2HTJA 2CGPA 2XF6A 1ZR4A 1YRNB 1WKMA 1G6NA 4BHPA 1YS6A 2EA2A 2OC6A 1K83J 3M8FA 4XKBA 1BM9A 5HNHA 1K7AA 4LG0B 4ESBA 3ZMUA 4FCYA 2OPTA 2Y0SN 1EH8A 2KT0A 4YFNF 3SFIA 5KNLA 3IKTA 1I1GA 2HOEA 2M4GA 3LA2A 2CYYA 5H6QA 4CO8A 1MKMA 4OIOF 3GLXA 2FOKA 2JA2A 5CJ9A 5LGNA 3MKYB 1O3TA 1K61A 3PJRA 3H5RA 4WCGA 1A35A 4D9JA 3JRDA 2TCTA 3KP2A 4GO1A 2CUFA 1YOVB 1K79A 3FXLA 5M5XJ 3HRSA 4KNYA 2L7MP 4HF2A 5IY5H 5D6EA 3VODA 2DI3A 3D5LA 4L9VA 3CC2I 1PUFB 4ASNA 4FX0A 4CXFA 4RB0A 4C3HJ 4V2FA 1LKXA 4B43A 3Q5FA 1F1ZA 1RR8C 4A0ZA 2QSFX 4MQVA 4E7JA 2PN6A 2FRHA 2NS7A 1MSFC 1TNTA 4L9NA 5J1RA 2QKLB 1RI7A 2R5ZB 2LY1A 1D8KA 3WTZA 4HNTA 3BDDA 4DBQA 1VQLI 2LD5A 4CCKA 4QPQA 2FMLA 3LAJA 4CGZA 1DDNA 2HQRA 2NOJB 4A5MA 3LFKA 3LSGA 1CQTA 4B4CA 4PJJA 4BJTA 3UR3C 2O8XA 4BJ6C 4RLQA 1WWXA 2WC2A 2P7CB 2R7ZJ 1G3SA 2R93J 4HQEA 3BQYA 2QSGX 2L4AA 4D7NA 3JRFA 3QPSA 4XOPA 4NUBA 2EK5A 5EGOA 4D5CA 1X3WB 3CO7C 3TO7A 2YX4A 2ZXWH 2V79A 3OSGA 3MCZA 3LSIA 4RGSA 3GYHX 4Y15A 2DA5A 3BJOA 3OR1C 4C9YA 1UG2A 2X1CA 1DP3A 3FK7A 2O61A 1RZ4A 2NVUB 4JK1X 4XLAA 1XCBA 2KJCA 2L5QA 3PL8A 2MC3A 2PI0A 2DMPA 2LKXA 4HX4A 1R7JA 2P5KA 3MEXA 2XB0X 4OIRF 1MH4A 2Z1DA 1TC3C 1YX5A 3DU6A 4YIRX 4Z2YA 3A2KA 2LY2A 4ESFA 4YIFA 4FE4A 3TKYA 1RC9A 2DTRA 2Z5UA 1YX3A 1W0UA 1WH7A 4G7OF 3NQOA 1OCZH 3IH3A 2VODA 2AXTC 2P6SA 3WG9A 2H09A 3T0YA 1SFUA 2B9SA 3Q0VA 3CCEI 4E7KA 2RC4A 3HEFA 4ZC3A 2NVYJ 3K4JA 4JOMA 5CQGA 1FT9A 2HKOA 4UVCA 3CO6C 4IHXA 1BR2A 4CH7A 3DKXA 1P4AA 4F7ZA 4IO9F 2A61A 4ENNA 5B5EC 1GXQA 2CH0A 2PQ8A 1QVTA 4XK4A 1GUUA 4D7MA 1ZGJA 4G6QA 1D0YA 3OYEA 3KLOA 2BZTA 5HLTA 1U8RA 4OMYA 2D5VA 1I3AA 3M3YJ 3ZQCA 2DU9A 4B8XA 4Q47A 2HI3A 4I02A 2YUSA 5ILUA 5LEJA 1DGRM 4LITA 5J3LA 3CCLI 1YO5C 1EA3A 3J7ZI 1HA8A 3KZYA 3GCMA 5EG0B 1Q1VA 2UXXA 2V9PA 3BOQA 4XBFA 1I1SA 1FWZA 2R7VA 2CU7A 2IAIA 3BTCA 4G7ZF 2V1NA 4A69C 4MGRA 2R5YB 1AA7A 1B6AA 5FLMJ 2FUG2 1YI2I 2OTLI 2R7SA 3FM3A 3WGHA 1W36D 2DW4A 5H20A 3KLNA 3C1DA 1Q1HA 3JREA 3ONQA 1V5GA 1LVAA 1P4XA 4XICA 3BR2A 2F48A 1JUSA 5EGOB 1VQPI 2V7FA 4PZJA 1RR7A 4PGHA 1W7PA 1XC5A 2JSCA 1OYYA 2ID6A 2R0QC 1G3TA 1QVUA 4N4OB 1JKQC 3F9KA 4U0VA 3FK6A 2E1MB 3BZ6A 1D0XA 2HVSA 4M6YA 4GFBA 2BEOA 2VQLA 1E3HA 4UV9A 4E7LA 1AKHB 4UUTA 1Z7LA 3W2WA 4UVAA 1IDZA 5CPRB 1ZH5A 2XAUA 2K27A 1TT0A 3QPLA 3S3NA 2K9MA 3NWTA 1BOAA 5DEQA 2OV7A 3F6VA 2KDZA 3CD6I 5LFAA 3JSOA 4ZZLA 3GUDA 2DFHA 2HKXA 1UFMA 1GV5A 2JJ7A 4M6VA 4LK0F 1VQNI 3G4SI 3BJAA 5JVGF 3IAS2 3N4MA 1Y6IA 3CP8A 1XMXA 2BXYA 3MZHA 2DN0A 3IAM2 3DEUA 3DPUA 5GAEJ 3I4PA 3EQLF 4XLCA 2E71A 2PFBA 5HDGA 2W7NA 4B3AA 4UUVA 5FKMA 2VPRA 2KMUA 5DTDA 1G59A 5F0FA 1IO2A 1WQ2A 3WTTC 4E70A 4DZPA 4IEJA 4L9TA 2E1OA 4AU7A 1NTCA 3BR1A 4GCVA 1SFOJ 3C2GA 3MMYB 2FOWA 4HX8A 2HOAA 4F92B 2G0EA 1MMGA 3F23A 2VBYA 4GGGA 4M71A 4UXNA 3K9TA 1K6YA 3KP7A 2R7QA 1VQ9I 3HRMA 2CS3A 2MLGA 3PNVA 2YPRA 1U5TB 2VC0A 5LLQA 3FM5A 1GV2A 3HYIA 3I54A 2W00A 4WXDA 4UY8I 5FLXK 2L7FP 1A36A 3BZCA 5J4VA 9ANTA 4U7DA 4KA4A 2TDXA 2KFDA 1UJ8A 3CCRI 4L5EA 2HNHA 3HPHA 1ETQA 1FBSA 4EM1A 1R4MB 3HXLA 1QZYA 2PEXA 2K85A 5J6XA 2X9DA 5J47A 2XROA 3RYRA 3ZMTA 2ZSIB 1VQ6I 2H8RA 2CV1A 3I5UA 2ZSHB 4RB2C 1YW7A 3WE2A 2ADUA 3K2AA 2LSOA 2KZVA 2RVCA 1AU7A 3DWLE 2HVQA 1YQAA 1MBJA 4HV5A 3K69A 3J7YJ 4LLLA 3BTLA 4IL6C 2QGUA 1F5TA 3BG7A 2DMNA 2A5YB 3ECOA 4XNFA 2ZB9A 3LSMA 3V42A 1CF7B 4BUPA 5IOZA 3BG9A 3S3MA 4J19A 3FISA 4O6JA 1HKQA 4P9UA 1Z6RA 2V9KA 2COBA 4BHCA 5EZGA 2GLOA 1B8IB 2JT1A 4AIHA 1HC8A 2K5CA 5M3MJ 2L3DA 2X1EA 1FOKA 3ULQB 5ILSA 2WADA 1MNMC 1V5EA 1JHFA 3QYEA 4G12A 1YW9A 1E2XA 3OY9A 4O3MA 2M0CA 3RCOA 5BNGA 4XSXF 5D5UB 4BNCA 2IT0A 4Y13A 1Z05A 2QUFA 3MZ8A 4BS9A 3L2VA 1FOWA 4WXHA 1HSTA 1W0TA 3GFMA 2W82A 3F6OA 2JPCA 5TJJA 1KYZA 4ZYHA 5J1UA 2HTSA 3DBLB 4N4NB 3TP3A 1SVLA 3FHZA 2DXIA 1IRZA 4NDLA 1MJAA 3MFKA 5KHDA 4JX4A 3D1NI 3CJQB 5C4JJ 1HBXG 2V1DA 3DEWA 5DD8A 1MDMB 2PJPA 2OQRA 1TT5B 3FBIB 1WJDA 3M1CA 1YJNI 3P9CA 2HR3A 1LQ1A 4LB6B 3MWMA 4PCQA 3J80K 3QQAA 1R49A 4BY1J 1R00A 1ORKA 4CUGA 2O0YA 5E8IA 4KFCA 3S2DJ 2PJRA 1BI2A 2RN7A 3WHBA 1FMVA 2OAZA 3NWSA 2LR8A 4OAZA 3L2QA 3ABTA 4HPQA 2LREA 4PJMA 3K10A 4LJZF 2XASA 2MW8A 5E1XA 2LC2A 1UMQA 1WJ5A 4Y3OA 3BR5A 3COAC 3BT9A 1V4RA 2JTVA 2QBYA 1USTA 1OFCX 2WAQA 3ASNH 2VOOA 1KZHA 2QZ8A 4FE7A 2ESHA 2R7RA 3J80Z 1H88C 1MMNA 3M4OJ 2KRHA 2R3SA 1W7PD 4AVPA 3BJ6A 1ONVA 3WG7H 3Q0WA 3PIOF 1BJZA 2VKVA 1KQ0A 4S0HB 2DOEA 1TWGJ 2DA6A 1SVOA 5E1ZB 1GVDA 3GXOA 4P9FA 2E34A 3O8HA 2HQNA 2VPLA 2K9SA 2KPMA 5HLIA 3A01B 1ZN2A 1FLIA 4ZZDA 1QA6A 1PDNC 3OV8A 1OQYA 1X1CA 3VOEA 4RS8A 2VJJA 3O8GA 2R5ZA 4IKFA 2M45A 2NS8A 2VT2A 2BW3B 4RLFA 2KIQA 1JE8A 3VYSB 2QQAA 2XKOA 1Y1VJ 2IA1A 3LSPA 2IS4A 3DQVC 3ZQIA 4P96A 3ZMSA 4WK8F 3I59A 1IUYA 2LLKA 3B6AA 3GFIA 2PJRB 2O03A 1D5VA 1IC8A 4I09A 3WU0A 3GFLA 1GXPA 3K7AJ 3KYCB 3U1DA 1Z91A 3CQZJ 3FXJA 1Y0UA 4MNUA 3J81K 3QOEA 1LPQA 1XSXA 