2B7EA

First ff domain of prp40 yeast protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
GAMEAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Prp40 FF1 domain and its interaction with the crn-TPR1 motif of Clf1 gives a new insight into the binding mode of FF domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords Pre-mRNA processing protein PRP40
total genus 21
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2b7eA00
2KFDA 2DOFA 2E71A 2KZGA 2KISA 2LKSA 2CQNA 1UZCA 2L9VA 2B7EA 2K85A 4FQGA 2KIQA 2DOEA 2DODA 2JUCA
chains in the Genus database with same CATH superfamily
4Y4RA 3U2RA 5D8LB 3VEPA 3E6CC 3S14J 5AONA 2DFIA 4XRSA 3LSKA 4RS8A 2A61A 1G3TA 5FLMJ 3L2UA 1GUUA 1HKTA 2CFXA 3FXLA 5FD6A 4DJAA 3H5AA 3F72A 2RC4A 1MD0A 2BY0A 4NHJA 5J4YA 3SZPA 2LP0A 1IW7F 2L9NA 1MH4A 4CYCB 1VQOI 1TWGJ 1J5YA 2RVCA 3ERMA 3IRQA 4Q5SF 1IGNA 4AC0A 4P96A 5JHFA 2HXIA 3K69A 3A01B 1K4SA 4BHPA 3NWTA 2NVTJ 4M71A 4CCMA 3OY9A 5CJ9A 5D4RA 4UV8A 1QZZA 3CQZJ 1ODDA 4A3EJ 2KIMA 3E6BA 5HOOA 2M4GA 3FMSA 5EZHA 2BHYA 2IGKA 2JN6A 4RAFA 5D4SA 2EB7A 1K83J 1PYVA 4CHUA 2WA0A 1D0ZA 1W0TA 1BW5A 3NEUA 4OIPF 4D5FA 1HW2A 1R1TA 4G7OF 2XPVA 1TNTA 3HPGA 4G9YA 4HLYA 3M1CA 1WH5A 3F22A 2VT3A 4MQVA 3JRBA 4D5CA 2B9SA 3TGNA 5IPAA 2EV5A 1BBYA 1BOBA 2ZO4A 1D1CA 4KICA 2VKDA 5IP9J 1B9MA 2XGEA 3CCEI 3I53A 3P7NA 5D5WB 3RQ4A 4IRHA 2IS4A 1TTYA 1MJAA 2H6BA 1I6XA 3MKYB 2KFDA 1K6YA 1D8KA 5ILSA 1QBJA 4CZZA 3SDGA 3GTMJ 2CFOA 2O3FA 4A3FJ 3FHNA 4QPOA 1ULYA 3F8BA 2QENA 3H3ZA 3GUDA 4F92B 4X0GA 4GCVA 2KZVA 4G6TB 2P81A 4A5NA 4ZZDA 2CV2A 4PGGA 3KP6A 2QQ9A 1J2XA 1I39A 1R22A 2DJNA 2JVHA 2QYOA 2M87A 4QTRA 2X1EA 2XAFA 3ZOBA 1MJBA 3T0YA 2ELJA 1D0XA 5LGUA 3KCCA 3JAMK 2VBXA 4PJMA 4A3BJ 4GYGA 1IRXA 3ERED 2X6WA 3CCQI 1CGPA 3I4MJ 2IPQX 1TWCJ 4JX6A 3LAPA 5HLTA 4DOZA 1FSHA 1KYWA 3C2BA 4M9ZA 2KHMA 3KP3A 3J7ZI 2PJRA 1TQMA 3GTLJ 2FRHA 3FM5A 3T8RA 2VKHA 2Z3YA 1YX3A 1DDNA 1MZBA 2GIZA 2FMYA 4A93J 2QA4I 1SFOJ 1Z0XA 4DW6A 2K3FA 2DI3A 1TL8A 2MC4A 5GPAA 4I01A 2GXBA 4CYCA 4A6EA 4QPQA 4MEYF 4S04A 3OWTA 1IXCA 4BS9A 2PEXA 1IDYA 3EPZA 4J19A 3J7AO 3CESA 2BXYA 1FYLA 3OYAA 3GW2A 2FMLA 3G1OA 2FF4A 3A02A 3BLYA 4FX0A 4M3GA 5JFRA 4G7ZF 5FRNA 2F5DA 1SFKA 2ZNZA 4ANJA 3FF5A 2X85A 2F5EA 4EVIA 3RIRA 1W4MA 2XGXA 5B66C 2CYYA 1MNEA 1O7LA 3ZQGA 2K3PA 3NARA 1XMKA 4N9IA 2BVLA 1ZLKA 1KQ0A 2CV0A 4RMNA 1TP4A 4EJWA 3BPVA 2QSGX 1BW6A 3PO2J 3RDIA 2TRTA 4ZYHA 5EGOA 2R4GA 1LE8A 4LJZF 1U5TA 1QU3A 1YS7A 3VYRB 3HSEA 2JTVA 3BG3A 3BG9A 3CMYA 1ZK8A 1IC8A 2RGVA 1AA7A 3R0AA 2OCEA 3G1MA 3KP5A 2VC0A 1WJDA 2F4MB 3HTUA 2K9QA 1K78A 4IQ4A 1WKMA 5TISC 2PJPA 5M5XJ 3S3MA 4Q4ZF 4ENMA 1BN5A 2IEKA 2QEXI 1TQIA 3OYDA 2Z33A 1EH8A 2Z1DA 3WG9A 3ZXSA 4XMYA 3ZMTA 2HR3A 2EFQA 2HVSA 3LOCA 5EYRA 3KEQA 4EV0A 5K5OA 2M5WA 3WTTC 3V7SA 4WXHA 1D3YA 1X4OA 3BC8A 4HPQA 1G3SA 1RKWA 2KLOA 4PSXA 5KVRA 3OYKA 1P2FA 2VBYA 4M3BA 4BJ5C 3OV8A 4AVPA 2XASA 1S9HA 1IDZA 5EGOB 1J9IA 1MMNA 5FLXK 3FZVA 3A01A 2NOJB 3GF2A 2IGNA 2LH9A 1YW8A 1XSXA 3ZGKA 1S3JA 1MMAA 4EJVA 3ONQA 2LYCA 2BV6A 1U8BA 1SFEA 3BY6A 1L3LA 3F23A 3S32A 5HS8A 3QP5A 4Z6YA 2BHZA 2QQAA 2W57A 2KT0A 4IVNA 4EM1A 4HNVA 5E8GA 1YG2A 3VWBA 4IHYA 4Y15A 5DV5A 3IH2A 4R79A 4HDUA 2XVCA 3GTPJ 4C9YA 4E7IA 1OYYA 2XSJC 1VQKI 1P4XA 2ELHA 2DMUA 2O03A 3K1MA 1RC9A 2FBIA 3TP3A 2Y0MA 3OYHA 4PJNA 3E97A 2EIKH 5B1BH 3TQNA 1BC7C 4U0WA 2HQ5A 1ON2A 4DQ2A 2OC6A 4RGRA 3ECOA 4C2UA 3K4KA 4X1EA 3E6MA 2V4JC 2A05A 5FD5A 3M1EA 4HNTA 2HU9A 2M1BA 3F3XA 3GTQJ 3DU6A 5KHDA 3GCMA 1HW1A 3OS1A 1JI8A 3HOYJ 1QHGA 1RESA 3M8JA 3TBIA 2B7EA 1JT6A 4I0AA 2Y9YA 4Y7NJ 3DWLE 3TMOA 4ZZLA 1QHHD 1XGSA 2ESHA 4XSZF 5K7FA 1X3WB 2E36A 3HGGA 4FQGA 3CDHA 1BI3A 1VQ7I 4K2EA 2STTA 1YTYA 2HWVA 2NVYJ 4OWRB 2M45A 4BUPA 4UB6C 3V4GA 3Q5FA 1Z1DA 2VOPA 1PDNC 5KNLA 3CCMI 1VQ5I 1JGGA 1TWFJ 1XB4A 2CUFA 3LSGA 2GA1A 3KP4A 4XL9A 3TEDA 2HTJA 3S3OA 5DD8A 2L7FP 2P0WA 2Q0OA 4IPAA 3RKXA 3W6KB 3ZR8X 2UWMA 3IC7A 1TNSA 4EATA 3RYPA 1E2XA 3CMEI 2KZGA 4Y52J 3DKXA 5D6EA 3B6AA 5DYMA 4BH9A 5EZGA 5J8FA 1KA8A 1ONVA 2QQBA 1MW7A 3CLOA 3PUBA 4MNUA 4PFPA 1YE9A 2L7MP 2VODA 5CLSA 3EUHC 4FE4A 1U9OA 1A6IA 1CQTA 4LB5A 2OZUA 2VXDA 2RNJA 1W7PA 1BM9A 4ESFA 1T38A 2HOAA 3WTWC 4XOTA 4ETSA 3ABLH 3LL7A 2E1CA 3WTYC 2H09A 2E2JJ 2NS7A 4NDLA 2NVXJ 3IH3A 2W1OA 2GM4A 1RZ4A 1UZCA 1X4PA 2EBIA 3ZQFA 1X2NA 4DZPA 4XRFA 4DBQA 4XIDA 3OYMA 2XAQA 3RTRA 1YW9A 5M3MJ 4Y17A 2XAJA 4A2UA 2E5NA 2XPWA 1AHDP 2KQRA 2KKOA 4GFBA 1TWHJ 1FMVA 2O9LA 1JJ6C 4BBSJ 3C2GA 2MD0A 1OMIA 3R4KA 4L0ZB 3HOZJ 2DOAA 3DLLF 1I1SA 3HRUA 1H8AC 3L2RA 2JQ7A 3ECHA 2A6TA 1A36A 3TO7A 1GT0C 1LFBA 1KQ9A 3VYUB 1Y1WJ 4G12A 1O3RA 1IRGA 5LHHA 1XD7A 2ZJRF 4XLHA 4IHVA 2MH9A 1VI0A 2JRTA 2EV0A 3E0JB 4G94A 2GZWA 5FB2A 3GO5A 3CCYA 3C7JA 1CF7B 1Z6TA 2XF7A 3PM1A 5L3FA 1G3WA 3EYYA 4PJLA 2X6OA 3I64A 3CZ6A 1T39A 5KAIC 4F7ZA 3FMRA 4I99C 1G59A 2ECCA 1ETKA 3LA3A 2DTRA 2V26A 2YX4A 4JOMA 2VUMJ 1P7JA 1RI7A 3K2AA 4LLNA 3BR5A 1VF9A 1B1BA 9ANTA 2RQQA 4E7HA 3VYTB 5K5RA 5H6RA 4B8XA 2XKOA 2ZFUA 2RV8A 4JYKA 5B5EC 3ZQCA 2YPRA 3IHUA 4NC8A 4MIMA 2L01A 2VXZA 1TLHB 2HYJA 4RLFA 5L3CA 2IXSA 4BQAA 4BJTA 1S7OA 1DUXC 3HG9A 3K10A 1LB2A 1DP7P 1XCBA 4XKBA 1NG6A 5E1WA 4C30A 2DMPA 3HOWJ 4BGDA 1VQ8I 5KCMA 1GDTA 1MDMB 4DGWB 1WJBA 3RPQA 2OCCH 3W2WA 3AG1H 1ETWA 4LIUA 3K70C 3I9V2 3O8GA 4KMUX 2MC3A 3KLNA 3P5JA 3ZMZA 4FHTA 5F0CA 2VQCA 3ASNH 4PZJA 1HOMA 4G7HF 5F1JA 4UUTA 5AIPA 3TKYA 2WAQN 1HQCA 4W97A 2HKXA 1R5HA 2Y0SA 1YFHA 2HTSA 1R1VA 1R7JA 3HDDA 4RGUA 1K4TA 1BJZA 1FT9A 5D6FA 3OYFA 1S8NA 3CCJI 2ZNYA 5D5XB 2MSYA 4PUSA 4M3DA 2UXNA 3K1NA 2WY7Q 1IG7A 1ZREA 2EFNA 5F0HA 1XPXA 1IUFA 2OTLI 4DYQA 4NQWB 2R5ZB 3X2QH 2XIGA 2N8GA 5TGTA 2CGPA 2KISA 2H8WA 4XQFA 3H5NA 1Z67A 2L3DA 3MZYA 2H27A 1NTCA 6PAXA 2DOFA 3D1NI 2AXLA 3QAHA 5A2QZ 3BTIA 5FLVA 2CQNA 1JKPC 5J1UA 4KA4A 3HKZA 2BW3A 2M8EA 3HRSA 3CTAA 4L5EA 3TOAA 4F93B 2LK2A 1FJLA 2P5KA 2YUSA 4CO8A 1KONA 2QWWA 3AL0C 4PJ0C 3BJOA 2E35A 3TW6A 1LVAA 3MN2A 2Y69H 2BBYA 3A0HC 2P7VB 1WJFA 4XRMA 3DTIA 3IV5A 4YFKF 4D7NA 5LGTA 4IO9F 4CGZA 1V54H 1BI1A 2XAGA 2HZTA 2FNPA 3HEFA 2L7ZA 4A3CJ 2DTZA 5KK1A 2V79A 4C3JJ 3WU1B 1BL0A 1XCVA 3PNYA 3Q9VA 2L2OA 3RI4A 1XGNA 4OMYA 3JSPA 3M9AA 1X2MA 2X9DA 