2B7EA

First ff domain of prp40 yeast protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
b'GAMEAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA processing protein PRP40
publication title The structure of Prp40 FF1 domain and its interaction with the crn-TPR1 motif of Clf1 gives a new insight into the binding mode of FF domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 21
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2b7eA00
2DODA 2JUCA 2KFDA 2KIQA 2KZGA 2L9VA 1UZCA 2CQNA 2K85A 4FQGA 2E71A 2DOEA 2LKSA 2B7EA 2DOFA 2KISA
chains in the Genus database with same CATH superfamily
5H2FC 3VWBA 3GTMJ 2XF7A 3V42A 4M72A 2ZXHA 1XD7A 2UV1A 2EFPA 3F72A 2EZLA 3CC4I 4LD5A 1JGSA 5FKOA 2M8EA 2CG4A 5JVTA 1X2MA 2VKHA 5TGTA 3GTKJ 1MJ9A 2EA2A 3IV5A 5FRMA 2TCTA 3K9TA 2KLOA 3A03A 2DT5A 3BY6A 1FOKA 1HDPA 4BQAA 1O3RA 1DP3A 1W5TA 4E7IA 1VI0A 4KIFA 3IL2A 3O6BB 3I9V2 5BPDA 1OQYA 3O3KA 3U1KA 4FQGA 3HOYJ 1G6NA 3CMMA 2HWVA 3DBRB 4M74A 3F6OA 2ME6A 5KHDA 2R7FA 3HDDA 3OOPA 4NQWA 4B48A 2XV4S 3BR5A 3DU5A 4ZYHA 3L2UA 4ENKA 1QZEA 3ZQCA 4Z6YA 3OR1C 3G2BA 5EG0A 1K4SA 1GV2A 1TP4A 4G8XA 4I98B 4N0BA 1Z67A 4YIIA 4DGWB 2P7CB 3IUOA 3ZQHA 1YFHA 1S9HA 2XB0X 2NS8A 1O57A 3FBNB 4OINF 1ENHA 2Z33A 4JQFA 3RTRA 5FD6A 3QRFF 3J80Z 3SZPA 3KIOA 1DU6A 2FD5A 2F6CA 3CCMI 1WJBA 4NC6A 1A6QA 2KFDA 1Y56A 2EZKA 3ABMH 2XGEA 4UVCA 2HQ5A 3LA7A 3OS1A 1WJDA 5DS9A 2JQ7A 1RUOA 2DFIA 2EWNA 2MA3A 4ESJA 5HDGA 2H1KA 2DA1A 3HJEA 1WRJA 3MKWB 2DPUA 4F91B 3WGIA 2PLYA 3OYEA 2B9SA 3DV8A 4F7ZA 1XCVA 2HOAA 4BY7J 4LG0B 5IT9K 2WBMA 3VOEA 4G6TB 1IZ1A 2LC2A 4F3QA 1BI1A 1BC7C 1ZREA 5J40A 2A6HF 4XBFA 1IUFA 1QZYA 4A6EA 4GDFA 5AIPA 4QLCU 1YS6A 4YIRX 3CC7I 1UG0A 2CUJA 3EUHA 1P9QC 3I0TA 3L9FA 1IRFA 1W36D 4RB3C 2O8KA 1QNTA 1KU9A 1X1BA 2LNBA 1XGSA 3JRCA 2YPRA 1JT6A 4KDPA 2UXXA 5KNLA 1Y39A 2UZKA 3KEOA 3S93A 4RGUA 5F64A 3K4MA 1ZH5A 4ASNA 2EV0A 4IZZA 1N78A 2PJRB 1WJCA 1G3SA 4E6KG 5HLTA 5D5UB 3L2VA 1ZR4A 4ANJA 3COAC 4PZJA 5K7ZA 3L09A 3F23A 1JI8A 4N4NB 3K10A 4EJVA 2K86A 2KPMA 1JJ8C 2QKMB 3S16J 2E35A 4ZDOA 4ZYEA 4G9YA 3LSJA 1RC9A 1AKHA 4XSXF 1FBQA 2X4HA 3MD2A 5H20A 3I3LA 4BGDA 1W1WE 3FKIJ 1SMTA 4U7BA 2EFWA 1MH3A 5EYRA 3FM3A 4JOMA 3A0HC 2DTRA 3KZYA 3H3ZA 1SVOA 2FJ1A 1K6OA 1NHAA 3FKJA 4P9UA 3LSKA 3J7YJ 3PQJA 4LGWA 3JAMK 3BR2A 3K2AA 2DYSH 2XASA 3FF5A 2H6BA 2IT0A 2QENA 1IDYA 4EVIA 1D1CA 2FMYA 3D5LA 2EZIA 3JSPA 2M30A 4CCLA 1KQ9A 2XSDC 2K27A 2A68F 3MFKA 3GBGA 1TQIA 5EEHA 2VBXA 1O3TA 2OQRA 3DPLC 2L9VA 1SFOJ 3CCYA 4C3JJ 3ZQLA 3QODA 3RI4A 1P2FA 3LAJA 1TWHJ 3QOPA 3DXJF 3JREA 3FXKA 1HBXG 1QHGA 4RM3A 4LFUA 2FU4A 4OU0A 1HW1A 3AG4H 3BR1A 4YG2F 5JLWA 2OU2A 2A5YB 3DLAA 3EQLF 3RKYA 4C3HJ 3GFIA 5LGTA 4II2A 1MNEA 4R1HA 2STWA 1UHSA 3R4KA 2LY2A 4IHSA 3TO6A 3CCQI 1FOWA 5E3NA 3B73A 1OYWA 4NUBA 4Y33A 1EH6A 2DMTA 4KIGA 2F5FA 3DFGA 2CV0A 2F4OB 4AC0A 2K9QA 2JA6J 3TOAA 3WU0A 4H0EA 3LSTA 2IBDA 3A0BC 4GRIA 4DZJA 5BMZA 3MVPA 4RAYA 4RB2C 2VL8A 4XLPF 1LE8B 4RBOA 2CQKA 2VJ5A 3TQNA 3GXOA 3ZMVA 3FXUA 4IRHA 1VQ8I 3K4JA 3RSNA 1YS7A 1FY7A 5GAHJ 2EILH 4ZTFA 3MEXA 1XS9A 4CO8A 1U6GA 3KYLA 4PJMA 3WGHA 2ECBA 2DMNA 2HTSA 1HA8A 4XKVA 1KU2A 1KONA 1IC8A 4PFPA 5EEGA 2E2IJ 3JRBA 1K78B 4I01A 3W3CA 1ZRCA 3MWMA 2DA7A 2FNAA 2W24A 3EPZA 4RAZA 3RCOA 3N05A 3DTKA 5IYBJ 3BTJA 5JR3A 2WY7Q 4ITVA 3HL2A 4RB1A 2DA6A 1U5TB 1W7PB 4B8XA 4AVPA 3DKYA 3LSGA 4BBSJ 2DPDA 1HCRA 2R7ZJ 1X58A 1UELB 2V26A 1LUJB 2ELHA 3HSRA 1YRNA 3RZOJ 1ZARA 1IV6A 1CQTA 4LG0A 2WAEA 1ZGWA 4RGXA 2MD5A 4RAGA 4JBAA 5D8LB 2ZB9A 1B4AA 2FOKA 3KP5A 1E3OC 2J5OA 3W6VA 1Y0NA 2H94A 5JLXA 4X1EA 3ONQA 2RKHA 4D0PA 5F0FA 3E97A 2M9HA 4CYCB 3LSIA 4LIUA 2A69F 4HSTA 3PQKA 4D7NA 1F4KA 1ZLKA 4BDYA 4B09A 1NG6A 1RETA 3ABKH 2VOOA 1Y0UA 1YIOA 1MD0A 2RGVA 2ZNYA 5F04A 4AIKA 5LGUA 2BY1A 2ZJPF 2QEXI 4CCMA 1BIBA 2WA0A 3Q0UA 1RR7A 3OYNA 1J09A 2ACJA 2PJRA 1OJLA 5D5XB 2QQ9A 4I7HA 2QYOA 5LHHA 3WU1B 1IUYA 3M07A 4A3CJ 1FZPB 4MNUA 4BE2A 1OR7C 2ZJ2A 2R7XA 1XPXA 1ZAOA 4PFOA 1KQ0A 3NWSA 5DDGA 1OKRA 1XDSA 1TWGJ 3PNVA 1MIJA 4XONA 2FEZA 1F5TA 2KDZA 2EK5A 3BT9A 5FROA 1HQCA 2HR3A 3OL4A 4I02A 5HOOA 4IVNA 5M5YJ 5E3MA 3S8PA 2L9SA 2BZTA 