3ERED 3HRTA 3GTQJ 1PUEE 4C3JJ 2ISZA 3GTLJ 3CCQI 3KFWX 1O4XA 5EF6A 1ULYA 2PG4A 2DJIA 2ACJA 2W24A 2ZJRF 1Z9CA 4RBOA 3KETA 5E3NA 4G6TB 5DM6F 3K1MA 2R7XA 1TQPA 5IOYA 3OL4A 3CCJI 1ZG1A 5F27A 2L01A 3J81Z 2HDCA 5L3EA 1R5HA 3GF2A 5GPAA 1T0FC 3W6KB 3LWFA 1P4WA 2XAHA 3TBIA 4YG2F 1NHAA 4KN4X 1BC7C 1QRYA 1X1BA 2BY0A 5LHGA 1R1TA 5IYCJ 2NVTJ 2FSWA 4HLYA 2ZCWA 2TRTA 2Y30A 1XCVA 2ZXJA 4ESJA 2JQ7A 3BP8A 1YJ9I 1OJLA 2IGKA 1LE8A 1TW3A 3I4MJ 2GA2A 1XD7A 5B66C 3KIOA 1Z67A 4KT5C 4KDPA 4R1HA 3U21A 3ZP5A 1WI9A 1NG7A 2HDWA 2IA2A 2HEOA 2H27A 5BPIA 3FXQA 3BG5A 3RKWA 4YFKF 4MFDA 2NAZA 1LUJB 1D1BA 2WAQN 4LD5A 3G1OA 3H3VK 2XGDA 3Q9VA 1S7OA 1FPQA 4CA0A 2KZGA 3C2HA 1YJWI 3CUQC 1UELB 4BXUA 2GWRA 2ELHA 3F22A 1FYMA 4I0AA 2ETHA 4ABZA 4CICA 2Q1ZB 3PO3J 2O6GE 1IG7A 2M7AA 4EM0B 5M3FJ 2EFWA 1XSDA 5GPCA 2IRFG 4LG3A 4E7HA 2DPUA 2QVOA 3I64A 5LBQA 4XKCA 1HLVA 2QM3A 1JI8A 4HOBA 2X6YA 3DLAA 5HVQC 4MEXF 4L18B 2YU3A 4S04A 1KU2A 2RGVA 3A02A 2I10A 3G73A 2OA4A 2IGMA 3CESA 3E6MA 3K4NA 4BQQA 3OYIA 2QYOA 4F93B 2AQEA 1HF0A 1R58A 3HOWJ 2STTA 1K6OA 3FXMA 3H35A 3LSTA 3OWTA 1B59A 5GP9A 2BHYA 3R60A 1LDJA 1SD7A 2QF7A 2HGCA 4QSHA 3R6SA 2KIFA 1TWHJ 2VQCA 2RNGA 5J1YA 4BEHA 1ZRFA 4PJLA 1FIAA 4AIJA 4HQMA 3S14J 4ITVA 1FBQA 4GYGA 2DOAA 5JR3A 3ROUA 1GVJA 2IJLA 2V6CA 1VQ4I 4LGWA 2XF7A 1SD4A 4M3EA 5L3DA 1H0MA 4BXXJ 3I58A 5CVVA 4WWCA 3RQIA 1R71A 1S5LC 3S2WA 3VWBA 2LRDA 1OYWA 4A3CJ 4HNVA 3ML6A 1R1VA 5IYBJ 4XQFA 3OYGA 2MA3A 1D3YA 3CCSI 1IRGA 2XPUA 2M0MA 2CFXA 4M6XA 2WBMA 3ASOH 2DTZA 3CDIA 4D0PA 1ENHA 1M1EB 2A05A 3PQJA 1BI0A 3OSFA 3Q9SA 1HCRA 1WPKA 3VPRA 2HOTA 3JRCA 2Z16A 2GM4A 5L3FA 2A68F 2CUEA 2K7LA 4XN3A 1EKEA 3AG2H 3V8LA 1H8AC 2OCCH 2QCOA 2QSHX 1FOXA 3EUKL 1IUFA 2DLLA 3GVAA 1IRXA 3CCVI 3S15J 2LK2A 2V4JC 3PSFA 2K40A 1VQ7I 1A31A 1ZK8A 4HSTA 5DCMB 3KE2A 5GAHJ 4HYEA 3U1KA 1J0RA 3DTIA 1VTNC 1LFPA 1FNNA 2EA4A 4W97A 2HZTA 4A12A 4XRFA 1Z3YA 5HDNA 1Z6TA 2JMWA 3OOPA 3KEQA 5LEKA 3LMMA 1ZYRF 1S7EA 4LG0A 1L0OC 3ZRGA 2OF7A 5E3LA 4KMFA 2HS5A 4K2EA 1APLC 4HAMA 3BR3A 3BTIA 2R7DA 1ERDA 2Z2SB 1R23A 2BY3A 1V5FA 2F4OB 5ICEA 4MTDA 3DKWA 5D8KB 5BMZA 3B02A 3ZGKA 2XPWA 4ENMA 1S8NA 1E3PA 1OR7A 4CCJA 4HDUA 1YIOA 1MBHA 4HW0A 3DTKA 1KQ8A 1ITYA 4GRIA 3SEQA 3OYHA 1BN5A 3S17J 4ENKA 5K7FA 2BW3A 4ZJZA 2W48A 1JJ6C 4OIPF 5B1BH 4HSRA 2UZKA 1I6XA 1XGOA 2LDUA 3LSJA 5LGTA 4XLHA 2KRCA 3AFHA 3ABKH 1LB2A 3JAMZ 3TDZC 3I4NJ 3M9AA 3RSNA 4UUSB 4XLPF 5TGTA 1LEAA 2BOLA 1V3FA 2YX7A 1W36C 1NK2P 4DJAA 1IN6A 2WAEA 5DUKA 2DT6A 1OR7C 2VOPA 3WTSC 2CQXA 1U9NA 2PX9A 5ICGA 1YG2A 4M9SA 4DW6A 1L3LA 2V9VA 1NG6A 3DU5A 2KL4A 1I27A 5CLSA 1T95A 4AVZA 3S93A 4OWRB 3I3LA 2DQLA 2X85A 2STWA 4Y4RA 1WH5A 4RB1A 4EQQA 5FFXA 3K4MA 3GX4X 1G3WA 3HKZA 1MD0A 5J8CA 1ETXA 3HUGA 1S9HA 4HZFA 2XAGA 2ZNYA 5DDGA 1GT0C 2X0LA 2RV8A 2Y31A 1ZELA 2CQNA 2DFEA 3F3XA 3V8KA 1DUXC 3DCFA 5HS8A 4AC0A 1FY7A 3CUOA 3ZQQA 3N97A 1PVEA 6PAXA 4KIGA 1W5TA 3TEDA 1RKWA 2IXSA 2L02A 1F4KA 3D5RC 2F5EA 3H92A 3PUBA 3E5UA 2M9HA 3N05A 3I59B 3PFYA 1O3QA 5KAIC 2RREA 2JZYA 3HGGA 4RAFA 4DZJA 3FMSA 5HDKA 3WGIA 1ZARA 1XPXA 1U6GA 1RRJA 4PFPA 3OIOA 3CTAA 1ODDA 1EV7A 1ZLKA 1HW5A 1DU6A 4II3A 2DA3A 1K78A 4I99C 5FROA 1BA5A 2CQQA 4DIQA 3MAJA 5EDNA 4J01A 3ZMDA 2EV0A 2CW8A 2HWVA 5AONA 3BG6A 4BKXA 4RM3A 1X4OA 1XDUA 2AQFA 2B7EA 1I3QJ 4UB6C 4A0XA 3TO6A 4E6KG 2FQ4A 2RQQA 1UHSA 4IHWA 1SANA 1FBUA 5CVJA 2MYSA 5F1JA 2H6CA 3FX3A 2E2JJ 3AG1H 3OYBA 4ANJA 1OKRA 2FJ1A 3WTUC 2FBHA 1RETA 3G1LA 2XSDC 4M3GA 1RUOA 2ZXIA 5CQEA 4DYQA 1TW2A 1R9TJ 3P7NA 2QBYB 1WJEA 3L9FA 2NOGA 4BGDA 1D8JA 2D2WA 4NNJA 2JSPA 3HRUA 3ECHA 4L5JA 4A3DJ 1I39A 4A3BJ 2CQ7A 2P81A 3ELKA 4A6DA 1KYWA 5F08A 2VKEA 5BOXA 1Y39A 4XRSG 3SZTA 3S1RJ 1FOYA 2CFOA 1TL8A 1YRNA 3PNTA 4FQGA 2HYJA 1X3UA 3HSRA 2OD5A 2KRFA 2FE3A 2XF5A 4F52A 2EJRA 1E17A 2XAJA 2P4WA 4XSZF 3SJMA 2EPFA 2ZMEA 4U87A 1ZQ3P 3RPQA 4OINF 4B3XA 3WTVC 5FFZA 5DV5A 2QA4I 2QEXI 5D5WB 4G8XA 1TWFJ 3RYPA 5JLXA 4ETSA 2UV1A 3CCYA 2VE8A 4G9YA 3GZ6A 3GFJA 1KA8A 3GZ5A 3MD2A 2L9NA 2GQQA 4Y33A 2EFPA 2EZIA 4IJAA 3VYRB 4B48A 2FF4A 3CMMA 2JA5J 3HM5A 5JI6A 5HS9A 1BOBA 1ZGWA 1O7LA 4HF1A 4EJVA 3SXYA 2YR2A 1SC7A 4IHYA 2F4MB 2OCEA 4F91B 4N0BA 2ESNA 1UZCA 1WZ2A 2IS2A 1FTTA 4A3EJ 3C18A 2W4SA 5DCFA 2E5NA 3KZIC 1J75A 4MEYF
chains in the Genus database with same CATH topology
2B7EA 2K85A 2KISA 4FQGA 2KZGA 2DOFA 2KIQA 2LKSA 2KFDA 2L9VA 2DOEA 2DODA 2CQNA 1UZCA 2E71A 2JUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2K85 A;  2KIS A;  4FQG A;  2KZG A;  2DOF A;  2KIQ A;  2LKS A;  2KFD A;  2L9V A;  2DOE A;  2DOD A;  2CQN A;  1UZC A;  2E71 A;  2JUC A; 
#chains in the Genus database with same CATH topology