1I3AA 1D8JA 3PL8A 5IP7J 1YIJI 4A5MA 2PMZA 1ZHFA 1H0MA 3F8NA 1W7PD 1V5GA 2BOLA 1ZLJA 3ZN0A 3N97A 2OU2A 2W85A 5TJJA 2BVMA 1FTTA 1WWXA 1AKHA 4LFUA 1HA8A 2L0KA 3I59B 4RAZA 4C3IJ 2L02A 2RREA 3LSJA 2O8XA 2DFHA 4L9JA 3BWGA 3CJRB 4OIRF 1X1CA 4CZCA 2YS9A 4D1QA 2GOXB 2FBHA 3KE2A 3EUHA 5ED4A 1U78A 4FCYA 3QYEA 3FKIJ 2AHQA 3E1SA 5ILVA 3BZCA 3FXUA 3SYTA 5FJ8J 2C6YA 3EETA 1R5ID 1FP2A 2PX9A 1PP8F 1YRNA 5L3BA 2BY2A 1MBGA 3G1LA 2DYRH 4MO7A 1U6GA 1P7IA 5LLQA 3HOXJ 2DMTA 3K7AJ 2NS8A 2HDWA 1SAUA 4LIVA 2GQQA 5LRSA 3AAFA 2R7XA 2W7NA 1A6QA 2CQXA 2CUZA 4LITA 1T0FA 2R3SA 3F6OA 3WHBA 3I56I 1Y1VJ 1XC5A 2P7CB 1W36C 2CQKA 1J7KA 1IJWC 5FKNA 3F6VA 3SEZA 2DT6A 1V3FA 4CCJA 2HDDA 1RKTA 3A03A 5FKKA 3IL2A 2JA2A 1Y0NA 2ZCWA 1X19A 1RR7A 2XRLA 4M9XA 4MHGA 3HC7A 4O3MA 2R92J 2FQ3A 2IT0A 2WADA 3W3CA 2A3SA 3FDYA 1H88C 1FY7A 1SMYF 1ZAOA 4A12A 2HPMA 1B8IA 2V6EA 3HUGB 4R8HA 2E60A 2JT1A 4ITVA 3PQKA 2NVQJ 4A3LJ 1IO2A 4B47A 2JWTA 4UUVA 1JKQC 1WH7A 2QF7A 5LEKA 1D1BA 4BHBA 2L9RA 1SD7A 5K7HA 1Q1VA 3RQIA 2DQLA 4XLEA 4YRVA 5FO5A 2CU7A 3PNTA 3ZRGA 2UZKA 1W36D 2W25A 2BY1A 1H9GA 1IN6A 1STZA 2HZDA 2YU3A 2LY1A 4KT5C 1A31A 1WGXA 1VFCA 1KU9A 4I76A 1T98A 3BJAA 3ESWB 1T2KA 4OMZA 2AQEA 5J1YA 2PMHA 3WTXC 5ICCA 3O6BB 3JRFA 1Z7LA 3AG2H 3IAM2 2EK5A 1UG0A 2LKXA 3HJEA 3CDLA 3I59A 2EH3A 3GTJJ 3L1PA 2L5QA 5HDNA 2CV1A 2M7AA 3CMAI 3GFIA 1I6HJ 4H4KC 4EGZA 1O3SA 2O6GE 3GFLA 4CCKA 3D5RC 2HQNA 4HQEA 4PCQA 1ZELA 1PJRA 3HSFA 3OIOA 2IBDA 4AU7A 2F5CA 3VOEA 1O3TA 2O8KA 3P9CA 4IHTA 1LPQA 5E17F 4BXXJ 2Z99A 4IOCF 1W5SA 4NC7A 2NOGA 3DLAA 3N05A 3PO3J 4UUSA 1ACIA 4L0YB 2Z5UA 4BY1J 4UVCA 1ENHA 1R5GA 4RM3A 2HQRA 2V1NA 4CDGA 2CUJA 3FWEA 3VYSB 4WWCA 3FBNB 3H9JA 2MA3A 1XSVA 3DTKA 1V5EA 3CJNA 3PUFA 1JTYA 1SVOA 1BI2A 1FEXA 5HLHA 2W00A 2VLAA 1J59A 1IN5A 1Y0UA 3AG3H 3BQYA 3FHZA 1VZ0A 4ENJA 2PI0A 5DTDA 2NS0A 1UCRA 2LBFA 2LY2A 1QRYA 5H6QA 1MMDA 2KP6A 3ZQLA 3MKLA 5GPCA 5AIQA 3RJPA 1XDSA 2DJIA 4O6JA 4AUXA 3LWFA 2EZHA 1OLTA 1OQYA 4IZZA 2PMUA 2ZXJA 1BR1A 4V2GA 1IAWA 1YS6A 4M6YA 4PK4A 3TOBA 4KIGA 1OCRH 1R58A 1K78B 3CC4I 2W48A 2VQGA 5FKOA 4XK4A 2LD5A 2R7ZJ 3BZ6A 1QPIA 2NNYA 3QPSA 1U5TB 1EV7A 2GXGA 5HLGA 4HQMA 1HKSA 2VKEA 1D1AA 4KMFA 2LMDA 2Y30A 1AOYA 3K4BA 3HOTA 4V19K 3MD2A 3G2BA 3U1KA 3J80Z 4ON0A 2CJJA 3MKZA 1I27A 3HKZN 5LGNA 4AIJA 4RGSA 5E3OA 5GAGJ 2M0MA 1KZHA 4B3AA 1TZLA 4IQJA 3BTLA 4PSWA 4YIIA 1S72I 1ZQ3P 1B9NA 2QM3A 1UHWA 1E17A 1F43A 2CQQA 2ISYA 3KFWX 2QKLB 4G6QA 4FISA 3IKTA 1GHCA 2EA4A 3ASOH 4FX4A 4M3FA 2ID6A 1YHQI 2DCEA 2DYSH 1TQPA 4E7JA 2VJ5A 1F9NA 5EDNA 4HOBA 1JUPA 4YFXF 1W1WE 2HOTA 1R23A 4WX9A 2Y9ZA 2KPMA 2V9KA 2M8GX 3B6CA 1JT0A 4FE7A 3NAUA 1WFXA 3ABUA 1GXPA 1R1UA 4QSHA 1KGSA 2OF7A 5FGMA 3HGYA 1K61A 3GZNB 1O57A 4HSTA 4YFNF 1OCCH 1MJ9A 4WF2A 2HVRA 5DCMB 4ZYDA 4L18B 5FRMA 4ZYGA 4UVAA 3DBRB 1Z77A 2YU9J 2VQLA 3K4NA 5J47A 3F8CA 1IV8A 2FX0A 1NG7A 1EH7A 3OIPA 3S15J 4AIKA 1U0JA 4QLCU 1LNWA 5GP9A 4CUGA 2Y48A 1AWCA 3H36A 2Z16A 2Y31A 2R5ZA 1HCRA 4ZTFA 1DP3A 1FTZA 1EKEA 1JUSA 4FETA 2OAZA 4ASNA 3BR6A 2IAIA 4OAYA 5LHIA 3JRHA 5F08A 1YJ9I 3TO6A 3LSPA 2BEOA 4EJOA 2Z2SB 3I71A 2E34A 5CVJA 2QCOA 1BIBA 3FXOA 3VPRA 5M5WJ 4MEXF 5ILUA 3I3LA 5D5UB 4ZH4F 3K4CA 2F6CA 1XTAA 3JRIA 3DKYA 1OCTC 2L54A 2JK3A 2E2HJ 4EEFG 4ZYAA 4EMSA 2RDPA 2CSOA 3EQLF 3QOPA 3ZN1A 3S2HJ 5E1XA 3V7CA 5E3NA 3JRCA 4ZYEA 3E5QA 4O5VA 4UV9A 5HS9A 5GAHJ 5LFAA 2FU4A 2EWNA 4HG2A 4N4NB 2R7DA 4BE2A 2H8RA 3UR3C 3MWMA 3K1PA 5BS6A 1MBKA 5DEQA 3CUQC 1ZG5A 3I55I 1ZGAA 1HSJA 1TW3A 1QNTA 1R71A 3F0CA 1V55H 3K2ZA 1X3UA 1O7FA 3RKQA 5GADJ 4KN4X 3CO6C 2R7RA 3H3UA 2RQPA 1P9QC 5J6XA 3M07A 3LA7A 2QVOA 4IF4A 1Z6RA 2QSFX 3WODF 4I7HA 1WCMJ 3I4NJ 1NHAA 2UV1A 3O2PE 4CCLA 3LSIA 3T5XA 2VC1A 3DXJF 1W5TA 3F8MA 2VE9A 2Y2ZA 2DU9A 4NQWA 2KDOA 1SAXA 2HGCA 3G4SI 5B3SH 3GX4X 4P1WA 1X58A 3J80K 5CQGA 1LFPA 2B63J 2P6TA 1RIOH 3WGGA 2K9NA 4XN3A 1JHHA 1Z91A 4GXOA 1F36A 3DEEA 3BCBA 3PSFA 2D1HA 3HRMA 4KUMA 1IN7A 1FIAA 2Q2EA 2DA1A 3H9QA 3WU0A 2NRAC 3S1MJ 2MG4A 2XAHA 2NYXA 4HNUA 1BIAA 3DU5A 2FJ1A 3C2HA 1B6AA 1YRNB 3V8KA 2OZ6A 3K9TA 2EINH 2HYGD 4RA2A 3BG7A 4D0PA 3BR2A 4I2OA 2K4JA 2JUGA 3K6GA 1Z7UA 4FTHA 3KIOA 3ISPA 3RPUD 2DXIA 2W4SA 1LEBA 2ESNA 2MLGA 3L2VA 2HOEA 3KEOA 1UMQA 2L4MA 1HSTA 2J5PA 2F5VA 2FD5A 2LY9A 2K40A 3J7YJ 2CMPA 3S1RJ 2JSCA 4DYCA 3I0TA 2L9SA 1FYMA 4EJTA 3ABTA 1ETVA 4KNYA 3G6EI 2BYVE 2ICWG 3TW7A 1ETOA 4IRIA 3FIWA 5ICFA 2QZ8A 3DQVC 3L9FA 2X51A 3SQNA 5C4JJ 2OTJI 5CYVA 1FBSA 3FISA 2DPDA 4M3EA 2BW3B 4BBRJ 3TDUC 2VJIA 3JSOA 3CF5F 3OYEA 5HNFA 3O3KA 2AO9A 2PJRB 2Q2EB 2M9HA 3P9KA 2CS3A 2WTEA 4N9HA 3NRVA 1G3YA 5J4VA 3L2QA 3LNQA 1B59A 2IGOA 3E7LA 3N4MA 1GVDA 1S6LA 1WPKA 2LSOA 4XOPA 2R7UA 2IRFG 2R5YB 3JCUC 4KJZA 2P8TA 3H5RA 3AFHA 5EEGA 4R1HA 2VASA 3SFIA 1F4KA 3OS2A 3LFUA 4XKWA 3S8PA 3C18A 5LBQA 1Y39A 1KU7A 2GWRA 4YEJA 1Z3YA 3BTJA 2CW8A 2FE3A 2R0QC 2DQRA 1FBQA 5F64A 3BOQA 4UB8C 1WHUA 1E0EA 2EZLA 2WV1A 4IJAA 1ZG3A 2DFFA 2M0CA 3FMQA 4F91B 4JX5A 3LAJA 1JKRC 2KMUA 3KZZA 2Q8KA 4Q47A 5DM6F 3PIPF 1KU2A 3R0JA 2R5YA 5E3MA 1MDMA 4OIOF 5IT9Z 4MGRA 3WHCA 2ZMEA 5J8CA 1RPWA 3DBLB 5BMZA 4OU0A 4I0BA 1FBUA 4IHXA 3LFKA 1T33A 4EM2A 3WTZA 2XDVA 3CDIA 5K7ZA 1ZYRF 2DT5A 3CCUI 1FYKA 5LEJA 3OYNA 3LSTA 2HXOA 2MGQA 4HDVA 1K6OA 5E79C 4HSRA 3FXRA 2PG4A 2CWEA 2QKMB 3DPLC 1YX5A 2W84A 5CPRB 2ZMEB 2R7VA 5C44J 3BJ6A 3GLXA 5E1ZB 5GTIC 3LA2A 2VN2A 1HF0A 2LVSA 1MIJA 2M3AA 1HKQA 1SANA 4CYDA 1MKMA 1KYZA 2VBWA 4HF0A 5B1AH 2WAQA 1ZGWA 4GYIA 2E1MB 2DMQA 3CJTB 5K5QA 1FPQA 3DPTA 5DCFA 2K85A 4RB2C 4U0VA 4QIWN 5DDGA 1RETA 3H35A 5F27A 3GTKJ 5ERIA 5HLIA 5H2FC 1N25A 1E3OC 1CF7A 4BAYA 2XB5A 2ZSHB 5L3EA 1ITYA 5F1RA 5M5YJ 4L9NA 3OS0A 2XKPA 3EDPA 3G3ZA 3CUQA 4KIBA 2WB1A 2X0LA 4XKCA 5EJCA 4CH7A 4YIRX 4XN0A 1EJ9A 4ZDOA 2XROA 1QVTA 1IRFA 1FLIA 1NK2P 2W82A 3QWLA 5ICGA 1VQ6I 3LSMA 2R7OA 5D5VB 1XSDA 3SXYA 4IHWA 5LRRA 3W2AA 2LKSA 4D9JA 2L7KA 2IGMA 4J01A 2A68F 2VL8A 1JTXA 3QPLA 4CSWA 5C4XJ 1P6RA 2EV6A 2HOSA 2QUFA 1ORKA 1MMGA 2Z9OA 2K5CA 4RDUA 3GTOJ 2E1OA 4YG2F 2DT7B 3GZ6A 4ZTJA 2IW5A 3HIFA 1T95A 2V6CA 5EG0B 1SVMA 1MNMC 4CICA 3DCFA 3P9IA 4A3GJ 4X6AJ 3JTHA 5JLXA 2FBKA 2DK5A 2A07F 4KFCA 2LF8A 5F6FA 4RBOA 2VONA 1R00A 3FXJA 3W2VA 4AWXB 1D0YA 1T6SA 