2GOXB 2K4BA 2M4GA 4P1WA 4DOZA 2ZMEC 1FMVA 1LJ9A 3GUDA 4FX4A 1A36A 4UVBA 3WHCA 1IRGA 1WI9A 5E17F 3ERMA 2VPLA 5HLGA 3OIPA 4Z2YA 1C0WA 2LREA 1CGPA 1T2KA 3BDDA 2QLZA 2A07F 4A3IJ 3H5AA 3HB9A 3ECHA 3TDZC 2W00A 1X1PA 4ENMA 5DV5A 4TV7A 3V8JA 2A61A 4RS8A 5J4YA 1EJ9A 2R5YA 2Y9YA 1MMNA 5M5XJ 1G59A 3F6VA 1B8IA 5CLSA 4C3IJ 4C2TA 3Q5FA 4O5VA 1FOYA 5FLVA 1MDMA 2LOOA 4BUPA 3HSEA 4B3AA 3DLLF 4RLQA 4X6AJ 4EJOA 3SYTA 2FQ4A 4A2UA 1R6RA 3Q0WA 2CQXA 4XLFA 1TT0A 1RNLA 1U9NA 2AHQA 4OAZA 3OYIA 4MQ9F 1PDNC 4KMFA 2CW7A 2M3AA 5J1UA 2XKOA 3EUAA 1QQIA 4II3A 1FTTA 4DNCA 1KGSA 2IJLA 5KAIC 1JXSA 2IPQX 1VFCA 5FGMA 1Z05A 5DCMB 2XC7A 2Q2EB 3BPXA 1R00A 3QPSA 2YUSA 4AWXB 3J80K 1T33A 3CCLI 2R7WA 1MJAA 2M34A 2VBZA 3DTIA 4QSHA 1NG7A 1QBJA 5H6RA 1QVTA 1X1DA 1MSEC 2FNPA 3TP3A 2JA7J 2FBIA 1LE8A 5L3CA 3ZRGA 1HF0A 4BDZA 1FWZA 1D1BA 2V79A 2OPTA 2TDXA 2H6CA 5ILVA 4HDVA 2VI6A 4BJ5C 2ELJA 3K4NA 3GZ5A 5GTIC 1V5GA 5TRDA 4HNUA 4IJAA 2NXNB 2ZC2A 3KFWX 4A3JJ 2QM3A 3IRRA 2Z99A 1YE9A 4YELA 5D4SA 2DA3A 1WJAA 3MKZA 4XNFA 1K78A 1P7JA 3F8FA 5F27A 5LRSA 2F5CA 4ZDLA 1BI0A 1R58A 2DCEA 1O7FA 1X19A 2F5VA 1YOVB 2L0KA 3ULQB 2DK8A 3ESWB 1W7PA 4MLOA 4HOBA 1YIJI 2XROA 2XAFA 5KCMA 2R7VA 1GLNA 1VQKI 2M0CA 2RREA 3IH2A 5IOYA 3H35A 1LDDA 1WFXA 3PNYA 5J4VA 2GA2A 2TRTA 3VSKA 5LFAA 2KJBA 3CQZJ 4GYIA 3CCRI 1KU7A 3CDLA 3LFUA 2DQRA 4I2OA 4A3FJ 4CICA 4BQQA 2KIFA 2E7WA 2VUMJ 5TISC 3OR2C 2V9VA 1WJ5A 3IHUA 2XPVA 1BIAA 3SEQA 1V54H 4MTDA 3I54A 3OIOA 2ZKZA 5E20A 2D1HA 3SQNA 4CYCA 4HG2A 1ZELA 1JUSA 3H1CA 3K0LA 2DOAA 2W48A 1OPCA 2G0EA 3BPVA 5GTHC 1K79A 2KISA 2L02A 1YJWI 2A3SA 2DMQA 4E7KA 3F22A 1Z91A 5GADJ 3MZYA 4MEXF 1LVKA 2BXZA 1R4NB 2RC4A 1HKTA 4XM3A 1IV8A 5CVVA 5EJCA 1BC8C 3K1NA 1FIPA 3JTGA 3CC2I 2EQRA 1W5CC 1KU3A 4BHPA 3AAFA 1X4OA 2STTA 5H6QA 2E1NA 2JSPA 5CQEA 2WV1A 1A31A 3BQZA 4N9HA 3WTTC 4A3MJ 1SANA 2R3SA 4UV8A 2F4IA 4MIMA 3MCZA 1POGA 3HOSA 3FZVA 1FBSA 3QPTA 5HODA 2MFZA 1ACIA 4B43A 1IRZA 1E17A 4AD9A 4S04A 2ZJRF 2BY0A 2E34A 2W1OA 2Z5UA 3RDIA 5LHGA 3PUFA 3RPQA 2XF5A 2MABA 3JRHA 2JRMA 2VB6A 3GFLA 1B1BA 1XSVA 3LWFA 5JFRA 3ABLH 4FCYA 1JGGA 1YI2I 2WB1A 3T1BA 4S05A 4UUTA 5L3DA 1MMDA 2L4MA 1HLVA 4UV9A 3NAUA 3ZMTA 3P5JA 1VQNI 1SD7A 2MH2A 4LIVA 3AG3H 1JJ6C 3G73A 1GV5A 2E2HJ 4PSXA 3LFKA 2LF8A 5J3LA 1IG7A 2LSOA 3M1EA 4FHTA 3GTLJ 1MMAA 2V6EA 1S29A 2VE9A 4IRGA 5EF6A 3ZQ7A 2EZHA 2ID3A 1N77A 4DJAA 2BVLA 5B1AH 2O9LA 4L18B 1Z6RA 3BJOA 5BPIA 1XMAA 1HKQA 3FXLA 1Z3XA 1ETYA 1FSEA 3DEWA 4L9NA 2HZTA 2VODA 3HC7A 5DCMA 2Q2EA 4BACA 3IRQA 1R23A 4P9FA 5FFXA 1QGPA 4DBRA 4DQ2A 4CGZA 1UB9A 1STZA 1ZN2A 2QCOA 2XAJA 4L5JA 4NC7A 4HLYA 4RA2A 3QP6A 1ETXA 4HDUA 5D5WB 5L3EA 4PGHA 1PUEE 4BY1J 5ICGA 1M1EB 2YU9J 3RKQA 4IF4A 4A3GJ 4AIJA 2BY3A 3RKWA 2VN2A 1R5HA 2VQGA 2XKPA 4L0ZB 3HUGA 3V7CA 5HS9A 3M3YJ 3IH4A 4UB8C 4A6DA 4D7MA 2LKSA 1DPUA 5CKTA 3LSRA 2K5CA 1VTNC 3HEFA 1Q1HA 2IGMA 2ZMEB 2XAQA 3G4SI 3DF8A 1R4MB 1WJEA 4E7SA 1S3JA 3RQIA 3VPRA 2BW3B 2HKOA 3QOEA 3P9KA 2LKPA 2CWEA 1BN5A 1IN5A 2P7VB 4RM2A 2CW0F 4XLHA 3WGGA 4CYDA 1IN7A 2E1OA 2YSRA 3RZDJ 1ODDA 2M87A 3V8LA 3NEUA 4HF1A 1LVAA 3M7GA 3SHFA 3OS0A 4IHYA 2K3FA 1BJAA 1RIOH 1EF4A 1V4RA 2XGXA 5J1YA 2W7NA 3H3VK 1N25A 1NK2P 3KCCA 3HOVJ 3GLLA 3K4CA 1PVEA 4ESBA 3KPHA 1W7PD 2XRNA 1TTYA 1I3AA 1OFCX 3EYYA 5D5VB 2EFOA 2PEXA 2CUFA 1LB2A 1XGNA 1QVUA 5AIQA 3CCVI 1HOMA 3GTPJ 2GWRA 3K4BA 2HU9A 2EIKH 4XLCA 1WH7A 3HXLA 2KKOA 1K7AA 3ZCOA 3KP7A 3J81Z 3HOUJ 4YRVA 2R7RA 2DA5A 3L2QA 4L0YB 3MKLA 2JJ7A 3FK7A 2EJRA 4NB5A 2HYJA 5JHUA 1RUNA 1IXRC 2CFOA 4CCKA 2K02A 2DLLA 4M6VA 1IN6A 4G94A 3DPTA 2HZDA 4CUGA 4DZPA 3FXOA 2L4AA 1H89C 2JPCA 3LSPA 1V5FA 3HZJA 2X51A 5C4JJ 1LNWA 4G7ZF 1H0MA 1R9TJ 4E7JA 2O5RA 4M9XA 1H9TA 3WTUC 2CGPA 2LY9A 4ZH4F 2VBYA 2CMPA 3DQVC 5FO5A 2LD5A 4HNTA 2OF7A 4PDKA 1FYKA 4Q47A 4MTEA 1S7OA 1MBJA 3OYJA 1D3YA 1D0XA 3KP4A 2D2WA 5HS8A 1KA8A 2X1DA 5A2QZ 2EBIA 1LQ1A 1XSDA 3PJRA 3DEEA 1RKTA 1FT9A 5J8FA 5ICCA 3BCBA 3M8EA 2KRHA 1A6IA 1FP2A 1XX5A 2ZXIA 3QYBA 2V7FA 1JHFA 2Y31A 2VKEA 2CUZA 3BZ6A 2P5LC 2ZSHB 3A02A 1W0TA 2HPIA 2NOGA 4FE7A 5HDKA 5ED4A 5AONA 2DOEA 2VQCA 3S14J 4UNOA 2M2EA 2YR2A 3D1NI 4EATA 3SDGA 3TDUC 4KISA 