 2DBB A;  3DEE A;  3L7W A;  1FIP A;  2GOM A;  2EFN A;  3R0J A;  2A07 F;  3PO2 J;  3OYJ A;  2XVC A;  1TWA J;  1T56 A;  5J4Y A;  3EUH A;  1OYI A;  3L2W A;  2E36 A;  1AWC A;  4NC7 A;  1HDD C;  1AKH A;  4I01 A;  3GTM J;  1ZKG A;  2VE9 A;  4BE2 A;  4QLC U;  2VLA A;  2MSY A;  3WGG A;  4FHT A;  2D1V A;  2H1K A;  1P92 A;  2CWE A;  3P9K A;  4I2O A;  2L7K A;  1ZG5 A;  1YIT I;  3E3V A;  2P0W A;  3M1E A;  3P9I A;  3RPU D;  4XON A;  5LHH A;  2EH3 A;  4JYK A;  3HOT A;  3PSI A;  4A3I J;  2Z99 A;  3W6J B;  3E7L A;  1ZG3 A;  1VQK I;  2YU9 J;  2IBD A;  3HHH A;  3A03 A;  3C3W A;  2DFI A;  2Y0S A;  1WI3 A;  2DJN A;  3DBR B;  4FIS A;  2K9N A;  2CRG A;  3H0G J;  2K3F A;  4RAY A;  2VL8 A;  3ISP A;  3GTK J;  1R6R A;  2BXZ A;  2VKD A;  3IKV A;  3ZN1 A;  3IRQ A;  1OIS A;  3ZQF A;  2UUZ A;  2R5Y A;  2P8T A;  2LKP A;  2ZME C;  2Y9Z A;  2NRA C;  2ELJ A;  1TP4 A;  2DK8 A;  5M5W J;  2R7W A;  1IRF A;  3LSH A;  1LEB A;  1S29 A;  4MIM A;  4KN7 X;  2DYR H;  2VBZ A;  1X4P A;  1Z3X A;  3EUH C;  5H2F C;  3GTJ J;  2ZJQ F;  2IEK A;  1HQC A;  1U78 A;  1Y8R B;  4M9X A;  2EBI A;  3TW6 A;  4WXC A;  4XLN F;  1ON2 A;  2PMU A;  2XB5 A;  3ZQL A;  1TQI A;  1TNS A;  4HX7 A;  2UXN A;  1ETV A;  4C2T A;  3KP5 A;  2X4H A;  2RKH A;  3U2R A;  2KKO A;  4R79 A;  2XHK A;  3RI4 A;  4OOI A;  4ZYE A;  3V7C A;  3OYK A;  2HFH A;  3CCM I;  2VI6 A;  3OYF A;  1JJ8 C;  2DT5 A;  3ZQH A;  3MKW B;  2B63 J;  1ZAO A;  1MJB A;  3H1C A;  3SZP A;  2FQ3 A;  4EJT A;  1IJW C;  4XRS A;  2A6T A;  2F5V A;  1C0W A;  1MW7 A;  1OCP A;  3JCU C;  2DYS H;  2ID3 A;  1HKS A;  3ZMV A;  3WOD F;  4G7H F;  2D1H A;  3E5X A;  1IW7 F;  3S32 A;  2BHZ A;  1QPI A;  2QQB A;  4H0E A;  4CZZ A;  2EIJ H;  1XGS A;  1RUN A;  3ZCO A;  2F5D A;  4EJU A;  2FEZ A;  4DNC A;  1IN5 A;  4L0Z B;  3KX2 A;  2DT7 B;  2Y48 A;  3GO5 A;  3GW2 A;  1SVM A;  3BG3 A;  4HNU A;  5ERI A;  4KIT B;  3OIQ A;  5F6F A;  1BIA A;  2M5W A;  2IS1 A;  3HL2 A;  3BLY A;  2XGX A;  2Y69 H;  5FKL A;  1GLN A;  3QP6 A;  2OUM A;  2F5C A;  2X6O A;  2YS9 A;  1ZHF A;  1Y1W J;  3KP4 A;  4IRH A;  5E20 A;  2WV0 A;  4AYB A;  2HDD A;  2G7U A;  1AOY A;  1MBF A;  2K4J A;  1QHH D;  3F8M A;  3OIP A;  1JT6 A;  3WU1 B;  4I7H A;  1VFC A;  1U3E M;  3HOS A;  2GAU A;  1LDK B;  1QGP A;  5CVR A;  1FEX A;  2M34 A;  1LJ9 A;  3RDI A;  4MFE A;  4N9H A;  1H89 C;  3OYA A;  5D4S A;  1RNL A;  1MBE A;  3M7G A;  4JQF A;  2DMT A;  1RES A;  2RAE A;  3TL4 X;  2GA1 A;  1SAX A;  1HKT A;  5ED4 A;  2NS0 A;  5AIQ A;  2XGC A;  3SDG A;  3G71 I;  2LG4 A;  1N75 A;  4M73 A;  4CCL A;  4ZYG A;  1XMK A;  2FXA A;  3ZOB A;  3FHN A;  2G9W A;  3LQR A;  4ENJ A;  2AHQ A;  4OMZ A;  3ZN0 A;  2JPB A;  4HLX A;  1UHW A;  5LD2 C;  1X58 A;  3HGY A;  4QPO A;  4KUM A;  2ME0 A;  4V19 K;  4HBL A;  1JT0 A;  3QU3 A;  3L09 A;  2MG4 A;  2L0K A;  1E0E A;  3RKQ A;  1FSH A;  2E5Z A;  4CYC A;  1MNE A;  3K2Z A;  2NXN B;  1ZRE A;  2F4I A;  1XGN A;  4YEL A;  5FD6 A;  1LDD A;  3F8N A;  2ME6 A;  1HSJ A;  4BXF A;  2IW5 A;  4U0Y A;  2DA4 A;  1SD6 A;  2KP6 A;  1K4T A;  1U0J A;  2LTP A;  5LHI A;  1XTA A;  1IXR C;  3G2B A;  2DK5 A;  5F04 A;  3KYD B;  3C2B A;  2L4M A;  2XRN A;  1D5Y A;  4QIW N;  3GZN B;  4WF2 A;  4Y52 J;  4FTH A;  3BY6 A;  2L54 A;  2MC4 A;  3PFI A;  3TO9 A;  3X2Q H;  3DF8 A;  4B1R A;  3T5X A;  1Z77 A;  3PIP F;  4XR6 A;  5IP6 A;  4DYR A;  4BE1 A;  2CV0 A;  1IV8 A;  2X6X A;  2WWY A;  2ICW G;  1H9G A;  3KEO A;  4DBR A;  5J8F A;  2EB7 A;  2BE5 F;  3G6E I;  4PJN A;  2KJB A;  3QWL A;  3JW4 A;  3P5J A;  3IC7 A;  1WRJ A;  3LSK A;  4RGR A;  4AM3 A;  4Y7N J;  3I71 A;  2M87 A;  3BWG A;  3HOU J;  3WTY C;  4LOC A;  3EET A;  4HV6 A;  2LNB A;  4XLF A;  2JK3 A;  5FKO A;  3OYC A;  1TWC J;  2M7B A;  1FP2 A;  5F0C A;  4A3J J;  3M07 A;  4BYY A;  2K9L A;  3CUQ A;  3TDU C;  3R61 A;  2GXG A;  2E7W A;  1MJ9 A;  4PSX A;  5KK1 A;  3E6C C;  5D4R A;  1X1D A;  3CP2 A;  3W3C A;  5JHF A;  3PQK A;  2VJI A;  3QOD A;  2H8W A;  3EYI A;  3CJN A;  2FNP A;  2O3F A;  5FGM A;  1Y8Q B;  1T33 A;  2Z3Y A;  2XAF A;  3K4L A;  2L9R A;  2DMU A;  2FA5 A;  4IPA A;  1H9T A;  3HSE A;  3DKY A;  1B9M A;  1N77 A;  4AYB N;  1J09 A;  2E7X A;  1BR1 A;  1X19 A;  4HA8 A;  4ON0 A;  1B72 A;  3LA3 A;  2HZD A;  3BPX A;  2Q8K A;  3LQQ A;  3TOB A;  4EJW A;  3BTJ A;  4NB5 A;  1B72 B;  3R0A A;  1T98 A;  1N78 A;  2EV6 A;  2CSO A;  1G8X A;  2K9Q A;  3VSK A;  4EVI A;  3ZMZ A;  4EEF G;  2R4G A;  3BCB A;  1IAW A;  3CJR B;  3IL2 A;  2VQH A;  3BQZ A;  2CO5 A;  4KJZ A;  3H36 A;  2JUG A;  2P5L C;  2XUB A;  4XKW A;  5DS9 A;  3GME A;  2FX0 A;  2O7O A;  4H4K C;  3SEZ A;  3Q0U A;  2GBY A;  1JTX A;  1V54 H;  1JXS A;  4I98 B;  2V1U A;  1IV6 A;  3K1P A;  2Q2E A;  3K4C A;  3GTO J;  1UCR A;  2QLZ A;  3S1N J;  1XN7 A;  4RA2 A;  1OPC A;  1W1W E;  3LNQ A;  3I0T A;  2O8K A;  2NVQ J;  1OLT A;  1P2F A;  3FXK A;  1U8B A;  1QZE A;  2LBF A;  3VDX A;  3HJE A;  5TRD A;  2VQG A;  2DOF A;  1R22 A;  4LLG F;  