3FXKA 1WI3A 4KITB 2XPUA 3VSKA 1JGSA 2LNBA 4TV7A 4BXFA 4BE1A 4ENNA 1WVRA 3AKZA 4RB0A 1LDJA 3OYLA 4FT8A 1LEAA 4I02A 3VB2A 2GBYA 2H1KA 2D2WA 2GIVA 2P5LC 3Q3SA 5EG0A 3SFZA 4CA0A 1U9NA 4ENKA 2XAUA 3QYFA 2M7BA 5C3EJ 4EM0B 3R6SA 4HX4A 2RKHA 4II2A 4P9UA 1YJNI 3D0SA 2OQRA 2EIMH 4A0YA 3CO7C 4AM3A 2X6YA 1ETYA 1R4MB 1A04A 4Y3OA 1FZPB 3MZ8A 3KYLA 5J3LA 1HXDA 1EA3A 1ZN2A 2ZKZA 3DEUA 2W24A 3C1DA 5E3LA 4HA8A 4OAZA 5LHGA 5A2QK 2XUBA 1ON1A 4WCGA 4EQQA 2O0YA 1E3PA 3OIQA 2HKOA 1VQMI 1M1EB 1SFXA 1SMTA 3JRGA 4IXAA 4U7DA 1LDDA 5TRDA 1HLVA 2HI3A 3PJRA 1SD5A 1MBHA 2WBMA 3HXLA 3OOUA 4XORA 2JA7J 2MYSA 2WWYA 1Y8RB 3ZMVA 3AL0B 1UAAA 4LLGF 3S17J 4BL0B 3SZGA 2A6EF 4N0BA 4IOAF 4LG0B 2QGUA 3ZQHA 4LB6B 3CCLI 3MVPA 1U3EM 2J5OA 5IOYA 5J40A 1N77A 4RM2A 3L2WA 3CD6I 2PN6A 3VFZA 3COAC 3DPUA 1OR7C 4NNJA 1MSEC 2KRCA 3KP2A 2O5RA 3S2WA 2IJLA 3CCSI 1XDUA 3OSFA 3CCRI 3K4LA 2PQ8A 4A3IJ 4HYEA 3DFGA 5JI6A 4E7SA 4BKXA 3SJMA 4KDPA 4MTDA 3IUOA 4JK1X 1X1DA 5JHUA 3JR9A 2FA5A 1Q1HA 2V1DA 1TBXA 2PFBA 4JBAA 5HODA 2HYFA 3OOPA 1IF1A 1G6NA 3JRDA 2EFOA 3BR3A 3CUOA 4UXNA 2GAUA 4I98B 1REPC 2R93J 3ZMDA 1PUFA 2KDZA 3D5SC 2XSDC 2E7XA 2HVQA 2CW7A 4C3HJ 3OL4A 3K4JA 3KYCB 1YO5C 4BQOA 2MABA 3T1BA 2LF7A 5L3GA 1JJ8C 1JXSA 3CLQA 1J75A 3S2DJ 3LQQA 3HUGA 1OYWA 3CP8A 5DUIA 4YIFA 3OMYA 2LTPA 1YITI 3OYGA 2I5UA 2IS1A 4DZJA 1WZ2A 1FX7A 3HOUJ 2K4BA 1GLNA 1J09A 3FX3A 4WXDA 3H0GJ 4MLOA 4BQNA 1V4RA 3RCOA 5D8KB 2HDCA 3H0DA 2FUG2 3T8TA 4HX7A 5JVGF 2KJBA 2JSPA 4ZDPA 4M6XA 1R6RA 4B48A 3JAMZ 2FEZA 3V42A 1DGWY 4NUBA 1O4XA 1TWAJ 3GZ5A 3H3VK 1FMWA 3DTEA 4BXUA 2ZJQF 2HNHA 4A69C 3BG5A 1ZRCA 2GA2A 1X1PA 2X1CA 2KIQA 1S29A 5IOZA 3F9KA 2ZJ2A 4B09A 2V1UA 2HEOA 2EZIA 4M72A 3FBIB 3R61A 3O8HA 2E5ZA 3HPHA 4LOCA 3V8LA 4ZJZA 2VB6A 4UY8I 4DNCA 1U5TC 2VPLA 1WJ5A 2DA3A 3U1DA 4H0EA 2KRHA 3OSGA 1X3ZB 4HF2A 1GV2A 1UHMA 2IVMA 3QPHA 4WK8F 3CCVI 3ABMH 4HBLA 3HHGA 2GOMA 2CRGA 3CUQB 2NVUB 3CMMA 3LMMA 3VSLA 3WTSC 1MMSA 3ZMUA 1XMAA 2LRDA 3QU6A 5CKTA 3L2CA 2QBYA 2IP2A 2NXNB 4PFOA 1X1BA 2HPIA 1WQ2A 3F21A 4KN7X 5DM7F 2P4WA 3E5XA 3OL3A 1IN8A 4S05A 2ELKA 3J81K 4IL6C 2DOEA 1G8XA 2F2EA 5FFXA 2D5VA 3FXQA 1O3QA 1DU6A 3M7GA 1S5LC 2HFHA 2IA2A 2F4OB 1C0WA 3BROA 3NWSA 3ELKA 1OCPA 3K4MA 4LD5A 3WE3A 2K9MA 1GXQA 2DA6A 3WTUC 1QPMA 2DFEA 2FQ4A 2E2IJ 2F4IA 4OOIA 4B1RA 3HTSB 3M4OJ 1DPUA 1QZEA 1YJWI 2JA6J 1YYVA 4A6DA 1B8IB 2FXAA 2ISZA 2BZTA 3RZOJ 3I5UA 2KIUA 4PDKA 4XONA 4E4HA 1IZ1A 4PGHA 3E3VA 3FKJA 3ZQQA 2VKVA 4MTEA 2O7OA 2M34A 4LK0F 2DDAA 3RKYA 3I4PA 4B43A 1LJ9A 4ZC3A 2ME6A 3RSNA 2MW8A 3BTCA 4EJUA 3CF2A 1MBJA 4UUSB 1ZRFA 2D1VA 4LG3A 2LG4A 3MMYB 4L5IA 5HNHA 5JVTA 1QGPA 1ERDA 3JRAA 3CP2A 3KX2A 1I5ZA 1IXRC 1LVKA 2L9VA 2R7FA 1A5JA 4CCOA 2OQGA 4EGYA 3EYIA 4XLPF 3KPHA 4IX7A 1B72A 1SD4A 4L9TA 2ZFWA 3D5LA 2MBFA 4M73A 1MSFC 1T8IA 3QODA 5DS9A 3ZQ7A 1B4AA 4N4OB 1POGA 4GRIA 2LC2A 1ETXA 1UG2A 2OUMA 3FXMA 3IWFA 5HVQC 1WI9A 1BR2A 2XV4S 3GLLA 1T56A 3IAS2 4KYWA 3CJQB 2R7SA 2LKPA 2EFWA 3UKGA 2K86A 3M8EA 3QQAA 5CVRA 1OCOH 2MH2A 3EUAA 2TCTA 2WAFA 2G7HA 4C2TA 2R7QA 5IYDJ 3MQ0A 5BPIA 4HRIA 1T0FC 1KU3A 1Z9CA 1FOKA 1QA6A 2OV7A 3BCAA 3M3YJ 2AQFA 5IP6A 1S7EA 3A0BC 4II3A 1WRJA 1ZGJA 3WG7H 4AD9A 1OCZH 3IKVA 4RB1A 1YQAA 2UXXA 2VOOA 2V1XA 1W7PB 1HBXG 5CVVA 1YIOA 1ZG1A 1UHSA 3KLOA 4CXFA 2G0EA 2DODA 4LGWA 2OBPA 3BG6A 3KYDB 3S1NJ 4MFDA 2EQRA 2R7WA 3Q9SA 4BY7J 2AS5F 3WE2A 4HF1A 1UB9A 2CO5A 2F5FA 3ZP5A 5JR3A 5EEHA 2L4AA 2M30A 3ROUA 1JE8A 3H92A 2LLKA 1BJAA 3QRFF 2JA5J 5M3FJ 3OYCA 5BNGA 4AYBN 2A5YB 1JKOC 3H9GA 3FK7A 2DO7A 4A0ZA 1RUNA 2KIFA 5E20A 1ZR4A 1OISA 1G4DA 1LE8B 1LUJB 1XMXA 3TP0A 3I58A 5IT3A 1K79A 1OKRA 2LFBA 1P92A 5CVIA 2VE8A 3IWZA 4CCNA 4BYYA 1P4AA 2ZJPF 4BE0A 1LKXA 2NAZA 3KZYA 3ABKH 1J0RA 2VJJA 1U2WA 3GEZA 2EILH 2YSRA 1OPCA 2OD5A 1YOVB 2K7LA 4UVBA 4E7ZA 3RPUA 3QOEA 3IH4A 3HL2A 1R4NB 2DA5A 3C3WA 1ZARA 3ZQIA 1ZR2A 1FOYA 1P4WA 2E1MC 3B02A 2CH0A 1QVUA 3WGHA 3A1YA 3REOA 5FFZA 2XF5A 2BY3A 2QSHX 1WSUA 2I8DA 4ESJA 1XGOA 2AXTC 3E5UA 2ACJA 3DV8A 2ZSIB 2EPFA 3CC7I 2VIXA 2P5VA 2XHKA 3GFMA 4HAMA 1Z05A 2DDBA 4XSXF 4RAYA 2LOOA 1DQUA 5IYBJ 1XG1A 3NQOA 4BDZA 1SEUA 3SDBA 3HRTA 1NH3A 2JJ7A 4C2MJ 1F5TA 3G73A 1MH3A 3KZIC 1QO0D 2G9WA 1RUOA 4HV5A 4E7LA 2VT2A 1OR7A 2VBZA 5E18F 2HQAA 1H9TA 2G7UA 2JRMA 2LDUA 3KEYA 4JP0A 2PBIA 3B73A 4LK1F 4P55A 2XGCA 4XNFA 2ME0A 3UNGC 4F3QA 3Q0UA 4I6ZA 1W0UA 4RGXA 1NK3P 3ZMSA 2ADUA 4L5JA 4S0HB 3HB9A 4E7KA 3MCZA 2V9PA 2B0LA 2OA4A 3L00A 2E71A 2NNNA 4QWQA 2EZKA 3LSRA 2DA4A 2COMA 3E6DA 3HM5A 2X1DA 2ZXWH 1PUEE 4JQFA 1XN7A 4M6VA 2ZXHA 1WJCA 2XF6A 2DN0A 1B72B 4W1UA 5K1YA 2MFZA 1EF4A 2O61A 2UUZA 5H20A 4A3KJ 3ML6A 1Y6IA 1G2HA 4F52A 3BT9A 2ZB9A 3GBGA 4E6KG 5HS7A 3A2KA 1YLFA 2M4KA 4XLCA 2Y75A 2ID3A 1APLC 2RAEA 3S3NA 4XBFA 1HDPA 3GFJA 4KIFA 1RR8C 3BR0A 4AIHA 2IS2A 3MEXA 1V5FA 1FSEA 5DCMA 4B44A 1R49A 1BI0A 3LQRA 1Y56A 1F1ZA 3S1QJ 4HW0A 4XM3A 1I3QJ 4U7BA 3WGIA 3HOVJ 4D7MA 5BPDA 3GXOA 4RB3C 1N75A 2VI6A 4U87A 3GYHX 2H94A 1WJEA 3IP4B 3BDDA 1TW2A 4V2FA 1KQ8A 2X48A 3RYRA 4DYRA 4A3DJ 3JTGA 1XX5A 4ABZA 2BGCA 5BOXA 2DW4A 5HDGA 5ICEA 1XS9A 3IRRA 1Z3XA 2K9SA 2RN7A 3M8FA 4XICA 2MD5A 2WV0A 1UELB 3HYIA 3TO9A 2ZMEC 4XRSG 1SD6A 1VQ9I 3SHFA 1FC3A 4U0YA 4HX8A 2D45A 4LMYA 2GXAA 1ZRDA 1R9TJ 2YX7A 5FKLA 2F48A 4FASD 1VQPI 4BACA 2PLYA 3SEQA 1VQ4I 1OFCX 2CUEA 1MBFA 1IXSB 2Q1ZB 3BPXA 4Q48A 1A35A 2EJRA 3BP8A 1HW5A 2IA0A 3PFYA 1H89C 2COBA 4RAGA 5CQEA 4E70A 1DU0A 2XC7A 3R60A 3JREA 4G8XA 1VTNC 4HEA2 1Y8QB 2R7TA 1RRJA 2QBYB 4B3XA 4DIQA 1ZH5A 4XLNF 1D5VA 2A69F 3OYIA 3FM3A 2DPUA 4BEHB 4MQ9F 2FNAA 1JUMA 5EEAA 4RLQA 1IUYA 2FOKA 5F0FA 1FWZA 5HDKA 3Q0WA 5E8IA 2VJ4A 1HC8A 4YELA 4KISA 3BQZA 3PIOF 1DPRA 3EUKL 3ZPLA 3MKWB 2I10A 5FLXZ 1MNDA 1BR4A 3BZKA 3L09A 4U88A 1TC3C 1EH6A 4IHSA 4G6DA 3RKWA 1UJ8A 4BNCA 3HBLA 1FOXA 1ZTRA 2A5WA 4WXCA 1YW7A 1T08B 4Y13A 1SVLA 2QLZA 4BEHA 2V9VA 3G71I 2OJED 2CW0F 5IY5H 1PUFB 4NC6A 3QPTA 4I09A 3MFKA 2V7FA 5IYCJ 1N78A 1UFMA 1BA5A 3WTVC 3LSHA 1BC8C 2JMWA 3V7RA 3PFIA 2VQHA 2X6XA 4HZFA 4F55A 2P6SA 2DLLA 2EIJH 2QQ8A 1VNDA 5F04A 4Z2YA 2VPRA 2K27A 5DUKA 2CQ7A 3S16J 4BU2A 1FOWA 2K02A 2JPBA 1TT5B 3DKWA 2ETHA 1FIPA 1FP1D 2JPCA 1USSA 4M9SA 4UNOA 3WU2C 1IRZA 5KAFC 2E1NA 3QYBA 