1BA5A 3KP2A 2EFNA 2BHZA 2OQGA 3JTHA 2JUGA 5F1RA 2ZFUA 1I50J 1KYZA 1Z7UA 1D1AA 3W2VA 3GO5A 5DM7F 2DA4A 3IC7A 2XF6A 1HKSA 2Z9OA 1ZG5A 3I56I 5E1ZB 2NVQJ 2MG4A 4HX7A 3S17J 4JX5A 4B1RA 4EJTA 4O6JA 4NHJA 1AWCA 2KZGA 2KMUA 1NK3P 2IW5A 1MBEA 3V7SA 2NYXA 2LMDA 1G2HA 2RDPA 2A6EF 4QTRA 4FISA 3LA3A 2XAHA 1FLIA 1T6SA 3IAS2 2LP0A 2DXIA 5IP6A 4XLEA 4M3DA 3CCJI 5CPRB 1ZGAA 4BJTA 3I71A 2D1VA 2EIJH 1HC8A 1I39A 2BYVE 3RKXA 2QBYB 4OIQF 3GWZA 5J6XA 2CQNA 2Q0OA 3E5UA 1B72B 3ABUA 3BTIA 4E7HA 2VKDA 2JA5J 1ONVA 5B5EC 3ZP5A 5HS7A 3F8CA 4OMYA 2O6GE 3JRDA 3T0YA 2ETHA 2ZMEA 2M0MA 2Y48A 4U88A 2LFBA 4U0YA 1FP1D 3OSFA 5BNGA 2BW3A 4N9IA 5EZGA 2ECCA 3FXRA 4V19K 3AL0B 2WC2A 1S7EA 5HLHA 5JVGF 4JP0A 4AIDA 2IAIA 4PJNA 2KL4A 4HSRA 2AO9A 2X48A 4EV0A 1Z0XA 3GF2A 5FKKA 4YIFA 2QZ8A 1P4XA 2GM4A 5E79C 2HVSA 1IN4A 4A3DJ 3Q9SA 1TWCJ 2R0QC 2W25A 4L9JA 2PI0A 1SFKA 4MFEA 1XSXA 2ME0A 4G6QA 4KT6A 5ILSA 5K5QA 3LSHA 5LHIA 4YFKF 2L9RA 3OYCA 4I6ZA 2COMA 2E36A 3BTLA 3FM5A 1IXSB 3OYAA 5E8IA 3L00A 1J0RA 3BQYA 2OUMA 2Y0SN 2R7DA 5DD4A 1ZRFA 5K7FA 2IA2A 1BBYA 2RN7A 3EUKL 2I10A 4NC8A 1S72I 3ZOBA 1SD4A 4BJ6C 1PP7U 1IDZA 2FQ3A 3PIPF 2JA2A 1AHDP 2V9KA 1Z21A 2W57A 4XOPA 2VQLA 4CHUA 1K4TA 2DMUA 2DMPA 5EZHA 3DKXA 2HGCA 1A04A 1OCOH 3S1QJ 2WADA 1ERDA 1QO0D 2RQPA 3VYUB 3ABTA 2VC0A 1GT0C 2DA2A 2DN0A 3GFJA 4A12A 1LFBA 1I27A 3FMQA 1LEBA 2PMZN 2XUBA 2PQ8A 3OY9A 1FNNA 1AA7A 4L9VA 3N97A 4M3EA 1R49A 5IYCJ 3KEYA 2K4JA 3GEZA 3I55I 4DW6A 1ZR2A 2COBA 3K4LA 2GA1A 1IN8A 3K70C 2AXLA 1JKPC 1T0FA 3HM5A 3TOBA 4AVZA 2HVQA 4RLFA 2C6YA 3SFIA 1OCZH 1RI7A 1XN7A 1PP8F 1TL8A 1JE8A 1SFUA 1R71A 2BVMA 2IS4A 2WTEA 2ZO4A 1U9OA 1W4MA 1GXQA 2W4SA 2X6YA 3DWLE 3LL7A 1H88C 1ZYRF 1YW8A 2DU9A 1FTZA 1RESA 4KMUX 3HRMA 3PM1A 1KZHA 4BNCA 2HXIA 3IKTA 4BYYA 3S1RJ 3WU2C 5DEQA 3CP8A 4Y15A 1VQ4I 4KN4X 2V1DA 1WSUA 1XC5A 5J1RA 2R4GA 3WTZA 3R60A 1ETKA 1P4AA 1BI3A 5LEKA 2XHKA 1Y6IA 3GTGJ 1Z7LA 3DU6A 2X85A 4JYKA 2ESNA 1DP7P 1WH5A 2JT1A 1P4WA 3TW6A 1GXPA 4A0XA 3E5QA 4EQQA 1XG1A 3CF5F 1LKXA 2RNJA 2NVXJ 3HRUA 3IWFA 5FJ8J 5B1BH 5DUIA 4UY8I 4RDUA 2IS2A 2PMUA 2KIMA 3HSFA 3WTSC 3G1OA 3W6JB 1U8BA 4C2UA 4PJ0C 4YEJA 1RPWA 1WWXA 3MAJA 4CCNA 2E5NA 3ZMZA 1Q1VA 3KYCB 4Y17A 2I5UA 3ML6A 2LY1A 3LNQA 2EV5A 1ZK8A 5CYVA 5LGNA 4A3BJ 3E3VA 2X6XA 4BHCA 2OJED 2DK5A 3R0JA 2B7EA 2JA8J 5ICEA 3ZGKA 3ISPA 3FBIB 2BEOA 1P7IA 5K5RA 1ZGJA 3FHZA 1B9MA 3KX2A 5FLXZ 4WK8F 1B72A 3HBLA 5KK1A 4ABZA 4PJLA 3NQOA 3S2WA 4AIHA 1WHUA 4A3EJ 5D8KB 2DFFA 2HOEA 2IS6A 3HIFA 3LA2A 1UMQA 4WXDA 1BW5A 3UR3C 3CCUI 2MC3A 4BL0B 3MZHA 2VT3A 4XN0A 1R22A 4XL9A 1YYVA 3JRGA 1QPIA 4GGGA 1WVRA 2K9SA 2HS5A 2ZFWA 3WODF 3L1PA 1ON2A 4HBLA 4Q5SF 3GW2A 2HOSA 2X6WA 2RQQA 4IEJA 3PO2J 4XSZF 4A5NA 2VXZA 4P55A 3PNTA 2DBBA 3L2RA 5C3EJ 4A3LJ 4I0AA 3CZ6A 5TJJA 1Z9CA 3J81K 3GTQJ 1JUMA 2L5QA 4Q48A 1G3YA 3L2CA 1O3QA 3VEPA 2V1UA 3VDXA 1UCRA 3I58A 2LF7A 1YITI 2A5WA 2GXBA 1K6YA 1QHHD 3FXQA 1T38A 1TQMA 2MW8A 5F1JA 4FTHA 4GYGA 4UHTA 1JTXA 2PG4A 3K6GA 3CESA 1A35A 2HQRA 3FWEA 3K4KA 4OAYA 5EGOB 3FHNA 1FMWA 3PIOF 3GLXA 1T08B 3WTVC 2Z16A 2KDOA 2M1BA 4ETSA 1IF1A 1SD6A 2JN6A 3KLOA 3IAM2 1MW7A 1Y8QB 3M8FA 1ZG3A 2HQNA 2JZYA 2PMZA 3P7NA 3QPHA 1ORKA 3SDBA 2DJNA 3OYMA 2J5PA 1FC3A 3BZCA 1U5TA 4A69C 4OMZA 2HOTA 2LG4A 3CJQB 1IRXA 1EV7A 1WPKA 4F92B 3JCUC 4PUSA 1SVLA 5IT3A 1BL0A 3M4OJ 5A2QK 2R7QA 4IKFA 1JHHA 4BKXA 1OMIA 1BOAA 1A5JA 3ZMUA 5D4RA 2P5KA 5CVIA 4QIWN 4EM1A 1HDDC 2VJ4A 3CJRB 3CUOA 3WTWC 4EM2A 1UAAA 4WX9A 2UWMA 3A01B 4GXOA 3AFHA 2HNHA 4M6YA 3ZQIA 3ELKA 2V1NA 3CUQC 1ON1A 3CF2A 2D45A 1F43A 5GP9A 1BM9A 3DEUA 2X9DA 2R7UA 3N4MA 3HOXJ 1SMYF 4PJJA 4HRIA 5K1YA 1P6RA 4KYWA 1XB4A 2XRLA 1KQ8A 2EB7A 1I1GA 1TC3C 1D5VA 2XPWA 1GHCA 3IH3A 2CU7A 2M4KA 3LQRA 1J2XA 5DD8A 3SEZA 2W82A 4CCOA 3FK6A 3GCMA 3L2WA 1SC7A 3ROUA 4BEHB 2KT0A 5DCFA 1VQ7I 4HLXA 4KA4A 2E5ZA 3FXJA 1SEUA 2E19A 4NQWB 2P0WA 2MYSA 4D5CA 1MBHA 2HDDA 4UUSB 1S8NA 1R1TA 2NVYJ 4Y7NJ 4CXFA 5EG0B 3EETA 2O3FA 4A0YA 4E70A 3QWLA 3DPUA 2L7FP 4BXXJ 4LB5A 3BG9A 3KZIC 3C2GA 2R7TA 1MMSA 2LK2A 1MNMC 2ZJQF 1GVDA 1XMKA 3H9JA 5E1XA 1QRYA 5LLQA 5E18F 4KNYA 5EEAA 3ASNH 4D9JA 1SAUA 3TP0A 4M3GA 2YU3A 5E3LA 2QSGX 