4UB8 C;  5FD5 A;  3TGN A;  3DP7 A;  3O6B B;  3PNY A;  3A4C A;  4XM3 A;  1XMA A;  5F64 A;  5DD4 A;  3ZXS A;  2X1D A;  2LMD A;  4XOT A;  2MD5 A;  4TV7 A;  2LFB A;  1T38 A;  5EG0 A;  4NQW B;  2DDA A;  1YYV A;  3QOP A;  4JX6 A;  4KT6 A;  1VQM I;  4A3G J;  3FXR A;  3E6B A;  1FMW A;  3RQ4 A;  2C6Y A;  4AWX B;  2H94 A;  1WHU A;  1EH7 A;  1J9I A;  2HQ5 A;  5E79 C;  1PJR A;  3ABU A;  3S3O A;  1BBY A;  1YW8 A;  3O2P E;  3ZR8 X;  4C3I J;  1KU9 A;  5BQT A;  2LYC A;  3AL0 B;  2IVM A;  2FBI A;  2QQ8 A;  1SMT A;  4NHJ A;  2CQK A;  3E0J B;  1FJL A;  3FKJ A;  1IF1 A;  1O57 A;  1O7F A;  1IN8 A;  1MMA A;  3FXO A;  4I76 A;  4ZDL A;  2IGO A;  4IQJ A;  1VF9 A;  5FO5 A;  2PLY A;  5IT9 K;  1FX7 A;  3CDL A;  2XPV A;  1FSE A;  1X3Z B;  4P5O A;  3V7R A;  4IOA F;  2CJJ A;  4LIV A;  2DFF A;  2MD0 A;  4CCM A;  3FKI J;  4RGU A;  3MN2 A;  3UNG C;  2ZXH A;  2HXI A;  3I9V 2;  3CMA I;  2DQR A;  1J59 A;  2XRL A;  2R7U A;  3IWF A;  2GIZ A;  2GXA A;  2OJE D;  2IGN A;  2Y0M A;  1FYK A;  1WJB A;  4A5N A;  2BV6 A;  2OQG A;  4M74 A;  1PP8 F;  3CJT B;  2EZH A;  1YLF A;  1QNT A;  3BPV A;  2CG4 A;  3M8E A;  1U2W A;  4M3B A;  2JN6 A;  3U9G A;  1T39 A;  4PGG A;  3VSL A;  4KMU X;  1T6S A;  5ILV A;  1YFH A;  3E1S A;  3JRH A;  4G94 A;  2Y75 A;  1S7A A;  2VON A;  1FTZ A;  2ECC A;  2J5P A;  1RPW A;  3DXJ F;  3S2H J;  3RZO J;  2XC7 A;  2DCE A;  4BQO A;  4LK1 F;  4O5V A;  2L2O A;  1KGS A;  4FAS D;  2VB6 A;  2DMQ A;  1FP1 D;  1MBK A;  2HPM A;  4Q4Z F;  5A2Q Z;  4Y17 A;  3LAP A;  1Z0X A;  1R5I D;  3OMY A;  1QU3 A;  3JTH A;  2CUJ A;  2VXD A;  4A3L J;  3F0C A;  2ZC2 A;  2UWM A;  2ZFU A;  3FIW A;  3K1N A;  2LBF B;  1XG1 A;  3EYY A;  1QO0 D;  1BL0 A;  5LRS A;  2EV5 A;  1BC8 C;  3VYU B;  3JR9 A;  3DV8 A;  2R7F A;  2LH9 A;  2Q2E B;  2ECB A;  2RNJ A;  2X48 A;  1HXD A;  2OZU A;  1E3O C;  3J7A Y;  2XV4 S;  3L2C A;  2VBW A;  1YTY A;  2FU4 A;  4KIB A;  3HKZ N;  1GDT A;  5E3M A;  5L3C A;  3JRB A;  3RPU A;  2NNY A;  5ICC A;  1MBG A;  3I55 I;  5FRN A;  2XSJ C;  4UVB A;  4FX4 A;  2JA8 J;  1MGT A;  3V8J A;  2M4K A;  2Z33 A;  3AG3 H;  3CDH A;  3HC7 A;  1R36 A;  4MLO A;  5FB2 A;  2WV1 A;  2COM A;  4E7S A;  2E1M C;  5E17 F;  4HRI A;  1JGG A;  1ZLJ A;  1B8I A;  3M8J A;  2XAQ A;  1CF7 A;  4OU0 A;  1W5S A;  3BZK A;  2PMH A;  1J5Y A;  4L9J A;  2MGQ A;  1KU7 A;  4IHS A;  2QKM B;  2H6B A;  3VEP A;  1K4S A;  2P5V A;  2BVM A;  1Y0N A;  1VND A;  2ZJP F;  3UKG A;  1TLH B;  1LFU P;  3IH2 A;  4V2G A;  2Z9O A;  1JUM A;  4YEJ A;  1I50 J;  2EZL A;  4U88 A;  4XMY A;  4A3M J;  3QPT A;  1X2N A;  3SFZ A;  2VUM J;  3QYB A;  2WB1 A;  3I56 I;  2LF7 A;  5CKT A;  3HTS B;  3OS1 A;  3E97 A;  2XGE A;  3H3U A;  2M2E A;  1KQ9 A;  1SAU A;  4BU2 A;  2FNA A;  1O3S A;  1UAA A;  4GDF A;  3H5A A;  1IN7 A;  3WHC A;  1WGX A;  4MQ9 F;  3PM1 A;  1MSE C;  1AHD P;  1UG0 A;  3K70 D;  2DA7 A;  5EYR A;  2JA6 J;  1X2M A;  4E7Z A;  1S6L A;  2WTE A;  2K4B A;  1NH3 A;  3QU6 A;  1QBJ A;  4CCO A;  2E35 A;  3B6C A;  1MMD A;  3S16 J;  4EMS A;  5K5R A;  1VQ5 I;  1XB4 A;  4RB3 C;  2CW7 A;  5D8L B;  5HOO A;  3D5S C;  1ETW A;  1MZB A;  4OAY A;  4BQN A;  4DYC A;  1U5T C;  1W4M A;  2M3A A;  2NYX A;  2P6T A;  2PMZ N;  2ZBK A;  4GYI A;  4EV0 A;  1ON1 A;  2VAS A;  1D1C A;  1SMY F;  3C7J A;  2GXB A;  3CME I;  1HW2 A;  3OOU A;  1JUP A;  4MHG A;  3SHF A;  4L5I A;  3CMY A;  2JWT A;  4JBA A;  1OCR H;  1WFX A;  5E8G A;  2GZW A;  3HHG A;  1TQM A;  1KU3 A;  2D45 A;  4C2U A;  3F21 A;  3L2R A;  3MKZ A;  3CC4 I;  4CYC B;  4R8H A;  1YIJ I;  3KZZ A;  3KYL A;  2JA7 J;  2A5W A;  3F72 A;  1VZ0 A;  2FBK A;  3ABL H;  5A2Q K;  3ZPL A;  4ZTJ A;  2QEN A;  3BR0 A;  4QWQ A;  2VXZ A;  1ETK A;  3L2U A;  1XS9 A;  4EGY A;  5CYV A;  3WTW C;  2O9L A;  3AL0 C;  3DFG A;  2K3P A;  5K5O A;  5EEA A;  2DO7 A;  1LFB A;  4KIC A;  4IXA A;  1K78 B;  1YS7 A;  1BW6 A;  1OCC H;  1QPM A;  3VFZ A;  2A6E F;  1ZRD A;  4I6Z A;  1G4D A;  4IVN A;  2DDB A;  4EAT A;  2KLO A;  3FDY A;  5JFR A;  5M5Y J;  4F55 A;  3E6D A;  3H9G A;  2A69 F;  2IP2 A;  2MBF A;  4PUS A;  1B4A A;  1G3Y A;  3IV5 A;  4U7B A;  3SYT A;  1MND A;  1T2K A;  3AAF A;  4BBR J;  4UV8 A;  3RKY A;  3KPH A;  2YSR A;  3QAH A;  3CF2 A;  4RAG A;  5HLG A;  2PBI A;  3WTX C;  1IZ1 A;  3OR2 C;  5GTI C;  4RMN A;  1W7P B;  4UNO A;  1DPU A;  1I5Z A;  3F8F A;  1X1A A;  3ERM A;  1MMS A;  4IZZ A;  3RZD J;  1R1U A;  2AXL A;  1QZZ A;  2EFO A;  4LMY A;  3HOV J;  4II2 A;  3GTG J;  4AD9 A;  4Q5S F;  3BC8 A;  2LKS A;  2ZNZ A;  4JP0 A;  5J40 A;  4RM2 A;  5BPD A;  2WY7 Q;  2ZME B;  3VB2 A;  2OBP A;  4X6A J;  1WJA A;  2RQP A;  3JRA A;  3NRV A;  5H6R A;  4CSW A;  5C3E J;  4IHV A;  3MKL A;  3VYT B;  4M3D A;  2X6W A;  1T8I A;  3KP3 A;  2GIV A;  4G6D A;  4KYW A;  4KIF A;  1NK3 P;  1ACI A;  3FMQ A;  3F8B A;  5KVR A;  4XN0 A;  3QPH A;  3QRF F;  3DPL C;  1WCM J;  1ZRC A;  4RDU A;  3T8R A;  2V1X A;  5EZH A;  5JVT A;  2W85 A;  2DOD A;  2KIU A;  3FZV A;  4AID A;  2R92 J;  3LA7 A;  4Q48 A;  4AIK A;  1VQO I;  1O3R A;  3HZJ A;  2E2I J;  1RKT A;  2G7H A;  1LNW A;  2EWN A;  1S3J A;  2FMY A;  3BCA A;  1V55 H;  1UB9 A;  4BE0 A;  1YHQ I;  4DGW B;  5B3S H;  2CV2 A;  4LIU A;  3FBN B;  4UHT A;  4CYD A;  4BBS J;  3G1M A;  4M9Z A;  2K02 A;  1DGW Y;  1Z1D A;  4BAC A;  3TMO A;  3OL3 A;  3JAM K;  3LOC A;  1XDS A;  3SDB A;  2PMZ A;  1A5J A;  3GWZ A;  3H0D A;  2EFQ A;  2JUC A;  3CLQ A;  2HOS A;  4IHT A;  2DPD A;  3EPZ A;  3V4G A;  3MVP A;  1KON A;  1VI0 A;  2MLK A;  1VQ8 I;  3QP5 A;  2HYF A;  4A3K J;  5CVU A;  3CZ6 A;  1DPR A;  4IX7 A;  4BEH B;  3A1Y A;  1IGN A;  3K0L A;  4BJ5 C;  3ZQG A;  1T08 B;  1T0F A;  5KAF C;  2HQA A;  2MH9 A;  4B47 A;  2VBX A;  3B73 A;  2QQ9 A;  2JRM A;  1ETO A;  2JRT A;  1X1P A;  4B44 A;  3OYD A;  5LRR A;  1JKP C;  1EJ9 A;  3WE3 A;  3GBG A;  4A93 J;  2CMP A;  1BR4 A;  4B09 A;  1F9N A;  3QYF A;  4LLN A;  1LVK A;  4PSW A;  3W2V A;  3TQN A;  2VKH A;  4BH9 A;  1B1B A;  1WJF A;  1IDY A;  5IP9 J;  1ZGA A;  4M3F A;  3ZQ7 A;  4Z6Y A;  4NC8 A;  4BQA A;  3A0H C;  2Y9Y A;  1SFE A;  3NAU A;  1I6H J;  1ZTR A;  3H9Q A;  1W5C C;  2WAF A;  4DOZ A;  5K1Y A;  2KIM A;  1OMI A;  1WSU A;  1CGP A;  3J7A O;  1SD5 A;  3DBH B;  4CZC A;  3IHU A;  4S05 A;  3FMR A;  2LY9 A;  2EIK H;  4HF0 A;  5C44 J;  3LSR A;  1SEU A;  1GHC A;  4ZDO A;  5D5V B;  4IRG A;  3HDD A;  4PK4 A;  1FZP B;  1JTY A;  3OS2 A;  2M1B A;  3OYL A;  1OCO H;  1IXS B;  3FXU A;  4A2U A;  3IRR A;  3K4K A;  2F2E A;  2BBY A;  5HLH A;  1DP7 P;  5DUI A;  2B0L A;  3KCC A;  2ELK A;  1PUF A;  5EEG A;  5E3O A;  2W84 A;  2VJ4 A;  1J2X A;  2EIL H;  4PJ0 C;  3TW7 A;  5L3B A;  1Z7U A;  1PYV A;  2XIG A;  2BY2 A;  3PUF A;  2IPQ X;  1B9N A;  5HS7 A;  2ZFW A;  1POG A;  3T1B A;  3HOX J;  5K7Z A;  3RJP A;  1G2H A;  5FLX Z;  1QQI A;  2EQR A;  3IP4 B;  5HNF A;  2M8E A;  2DA1 A;  3IH4 A;  5AIP A;  1PP7 U;  4KIS A;  3S1M J;  4IQ4 A;  4IOC F;  3FF5 A;  2Y2Z A;  4GXO A;  4FET A;  1A6I A;  3GEZ A;  3AG4 H;  2JVG A;  4CCN A;  3OS0 A;  2IA0 A;  4X1E A;  5FRM A;  3S1Q J;  3CUQ B;  1BW5 A;  4HG2 A;  2JVH A;  3Q3S A;  3I53 A;  1SFK A;  2GOX B;  3JSP A;  1BI3 A;  3H3Z A;  3WU2 C;  3O3K A;  2A3S A;  4BAY A;  2IS6 A;  3LL7 A;  1IN4 A;  5LGU A;  1A04 A;  2N8G A;  2LVS A;  2VN2 A;  4C2M J;  3HIF A;  2W1O A;  4BY7 J;  1WVR A;  2VT3 A;  2R7O A;  2VC1 A;  2KQR A;  2VJ5 A;  3H5N A;  3A0B C;  1D0Z A;  2VIX A;  4CHU A;  2H1L A;  4NBQ A;  2KIS A;  2WY8 Q;  3V7S A;  1J7K A;  4BDY A;  1XGM A;  2EIN H;  3DTE A;  1XX5 A;  1HW1 A;  3SZG A;  1OCT C;  4D5F A;  1R4N B;  1BJA A;  2BYV E;  3HTU A;  2KDO A;  5F0H A;  5IT9 Z;  4YFX F;  1F36 A;  3FWE A;  2K86 A;  1SFX A;  5DCM A;  2W25 A;  2M30 A;  4PFO A;  1DQU A;  2ZKZ A;  2OTJ I;  2X51 A;  5FKN A;  4HEA 2;  2HU9 A;  1N25 A;  4MO7 A;  5EJC A;  3RKX A;  5HOD A;  1FC3 A;  4P1W A;  1P7J A;  2F6C A;  1Z21 A;  1IXC A;  4A3F J;  5FJ8 J;  3L00 A;  4X0G A;  4MTE A;  2J5O A;  3RIR A;  1LE8 B;  2P7V B;  3CC7 I;  5TIS C;  2HPI A;  2ZJ2 A;  3CCU I;  4BL0 B;  1R5G A;  3MZY A;  2CW0 F;  3S8P A;  3HOY J;  2E1N A;  3EDP A;  1WJC A;  3CLO A;  2I8D A;  3L1P A;  1FYL A;  4AUX A;  5CVI A;  4ZYA A;  2Q0O A;  1JKO C;  4N9I A;  4LB5 A;  1MIJ A;  1U9O A;  3K6G A;  5FKK A;  1BIB A;  1EH6 A;  2L9V A;  2F5F A;  2NNN A;  5JHU A;  1JGS A;  3BR6 A;  2XDV A;  3K4B A;  2AO9 A;  5L3G A;  4J00 A;  4YII A;  2W57 A;  3HPG A;  5K5Q A;  3F8C A;  5C4X J;  4IF4 A;  4D1Q A;  3EUA A;  3DPT A;  2V26 A;  2ZO4 A;  2HXO A;  3HOZ J;  4EJO A;  4F3Q A;  3LFU A;  4XRM A;  1HDP A;  5B1A H;  4ZYD A;  4LFU A;  1REP C;  3G3Z A;  2OZ6 A;  1F43 A;  3E5Q A;  1MDM A;  3H9J A;  1BI1 A;  4HDV A;  1MH3 A;  4RGX A;  4XL9 A;  2EIM H;  5IPA A;  4E4H A;  3T8T A;  4DQ2 A;  1P6R A;  3ESW B;  2BGC A;  2MFZ A;  4BHB A;  4XID A;  2O5R A;  2MAB A;  3D0S A;  5GAD J;  5E18 F;  2HYG D;  3HB9 A;  4I0B A;  2EZK A;  5D6F A;  4FT8 A;  5BS6 A;  3HUG B;  5IYD J;  4ZH4 F;  2E2H J;  2RDP A;  2L7Z A;  5F1R A;  3JRI A;  5DM7 F;  4A6E A;  5K7H A;  1Y56 A;  4EGZ A;  2HVR A;  4PDK A;  5FLV A;  2NVX J;  2XKP A;  3RTR A;  3SQN A;  1A6Q A;  1QHG A;  2ISY A;  2R7T A;  4QTR A;  3K70 C;  4NC6 A;  1DU0 A;  3GLL A;  5JLW A;  3OYN A;  5IP7 J;  2OU2 A;  2DA2 A;  1EF4 A;  4U0W A;  4W1U A;  2E19 A;  3TP0 A;  2FD5 A;  4JX5 A;  1RIO H;  2LP0 A;  2MH2 A;  3JRG A;  1STZ A;  2E60 A;  2L9S A;  3IUO A;  2M8G X;  5IT3 A;  3GTP J;  4P55 A;  1XSV A;  4IRI A;  4YRV A;  2LOO A;  4XOR A;  1S72 I;  1USS A;  3A01 A;  5EEH A;  2KHM A;  2V6E A;  1D1A A;  3MQ0 A;  3DLL F;  1YE9 A;  1ETY A;  3NAR A;  4C30 A;  