3S93A 4AYBA 4BQQA 3PQJA 4B4CA 1MGTA 4UHTA 4M74A 3DBHB 2DK8A 1WJAA 3DP7A 3DEWA 3QP6A 4GDFA 1X1AA 2Y0SN 2OPTA 4BDYA 2H6CA 1AU7A 2BXZA 2PMZN 1PVEA 1XGMA 4GO1A 1SFUA 1QZYA 4A3MJ 1LDKB 4NB5A 3SZTA 2DBBA 3KETA 2YR2A 2JA8J 2WAEA 2LR8A 2M2EA 3AG4H 2XRNA 2EA2A 4AVZA 1LFUP 3OR1C 4LG0A 4IRGA 4PJJA 1IN4A 4HV6A 3OYJA 2ZC2A 3TL4X 4J00A 4P5OA 2ZBKA 4BHCA 2DA7A 4ESBA 3OR2C 4AIDA 2GLOA 1RNLA 2FOWA 4P9FA 1IV6A 5DD4A 3Q0VA 3ZCOA 3J81Z 1W5CC 3L7WA 5GTHC 1MBEA 1S7AA 1USTA 4A0XA 3CC2I 2HS5A 3U21A 1BOAA 1AKHB 2H1LA 2DMNA 3K70D 1U8RA 1SC7A 2TDXA 5BQTA 1HDDC 2ECBA 2EFPA 4OIQF 1E3HA 1R36A 4KT6A 2KL4A 1QQIA 1PP7U 5GAEJ 1VQLI 4IKFA 4XKVA 3ULQB 4GGGA 1ZKGA 4L9VA 1OJLA 1GV5A 3J7AY 5FROA 1FNNA 4Y33A 2JZYA 5J1RA 1JHFA 5FKMA 5IT9K 2XB0X 2LBFB 3MAJA 3KP7A 3GTGJ 3U9GA 1GVJA 1I50J 4LLLA 2IS6A 3F8FA 3HSRA 3W6VA 2XGDA 2E7WA 3TDZC 2KRFA 2MLKA 3PNVA 4OINF 3VDXA 2KJCA 3GMEA 4HLXA 1TT0A 4A3JJ 4DBRA 3VODA 4NBQA 3K0LA 2LREA 3GVAA 1YI2I 2E19A 3HHHA 1ETQA 5LD2C 2FSWA 4XLAA 2RNGA 5EF6A 3BR1A 4IEJA 1L0OC 4JX4A 3W6JB 2JVGA 4BJ6C 2A6HF 3I54A 4XR6A 4MFEA 2K9LA 2DAOA 1VQNI 1K7AA 5CVUA 1Z21A 3DF8A 3QU3A 1LQ1A 1D5YA 3GWZA 2STWA 2ZXIA 5JLWA 2JUCA 3HZJA 4XLFA 3OYBA 2WC2A 3MZHA 2CG4A 3H1CA 2IA1A 2WB1N 2X4HA 3PSIA 3RZDJ 1OYIA 4ZDLA 3JW4A 3A4CA 1I1GA 2WY8Q 3FK6A 3HOSA 2DA2A 3V8JA 5L3DA 2BE5F 1DGRM
chains in the Genus database with same CATH topology
2KFDA 2DOFA 2E71A 2KZGA 2KISA 2LKSA 2CQNA 1UZCA 2L9VA 2B7EA 2K85A 4FQGA 2KIQA 2DOEA 2DODA 2JUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFD A;  2DOF A;  2E71 A;  2KZG A;  2KIS A;  2LKS A;  2CQN A;  1UZC A;  2L9V A;  2B7E A;  2K85 A;  4FQG A;  2KIQ A;  2DOE A;  2DOD A;  2JUC A; 
#chains in the Genus database with same CATH topology
 4Y4R A;  3U2R A;  5D8L B;  3VEP A;  3E6C C;  3S14 J;  5AON A;  2DFI A;  4XRS A;  3LSK A;  4RS8 A;  2A61 A;  1G3T A;  5FLM J;  3L2U A;  1GUU A;  1HKT A;  2CFX A;  3FXL A;  5FD6 A;  4DJA A;  3H5A A;  3F72 A;  2RC4 A;  1MD0 A;  2BY0 A;  4NHJ A;  5J4Y A;  3SZP A;  2LP0 A;  1IW7 F;  2L9N A;  1MH4 A;  4CYC B;  1VQO I;  1TWG J;  1J5Y A;  2RVC A;  3ERM A;  3IRQ A;  4Q5S F;  1IGN A;  4AC0 A;  4P96 A;  5JHF A;  2HXI A;  3K69 A;  3A01 B;  1K4S A;  4BHP A;  3NWT A;  2NVT J;  4M71 A;  4CCM A;  3OY9 A;  5CJ9 A;  5D4R A;  4UV8 A;  1QZZ A;  3CQZ J;  1ODD A;  4A3E J;  2KIM A;  3E6B A;  5HOO A;  2M4G A;  3FMS A;  5EZH A;  2BHY A;  2IGK A;  2JN6 A;  4RAF A;  5D4S A;  2EB7 A;  1K83 J;  1PYV A;  4CHU A;  2WA0 A;  1D0Z A;  1W0T A;  1BW5 A;  3NEU A;  4OIP F;  4D5F A;  1HW2 A;  1R1T A;  4G7O F;  2XPV A;  1TNT A;  3HPG A;  4G9Y A;  4HLY A;  3M1C A;  1WH5 A;  3F22 A;  2VT3 A;  4MQV A;  3JRB A;  4D5C A;  2B9S A;  3TGN A;  5IPA A;  2EV5 A;  1BBY A;  1BOB A;  2ZO4 A;  1D1C A;  4KIC A;  2VKD A;  5IP9 J;  1B9M A;  2XGE A;  3CCE I;  3I53 A;  3P7N A;  5D5W B;  3RQ4 A;  4IRH A;  2IS4 A;  1TTY A;  1MJA A;  2H6B A;  1I6X A;  3MKY B;  2KFD A;  1K6Y A;  1D8K A;  5ILS A;  1QBJ A;  4CZZ A;  3SDG A;  3GTM J;  2CFO A;  2O3F A;  4A3F J;  3FHN A;  4QPO A;  1ULY A;  3F8B A;  2QEN A;  3H3Z A;  3GUD A;  4F92 B;  4X0G A;  4GCV A;  2KZV A;  4G6T B;  2P81 A;  4A5N A;  4ZZD A;  2CV2 A;  4PGG A;  3KP6 A;  2QQ9 A;  1J2X A;  1I39 A;  1R22 A;  2DJN A;  2JVH A;  2QYO A;  2M87 A;  4QTR A;  2X1E A;  2XAF A;  3ZOB A;  1MJB A;  3T0Y A;  2ELJ A;  1D0X A;  5LGU A;  3KCC A;  3JAM K;  2VBX A;  4PJM A;  4A3B J;  4GYG A;  1IRX A;  3ERE D;  2X6W A;  3CCQ I;  1CGP A;  3I4M J;  2IPQ X;  1TWC J;  4JX6 A;  3LAP A;  5HLT A;  4DOZ A;  1FSH A;  1KYW A;  3C2B A;  4M9Z A;  2KHM A;  3KP3 A;  3J7Z I;  2PJR A;  1TQM A;  3GTL J;  2FRH A;  3FM5 A;  3T8R A;  2VKH A;  2Z3Y A;  1YX3 A;  1DDN A;  1MZB A;  2GIZ A;  2FMY A;  4A93 J;  2QA4 I;  1SFO J;  1Z0X A;  4DW6 A;  2K3F A;  2DI3 A;  1TL8 A;  2MC4 A;  5GPA A;  4I01 A;  2GXB A;  4CYC A;  4A6E A;  4QPQ A;  4MEY F;  4S04 A;  3OWT A;  1IXC A;  4BS9 A;  2PEX A;  1IDY A;  3EPZ A;  4J19 A;  3J7A O;  3CES A;  2BXY A;  1FYL A;  3OYA A;  3GW2 A;  2FML A;  3G1O A;  2FF4 A;  3A02 A;  3BLY A;  4FX0 A;  4M3G A;  5JFR A;  4G7Z F;  5FRN A;  2F5D A;  1SFK A;  2ZNZ A;  4ANJ A;  3FF5 A;  2X85 A;  2F5E A;  4EVI A;  3RIR A;  1W4M A;  2XGX A;  5B66 C;  2CYY A;  1MNE A;  1O7L A;  3ZQG A;  2K3P A;  3NAR A;  1XMK A;  4N9I A;  2BVL A;  1ZLK A;  1KQ0 A;  2CV0 A;  4RMN A;  1TP4 A;  4EJW A;  3BPV A;  2QSG X;  1BW6 A;  3PO2 J;  3RDI A;  2TRT A;  4ZYH A;  5EGO A;  2R4G A;  1LE8 A;  4LJZ F;  1U5T A;  1QU3 A;  1YS7 A;  3VYR B;  3HSE A;  2JTV A;  3BG3 A;  3BG9 A;  3CMY A;  1ZK8 A;  1IC8 A;  2RGV A;  1AA7 A;  3R0A A;  2OCE A;  3G1M A;  3KP5 A;  2VC0 A;  1WJD A;  2F4M B;  3HTU A;  2K9Q A;  1K78 A;  4IQ4 A;  1WKM A;  5TIS C;  2PJP A;  5M5X J;  3S3M A;  4Q4Z F;  4ENM A;  1BN5 A;  2IEK A;  2QEX I;  1TQI A;  3OYD A;  2Z33 A;  1EH8 A;  2Z1D A;  3WG9 A;  3ZXS A;  4XMY A;  3ZMT A;  2HR3 A;  2EFQ A;  2HVS A;  3LOC A;  5EYR A;  3KEQ A;  4EV0 A;  5K5O A;  2M5W A;  3WTT C;  3V7S A;  4WXH A;  1D3Y A;  1X4O A;  3BC8 A;  4HPQ A;  1G3S A;  1RKW A;  2KLO A;  4PSX A;  5KVR A;  3OYK A;  1P2F A;  2VBY A;  4M3B A;  4BJ5 C;  3OV8 A;  4AVP A;  2XAS A;  1S9H A;  1IDZ A;  5EGO B;  1J9I A;  1MMN A;  5FLX K;  3FZV A;  3A01 A;  2NOJ B;  3GF2 A;  2IGN A;  2LH9 A;  1YW8 A;  1XSX A;  3ZGK A;  1S3J A;  1MMA A;  4EJV A;  3ONQ A;  2LYC A;  2BV6 A;  1U8B A;  1SFE A;  3BY6 A;  1L3L A;  3F23 A;  3S32 A;  5HS8 A;  3QP5 A;  4Z6Y A;  2BHZ A;  2QQA A;  2W57 A;  2KT0 A;  4IVN A;  4EM1 A;  4HNV A;  5E8G A;  1YG2 A;  3VWB A;  4IHY A;  4Y15 A;  5DV5 A;  3IH2 A;  4R79 A;  4HDU A;  2XVC A;  3GTP J;  4C9Y A;  4E7I A;  1OYY A;  2XSJ C;  1VQK I;  1P4X A;  2ELH A;  2DMU A;  2O03 A;  3K1M A;  1RC9 A;  2FBI A;  3TP3 A;  2Y0M A;  3OYH A;  4PJN A;  3E97 A;  2EIK H;  5B1B H;  3TQN A;  1BC7 C;  4U0W A;  2HQ5 A;  1ON2 A;  4DQ2 A;  2OC6 A;  4RGR A;  3ECO A;  4C2U A;  3K4K A;  4X1E A;  3E6M A;  2V4J C;  2A05 A;  5FD5 A;  3M1E A;  4HNT A;  2HU9 A;  2M1B A;  3F3X A;  3GTQ J;  3DU6 A;  5KHD A;  3GCM A;  1HW1 A;  3OS1 A;  1JI8 A;  3HOY J;  1QHG A;  1RES A;  3M8J A;  3TBI A;  2B7E A;  1JT6 A;  4I0A