3OV8A 1DGRM 3BROA 4FE4A 4BXFA 2ESHA 4HF2A 2VLAA 3M9AA 1AU7A 2VPRA 3CJTB 1T39A 4LB6B 5GAEJ 4WXHA 5JHFA 2L3DA 2RAEA 1ULYA 2ZBKA 3QPLA 2XIGA 5F0CA 1J59A 2DFHA 1BR4A 3BJAA 3D5SC 2QVOA 3F0CA 1RKWA 1ZQ3P 1WGXA 4IL6C 4XKBA 3ZQGA 2QUFA 2IGOA 4EEFG 4KN7X 5LBQA 4BE0A 4S0HB 2HEOA 1HSTA 2CH0A 4Y4RA 4M3FA 3IKVA 1X4PA 1APLC 3PUBA 1YX3A 1IXCA 1PYVA 3FMSA 2LYCA 4UB6C 5E8GA 1D0ZA 4XRMA 3E6DA 3W6KB 2VASA 4XKWA 1B6AA 4D1QA 1HSJA 1GUUA 1CF7B 3GMEA 1U8RA 1R36A 1RZ4A 2HI3A 3X2QH 2HYFA 3IP4B 2Z1DA 1ETQA 4HF0A 1WZ2A 4I09A 3U21A 3REOA 1HW5A 2EFQA 2K9LA 3T5XA 3HKZN 1E0EA 5LD2C 3BTCA 2G7HA 1IO2A 4WWCA 4FX0A 1GVJA 4ZTJA 4HPQA 3QU6A 3RJPA 4BQNA 4G7HF 2Y69H 1VF9A 1B59A 4ZDPA 1XGMA 1AKHB 4ZZDA 2QA4I 1TQPA 1TLHB 2OTLI 2KZVA 1BW6A 2M45A 2FMLA 3VB2A 1UFMA 3G1LA 4PCQA 1HW2A 3O2PE 4OIRF 2GXGA 3H9GA 3Q3SA 1WQ2A 2KRCA 3JR9A 2VE8A 3CP2A 4QPQA 1FX7A 2JVGA 5F08A 5EGOA 1OYYA 1UG2A 4FT8A 3ZMSA 4OIPF 5C4XJ 1SFEA 4XICA 1RR8C 2OD5A 4BAYA 3AG2H 3H3UA 3G71I 3K1MA 1LEAA 1JKRC 4F93B 1FEXA 2F2EA 5IOZA 1NTCA 1MMGA 1MBKA 1ZLJA 3QYFA 1ITYA 3TMOA 2AS5F 1J9IA 4M6XA 3W2WA 4IOCF 2IGNA 3BWGA 5CVJA 4U87A 3VODA 2RVCA 1RRJA 1ETVA 4IPAA 2H8WA 3MKYB 3TO9A 3LMMA 4NDLA 1P92A 3O8GA 2MBFA 2CYYA 3MMYB 2OAZA 4F55A 1QU3A 3S32A 3F9KA 2CFXA 2FBHA 3D5RC 3UKGA 4G12A 3FDYA 2WWYA 5DYMA 2V1XA 5J8CA 3A01A 3H9QA 4NNJA 4IOAF 1G3WA 1IGNA 2WV0A 2CRGA 4JX6A 2EPFA 2F5EA 2KIUA 5L3FA 4X0GA 5HNHA 3OYLA 2JVHA 4HX4A 4NBQA 3PFYA 4M9SA 1H9GA 2NAZA 2JSCA 3ZMDA 1Z1DA 2Q1ZB 1W5SA 4U7DA 1REPC 2FXAA 3E5XA 3K7AJ 2L54A 2KJCA 4EJWA 1DGWY 4W1UA 2MSYA 2FBKA 1GDTA 1LDJA 1TNSA 4HEA2 4EGYA 2BHYA 3H5RA 1W36C 3H5NA 4BEHA 1F9NA 4L5IA 3GVAA 1EA3A 2GIZA 1KYWA 2ELKA 5FKLA 3ECOA 4DYQA 2L2OA 4UUSA 4KJZA 2M8GX 5LRRA 1OYIA 4FETA 1YO5C 3HGYA 2HVRA 2DOFA 4HQMA 4HZFA 3LSMA 3I59B 4A93J 3K1PA 3OYHA 4A3KJ 1WI3A 3QP5A 3HTSB 2ZSIB 3FMRA 4Y13A 4BXUA 2K40A 4ZYDA 4HA8A 2R5ZB 1XCBA 5FLXK 4ZC3A 1VQ5I 2XGDA 3ZXSA 2M7BA 2DFEA 4C2MJ 2XSJC 2LDUA 5E1WA 5D6EA 4GFBA 1FOXA 3F21A 3C7JA 3O8HA 4LLGF 2BY2A 2PMHA 1ETOA 3OYBA 1G4DA 3U2RA 1YRNB 1E2XA 1YHQI 5B3SH 3BG7A 2IXSA 4E7ZA 4BHBA 4I76A 4ENJA 2KQRA 2FX0A 2V9PA 2HKXA 2LLKA 4CCJA 2XDVA 4XR6A 2O03A 4EMSA 2CW8A 3OYKA 3S15J 1MGTA 3JSOA 4HV5A 3TL4X 2W85A 4UVAA 2JWTA 3G6EI 4LG3A 2GIVA 4H4KC 3UNGC 2E1MC 1DQUA 2ISYA 2QQBA 1EH8A 3DCFA 1VQOI 2CO5A 4KITB 5F0HA 1T8IA 5ILUA 2ID6A 5K7HA 3ZQFA 4LITA 3OWTA 4LLLA 3EYIA 5FKMA 3HKZA 4HX8A 3JRAA 1J7KA 1Y1VJ 2KIQA 4IHWA 2M5WA 3CUQB 3AG1H 2DW4A 1CF7A 3RPUA 1X3ZB 3E7LA 1S6LA 5K5OA 2IA0A 4GCVA 3I53A 5CQGA 6PAXA 4BH9A 1UJ8A 1QPMA 3JRFA 4IQJA 3SXYA 4HAMA 2K85A 3A2KA 3H92A 1V5EA 4MFDA 3OOUA 4ZYAA 4DBQA 1T56A 2O7OA 1U3EM 3HRSA 2K7LA 3PFIA 1OCTC 1J5YA 1YX5A 4L9TA 2P6TA 4XN3A 3PL8A 3HHGA 3HHHA 4M3BA 3OS2A 2JK3A 3B6AA 3D0SA 1O3SA 1OR7A 2JMWA 3E1SA 5FFZA 4M71A 4XK4A 4ENNA 3VFZA 4XMYA 4XORA 1MZBA 2VT2A 2NS0A 3KZZA 5FB2A 2O61A 4B4CA 1WKMA 1I3QJ 1UHMA 4RGSA 1DPRA 1YG2A 3WE2A 1XDUA 1L3LA 2G9WA 3H36A 4CZCA 2FE3A 2OV7A 1BR1A 2QF7A 4XRSA 1YJNI 1TW3A 2PFBA 1LPQA 4OOIA 2PJPA 3HPHA 2GLOA 2W84A 2HQAA 5L3GA 4CSWA 4CZZA 1OCPA 1MKMA 4XKCA 2R5YB 1B8IB 2G7UA 1QA6A 2JRTA 5IYDJ 3M8JA 2R92J 3BG3A 3HOWJ 3OYGA 1MDMB 1XMXA 1SVMA 2HXOA 2P8TA 2LR8A 2R7SA 1PUFB 2PN6A 5CVUA 4C30A 4EM0B 1AOYA 1Y8RB 1MJBA 3HYIA 2AQEA 2OC6A 2Y0MA 4KT5C 2E1CA 1R7JA 3BR6A 3S3NA 4B3XA 5DUKA 3FISA 3MQ0A 3JW4A 2NS7A 1I1SA 5L3BA 5M3FJ 1G3TA 4MO7A 4OIOF 4UXNA 3B02A 3BR3A 2RV8A 1L0OC 1X1AA 2ZCWA 3K69A 2YX7A 2DI3A 1IW7F 4BU2A 1D0YA 4HW0A 5BQTA 3DTEA 2DODA 1TT5B 1VQ9I 2IS1A 1TW2A 2E60A 2NVUB 3FXMA 5F6FA 3R0AA 1N75A 3R6SA 2IP2A 3BZKA 1TWAJ 2A6TA 3OL3A 4QPOA 4HV6A 3CTAA 3F8MA 2O8XA 3P9CA 1LFUP 1JKOC 1ZKGA 2PBIA 3J7ZI 2L7MP 2ZNZA 3I59A 2E71A 3F3XA 9ANTA 4G6DA 1YQAA 5CVRA 4MHGA 2LRDA 4DYCA 3VYTB 2VC1A 1V55H 3CMEI 3CMAI 1OCRH 2HTJA 4E4HA 3CMYA 3R61A 4J19A 3EUHC 4AYBN 2MH9A 2ADUA 4GO1A 3FIWA 2B0LA 5DTDA 2R5ZA 1U2WA 2L9NA 4KIBA 4PSWA 5IPAA 2V6CA 3U9GA 1MBFA 3HTUA 3M1CA 4C9YA 4I0BA 1Z3YA 4JK1X 5GAGJ 1XGOA 2FF4A 2LH9A 2QSFX 4RMNA 4XRFA 2Z2SB 3TO7A 3GTOJ 2K3PA 1U0JA 2AQFA 2HFHA 5CJ9A 4I99C 1FBUA 2DDAA 3E6MA 4LLNA 3VYRB 1I6XA 3RYRA 3E6CC 2RNGA 1OISA 