4BDZ A;  1P7I A;  4ZDP A;  5D5X B;  4A0Y A;  3W6V A;  3ABM H;  2CUZ A;  3R4K A;  1TZL A;  1JHH A;  4UUS A;  3CF5 F;  3BRO A;  3KEY A;  3HBL A;  5GTH C;  4M72 A;  4L0Y B;  1P9Q C;  4EM2 A;  2DAO A;  2WA0 A;  4ZTF A;  3KP6 A;  3HG9 A;  3REO A;  2BVL A;  2E1C A;  4XKV A;  3HSF A;  5E1W A;  1JKR C;  3NEU A;  5ICF A;  2BY1 A;  4CDG A;  3AKZ A;  4WX9 A;  3OYM A;  1TTY A;  3IWZ A;  3JTG A;  2LF8 A;  4OIQ F;  3W2A A;  5GAG J;  4NQW A;  3TOA A;  2AS5 F;  1UHM A;  2I5U A;  1TBX A;  2WB1 N;  4RAZ A;  5KCM A;  2A6H F;  4E7I A;  1ZR2 A;  2QWW A;  4XLE A;  5DYM A;  1HOM A;  1U5T A;  2HTJ A;  2CGP A;  2XF6 A;  1ZR4 A;  1YRN B;  1WKM A;  1G6N A;  4BHP A;  1YS6 A;  2EA2 A;  2OC6 A;  1K83 J;  3M8F A;  4XKB A;  1BM9 A;  5HNH A;  1K7A A;  4LG0 B;  4ESB A;  3ZMU A;  4FCY A;  2OPT A;  2Y0S N;  1EH8 A;  2KT0 A;  4YFN F;  3SFI A;  5KNL A;  3IKT A;  1I1G A;  2HOE A;  2M4G A;  3LA2 A;  2CYY A;  5H6Q A;  4CO8 A;  1MKM A;  4OIO F;  3GLX A;  2FOK A;  2JA2 A;  5CJ9 A;  5LGN A;  3MKY B;  1O3T A;  1K61 A;  3PJR A;  3H5R A;  4WCG A;  1A35 A;  4D9J A;  3JRD A;  2TCT A;  3KP2 A;  4GO1 A;  2CUF A;  1YOV B;  1K79 A;  3FXL A;  5M5X J;  3HRS A;  4KNY A;  2L7M P;  4HF2 A;  5IY5 H;  5D6E A;  3VOD A;  2DI3 A;  3D5L A;  4L9V A;  3CC2 I;  1PUF B;  4ASN A;  4FX0 A;  4CXF A;  4RB0 A;  4C3H J;  4V2F A;  1LKX A;  4B43 A;  3Q5F A;  1F1Z A;  1RR8 C;  4A0Z A;  2QSF X;  4MQV A;  4E7J A;  2PN6 A;  2FRH A;  2NS7 A;  1MSF C;  1TNT A;  4L9N A;  5J1R A;  2QKL B;  1RI7 A;  2R5Z B;  2LY1 A;  1D8K A;  3WTZ A;  4HNT A;  3BDD A;  4DBQ A;  1VQL I;  2LD5 A;  4CCK A;  4QPQ A;  2FML A;  3LAJ A;  4CGZ A;  1DDN A;  2HQR A;  2NOJ B;  4A5M A;  3LFK A;  3LSG A;  1CQT A;  4B4C A;  4PJJ A;  4BJT A;  3UR3 C;  2O8X A;  4BJ6 C;  4RLQ A;  1WWX A;  2WC2 A;  2P7C B;  2R7Z J;  1G3S A;  2R93 J;  4HQE A;  3BQY A;  2QSG X;  2L4A A;  4D7N A;  3JRF A;  3QPS A;  4XOP A;  4NUB A;  2EK5 A;  5EGO A;  4D5C A;  1X3W B;  3CO7 C;  3TO7 A;  2YX4 A;  2ZXW H;  2V79 A;  3OSG A;  3MCZ A;  3LSI A;  4RGS A;  3GYH X;  4Y15 A;  2DA5 A;  3BJO A;  3OR1 C;  4C9Y A;  1UG2 A;  2X1C A;  1DP3 A;  3FK7 A;  2O61 A;  1RZ4 A;  2NVU B;  4JK1 X;  4XLA A;  1XCB A;  2KJC A;  2L5Q A;  3PL8 A;  2MC3 A;  2PI0 A;  2DMP A;  2LKX A;  4HX4 A;  1R7J A;  2P5K A;  3MEX A;  2XB0 X;  4OIR F;  1MH4 A;  2Z1D A;  1TC3 C;  1YX5 A;  3DU6 A;  4YIR X;  4Z2Y A;  3A2K A;  2LY2 A;  4ESF A;  4YIF A;  4FE4 A;  3TKY A;  1RC9 A;  2DTR A;  2Z5U A;  1YX3 A;  1W0U A;  1WH7 A;  4G7O F;  3NQO A;  1OCZ H;  3IH3 A;  2VOD A;  2AXT C;  2P6S A;  3WG9 A;  2H09 A;  3T0Y A;  1SFU A;  2B9S A;  3Q0V A;  3CCE I;  4E7K A;  2RC4 A;  3HEF A;  4ZC3 A;  2NVY J;  3K4J A;  4JOM A;  5CQG A;  1FT9 A;  2HKO A;  4UVC A;  3CO6 C;  4IHX A;  1BR2 A;  4CH7 A;  3DKX A;  1P4A A;  4F7Z A;  4IO9 F;  2A61 A;  4ENN A;  5B5E C;  1GXQ A;  2CH0 A;  2PQ8 A;  1QVT A;  4XK4 A;  1GUU A;  4D7M A;  1ZGJ A;  4G6Q A;  1D0Y A;  3OYE A;  3KLO A;  2BZT A;  5HLT A;  1U8R A;  4OMY A;  2D5V A;  1I3A A;  3M3Y J;  3ZQC A;  2DU9 A;  4B8X A;  4Q47 A;  2HI3 A;  4I02 A;  2YUS A;  5ILU A;  5LEJ A;  1DGR M;  4LIT A;  5J3L A;  3CCL I;  1YO5 C;  1EA3 A;  3J7Z I;  1HA8 A;  3KZY A;  3GCM A;  5EG0 B;  1Q1V A;  2UXX A;  2V9P A;  3BOQ A;  4XBF A;  1I1S A;  1FWZ A;  2R7V A;  2CU7 A;  2IAI A;  3BTC A;  4G7Z F;  2V1N A;  4A69 C;  4MGR A;  2R5Y B;  1AA7 A;  1B6A A;  5FLM J;  2FUG 2;  1YI2 I;  2OTL I;  2R7S A;  3FM3 A;  3WGH A;  1W36 D;  2DW4 A;  5H20 A;  3KLN A;  3C1D A;  1Q1H A;  3JRE A;  3ONQ A;  1V5G A;  1LVA A;  1P4X A;  4XIC A;  3BR2 A;  2F48 A;  1JUS A;  5EGO B;  1VQP I;  2V7F A;  4PZJ A;  1RR7 A;  4PGH A;  1W7P A;  1XC5 A;  2JSC A;  1OYY A;  2ID6 A;  2R0Q C;  1G3T A;  1QVU A;  4N4O B;  1JKQ C;  3F9K A;  4U0V A;  3FK6 A;  2E1M B;  3BZ6 A;  1D0X A;  2HVS A;  4M6Y A;  4GFB A;  2BEO A;  2VQL A;  1E3H A;  4UV9 A;  4E7L A;  1AKH B;  4UUT A;  1Z7L A;  3W2W A;  4UVA A;  1IDZ A;  5CPR B;  1ZH5 A;  2XAU A;  2K27 A;  1TT0 A;  3QPL A;  3S3N A;  2K9M A;  3NWT A;  1BOA A;  5DEQ A;  2OV7 A;  3F6V A;  2KDZ A;  3CD6 I;  5LFA A;  3JSO A;  4ZZL A;  3GUD A;  2DFH A;  2HKX A;  1UFM A;  1GV5 A;  2JJ7 A;  4M6V A;  4LK0 F;  1VQN I;  3G4S I;  3BJA A;  5JVG F;  3IAS 2;  3N4M A;  1Y6I A;  3CP8 A;  1XMX A;  2BXY A;  3MZH A;  2DN0 A;  3IAM 2;  3DEU A;  3DPU A;  5GAE J;  3I4P A;  3EQL F;  4XLC A;  2E71 A;  2PFB A;  5HDG A;  2W7N A;  4B3A A;  4UUV A;  5FKM A;  2VPR A;  2KMU A;  5DTD A;  1G59 A;  5F0F A;  1IO2 A;  1WQ2 A;  3WTT C;  4E70 A;  4DZP A;  4IEJ A;  4L9T A;  2E1O A;  4AU7 A;  1NTC A;  3BR1 A;  4GCV A;  1SFO J;  3C2G A;  3MMY B;  2FOW A;  4HX8 A;  2HOA A;  4F92 B;  2G0E A;  1MMG A;  3F23 A;  2VBY A;  4GGG A;  4M71 A;  4UXN A;  3K9T A;  1K6Y A;  3KP7 A;  2R7Q A;  1VQ9 I;  3HRM