A;  2Y9Y A;  4Y7N J;  3DWL E;  3TMO A;  4ZZL A;  1QHH D;  1XGS A;  2ESH A;  4XSZ F;  5K7F A;  1X3W B;  2E36 A;  3HGG A;  4FQG A;  3CDH A;  1BI3 A;  1VQ7 I;  4K2E A;  2STT A;  1YTY A;  2HWV A;  2NVY J;  4OWR B;  2M45 A;  4BUP A;  4UB6 C;  3V4G A;  3Q5F A;  1Z1D A;  2VOP A;  1PDN C;  5KNL A;  3CCM I;  1VQ5 I;  1JGG A;  1TWF J;  1XB4 A;  2CUF A;  3LSG A;  2GA1 A;  3KP4 A;  4XL9 A;  3TED A;  2HTJ A;  3S3O A;  5DD8 A;  2L7F P;  2P0W A;  2Q0O A;  4IPA A;  3RKX A;  3W6K B;  3ZR8 X;  2UWM A;  3IC7 A;  1TNS A;  4EAT A;  3RYP A;  1E2X A;  3CME I;  2KZG A;  4Y52 J;  3DKX A;  5D6E A;  3B6A A;  5DYM A;  4BH9 A;  5EZG A;  5J8F A;  1KA8 A;  1ONV A;  2QQB A;  1MW7 A;  3CLO A;  3PUB A;  4MNU A;  4PFP A;  1YE9 A;  2L7M P;  2VOD A;  5CLS A;  3EUH C;  4FE4 A;  1U9O A;  1A6I A;  1CQT A;  4LB5 A;  2OZU A;  2VXD A;  2RNJ A;  1W7P A;  1BM9 A;  4ESF A;  1T38 A;  2HOA A;  3WTW C;  4XOT A;  4ETS A;  3ABL H;  3LL7 A;  2E1C A;  3WTY C;  2H09 A;  2E2J J;  2NS7 A;  4NDL A;  2NVX J;  3IH3 A;  2W1O A;  2GM4 A;  1RZ4 A;  1UZC A;  1X4P A;  2EBI A;  3ZQF A;  1X2N A;  4DZP A;  4XRF A;  4DBQ A;  4XID A;  3OYM A;  2XAQ A;  3RTR A;  1YW9 A;  5M3M J;  4Y17 A;  2XAJ A;  4A2U A;  2E5N A;  2XPW A;  1AHD P;  2KQR A;  2KKO A;  4GFB A;  1TWH J;  1FMV A;  2O9L A;  1JJ6 C;  4BBS J;  3C2G A;  2MD0 A;  1OMI A;  3R4K A;  4L0Z B;  3HOZ J;  2DOA A;  3DLL F;  1I1S A;  3HRU A;  1H8A C;  3L2R A;  2JQ7 A;  3ECH A;  2A6T A;  1A36 A;  3TO7 A;  1GT0 C;  1LFB A;  1KQ9 A;  3VYU B;  1Y1W J;  4G12 A;  1O3R A;  1IRG A;  5LHH A;  1XD7 A;  2ZJR F;  4XLH A;  4IHV A;  2MH9 A;  1VI0 A;  2JRT A;  2EV0 A;  3E0J B;  4G94 A;  2GZW A;  5FB2 A;  3GO5 A;  3CCY A;  3C7J A;  1CF7 B;  1Z6T A;  2XF7 A;  3PM1 A;  5L3F A;  1G3W A;  3EYY A;  4PJL A;  2X6O A;  3I64 A;  3CZ6 A;  1T39 A;  5KAI C;  4F7Z A;  3FMR A;  4I99 C;  1G59 A;  2ECC A;  1ETK A;  3LA3 A;  2DTR A;  2V26 A;  2YX4 A;  4JOM A;  2VUM J;  1P7J A;  1RI7 A;  3K2A A;  4LLN A;  3BR5 A;  1VF9 A;  1B1B A;  9ANT A;  2RQQ A;  4E7H A;  3VYT B;  5K5R A;  5H6R A;  4B8X A;  2XKO A;  2ZFU A;  2RV8 A;  4JYK A;  5B5E C;  3ZQC A;  2YPR A;  3IHU A;  4NC8 A;  4MIM A;  2L01 A;  2VXZ A;  1TLH B;  2HYJ A;  4RLF A;  5L3C A;  2IXS A;  4BQA A;  4BJT A;  1S7O A;  1DUX C;  3HG9 A;  3K10 A;  1LB2 A;  1DP7 P;  1XCB A;  4XKB A;  1NG6 A;  5E1W A;  4C30 A;  2DMP A;  3HOW J;  4BGD A;  1VQ8 I;  5KCM A;  1GDT A;  1MDM B;  4DGW B;  1WJB A;  3RPQ A;  2OCC H;  3W2W A;  3AG1 H;  1ETW A;  4LIU A;  3K70 C;  3I9V 2;  3O8G A;  4KMU X;  2MC3 A;  3KLN A;  3P5J A;  3ZMZ A;  4FHT A;  5F0C A;  2VQC A;  3ASN H;  4PZJ A;  1HOM A;  4G7H F;  5F1J A;  4UUT A;  5AIP A;  3TKY A;  2WAQ N;  1HQC A;  4W97 A;  2HKX A;  1R5H A;  2Y0S A;  1YFH A;  2HTS A;  1R1V A;  1R7J A;  3HDD A;  4RGU A;  1K4T A;  1BJZ A;  1FT9 A;  5D6F A;  3OYF A;  1S8N A;  3CCJ I;  2ZNY A;  5D5X B;  2MSY A;  4PUS A;  4M3D A;  2UXN A;  3K1N A;  2WY7 Q;  1IG7 A;  1ZRE A;  2EFN A;  5F0H A;  1XPX A;  1IUF A;  2OTL I;  4DYQ A;  4NQW B;  2R5Z B;  3X2Q H;  2XIG A;  2N8G A;  5TGT A;  2CGP A;  2KIS A;  2H8W A;  4XQF A;  3H5N A;  1Z67 A;  2L3D A;  3MZY A;  2H27 A;  1NTC A;  6PAX A;  2DOF A;  3D1N I;  2AXL A;  3QAH A;  5A2Q Z;  3BTI A;  5FLV A;  2CQN A;  1JKP C;  5J1U A;  4KA4 A;  3HKZ A;  2BW3 A;  2M8E A;  3HRS A;  3CTA A;  4L5E A;  3TOA A;  4F93 B;  2LK2 A;  1FJL A;  2P5K A;  2YUS A;  4CO8 A;  1KON A;  2QWW A;  3AL0 C;  4PJ0 C;  3BJO A;  2E35 A;  3TW6 A;  1LVA A;  3MN2 A;  2Y69 H;  2BBY A;  3A0H C;  2P7V B;  1WJF A;  4XRM A;  3DTI A;  3IV5 A;  4YFK F;  4D7N A;  5LGT A;  4IO9 F;  4CGZ A;  1V54 H;  1BI1 A;  2XAG A;  2HZT A;  2FNP A;  3HEF A;  2L7Z A;  4A3C J;  2DTZ A;  5KK1 A;  2V79 A;  4C3J J;  3WU1 B;  1BL0 A;  1XCV A;  3PNY A;  3Q9V A;  2L2O A;  3RI4 A;  1XGN A;  4OMY A;  3JSP A;  3M9A A;  1X2M A;  2X9D A;  1I3A A;  1D8J A;  3PL8 A;  5IP7 J;  1YIJ I;  4A5M A;  2PMZ A;  1ZHF A;  1H0M A;  3F8N A;  1W7P D;  1V5G A;  2BOL A;  1ZLJ A;  3ZN0 A;  3N97 A;  2OU2 A;  2W85 A;  5TJJ A;  2BVM A;  1FTT A;  1WWX A;  1AKH A;  4LFU A;  1HA8 A;  2L0K A;  3I59 B;  4RAZ A;  4C3I J;  2L02 A;  2RRE A;  3LSJ A;  2O8X A;  2DFH A;  4L9J A;  3BWG A;  3CJR B;  4OIR F;  1X1C A;  4CZC A;  2YS9 A;  4D1Q A;  2GOX B;  2FBH A;  3KE2 A;  3EUH A;  5ED4 A;  1U78 A;  4FCY A;  3QYE A;  3FKI J;  2AHQ A;  3E1S A;  5ILV A;  3BZC A;  3FXU A;  3SYT A;  5FJ8 J;  2C6Y A;  3EET A;  1R5I D;  1FP2 A;  2PX9 A;  1PP8 F;  1YRN A;  5L3B A;  2BY2 A;  1MBG A;  3G1L A;  2DYR H;  4MO7 A;  1U6G A;  1P7I A;  5LLQ A;  3HOX J;  2DMT A;  3K7A J;  2NS8 A;  2HDW A;  1SAU A;  4LIV A;  2GQQ A;  5LRS A;  3AAF A;  2R7X A;  2W7N A;  1A6Q A;  2CQX A;  2CUZ A;  4LIT A;  1T0F A;  2R3S A;  3F6O A;  3WHB A;  3I56 I;  1Y1V J;  1XC5 A;  2P7C B;  1W36 C;  2CQK A;  1J7K A;  1IJW C;  5FKN A;  3F6V A;  3SEZ A;  2DT6 A;  1V3F A;  4CCJ A;  2HDD A;  1RKT A;  3A03 A;  5FKK A;  3IL2 A;  2JA2 A;  1Y0N A;  2ZCW A;  1X19 A;  1RR7 A;  2XRL A;  4M9X A;  4MHG A;  3HC7 A;  4O3M A;  2R92 J;  2FQ3 A;  2IT0 A;  2WAD A;  3W3C A;  2A3S A;  3FDY A;  1H88 C;  1FY7 A;  1SMY F;  1ZAO A;  4A12 A;  2HPM A;  1B8I A;  2V6E A;  3HUG B;  4R8H A;  2E60 A;  2JT1 A;  4ITV A;  3PQK A;  2NVQ J;  4A3L J;  1IO2 A;  4B47 A;  2JWT A;  4UUV A;  1JKQ C;  1WH7 A;  2QF7 A;  5LEK A;  1D1B A;  4BHB A;  2L9R A;  1SD7 A;  5K7H A;  1Q1V A;  3RQI A;  2DQL A;  4XLE A;  4YRV A;  5FO5 A;  2CU7 A;  3PNT A;  3ZRG A;  2UZK A;  1W36 D;  2W25 A;  2BY1 A;  1H9G A;  1IN6 A;  1STZ A;  2HZD A;  2YU3 A;  2LY1 A;  4KT5 C;  1A31 A;  1WGX A;  1VFC A;  1KU9 A;  4I76 A;  1T98 A;  3BJA A;  3ESW B;  1T2K A;  4OMZ A;  2AQE A;  5J1Y A;  2PMH A;  3WTX C;  5ICC A;  3O6B B;  3JRF A;  1Z7L A;  3AG2 H;  3IAM 2;  2EK5 A;  1UG0 A;  2LKX A;  3HJE A;  3CDL A;  3I59 A;  2EH3 A;  3GTJ J;  3L1P A;  2L5Q A;  5HDN A;  2CV1 A;  2M7A A;  3CMA I;  3GFI A;  1I6H J;  4H4K C;  4EGZ A;  1O3S A;  2O6G E;  3GFL A;  4CCK A;  3D5R C;  2HQN A;  4HQE A;  4PCQ A;  1ZEL A;  1PJR A;  3HSF A;  3OIO A;  2IBD A;  4AU7 A;  2F5C A;  3VOE A;  1O3T A;  2O8K A;  3P9C A;  4IHT A;  1LPQ A;  5E17 F;  4BXX J;  2Z99 A;  4IOC F;  1W5S A;  4NC7 A;  2NOG A;  3DLA A;  3N05 A;  3PO3 J;  4UUS A;  1ACI A;  4L0Y B;  2Z5U A;  4BY1 J;  4UVC A;  1ENH A;  1R5G A;  4RM3 A;  2HQR A;  2V1N A;  4CDG A;  2CUJ A;  3FWE A;  3VYS B;  4WWC A;  3FBN B;  3H9J A;  2MA3 A;  1XSV A;  3DTK A;  1V5E A;  3CJN A;  3PUF A;  1JTY A;  1SVO A;  1BI2 A;  1FEX A;  5HLH A;  2W00 A;  2VLA A;  1J59 A;  1IN5 A;  1Y0U A;  3AG3 H;  3BQY A;  3FHZ A;  1VZ0 A;  4ENJ A;  2PI0 A;  5DTD A;  2NS0 A;  1UCR A;  2LBF A;  2LY2 A;  1QRY A;  5H6Q A;  1MMD A;  2KP6 A;  3ZQL A;  3MKL A;  5GPC A;  5AIQ A;  3RJP A;  1XDS A;  2DJI A;  4O6J A;  4AUX A;  3LWF A;  2EZH A;  1OLT A;  1OQY A;  4IZZ A;  2PMU A;  2ZXJ A;  1BR1 A;  4V2G A;  1IAW A;  1YS6 A;  4M6Y A;  4PK4 A;  3TOB A;  4KIG A;  1OCR H;  1R58 A;  1K78 B;  3CC4 I;  2W48 A;  2VQG A;  5FKO A;  4XK4 A;  2LD5 A;  2R7Z J;  3BZ6 A;  1QPI A;  2NNY A;  3QPS A;  1U5T B;  1EV7 A;  2GXG A;  5HLG A;  4HQM A;  1HKS A;  2VKE A;  1D1A A;  4KMF A;  2LMD A;  2Y30 A;  1AOY A;  3K4B A;  3HOT A;  4V19 K;  3MD2 A;  3G2B A;  3U1K A;  3J80 Z;  4ON0 A;  2CJJ A;  3MKZ A;  1I27 A;  3HKZ N;  5LGN A;  4AIJ A;  4RGS A;  5E3O A;  5GAG J;  2M0M A;  1KZH A;  4B3A A;  1TZL A;  4IQJ A;  3BTL A;  4PSW A;  4YII A;  1S72 I;  1ZQ3 P;  1B9N A;  2QM3 A;  1UHW A;  1E17 A;  1F43 A;  2CQQ A;  2ISY A;  3KFW X;  2QKL B;  4G6Q A;  4FIS A;  3IKT A;  1GHC A;  2EA4 A;  3ASO H;  4FX4 A;  4M3F A;  2ID6 A;  1YHQ I;  2DCE A;  2DYS H;  1TQP A;  4E7J A;  2VJ5 A;  1F9N A;  5EDN A;  4HOB A;  1JUP A;  4YFX F;  1W1W E;  2HOT A;  1R23 A;  4WX9 A;  2Y9Z A;  2KPM A;  2V9K A;  2M8G X;  3B6C A;  1JT0 A;  4FE7 A;  3NAU A;  1WFX A;  3ABU A;  1GXP A;  1R1U A;  4QSH A;  1KGS A;  2OF7 A;  5FGM A;  3HGY A;  1K61 A;  3GZN B;  1O57 A;  4HST A;  4YFN F;  1OCC H;  1MJ9 A;  4WF2 A;  2HVR A;  5DCM B;  4ZYD A;  4L18 B;  5FRM A;  4ZYG A;  4UVA A;  3DBR B;  1Z77 A;  2YU9 J;  2VQL A;  3K4N A;  5J47 A;  3F8C A;  1IV8 A;  2FX0 A;  1NG7 A;  1EH7 A;  3OIP A;  3S15 J;  4AIK A;  1U0J A;  4QLC U;  1LNW A;  5GP9 A;  4CUG A;  2Y48 A;  1AWC A;  3H36 A;  2Z16 A;  2Y31 A;  2R5Z A;  1HCR A;  4ZTF A;  1DP3 A;  1FTZ A;  1EKE A;  1JUS A;  4FET A;  2OAZ A;  4ASN A;  3BR6 A;  2IAI A;  4OAY A;  5LHI A;  3JRH A;  5F08 A;  1YJ9 I;  3TO6 A;  3LSP A;  2BEO A;  4EJO A;  2Z2S B;  3I71 A;  2E34 A;  5CVJ A;  2QCO A;  1BIB A;  3FXO A;  3VPR A;  5M5W J;  4MEX F;  5ILU A;  3I3L A;  5D5U B;  4ZH4 F;  3K4C A;  2F6C A;  1XTA A;  3JRI A;  3DKY A;  1OCT C;  2L54 A;  2JK3 A;  2E2H J;  4EEF G;  4ZYA A;  4EMS A;  2RDP A;  2CSO A;  3EQL F;  3QOP A;  3ZN1 A;  3S2H J;  5E1X A;  3V7C A;  5E3N A;  3JRC A;  4ZYE A;  3E5Q A;  4O5V A;  4UV9 A;  5HS9 A;  5GAH J;  5LFA A;  2FU4 A;  2EWN A;  4HG2 A;  4N4N B;  2R7D A;  4BE2 A;  2H8R A;  3UR3 C;  3MWM A;  3K1P A;  5BS6 A;  1MBK A;  5DEQ A;  3CUQ C;  1ZG5 A;  3I55 I;  1ZGA A;  1HSJ A;  1TW3 A;  1QNT A;  1R71 A;  3F0C A;  1V55 H;  3K2Z A;  1X3U A;  1O7F A;  3RKQ A;  5GAD J;  4KN4 X;  3CO6 C;  2R7R A;  3H3U A;  2RQP A;  1P9Q C;  5J6X A;  3M07 A;  3LA7 A;  2QVO A;  4IF4 A;  1Z6R A;  2QSF X;  3WOD F;  4I7H A;  1WCM J;  3I4N J;  1NHA A;  2UV1 A;  3O2P E;  4CCL A;  3LSI A;  3T5X A;  2VC1 A;  3DXJ F;  1W5T A;  3F8M A;  2VE9 A;  2Y2Z A;  2DU9 A;  4NQW A;  2KDO A;  1SAX A;  2HGC A;  3G4S I;  5B3S H;  3GX4 X;  4P1W A;  1X58 A;  3J80 K;  5CQG A;  1LFP A;  2B63 J;  2P6T A;  1RIO H;  3WGG A;  2K9N A;  4XN3 A;  1JHH A;  1Z91 A;  4GXO A;  1F36 A;  3DEE A;  3BCB A;  3PSF A;  2D1H A;  3HRM A;  4KUM A;  1IN7 A;  1FIA A;  2Q2E A;  2DA1 A;  3H9Q A;  3WU0 A;  2NRA C;  3S1M J;  2MG4 A;  2XAH A;  2NYX A;  4HNU A;  1BIA A;  3DU5 A;  2FJ1 A;  3C2H A;  1B6A A;  1YRN B;  3V8K A;  2OZ6 A;  3K9T A;  2EIN H;  2HYG D;  4RA2 A;  3BG7 A;  4D0P A;  3BR2 A;  4I2O A;  2K4J A;  2JUG A;  3K6G A;  1Z7U A;  4FTH A;  3KIO A;  3ISP A;  3RPU D;  2DXI A;  2W4S A;  1LEB A;  2ESN A;  2MLG A;  3L2V A;  2HOE A;  3KEO A;  1UMQ A;  2L4M A;  1HST A;  2J5P A;  2F5V A;  2FD5 A;  2LY9 A;  2K40 A;  3J7Y J;  2CMP A;  3S1R J;  2JSC A;  4DYC A;  3I0T A;  2L9S A;  1FYM A;  4EJT A;  3ABT A;  1ETV A;  4KNY A;  3G6E I;  2BYV E;  2ICW G;  3TW7 A;  1ETO A;  4IRI A;  3FIW A;  5ICF A;  2QZ8 A;  3DQV C;  3L9F A;  2X51 A;  3SQN A;  5C4J J;  2OTJ I;  5CYV A;  1FBS A;  3FIS A;  2DPD A;  4M3E A;  2BW3 B;  4BBR J;  3TDU C;  2VJI A;  3JSO A;  3CF5 F;  3OYE A;  5HNF A;  3O3K A;  2AO9 A;  2PJR B;  2Q2E B;  2M9H A;  3P9K A;  2CS3 A;  2WTE A;  4N9H A;  3NRV A;  1G3Y A;  5J4V A;  3L2Q A;  3LNQ A;  1B59 A;  2IGO A;  3E7L A;  3N4M A;  1GVD A;  1S6L A;  1WPK A;  2LSO A;  4XOP A;  2R7U A;  2IRF G;  2R5Y B;  3JCU C;  4KJZ A;  2P8T A;  3H5R A;  3AFH A;  5EEG A;  4R1H A;  2VAS A;  3SFI A;  1F4K A;  3OS2 A;  3LFU A;  4XKW A;  3S8P A;  3C18 A;  5LBQ A;  1Y39 A;  1KU7 A;  2GWR A;  4YEJ A;  1Z3Y A;  3BTJ A;  2CW8 A;  2FE3 A;  2R0Q C;  2DQR A;  1FBQ A;  5F64 A;  3BOQ A;  4UB8 C;  1WHU A;  1E0E A;  2EZL A;  2WV1 A;  4IJA A;  1ZG3 A;  2DFF A;  2M0C A;  3FMQ A;  4F91 B;  4JX5 A;  3LAJ A;  1JKR C;  2KMU A;  3KZZ A;  2Q8K A;  4Q47 A;  5DM6 F;  3PIP F;  1KU2 A;  3R0J A;  2R5Y A;  5E3M A;  1MDM A;  4OIO F;  5IT9 Z;  4MGR A;  3WHC A;  2ZME A;  5J8C A;  1RPW A;  3DBL B;  5BMZ A;  4OU0 A;  4I0B A;  1FBU A;  4IHX A;  3LFK A;  1T33 A;  4EM2 A;  3WTZ A;  2XDV A;  3CDI A;  5K7Z A;  1ZYR F;  2DT5 A;  3CCU I;  1FYK A;  5LEJ A;  3OYN A;  3LST A;  2HXO A;  2MGQ A;  4HDV A;  1K6O A;  5E79 C;  4HSR A;  3FXR A;  2PG4 A;  2CWE A;  2QKM B;  3DPL C;  1YX5 A;  2W84 A;  5CPR B;  2ZME B;  2R7V A;  5C44 J;  3BJ6 A;  3GLX A;  5E1Z B;  5GTI C;  3LA2 A;  2VN2 A;  1HF0 A;  2LVS A;  1MIJ A;  2M3A A;  1HKQ A;  1SAN A;  4CYD A;  1MKM A;  1KYZ A;  2VBW A;  4HF0 A;  5B1A H;  2WAQ A;  1ZGW A;  4GYI A;  2E1M B;  2DMQ A;  3CJT B;  5K5Q A;  1FPQ A;  3DPT A;  5DCF A;  2K85 A;  4RB2 C;  4U0V A;  4QIW N;  5DDG A;  1RET A;  3H35 A;  5F27 A;  3GTK J;  5ERI A;  5HLI A;  5H2F C;  1N25 A;  1E3O C;  1CF7 A;  4BAY A;  2XB5 A;  2ZSH B;  5L3E A;  1ITY A;  5F1R A;  5M5Y J;  4L9N A;  3OS0 A;  2XKP