2NNYA 3S1MJ 3BR0A 1D5YA 2HDWA 2FA5A 2BGCA 2IVMA 2LTPA 2P4WA 3I4MJ 3GTJJ 3BC8A 4IQ4A 2CV1A 2WAQN 4YFXF 3BLYA 3SJMA 3WTXC 1ZG1A 2K9MA 2QQAA 2CS3A 3HRTA 5HLIA 2DAOA 2O0YA 3PO3J 2L01A 1ZRDA 2XGCA 3CUQA 3MZ8A 1YTYA 2X6OA 1FPQA 4BBRJ 1F36A 2OZUA 2VONA 1ZHFA 2N8GA 2DT7B 5B66C 1I6HJ 4XLAA 2XAGA 4DYRA 4XQFA 2CSOA 4UUVA 5LEJA 2BV6A 3GYHX 3S3MA 5M5WJ 3A4CA 1D8KA 2GZWA 4MGRA 3AKZA 3CJNA 2X0LA 3VYSB 2YS9A 4Y52J 2DO7A 4WXCA 3ZN0A 1FYLA 2MC4A 2MLKA 3K70D 3ZPLA 4HYEA 2K9NA 4Y3OA 4BS9A 4CA0A 4CDGA 2GXAA 4WF2A 1FSHA 4P96A 5FLMJ 3KETA 2QWWA 2X1CA 2Y75A 3RPUD 3BOQA 1VNDA 3TW7A 1JT0A 3A1YA 3OIQA 4BE1A 2QBYA 3C18A 5M3MJ 3ZQQA 3F8NA 1X3UA 1MSFC 5FRNA 4AM3A 3TGNA 1Y1WJ 1K61A 1T98A 3G1MA 3LAPA 4A0ZA 3Q0VA 2AXTC 1VZ0A 1VQMI 2VJJA 2EIMH 5J47A 4OWRB 2KHMA 3CD6I 3BP8A 2HPMA 2LBFB 2NOJB 4XIDA 3GZNB 3CLOA 2M7AA 5IT9Z 4J00A 3ASOH 2IA1A 1PUFA 5HDNA 3CLQA 3H0DA 1DU0A 3KE2A 2Y2ZA 3SFZA 1S7AA 2WB1N 3GX4X 2Y30A 4L5EA 2ISZA 1X2NA 2KRFA 3DBLB 2Y0SA 1DDNA 1TZLA 4Q4ZF 5DM6F 5BOXA 2LKXA 1TBXA 4N4OB 1USSA 2E1MB 2MLGA 5C44J 4U0WA 1JUPA 5JI6A 3QQAA 1TNTA 3CCSI 3W2AA 3KYDB 2Z3YA 1HXDA 1SD5A 2NVTJ 3CO7C 2CJJA 3WE3A 3I4PA 1BI2A 1XTAA 2YX4A 4PGGA 3PSFA 5IP7J 1DUXC 4KUMA 4R8HA 5FKNA 3BJ6A 3WG7H 1LDKB 1TWFJ 3TBIA 3U1DA 2JPBA 3J7AY 2QSHX 2ZXJA 4IHXA 1X1CA 3K2ZA 2HYGD 3VSLA 4E7LA 1YW9A 3NARA 1K83J 2UXNA 2EA4A 4AYBA 3DP7A 3H0GJ 2XVCA 2MD0A 4XLNF 1EKEA 2EH3A 1FJLA 1UHWA 1BOBA 2L7ZA 3OYFA 5KVRA 3TEDA 2L7KA 3HUGB 3KP3A 1FYMA 4XRSG 2EINH 2PX9A 3GZ6A 5BS6A 5GPCA 2D5VA 4MEYF 3V8KA 1T0FC 2GAUA 3L7WA 4AU7A 2DYRH 2DQLA 3JAMZ 2XPUA 2A05A 3LOCA 4K2EA 3BG6A 3C1DA 4JX4A 4IHVA 2OBPA 2BOLA 1I5ZA 3FX3A 2WY8Q 5IP9J 1ETWA 1JTYA 4RAFA 4KFCA 3OSGA 3S3OA 1VQ6I 4FASD 2BE5F 3ZN1A 2CQ7A 2V4JC 3B6CA 4M9ZA 2BXYA 4KICA 4F52A 2E7XA 1FIAA 4LJZF 4D5FA 2WAQA 3P9IA 2H8RA 2X1EA 3KLNA 5ICFA 5IY5H 4PK4A 1R1VA 2R93J 2H09A 3S1NJ 3CO6C 5HVQC 3DBHB 1T95A 2MGQA 2JTVA 2R7OA 1Z6TA 3RYPA 3V7RA 5HNFA 1R5ID 2FUG2 2QKLB 3OMYA 2I8DA 4YFNF 3HPGA 1O4XA 2LVSA 3C3WA 1BR2A 2ICWG 1MNDA 3OYDA 4IRIA 4RB0A 2NNNA 4W97A 4IX7A 3SZTA 2Y9ZA 2H27A 2QGUA 2F4MB 3CDIA 4LOCA 3TKYA 2NRAC 3Q9VA 4LK1F 3BG5A 1H8AC 2XAUA 4RGRA 1Z77A 4ZZLA 2CQQA 1JKQC 4LK0F 3F8BA 3NRVA 2VIXA 3ERED 2OZ6A 3T8RA 4B44A 3CCEI 4J01A 5D6FA 3SZGA 1X3WB 3C2BA 2EV6A 2IGKA 1R5GA 3KP6A 4CH7A 4O3MA 3I4NJ 4ZJZA 1F1ZA 2OCEA 3RIRA 4AUXA 2VQHA 4IXAA 2CV2A 4G7OF 3WTYC 2P81A 1IJWC 1WCMJ 1PJRA 4ESFA 4WCGA 2GBYA 3HOTA 1OCCH 3C2HA 3T8TA 2UUZA 4DIQA 2OCCH 3IWZA 3PSIA 3V4GA 5GPAA 4ZYGA 4U0VA 3J7AO 1QZZA 2XB5A 3EDPA 3G3ZA 4R79A 2WAFA 5ERIA 5E3OA 3E6BA 1O7LA 1E3PA 5KAFC 4ON0A 1MH4A 1MBGA 1UZCA 3AL0C 2B63J 1IAWA 3HGGA 2HDCA 3KEQA 1EH7A 2ZXWH 1SAXA 2BBYA 3HG9A 1WJFA 2OA4A 2F5DA 1U78A 2LBFA 1SFXA 3LQQA 1YJ9I 1BJZA 1NH3A 1V3FA 1B9NA 4M73A 3RQ4A 3HOZJ 2VBWA 1YLFA 3NWTA 2P6SA 3BCAA 2VJIA 2DJIA 3WG9A 2FSWA 4LMYA 4EGZA 2DDBA 4P5OA 2GQQA 3MN2A 2QQ8A 4V2GA 4XOTA 3S2HJ 1D8JA 1S5LC 1YW7A 2P5VA 1USTA 2DTZA 2E2JJ 1E3HA 4HNVA 1W0UA 2JUCA 4IHTA 3DKWA 3I5UA 4V2FA 2CUEA 4A5MA 3S2DJ 1OLTA 4QWQA 1J75A 4HQEA 3JRIA 2FRHA 2VKVA 2GOMA 5EDNA 4IO9F 2VXDA 3GFMA 1VQLI 3QYEA 1U5TC 3I64A 4B47A 2DT6A 3QU3A 2KP6A 5FD5A 2Q8KA 3WHBA 2VOPA 3E0JB 3QAHA 2IEKA 2F48A 3CDHA 1LFPA 1VQPI 2IRFG 4BQOA 2H1LA 1R1UA 1G8XA 1ZTRA 2FOWA 3ZR8X 4EJUA 2OTJI 4MQVA
chains in the Genus database with same CATH topology
2DODA 2JUCA 2KFDA 2KIQA 2KZGA 2L9VA 1UZCA 2CQNA 2K85A 4FQGA 2E71A 2DOEA 2LKSA 2B7EA 2DOFA 2KISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOD A;  2JUC A;  2KFD A;  2KIQ A;  2KZG A;  2L9V A;  1UZC A;  2CQN A;  2K85 A;  4FQG A;  2E71 A;  2DOE A;  2LKS A;  2B7E A;  2DOF A;  2KIS A; 
#chains in the Genus database with same CATH topology