A;  2CS3 A;  2MLG A;  3PNV A;  2YPR A;  1U5T B;  2VC0 A;  5LLQ A;  3FM5 A;  1GV2 A;  3HYI A;  3I54 A;  2W00 A;  4WXD A;  4UY8 I;  5FLX K;  2L7F P;  1A36 A;  3BZC A;  5J4V A;  9ANT A;  4U7D A;  4KA4 A;  2TDX A;  2KFD A;  1UJ8 A;  3CCR I;  4L5E A;  2HNH A;  3HPH A;  1ETQ A;  1FBS A;  4EM1 A;  1R4M B;  3HXL A;  1QZY A;  2PEX A;  2K85 A;  5J6X A;  2X9D A;  5J47 A;  2XRO A;  3RYR A;  3ZMT A;  2ZSI B;  1VQ6 I;  2H8R A;  2CV1 A;  3I5U A;  2ZSH B;  4RB2 C;  1YW7 A;  3WE2 A;  2ADU A;  3K2A A;  2LSO A;  2KZV A;  2RVC A;  1AU7 A;  3DWL E;  2HVQ A;  1YQA A;  1MBJ A;  4HV5 A;  3K69 A;  3J7Y J;  4LLL A;  3BTL A;  4IL6 C;  2QGU A;  1F5T A;  3BG7 A;  2DMN A;  2A5Y B;  3ECO A;  4XNF A;  2ZB9 A;  3LSM A;  3V42 A;  1CF7 B;  4BUP A;  5IOZ A;  3BG9 A;  3S3M A;  4J19 A;  3FIS A;  4O6J A;  1HKQ A;  4P9U A;  1Z6R A;  2V9K A;  2COB A;  4BHC A;  5EZG A;  2GLO A;  1B8I B;  2JT1 A;  4AIH A;  1HC8 A;  2K5C A;  5M3M J;  2L3D A;  2X1E A;  1FOK A;  3ULQ B;  5ILS A;  2WAD A;  1MNM C;  1V5E A;  1JHF A;  3QYE A;  4G12 A;  1YW9 A;  1E2X A;  3OY9 A;  4O3M A;  2M0C A;  3RCO A;  5BNG A;  4XSX F;  5D5U B;  4BNC A;  2IT0 A;  4Y13 A;  1Z05 A;  2QUF A;  3MZ8 A;  4BS9 A;  3L2V A;  1FOW A;  4WXH A;  1HST A;  1W0T A;  3GFM A;  2W82 A;  3F6O A;  2JPC A;  5TJJ A;  1KYZ A;  4ZYH A;  5J1U A;  2HTS A;  3DBL B;  4N4N B;  3TP3 A;  1SVL A;  3FHZ A;  2DXI A;  1IRZ A;  4NDL A;  1MJA A;  3MFK A;  5KHD A;  4JX4 A;  3D1N I;  3CJQ B;  5C4J J;  1HBX G;  2V1D A;  3DEW A;  5DD8 A;  1MDM B;  2PJP A;  2OQR A;  1TT5 B;  3FBI B;  1WJD A;  3M1C A;  1YJN I;  3P9C A;  2HR3 A;  1LQ1 A;  4LB6 B;  3MWM A;  4PCQ A;  3J80 K;  3QQA A;  1R49 A;  4BY1 J;  1R00 A;  1ORK A;  4CUG A;  2O0Y A;  5E8I A;  4KFC A;  3S2D J;  2PJR A;  1BI2 A;  2RN7 A;  3WHB A;  1FMV A;  2OAZ A;  3NWS A;  2LR8 A;  4OAZ A;  3L2Q A;  3ABT A;  4HPQ A;  2LRE A;  4PJM A;  3K10 A;  4LJZ F;  2XAS A;  2MW8 A;  5E1X A;  2LC2 A;  1UMQ A;  1WJ5 A;  4Y3O A;  3BR5 A;  3COA C;  3BT9 A;  1V4R A;  2JTV A;  2QBY A;  1UST A;  1OFC X;  2WAQ A;  3ASN H;  2VOO A;  1KZH A;  2QZ8 A;  4FE7 A;  2ESH A;  2R7R A;  3J80 Z;  1H88 C;  1MMN A;  3M4O J;  2KRH A;  2R3S A;  1W7P D;  4AVP A;  3BJ6 A;  1ONV A;  3WG7 H;  3Q0W A;  3PIO F;  1BJZ A;  2VKV A;  1KQ0 A;  4S0H B;  2DOE A;  1TWG J;  2DA6 A;  1SVO A;  5E1Z B;  1GVD A;  3GXO A;  4P9F A;  2E34 A;  3O8H A;  2HQN A;  2VPL A;  2K9S A;  2KPM A;  5HLI A;  3A01 B;  1ZN2 A;  1FLI A;  4ZZD A;  1QA6 A;  1PDN C;  3OV8 A;  1OQY A;  1X1C A;  3VOE A;  4RS8 A;  2VJJ A;  3O8G A;  2R5Z A;  4IKF A;  2M45 A;  2NS8 A;  2VT2 A;  2BW3 B;  4RLF A;  2KIQ A;  1JE8 A;  3VYS B;  2QQA A;  2XKO A;  1Y1V J;  2IA1 A;  3LSP A;  2IS4 A;  3DQV C;  3ZQI A;  4P96 A;  3ZMS A;  4WK8 F;  3I59 A;  1IUY A;  2LLK A;  3B6A A;  3GFI A;  2PJR B;  2O03 A;  1D5V A;  1IC8 A;  4I09 A;  3WU0 A;  3GFL A;  1GXP A;  3K7A J;  3KYC B;  3U1D A;  1Z91 A;  3CQZ J;  3FXJ A;  1Y0U A;  4MNU A;  3J81 K;  3QOE A;  1LPQ A;  1XSX A;  3ERE D;  3HRT A;  3GTQ J;  1PUE E;  4C3J J;  2ISZ A;  3GTL J;  3CCQ I;  3KFW X;  1O4X A;  5EF6 A;  1ULY A;  2PG4 A;  2DJI A;  2ACJ A;  2W24 A;  2ZJR F;  1Z9C A;  4RBO A;  3KET A;  5E3N A;  4G6T B;  5DM6 F;  3K1M A;  2R7X A;  1TQP A;  5IOY A;  3OL4 A;  3CCJ I;  1ZG1 A;  5F27 A;  2L01 A;  3J81 Z;  2HDC A;  5L3E A;  1R5H A;  3GF2 A;  5GPA A;  1T0F C;  3W6K B;  3LWF A;  1P4W A;  2XAH A;  3TBI A;  4YG2 F;  1NHA A;  4KN4 X;  1BC7 C;  1QRY A;  1X1B A;  2BY0 A;  5LHG A;  1R1T A;  5IYC J;  2NVT J;  2FSW A;  4HLY A;  2ZCW A;  2TRT A;  2Y30 A;  1XCV A;  2ZXJ A;  4ESJ A;  2JQ7 A;  3BP8 A;  1YJ9 I;  1OJL A;  2IGK A;  1LE8 A;  1TW3 A;  3I4M J;  2GA2 A;  1XD7 A;  5B66 C;  3KIO A;  1Z67 A;  4KT5 C;  4KDP A;  4R1H A;  3U21 A;  3ZP5 A;  1WI9 A;  1NG7 A;  2HDW A;  2IA2 A;  2HEO A;  2H27 A;  5BPI A;  3FXQ A;  3BG5 A;  3RKW A;  4YFK F;  4MFD A;  2NAZ A;  1LUJ B;  1D1B A;  2WAQ N;  4LD5 A;  3G1O A;  3H3V K;  2XGD A;  3Q9V A;  1S7O A;  1FPQ A;  4CA0 A;  2KZG A;  3C2H A;  1YJW I;  3CUQ C;  1UEL B;  4BXU A;  2GWR A;  2ELH A;  3F22 A;  1FYM A;  4I0A A;  2ETH A;  4ABZ A;  4CIC A;  2Q1Z B;  3PO3 J;  2O6G E;  1IG7 A;  2M7A A;  4EM0 B;  5M3F J;  2EFW A;  1XSD A;  5GPC A;  2IRF G;  4LG3 A;  4E7H A;  2DPU A;  2QVO A;  3I64 A;  5LBQ A;  4XKC A;  1HLV A;  2QM3 A;  1JI8 A;  4HOB A;  2X6Y A;  3DLA A;  5HVQ C;  4MEX F;  4L18 B;  2YU3 A;  4S04 A;  1KU2 A;  2RGV A;  3A02 A;  2I10 A;  3G73 A;  2OA4 A;  2IGM A;  3CES A;  3E6M A;  3K4N A;  4BQQ A;  3OYI A;  2QYO A;  4F93 B;  2AQE A;  1HF0 A;  1R58 A;  3HOW J;  2STT A;  1K6O A;  3FXM A;  3H35 A;  3LST A;  3OWT A;  1B59 A;  5GP9 A;  2BHY A;  3R60 A;  1LDJ A;  1SD7 A;  2QF7 A;  2HGC A;  4QSH A;  3R6S A;  2KIF A;  1TWH J;  2VQC A;  2RNG A;  5J1Y A;  4BEH