A;  3EDP A;  3G3Z A;  3CUQ A;  4KIB A;  2WB1 A;  2X0L A;  4XKC A;  5EJC A;  4CH7 A;  4YIR X;  4XN0 A;  1EJ9 A;  4ZDO A;  2XRO A;  1QVT A;  1IRF A;  1FLI A;  1NK2 P;  2W82 A;  3QWL A;  5ICG A;  1VQ6 I;  3LSM A;  2R7O A;  5D5V B;  1XSD A;  3SXY A;  4IHW A;  5LRR A;  3W2A A;  2LKS A;  4D9J A;  2L7K A;  2IGM A;  4J01 A;  2A68 F;  2VL8 A;  1JTX A;  3QPL A;  4CSW A;  5C4X J;  1P6R A;  2EV6 A;  2HOS A;  2QUF A;  1ORK A;  1MMG A;  2Z9O A;  2K5C A;  4RDU A;  3GTO J;  2E1O A;  4YG2 F;  2DT7 B;  3GZ6 A;  4ZTJ A;  2IW5 A;  3HIF A;  1T95 A;  2V6C A;  5EG0 B;  1SVM A;  1MNM C;  4CIC A;  3DCF A;  3P9I A;  4A3G J;  4X6A J;  3JTH A;  5JLX A;  2FBK A;  2DK5 A;  2A07 F;  4KFC A;  2LF8 A;  5F6F A;  4RBO A;  2VON A;  1R00 A;  3FXJ A;  3W2V A;  4AWX B;  1D0Y A;  1T6S A;  3FXK A;  1WI3 A;  4KIT B;  2XPU A;  3VSK A;  1JGS A;  2LNB A;  4TV7 A;  4BXF A;  4BE1 A;  4ENN A;  1WVR A;  3AKZ A;  4RB0 A;  1LDJ A;  3OYL A;  4FT8 A;  1LEA A;  4I02 A;  3VB2 A;  2GBY A;  2H1K A;  2D2W A;  2GIV A;  2P5L C;  3Q3S A;  5EG0 A;  3SFZ A;  4CA0 A;  1U9N A;  4ENK A;  2XAU A;  3QYF A;  2M7B A;  5C3E J;  4EM0 B;  3R6S A;  4HX4 A;  2RKH A;  4II2 A;  4P9U A;  1YJN I;  3D0S A;  2OQR A;  2EIM H;  4A0Y A;  3CO7 C;  4AM3 A;  2X6Y A;  1ETY A;  1R4M B;  1A04 A;  4Y3O A;  1FZP B;  3MZ8 A;  3KYL A;  5J3L A;  1HXD A;  1EA3 A;  1ZN2 A;  2ZKZ A;  3DEU A;  2W24 A;  3C1D A;  5E3L A;  4HA8 A;  4OAZ A;  5LHG A;  5A2Q K;  2XUB A;  1ON1 A;  4WCG A;  4EQQ A;  2O0Y A;  1E3P A;  3OIQ A;  2HKO A;  1VQM I;  1M1E B;  1SFX A;  1SMT A;  3JRG A;  4IXA A;  4U7D A;  1LDD A;  5TRD A;  1HLV A;  2HI3 A;  3PJR A;  1SD5 A;  1MBH A;  2WBM A;  3HXL A;  3OOU A;  4XOR A;  2JA7 J;  2MYS A;  2WWY A;  1Y8R B;  3ZMV A;  3AL0 B;  1UAA A;  4LLG F;  3S17 J;  4BL0 B;  3SZG A;  2A6E F;  4N0B A;  4IOA F;  4LG0 B;  2QGU A;  3ZQH A;  4LB6 B;  3CCL I;  3MVP A;  1U3E M;  2J5O A;  5IOY A;  5J40 A;  1N77 A;  4RM2 A;  3L2W A;  3CD6 I;  2PN6 A;  3VFZ A;  3COA C;  3DPU A;  1OR7 C;  4NNJ A;  1MSE C;  2KRC A;  3KP2 A;  2O5R A;  3S2W A;  2IJL A;  3CCS I;  1XDU A;  3OSF A;  3CCR I;  3K4L A;  2PQ8 A;  4A3I J;  4HYE A;  3DFG A;  5JI6 A;  4E7S A;  4BKX A;  3SJM A;  4KDP A;  4MTD A;  3IUO A;  4JK1 X;  1X1D A;  5JHU A;  3JR9 A;  2FA5 A;  1Q1H A;  2V1D A;  1TBX A;  2PFB A;  4JBA A;  5HOD A;  2HYF A;  3OOP A;  1IF1 A;  1G6N A;  3JRD A;  2EFO A;  3BR3 A;  3CUO A;  4UXN A;  2GAU A;  4I98 B;  1REP C;  2R93 J;  3ZMD A;  1PUF A;  2KDZ A;  3D5S C;  2XSD C;  2E7X A;  2HVQ A;  2CW7 A;  4C3H J;  3OL4 A;  3K4J A;  3KYC B;  1YO5 C;  4BQO A;  2MAB A;  3T1B A;  2LF7 A;  5L3G A;  1JJ8 C;  1JXS A;  3CLQ A;  1J75 A;  3S2D J;  3LQQ A;  3HUG A;  1OYW A;  3CP8 A;  5DUI A;  4YIF A;  3OMY A;  2LTP A;  1YIT I;  3OYG A;  2I5U A;  2IS1 A;  4DZJ A;  1WZ2 A;  1FX7 A;  3HOU J;  2K4B A;  1GLN A;  1J09 A;  3FX3 A;  4WXD A;  3H0G J;  4MLO A;  4BQN A;  1V4R A;  3RCO A;  5D8K B;  2HDC A;  3H0D A;  2FUG 2;  3T8T A;  4HX7 A;  5JVG F;  2KJB A;  2JSP A;  4ZDP A;  4M6X A;  1R6R A;  4B48 A;  3JAM Z;  2FEZ A;  3V42 A;  1DGW Y;  4NUB A;  1O4X A;  1TWA J;  3GZ5 A;  3H3V K;  1FMW A;  3DTE A;  4BXU A;  2ZJQ F;  2HNH A;  4A69 C;  3BG5 A;  1ZRC A;  2GA2 A;  1X1P A;  2X1C A;  2KIQ A;  1S29 A;  5IOZ A;  3F9K A;  2ZJ2 A;  4B09 A;  2V1U A;  2HEO A;  2EZI A;  4M72 A;  3FBI B;  3R61 A;  3O8H A;  2E5Z A;  3HPH A;  4LOC A;  3V8L A;  4ZJZ A;  2VB6 A;  4UY8 I;  4DNC A;  1U5T C;  2VPL A;  1WJ5 A;  2DA3 A;  3U1D A;  4H0E A;  2KRH A;  3OSG A;  1X3Z B;  4HF2 A;  1GV2 A;  1UHM A;  2IVM A;  3QPH A;  4WK8 F;  3CCV I;  3ABM H;  4HBL A;  3HHG A;  2GOM A;  2CRG A;  3CUQ B;  2NVU B;  3CMM A;  3LMM A;  3VSL A;  3WTS C;  1MMS A;  3ZMU A;  1XMA A;  2LRD A;  3QU6 A;  5CKT A;  3L2C A;  2QBY A;  2IP2 A;  2NXN B;  4PFO A;  1X1B A;  2HPI A;  1WQ2 A;  3F21 A;  4KN7 X;  5DM7 F;  2P4W A;  3E5X A;  3OL3 A;  1IN8 A;  4S05 A;  2ELK A;  3J81 K;  4IL6 C;  2DOE A;  1G8X A;  2F2E A;  5FFX A;  2D5V A;  3FXQ A;  1O3Q A;  1DU6 A;  3M7G A;  1S5L C;  2HFH A;  2IA2 A;  2F4O B;  1C0W A;  3BRO A;  3NWS A;  3ELK A;  1OCP A;  3K4M A;  4LD5 A;  3WE3 A;  2K9M A;  1GXQ A;  2DA6 A;  3WTU C;  1QPM A;  2DFE A;  2FQ4 A;  2E2I J;  2F4I A;  4OOI A;  4B1R A;  3HTS B;  3M4O J;  1DPU A;  1QZE A;  1YJW I;  2JA6 J;  1YYV A;  4A6D A;  1B8I B;  2FXA A;  2ISZ A;  2BZT A;  3RZO J;  3I5U A;  2KIU A;  4PDK A;  4XON A;  4E4H A;  1IZ1 A;  4PGH A;  3E3V A;  3FKJ A;  3ZQQ A;  2VKV A;  4MTE A;  2O7O A;  2M34 A;  4LK0 F;  2DDA A;  3RKY A;  3I4P A;  4B43 A;  1LJ9 A;  4ZC3 A;  2ME6 A;  3RSN A;  2MW8 A;  3BTC A;  4EJU A;  3CF2 A;  1MBJ A;  4UUS B;  1ZRF A;  2D1V A;  4LG3 A;  2LG4 A;  3MMY B;  4L5I A;  5HNH A;  5JVT A;  1QGP A;  1ERD A;  3JRA A;  3CP2 A;  3KX2 A;  1I5Z A;  1IXR C;  1LVK A;  2L9V A;  2R7F A;  1A5J A;  4CCO A;  2OQG A;  4EGY A;  3EYI A;  4XLP F;  3KPH A;  4IX7 A;  1B72 A;  1SD4 A;  4L9T A;  2ZFW A;  3D5L A;  2MBF A;  4M73 A;  1MSF C;  1T8I A;  3QOD A;  5DS9 A;  3ZQ7 A;  1B4A A;  4N4O B;  1POG A;  4GRI A;  2LC2 A;  1ETX A;  1UG2 A;  2OUM A;  3FXM A;  3IWF A;  5HVQ C;  1WI9 A;  1BR2 A;  2XV4 S;  3GLL A;  1T56 A;  3IAS 2;  4KYW A;  3CJQ B;  2R7S A;  2LKP A;  2EFW A;  3UKG A;  2K86 A;  3M8E A;  3QQA A;  5CVR A;  1OCO H;  2MH2 A;  3EUA A;  2TCT A;  2WAF A;  2G7H A;  4C2T A;  2R7Q A;  5IYD J;  3MQ0 A;  5BPI A;  4HRI A;  1T0F C;  1KU3 A;  1Z9C A;  1FOK A;  1QA6 A;  2OV7 A;  3BCA A;  3M3Y J;  2AQF A;  5IP6 A;  1S7E A;  3A0B C;  4II3 A;  1WRJ A;  1ZGJ A;  3WG7 H;  4AD9 A;  1OCZ H;  3IKV A;  4RB1 A;  1YQA A;  2UXX A;  2VOO A;  2V1X A;  1W7P B;  1HBX G;  5CVV A;  1YIO A;  1ZG1 A;  1UHS A;  3KLO A;  4CXF A;  2G0E A;  2DOD A;  4LGW A;  2OBP A;  3BG6 A;  3KYD B;  3S1N J;  4MFD A;  2EQR A;  2R7W A;  3Q9S A;  4BY7 J;  2AS5 F;  3WE2 A;  4HF1 A;  1UB9 A;  2CO5 A;  2F5F A;  3ZP5 A;  5JR3 A;  5EEH A;  2L4A A;  2M30 A;  3ROU A;  1JE8 A;  3H92 A;  2LLK A;  1BJA A;  3QRF F;  2JA5 J;  5M3F J;  3OYC A;  5BNG A;  4AYB N;  2A5Y B;  1JKO C;  3H9G A;  3FK7 A;  2DO7 A;  4A0Z A;  1RUN A;  2KIF A;  5E20 A;  1ZR4 A;  1OIS A;  1G4D A;  1LE8 