 5H2F C;  3VWB A;  3GTM J;  2XF7 A;  3V42 A;  4M72 A;  2ZXH A;  1XD7 A;  2UV1 A;  2EFP A;  3F72 A;  2EZL A;  3CC4 I;  4LD5 A;  1JGS A;  5FKO A;  2M8E A;  2CG4 A;  5JVT A;  1X2M A;  2VKH A;  5TGT A;  3GTK J;  1MJ9 A;  2EA2 A;  3IV5 A;  5FRM A;  2TCT A;  3K9T A;  2KLO A;  3A03 A;  2DT5 A;  3BY6 A;  1FOK A;  1HDP A;  4BQA A;  1O3R A;  1DP3 A;  1W5T A;  4E7I A;  1VI0 A;  4KIF A;  3IL2 A;  3O6B B;  3I9V 2;  5BPD A;  1OQY A;  3O3K A;  3U1K A;  4FQG A;  3HOY J;  1G6N A;  3CMM A;  2HWV A;  3DBR B;  4M74 A;  3F6O A;  2ME6 A;  5KHD A;  2R7F A;  3HDD A;  3OOP A;  4NQW A;  4B48 A;  2XV4 S;  3BR5 A;  3DU5 A;  4ZYH A;  3L2U A;  4ENK A;  1QZE A;  3ZQC A;  4Z6Y A;  3OR1 C;  3G2B A;  5EG0 A;  1K4S A;  1GV2 A;  1TP4 A;  4G8X A;  4I98 B;  4N0B A;  1Z67 A;  4YII A;  4DGW B;  2P7C B;  3IUO A;  3ZQH A;  1YFH A;  1S9H A;  2XB0 X;  2NS8 A;  1O57 A;  3FBN B;  4OIN F;  1ENH A;  2Z33 A;  4JQF A;  3RTR A;  5FD6 A;  3QRF F;  3J80 Z;  3SZP A;  3KIO A;  1DU6 A;  2FD5 A;  2F6C A;  3CCM I;  1WJB A;  4NC6 A;  1A6Q A;  2KFD A;  1Y56 A;  2EZK A;  3ABM H;  2XGE A;  4UVC A;  2HQ5 A;  3LA7 A;  3OS1 A;  1WJD A;  5DS9 A;  2JQ7 A;  1RUO A;  2DFI A;  2EWN A;  2MA3 A;  4ESJ A;  5HDG A;  2H1K A;  2DA1 A;  3HJE A;  1WRJ A;  3MKW B;  2DPU A;  4F91 B;  3WGI A;  2PLY A;  3OYE A;  2B9S A;  3DV8 A;  4F7Z A;  1XCV A;  2HOA A;  4BY7 J;  4LG0 B;  5IT9 K;  2WBM A;  3VOE A;  4G6T B;  1IZ1 A;  2LC2 A;  4F3Q A;  1BI1 A;  1BC7 C;  1ZRE A;  5J40 A;  2A6H F;  4XBF A;  1IUF A;  1QZY A;  4A6E A;  4GDF A;  5AIP A;  4QLC U;  1YS6 A;  4YIR X;  3CC7 I;  1UG0 A;  2CUJ A;  3EUH A;  1P9Q C;  3I0T A;  3L9F A;  1IRF A;  1W36 D;  4RB3 C;  2O8K A;  1QNT A;  1KU9 A;  1X1B A;  2LNB A;  1XGS A;  3JRC A;  2YPR A;  1JT6 A;  4KDP A;  2UXX A;  5KNL A;  1Y39 A;  2UZK A;  3KEO A;  3S93 A;  4RGU A;  5F64 A;  3K4M A;  1ZH5 A;  4ASN A;  2EV0 A;  4IZZ A;  1N78 A;  2PJR B;  1WJC A;  1G3S A;  4E6K G;  5HLT A;  5D5U B;  3L2V A;  1ZR4 A;  4ANJ A;  3COA C;  4PZJ A;  5K7Z A;  3L09 A;  3F23 A;  1JI8 A;  4N4N B;  3K10 A;  4EJV A;  2K86 A;  2KPM A;  1JJ8 C;  2QKM B;  3S16 J;  2E35 A;  4ZDO A;  4ZYE A;  4G9Y A;  3LSJ A;  1RC9 A;  1AKH A;  4XSX F;  1FBQ A;  2X4H A;  3MD2 A;  5H20 A;  3I3L A;  4BGD A;  1W1W E;  3FKI J;  1SMT A;  4U7B A;  2EFW A;  1MH3 A;  5EYR A;  3FM3 A;  4JOM A;  3A0H C;  2DTR A;  3KZY A;  3H3Z A;  1SVO A;  2FJ1 A;  1K6O A;  1NHA A;  3FKJ A;  4P9U A;  3LSK A;  3J7Y J;  3PQJ A;  4LGW A;  3JAM K;  3BR2 A;  3K2A A;  2DYS H;  2XAS A;  3FF5 A;  2H6B A;  2IT0 A;  2QEN A;  1IDY A;  4EVI A;  1D1C A;  2FMY A;  3D5L A;  2EZI A;  3JSP A;  2M30 A;  4CCL A;  1KQ9 A;  2XSD C;  2K27 A;  2A68 F;  3MFK A;  3GBG A;  1TQI A;  5EEH A;  2VBX A;  1O3T A;  2OQR A;  3DPL C;  2L9V A;  1SFO J;  3CCY A;  4C3J J;  3ZQL A;  3QOD A;  3RI4 A;  1P2F A;  3LAJ A;  1TWH J;  3QOP A;  3DXJ F;  3JRE A;  3FXK A;  1HBX G;  1QHG A;  4RM3 A;  4LFU A;  2FU4 A;  4OU0 A;  1HW1 A;  3AG4 H;  3BR1 A;  4YG2 F;  5JLW A;  2OU2 A;  2A5Y B;  3DLA A;  3EQL F;  3RKY A;  4C3H J;  3GFI A;  5LGT A;  4II2 A;  1MNE A;  4R1H A;  2STW A;  1UHS A;  3R4K A;  2LY2 A;  4IHS A;  3TO6 A;  3CCQ I;  1FOW A;  5E3N A;  3B73 A;  1OYW A;  4NUB A;  4Y33 A;  1EH6 A;  2DMT A;  4KIG A;  2F5F A;  3DFG A;  2CV0 A;  2F4O B;  4AC0 A;  2K9Q A;  2JA6 J;  3TOA A;  3WU0 A;  4H0E A;  3LST A;  2IBD A;  3A0B C;  4GRI A;  4DZJ A;  5BMZ A;  3MVP A;  4RAY A;  4RB2 C;  2VL8 A;  4XLP F;  1LE8 B;  4RBO A;  2CQK A;  2VJ5 A;  3TQN A;  3GXO A;  3ZMV A;  3FXU A;  4IRH A;  1VQ8 I;  3K4J A;  3RSN A;  1YS7 A;  1FY7 A;  5GAH J;  2EIL H;  4ZTF A;  3MEX A;  1XS9 A;  4CO8 A;  1U6G A;  3KYL A;  4PJM A;  3WGH A;  2ECB A;  2DMN A;  2HTS A;  1HA8 A;  4XKV A;  1KU2 A;  1KON A;  1IC8 A;  4PFP A;  5EEG A;  2E2I J;  3JRB A;  1K78 B;  4I01 A;  3W3C A;  1ZRC A;  3MWM A;  2DA7 A;  2FNA A;  2W24 A;  3EPZ A;  4RAZ A;  3RCO A;  3N05 A;  3DTK A;  5IYB J;  3BTJ A;  5JR3 A;  2WY7 Q;  4ITV A;  3HL2 A;  4RB1 A;  2DA6 A;  1U5T B;  1W7P B;  4B8X A;  4AVP A;  3DKY A;  3LSG A;  4BBS J;  2DPD A;  1HCR A;  2R7Z J;  1X58 A;  1UEL B;  2V26 A;  1LUJ B;  2ELH A;  3HSR A;  1YRN A;  3RZO J;  1ZAR A;  1IV6 A;  1CQT A;  4LG0 A;  2WAE A;  1ZGW A;  4RGX A;  2MD5 A;  4RAG A;  4JBA A;  5D8L B;  2ZB9 A;  1B4A A;  2FOK A;  3KP5 A;  1E3O C;  2J5O A;  3W6V A;  1Y0N A;  2H94 A;  5JLX A;  4X1E A;  3ONQ A;  2RKH A;  4D0P A;  5F0F A;  3E97 A;  2M9H A;  4CYC B;  3LSI A;  4LIU A;  2A69 F;  4HST A;  3PQK A;  4D7N A;  1F4K A;  1ZLK