A;  1ZRF A;  4PJL A;  1FIA A;  4AIJ A;  4HQM A;  3S14 J;  4ITV A;  1FBQ A;  4GYG A;  2DOA A;  5JR3 A;  3ROU A;  1GVJ A;  2IJL A;  2V6C A;  1VQ4 I;  4LGW A;  2XF7 A;  1SD4 A;  4M3E A;  5L3D A;  1H0M A;  4BXX J;  3I58 A;  5CVV A;  4WWC A;  3RQI A;  1R71 A;  1S5L C;  3S2W A;  3VWB A;  2LRD A;  1OYW A;  4A3C J;  4HNV A;  3ML6 A;  1R1V A;  5IYB J;  4XQF A;  3OYG A;  2MA3 A;  1D3Y A;  3CCS I;  1IRG A;  2XPU A;  2M0M A;  2CFX A;  4M6X A;  2WBM A;  3ASO H;  2DTZ A;  3CDI A;  4D0P A;  1ENH A;  1M1E B;  2A05 A;  3PQJ A;  1BI0 A;  3OSF A;  3Q9S A;  1HCR A;  1WPK A;  3VPR A;  2HOT A;  3JRC A;  2Z16 A;  2GM4 A;  5L3F A;  2A68 F;  2CUE A;  2K7L A;  4XN3 A;  1EKE A;  3AG2 H;  3V8L A;  1H8A C;  2OCC H;  2QCO A;  2QSH X;  1FOX A;  3EUK L;  1IUF A;  2DLL A;  3GVA A;  1IRX A;  3CCV I;  3S15 J;  2LK2 A;  2V4J C;  3PSF A;  2K40 A;  1VQ7 I;  1A31 A;  1ZK8 A;  4HST A;  5DCM B;  3KE2 A;  5GAH J;  4HYE A;  3U1K A;  1J0R A;  3DTI A;  1VTN C;  1LFP A;  1FNN A;  2EA4 A;  4W97 A;  2HZT A;  4A12 A;  4XRF A;  1Z3Y A;  5HDN A;  1Z6T A;  2JMW A;  3OOP A;  3KEQ A;  5LEK A;  3LMM A;  1ZYR F;  1S7E A;  4LG0 A;  1L0O C;  3ZRG A;  2OF7 A;  5E3L A;  4KMF A;  2HS5 A;  4K2E A;  1APL C;  4HAM A;  3BR3 A;  3BTI A;  2R7D A;  1ERD A;  2Z2S B;  1R23 A;  2BY3 A;  1V5F A;  2F4O B;  5ICE A;  4MTD A;  3DKW A;  5D8K B;  5BMZ A;  3B02 A;  3ZGK A;  2XPW A;  4ENM A;  1S8N A;  1E3P A;  1OR7 A;  4CCJ A;  4HDU A;  1YIO A;  1MBH A;  4HW0 A;  3DTK A;  1KQ8 A;  1ITY A;  4GRI A;  3SEQ A;  3OYH A;  1BN5 A;  3S17 J;  4ENK A;  5K7F A;  2BW3 A;  4ZJZ A;  2W48 A;  1JJ6 C;  4OIP F;  5B1B H;  4HSR A;  2UZK A;  1I6X A;  1XGO A;  2LDU A;  3LSJ A;  5LGT A;  4XLH A;  2KRC A;  3AFH A;  3ABK H;  1LB2 A;  3JAM Z;  3TDZ C;  3I4N J;  3M9A A;  3RSN A;  4UUS B;  4XLP F;  5TGT A;  1LEA A;  2BOL A;  1V3F A;  2YX7 A;  1W36 C;  1NK2 P;  4DJA A;  1IN6 A;  2WAE A;  5DUK A;  2DT6 A;  1OR7 C;  2VOP A;  3WTS C;  2CQX A;  1U9N A;  2PX9 A;  5ICG A;  1YG2 A;  4M9S A;  4DW6 A;  1L3L A;  2V9V A;  1NG6 A;  3DU5 A;  2KL4 A;  1I27 A;  5CLS A;  1T95 A;  4AVZ A;  3S93 A;  4OWR B;  3I3L A;  2DQL A;  2X85 A;  2STW A;  4Y4R A;  1WH5 A;  4RB1 A;  4EQQ A;  5FFX A;  3K4M A;  3GX4 X;  1G3W A;  3HKZ A;  1MD0 A;  5J8C A;  1ETX A;  3HUG A;  1S9H A;  4HZF A;  2XAG A;  2ZNY A;  5DDG A;  1GT0 C;  2X0L A;  2RV8 A;  2Y31 A;  1ZEL A;  2CQN A;  2DFE A;  3F3X A;  3V8K A;  1DUX C;  3DCF A;  5HS8 A;  4AC0 A;  1FY7 A;  3CUO A;  3ZQQ A;  3N97 A;  1PVE A;  6PAX A;  4KIG A;  1W5T A;  3TED A;  1RKW A;  2IXS A;  2L02 A;  1F4K A;  3D5R C;  2F5E A;  3H92 A;  3PUB A;  3E5U A;  2M9H A;  3N05 A;  3I59 B;  3PFY A;  1O3Q A;  5KAI C;  2RRE A;  2JZY A;  3HGG A;  4RAF A;  4DZJ A;  3FMS A;  5HDK A;  3WGI A;  1ZAR A;  1XPX A;  1U6G A;  1RRJ A;  4PFP A;  3OIO A;  3CTA A;  1ODD A;  1EV7 A;  1ZLK A;  1HW5 A;  1DU6 A;  4II3 A;  2DA3 A;  1K78 A;  4I99 C;  5FRO A;  1BA5 A;  2CQQ A;  4DIQ A;  3MAJ A;  5EDN A;  4J01 A;  3ZMD A;  2EV0 A;  2CW8 A;  2HWV A;  5AON A;  3BG6 A;  4BKX A;  4RM3 A;  1X4O A;  1XDU A;  2AQF A;  2B7E A;  1I3Q J;  4UB6 C;  4A0X A;  3TO6 A;  4E6K G;  2FQ4 A;  2RQQ A;  1UHS A;  4IHW A;  1SAN A;  1FBU A;  5CVJ A;  2MYS A;  5F1J A;  2H6C A;  3FX3 A;  2E2J J;  3AG1 H;  3OYB A;  4ANJ A;  1OKR A;  2FJ1 A;  3WTU C;  2FBH A;  1RET A;  3G1L A;  2XSD C;  4M3G A;  1RUO A;  2ZXI A;  5CQE A;  4DYQ A;  1TW2 A;  1R9T J;  3P7N A;  2QBY B;  1WJE A;  3L9F A;  2NOG A;  4BGD A;  1D8J A;  2D2W A;  4NNJ A;  2JSP A;  3HRU A;  3ECH A;  4L5J A;  4A3D J;  1I39 A;  4A3B J;  2CQ7 A;  2P81 A;  3ELK A;  4A6D A;  1KYW A;  5F08 A;  2VKE A;  5BOX A;  1Y39 A;  4XRS G;  3SZT A;  3S1R J;  1FOY A;  2CFO A;  1TL8 A;  1YRN A;  3PNT A;  4FQG A;  2HYJ A;  1X3U A;  3HSR A;  2OD5 A;  2KRF A;  2FE3 A;  2XF5 A;  4F52 A;  2EJR A;  1E17 A;  2XAJ A;  2P4W A;  4XSZ F;  3SJM A;  2EPF A;  2ZME A;  4U87 A;  1ZQ3 P;  3RPQ A;  4OIN F;  4B3X A;  3WTV C;  5FFZ A;  5DV5 A;  2QA4 I;  2QEX I;  5D5W B;  4G8X A;  1TWF J;  3RYP A;  5JLX A;  4ETS A;  2UV1 A;  3CCY A;  2VE8 A;  4G9Y A;  3GZ6 A;  3GFJ A;  1KA8 A;  3GZ5 A;  3MD2 A;  2L9N A;  2GQQ A;  4Y33 A;  2EFP A;  2EZI A;  4IJA A;  3VYR B;  4B48 A;  2FF4 A;  3CMM A;  2JA5 J;  3HM5 A;  5JI6 A;  5HS9 A;  1BOB A;  1ZGW A;  1O7L A;  4HF1 A;  4EJV A;  3SXY A;  2YR2 A;  1SC7 A;  4IHY A;  2F4M B;  2OCE A;  4F91 B;  4N0B A;  2ESN A;  1UZC A;  1WZ2 A;  2IS2 A;  1FTT A;  4A3E J;  3C18 A;  2W4S A;  5DCF A;  2E5N A;  3KZI C;  1J75 A;  4MEY F; 
#chains in the Genus database with same CATH homology
 2B7E A;  2K85 A;  2KIS A;  4FQG A;  2KZG A;  2DOF A;  2KIQ A;  2LKS A;  2KFD A;  2L9V A;  2DOE A;  2DOD A;  2CQN A;  1UZC A;  2E71 A;  2JUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...