B;  1LUJ B;  1XMX A;  3TP0 A;  3I58 A;  5IT3 A;  1K79 A;  1OKR A;  2LFB A;  1P92 A;  5CVI A;  2VE8 A;  3IWZ A;  4CCN A;  4BYY A;  1P4A A;  2ZJP F;  4BE0 A;  1LKX A;  2NAZ A;  3KZY A;  3ABK H;  1J0R A;  2VJJ A;  1U2W A;  3GEZ A;  2EIL H;  2YSR A;  1OPC A;  2OD5 A;  1YOV B;  2K7L A;  4UVB A;  4E7Z A;  3RPU A;  3QOE A;  3IH4 A;  3HL2 A;  1R4N B;  2DA5 A;  3C3W A;  1ZAR A;  3ZQI A;  1ZR2 A;  1FOY A;  1P4W A;  2E1M C;  3B02 A;  2CH0 A;  1QVU A;  3WGH A;  3A1Y A;  3REO A;  5FFZ A;  2XF5 A;  2BY3 A;  2QSH X;  1WSU A;  2I8D A;  4ESJ A;  1XGO A;  2AXT C;  3E5U A;  2ACJ A;  3DV8 A;  2ZSI B;  2EPF A;  3CC7 I;  2VIX A;  2P5V A;  2XHK A;  3GFM A;  4HAM A;  1Z05 A;  2DDB A;  4XSX F;  4RAY A;  2LOO A;  1DQU A;  5IYB J;  1XG1 A;  3NQO A;  4BDZ A;  1SEU A;  3SDB A;  3HRT A;  1NH3 A;  2JJ7 A;  4C2M J;  1F5T A;  3G73 A;  1MH3 A;  3KZI C;  1QO0 D;  2G9W A;  1RUO A;  4HV5 A;  4E7L A;  2VT2 A;  1OR7 A;  2VBZ A;  5E18 F;  2HQA A;  1H9T A;  2G7U A;  2JRM A;  2LDU A;  3KEY A;  4JP0 A;  2PBI A;  3B73 A;  4LK1 F;  4P55 A;  2XGC A;  4XNF A;  2ME0 A;  3UNG C;  4F3Q A;  3Q0U A;  4I6Z A;  1W0U A;  4RGX A;  1NK3 P;  3ZMS A;  2ADU A;  4L5J A;  4S0H B;  3HB9 A;  4E7K A;  3MCZ A;  2V9P A;  2B0L A;  2OA4 A;  3L00 A;  2E71 A;  2NNN A;  4QWQ A;  2EZK A;  3LSR A;  2DA4 A;  2COM A;  3E6D A;  3HM5 A;  2X1D A;  2ZXW H;  1PUE E;  4JQF A;  1XN7 A;  4M6V A;  2ZXH A;  1WJC A;  2XF6 A;  2DN0 A;  1B72 B;  4W1U A;  5K1Y A;  2MFZ A;  1EF4 A;  2O61 A;  2UUZ A;  5H20 A;  4A3K J;  3ML6 A;  1Y6I A;  1G2H A;  4F52 A;  3BT9 A;  2ZB9 A;  3GBG A;  4E6K G;  5HS7 A;  3A2K A;  1YLF A;  2M4K A;  4XLC A;  2Y75 A;  2ID3 A;  1APL C;  2RAE A;  3S3N A;  4XBF A;  1HDP A;  3GFJ A;  4KIF A;  1RR8 C;  3BR0 A;  4AIH A;  2IS2 A;  3MEX A;  1V5F A;  1FSE A;  5DCM A;  4B44 A;  1R49 A;  1BI0 A;  3LQR A;  1Y56 A;  1F1Z A;  3S1Q J;  4HW0 A;  4XM3 A;  1I3Q J;  4U7B A;  3WGI A;  3HOV J;  4D7M A;  5BPD A;  3GXO A;  4RB3 C;  1N75 A;  2VI6 A;  4U87 A;  3GYH X;  2H94 A;  1WJE A;  3IP4 B;  3BDD A;  1TW2 A;  4V2F A;  1KQ8 A;  2X48 A;  3RYR A;  4DYR A;  4A3D J;  3JTG A;  1XX5 A;  4ABZ A;  2BGC A;  5BOX A;  2DW4 A;  5HDG A;  5ICE A;  1XS9 A;  3IRR A;  1Z3X A;  2K9S A;  2RN7 A;  3M8F A;  4XIC A;  2MD5 A;  2WV0 A;  1UEL B;  3HYI A;  3TO9 A;  2ZME C;  4XRS G;  1SD6 A;  1VQ9 I;  3SHF A;  1FC3 A;  4U0Y A;  4HX8 A;  2D45 A;  4LMY A;  2GXA A;  1ZRD A;  1R9T J;  2YX7 A;  5FKL A;  2F48 A;  4FAS D;  1VQP I;  4BAC A;  2PLY A;  3SEQ A;  1VQ4 I;  1OFC X;  2CUE A;  1MBF A;  1IXS B;  2Q1Z B;  3BPX A;  4Q48 A;  1A35 A;  2EJR A;  3BP8 A;  1HW5 A;  2IA0 A;  3PFY A;  1H89 C;  2COB A;  4RAG A;  5CQE A;  4E70 A;  1DU0 A;  2XC7 A;  3R60 A;  3JRE A;  4G8X A;  1VTN C;  4HEA 2;  1Y8Q B;  2R7T A;  1RRJ A;  2QBY B;  4B3X A;  4DIQ A;  1ZH5 A;  4XLN F;  1D5V A;  2A69 F;  3OYI A;  3FM3 A;  2DPU A;  4BEH B;  4MQ9 F;  2FNA A;  1JUM A;  5EEA A;  4RLQ A;  1IUY A;  2FOK A;  5F0F A;  1FWZ A;  5HDK A;  3Q0W A;  5E8I A;  2VJ4 A;  1HC8 A;  4YEL A;  4KIS A;  3BQZ A;  3PIO F;  1DPR A;  3EUK L;  3ZPL A;  3MKW B;  2I10 A;  5FLX Z;  1MND A;  1BR4 A;  3BZK A;  3L09 A;  4U88 A;  1TC3 C;  1EH6 A;  4IHS A;  4G6D A;  3RKW A;  1UJ8 A;  4BNC A;  3HBL A;  1FOX A;  1ZTR A;  2A5W A;  4WXC A;  1YW7 A;  1T08 B;  4Y13 A;  1SVL A;  2QLZ A;  4BEH A;  2V9V A;  3G71 I;  2OJE D;  2CW0 F;  5IY5 H;  1PUF B;  4NC6 A;  3QPT A;  4I09 A;  3MFK A;  2V7F A;  5IYC J;  1N78 A;  1UFM A;  1BA5 A;  3WTV C;  3LSH A;  1BC8 C;  2JMW A;  3V7R A;  3PFI A;  2VQH A;  2X6X A;  4HZF A;  4F55 A;  2P6S A;  2DLL A;  2EIJ H;  2QQ8 A;  1VND A;  5F04 A;  4Z2Y A;  2VPR A;  2K27 A;  5DUK A;  2CQ7 A;  3S16 J;  4BU2 A;  1FOW A;  2K02 A;  2JPB A;  1TT5 B;  3DKW A;  2ETH A;  1FIP A;  1FP1 D;  2JPC A;  1USS A;  4M9S A;  4UNO A;  3WU2 C;  1IRZ A;  5KAF C;  2E1N A;  3QYB A;  3S93 A;  4AYB A;  4BQQ A;  3PQJ A;  4B4C A;  1MGT A;  4UHT A;  4M74 A;  3DBH B;  2DK8 A;  1WJA A;  3DP7 A;  3DEW A;  3QP6 A;  4GDF A;  1X1A A;  2Y0S N;  2OPT A;  4BDY A;  2H6C A;  1AU7 A;  2BXZ A;  2PMZ N;  1PVE A;  1XGM A;  4GO1 A;  1SFU A;  1QZY A;  4A3M J;  1LDK B;  4NB5 A;  3SZT A;  2DBB A;  3KET A;  2YR2 A;  2JA8 J;  2WAE A;  2LR8 A;  2M2E A;  3AG4 H;  2XRN A;  2EA2 A;  4AVZ A;  1LFU P;  3OR1 C;  4LG0 A;  4IRG A;  4PJJ A;  1IN4 A;  4HV6 A;  3OYJ A;  2ZC2 A;  3TL4 X;  4J00 A;  4P5O A;  2ZBK A;  4BHC A;  2DA7 A;  4ESB A;  3OR2 C;  4AID A;  2GLO A;  1RNL A;  2FOW A;  4P9F A;  1IV6 A;  5DD4 A;  3Q0V A;  3ZCO A;  3J81 Z;  1W5C C;  3L7W A;  5GTH C;  1MBE A;  1S7A A;  1UST A;  4A0X A;  3CC2 I;  2HS5 A;  3U21 A;  1BOA A;  1AKH B;  2H1L A;  2DMN A;  3K70 D;  1U8R A;  1SC7 A;  2TDX A;  5BQT A;  1HDD C;  2ECB A;  2EFP A;  4OIQ F;  1E3H A;  1R36 A;  4KT6 A;  2KL4 A;  1QQI A;  1PP7 U;  5GAE J;  1VQL I;  4IKF A;  4XKV A;  3ULQ B;  4GGG A;  1ZKG A;  4L9V A;  1OJL A;  1GV5 A;  3J7A Y;  5FRO A;  1FNN A;  4Y33 A;  2JZY A;  5J1R A;  1JHF A;  5FKM A;  5IT9 K;  2XB0 X;  2LBF B;  3MAJ A;  3KP7 A;  3GTG J;  3U9G A;  1GVJ A;  1I50 J;  4LLL A;  2IS6 A;  3F8F A;  3HSR A;  3W6V A;  2XGD A;  2E7W A;  3TDZ C;  2KRF A;  2MLK A;  3PNV A;  4OIN F;  3VDX A;  2KJC A;  3GME A;  4HLX A;  1TT0 A;  4A3J J;  4DBR A;  3VOD A;  4NBQ A;  3K0L A;  2LRE A;  3GVA A;  1YI2 I;  2E19 A;  3HHH A;  1ETQ A;  5LD2 C;  2FSW A;  4XLA A;  2RNG A;  5EF6 A;  3BR1 A;  4IEJ A;  1L0O C;  4JX4 A;  3W6J B;  2JVG A;  4BJ6 C;  2A6H F;  3I54 A;  4XR6 A;  4MFE A;  2K9L A;  2DAO A;  1VQN I;  1K7A A;  5CVU A;  1Z21 A;  3DF8 A;  3QU3 A;  1LQ1 A;  1D5Y A;  3GWZ A;  2STW A;  2ZXI A;  5JLW A;  2JUC A;  3HZJ A;  4XLF A;  3OYB A;  2WC2 A;  3MZH A;  2CG4 A;  3H1C A;  2IA1 A;  2WB1 N;  2X4H A;  3PSI A;  3RZD J;  1OYI A;  4ZDL A;  3JW4 A;  3A4C A;  1I1G A;  2WY8 Q;  3FK6 A;  3HOS A;  2DA2 A;  3V8J A;  5L3D A;  2BE5 F;  1DGR M; 
#chains in the Genus database with same CATH homology
 2KFD A;  2DOF A;  2E71 A;  2KZG A;  2KIS A;  2LKS A;  2CQN A;  1UZC A;  2L9V A;  2B7E A;  2K85 A;  4FQG A;  2KIQ A;  2DOE A;  2DOD A;  2JUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...