A;  4BDY A;  4B09 A;  1NG6 A;  1RET A;  3ABK H;  2VOO A;  1Y0U A;  1YIO A;  1MD0 A;  2RGV A;  2ZNY A;  5F04 A;  4AIK A;  5LGU A;  2BY1 A;  2ZJP F;  2QEX I;  4CCM A;  1BIB A;  2WA0 A;  3Q0U A;  1RR7 A;  3OYN A;  1J09 A;  2ACJ A;  2PJR A;  1OJL A;  5D5X B;  2QQ9 A;  4I7H A;  2QYO A;  5LHH A;  3WU1 B;  1IUY A;  3M07 A;  4A3C J;  1FZP B;  4MNU A;  4BE2 A;  1OR7 C;  2ZJ2 A;  2R7X A;  1XPX A;  1ZAO A;  4PFO A;  1KQ0 A;  3NWS A;  5DDG A;  1OKR A;  1XDS A;  1TWG J;  3PNV A;  1MIJ A;  4XON A;  2FEZ A;  1F5T A;  2KDZ A;  2EK5 A;  3BT9 A;  5FRO A;  1HQC A;  2HR3 A;  3OL4 A;  4I02 A;  5HOO A;  4IVN A;  5M5Y J;  5E3M A;  3S8P A;  2L9S A;  2BZT A;  2GOX B;  2K4B A;  2M4G A;  4P1W A;  4DOZ A;  2ZME C;  1FMV A;  1LJ9 A;  3GUD A;  4FX4 A;  1A36 A;  4UVB A;  3WHC A;  1IRG A;  1WI9 A;  5E17 F;  3ERM A;  2VPL A;  5HLG A;  3OIP A;  4Z2Y A;  1C0W A;  2LRE A;  1CGP A;  1T2K A;  3BDD A;  2QLZ A;  2A07 F;  4A3I J;  3H5A A;  3HB9 A;  3ECH A;  3TDZ C;  2W00 A;  1X1P A;  4ENM A;  5DV5 A;  4TV7 A;  3V8J A;  2A61 A;  4RS8 A;  5J4Y A;  1EJ9 A;  2R5Y A;  2Y9Y A;  1MMN A;  5M5X J;  1G59 A;  3F6V A;  1B8I A;  5CLS A;  4C3I J;  4C2T A;  3Q5F A;  4O5V A;  1FOY A;  5FLV A;  1MDM A;  2LOO A;  4BUP A;  3HSE A;  4B3A A;  3DLL F;  4RLQ A;  4X6A J;  4EJO A;  3SYT A;  2FQ4 A;  4A2U A;  1R6R A;  3Q0W A;  2CQX A;  4XLF A;  1TT0 A;  1RNL A;  1U9N A;  2AHQ A;  4OAZ A;  3OYI A;  4MQ9 F;  1PDN C;  4KMF A;  2CW7 A;  2M3A A;  5J1U A;  2XKO A;  3EUA A;  1QQI A;  4II3 A;  1FTT A;  4DNC A;  1KGS A;  2IJL A;  5KAI C;  1JXS A;  2IPQ X;  1VFC A;  5FGM A;  1Z05 A;  5DCM B;  2XC7 A;  2Q2E B;  3BPX A;  1R00 A;  3QPS A;  2YUS A;  4AWX B;  3J80 K;  1T33 A;  3CCL I;  2R7W A;  1MJA A;  2M34 A;  2VBZ A;  3DTI A;  4QSH A;  1NG7 A;  1QBJ A;  5H6R A;  1QVT A;  1X1D A;  1MSE C;  2FNP A;  3TP3 A;  2JA7 J;  2FBI A;  1LE8 A;  5L3C A;  3ZRG A;  1HF0 A;  4BDZ A;  1FWZ A;  1D1B A;  2V79 A;  2OPT A;  2TDX A;  2H6C A;  5ILV A;  4HDV A;  2VI6 A;  4BJ5 C;  2ELJ A;  3K4N A;  3GZ5 A;  5GTI C;  1V5G A;  5TRD A;  4HNU A;  4IJA A;  2NXN B;  2ZC2 A;  3KFW X;  4A3J J;  2QM3 A;  3IRR A;  2Z99 A;  1YE9 A;  4YEL A;  5D4S A;  2DA3 A;  1WJA A;  3MKZ A;  4XNF A;  1K78 A;  1P7J A;  3F8F A;  5F27 A;  5LRS A;  2F5C A;  4ZDL A;  1BI0 A;  1R58 A;  2DCE A;  1O7F A;  1X19 A;  2F5V A;  1YOV B;  2L0K A;  3ULQ B;  2DK8 A;  3ESW B;  1W7P A;  4MLO A;  4HOB A;  1YIJ I;  2XRO A;  2XAF A;  5KCM A;  2R7V A;  1GLN A;  1VQK I;  2M0C A;  2RRE A;  3IH2 A;  5IOY A;  3H35 A;  1LDD A;  1WFX A;  3PNY A;  5J4V A;  2GA2 A;  2TRT A;  3VSK A;  5LFA A;  2KJB A;  3CQZ J;  4GYI A;  3CCR I;  1KU7 A;  3CDL A;  3LFU A;  2DQR A;  4I2O A;  4A3F J;  4CIC A;  4BQQ A;  2KIF A;  2E7W A;  2VUM J;  5TIS C;  3OR2 C;  2V9V A;  1WJ5 A;  3IHU A;  2XPV A;  1BIA A;  3SEQ A;  1V54 H;  4MTD A;  3I54 A;  3OIO A;  2ZKZ A;  5E20 A;  2D1H A;  3SQN A;  4CYC A;  4HG2 A;  1ZEL A;  1JUS A;  3H1C A;  3K0L A;  2DOA A;  2W48 A;  1OPC A;  2G0E A;  3BPV A;  5GTH C;  1K79 A;  2KIS A;  2L02 A;  1YJW I;  2A3S A;  2DMQ A;  4E7K A;  3F22 A;  1Z91 A;  5GAD J;  3MZY A;  4MEX F;  1LVK A;  2BXZ A;  1R4N B;  2RC4 A;  1HKT A;  4XM3 A;  1IV8 A;  5CVV A;  5EJC A;  1BC8 C;  3K1N A;  1FIP A;  3JTG A;  3CC2 I;  2EQR A;  1W5C C;  1KU3 A;  4BHP A;  3AAF A;  1X4O A;  2STT A;  5H6Q A;  2E1N A;  2JSP A;  5CQE A;  2WV1 A;  1A31 A;  3BQZ A;  4N9H A;  3WTT C;  4A3M J;  1SAN A;  2R3S A;  4UV8 A;  2F4I A;  4MIM A;  3MCZ A;  1POG A;  3HOS A;  3FZV A;  1FBS A;  3QPT A;  5HOD A;  2MFZ A;  1ACI A;  4B43 A;  1IRZ A;  1E17 A;  4AD9 A;  4S04 A;  2ZJR F;  2BY0 A;  2E34 A;  2W1O A;  2Z5U A;  3RDI A;  5LHG A;  3PUF A;  3RPQ A;  2XF5 A;  2MAB A;  3JRH A;  2JRM A;  2VB6 A;  3GFL A;  1B1B A;  1XSV A;  3LWF A;  5JFR A;  3ABL H;  4FCY A;  1JGG A;  1YI2 I;  2WB1 A;  3T1B A;  4S05 A;  4UUT A;  5L3D A;  1MMD A;  2L4M A;  1HLV A;  4UV9 A;  3NAU A;  3ZMT A;  3P5J A;  1VQN I;  1SD7 A;  2MH2 A;  4LIV A;  3AG3 H;  1JJ6 C;  3G73 A;  1GV5 A;  2E2H J;  4PSX A;  3LFK A;  2LF8 A;  5J3L A;  1IG7 A;  2LSO A;  3M1E A;  4FHT A;  3GTL J;  1MMA A;  2V6E A;  1S29 A;  2VE9 A;  4IRG A;  5EF6 A;  3ZQ7 A;  2EZH A;  2ID3 A;  1N77 A;  4DJA A;  2BVL A;  5B1A H;  2O9L A;  4L18 B;  1Z6R A;  3BJO A;  5BPI A;  1XMA A;  1HKQ A;  3FXL A;  1Z3X A;  1ETY A;  1FSE A;  3DEW A;  4L9N A;  2HZT A;  2VOD A;  3HC7 A;  5DCM A;  2Q2E A;  4BAC A;  3IRQ A;  1R23 A;  4P9F A;  5FFX A;  1QGP A;  4DBR A;  4DQ2 A;  4CGZ A;  1UB9 A;  1STZ A;  1ZN2 A;  2QCO A;  2XAJ A;  4L5J A;  4NC7 A;  4HLY A;  4RA2 A;  3QP6 A;  1ETX A;  4HDU A;  5D5W B;  5L3E A;  4PGH A;  1PUE E;  4BY1 J;  5ICG A;  1M1E B;  2YU9 J;  3RKQ A;  4IF4 A;  4A3G J;  4AIJ A;  2BY3 A;  3RKW A;  2VN2 A;  1R5H A;  2VQG A;  2XKP A;  4L0Z B;  3HUG A;  3V7C A;  5HS9 A;  3M3Y J;  3IH4 A;  4UB8 C;  4A6D A;  4D7M A;  2LKS A;  1DPU A;  5CKT A;  3LSR A;  2K5C A;  1VTN C;  3HEF A;  1Q1H A;  2IGM A;  2ZME B;  2XAQ A;  3G4S I;  3DF8 A;  1R4M B;  1WJE A;  4E7S A;  1S3J A;  3RQI A;  3VPR A;  2BW3 B;  2HKO A;  3QOE A;  3P9K A;  2LKP A;  2CWE A;  1BN5 A;  1IN5 A;  2P7V B;  4RM2 A;  2CW0 F;  4XLH A;  3WGG A;  4CYD A;  1IN7 A;  2E1O A;  2YSR A;  3RZD J;  1ODD A;  2M87 A;  3V8L A;  3NEU A;  4HF1 A;  1LVA A;  3M7G A;  3SHF A;  3OS0 A;  4IHY A;  2K3F A;  1BJA A;  1RIO H;  1EF4 A;  1V4R A;  2XGX A;  5J1Y A;  2W7N A;  3H3V K;  1N25 A;  1NK2 P;  3KCC A;  3HOV J;  3GLL A;  3K4C A;  1PVE A;  4ESB A;  3KPH A;  1W7P D;  2XRN A;  1TTY A;  1I3A A;  1OFC X;  3EYY A;  5D5V B;  2EFO A;  2PEX A;  2CUF A;  1LB2 A;  1XGN A;  1QVU A;  5AIQ A;  3CCV I;  1HOM A;  3GTP J;  2GWR A;  3K4B A;  2HU9 A;  2EIK H;  4XLC A;  1WH7 A;  3HXL A;  2KKO A;  1K7A A;  3ZCO A;  3KP7 A;  3J81 Z;  3HOU J;  4YRV A;  2R7R A;  2DA5 A;  3L2Q A;  4L0Y B;  3MKL A;  2JJ7 A;  3FK7 A;  2EJR A;  4NB5 A;  2HYJ A;  5JHU A;  1RUN A;  1IXR C;  2CFO A;  4CCK A;  2K02 A;  2DLL A;  4M6V A;  1IN6 A;  4G94 A;  3DPT A;  2HZD A;  4CUG A;  4DZP A;  3FXO A;  2L4A A;  1H89 C;  2JPC A;  3LSP A;  1V5F A;  3HZJ A;  2X51 A;  5C4J J;  1LNW A;  4G7Z F;  1H0M A;  1R9T J;  4E7J A;  2O5R A;  4M9X A;  1H9T A;  3WTU C;  2CGP A;  2LY9 A;  4ZH4 F;  2VBY A;  2CMP A;  3DQV C;  5FO5 A;  2LD5 A;  4HNT A;  2OF7 A;  4PDK A;  1FYK A;  4Q47 A;  4MTE A;  1S7O A;  1MBJ A;  3OYJ A;  1D3Y A;  1D0X A;  3KP4 A;  2D2W A;  5HS8 A;  1KA8 A;  2X1D A;  5A2Q Z;  2EBI A;  1LQ1 A;  1XSD A;  3PJR A;  3DEE A;  1RKT A;  1FT9 A;  5J8F A;  5ICC A;  3BCB A;  3M8E A;  2KRH A;  1A6I A;  1FP2 A;  1XX5 A;  2ZXI A;  3QYB A;  2V7F A;  1JHF A;  2Y31 A;  2VKE A;  2CUZ A;  3BZ6 A;  2P5L C;  2ZSH B;  3A02 A;  1W0T A;  2HPI A;  2NOG A;  4FE7 A;  5HDK A;  5ED4 A;  5AON A;  2DOE A;  2VQC A;  3S14 J;  4UNO A;  2M2E A;  2YR2 A;  3D1N I;  4EAT A;  3SDG A;  3TDU C;  4KIS A;  1BA5 A;  3KP2 A;  2EFN A;  2BHZ A;  2OQG A;  3JTH A;  2JUG A;  5F1R A;  2ZFU A;  1I50 J;  1KYZ A;  1Z7U A;  1D1A A;  3W2V A;  3GO5 A;  5DM7 F;  2DA4 A;  3IC7 A;  2XF6 A;  1HKS A;  2Z9O A;  1ZG5 A;  3I56 I;  5E1Z B;  2NVQ J;  2MG4 A;  4HX7 A;  3S17 J;  4JX5 A;  4B1R A;  4EJT A;  4O6J A;  4NHJ A;  1AWC A;  2KZG A;  2KMU A;  1NK3 P;  2IW5 A;  1MBE A;  3V7S A;  2NYX A;  2LMD A;  1G2H A;  2RDP A;  2A6E F;  4QTR A;  4FIS A;  3LA3 A;  2XAH A;  1FLI A;  1T6S A;  3IAS 2;  2LP0 A;  2DXI A;  5IP6 A;  4XLE A;  4M3D A;  3CCJ I;  5CPR B;  1ZGA A;  4BJT A;  3I71 A;  2D1V A;  2EIJ H;  1HC8 A;  1I39 A;  2BYV E;  3RKX A;  2QBY B;  4OIQ F;  3GWZ A;  5J6X A;  2CQN A;  2Q0O A;  3E5U A;  1B72 B;  3ABU A;  3BTI A;  4E7H A;  2VKD A;  2JA5 J;  1ONV A;  5B5E C;  3ZP5 A;  5HS7 A;  3F8C A;  4OMY A;  2O6G E;  3JRD A;  3T0Y A;  2ETH A;  2ZME A;  2M0M A;  2Y48 A;  4U88 A;  2LFB A;  4U0Y A;  1FP1 D;  3OSF A;  5BNG A;  2BW3 A;  4N9I A;  5EZG A;  2ECC A;  3FXR A;  4V19 K;  3AL0 B;  2WC2 A;  1S7E A;  5HLH A;  5JVG F;  4JP0 A;  4AID A;  2IAI A;  4PJN A;  2KL4 A;  4HSR A;  2AO9 A;  2X48 A;  4EV0 A;  1Z0X A;  3GF2 A;  5FKK A;  4YIF A;  2QZ8 A;  1P4X A;  2GM4 A;  5E79 C;  2HVS A;  1IN4 A;  4A3D J;  3Q9S A;  1TWC J;  2R0Q C;  2W25 A;  4L9J A;  2PI0 A;  1SFK A;  4MFE A;  1XSX A;  2ME0 A;  4G6Q A;  4KT6 A;  5ILS A;  5K5Q A;  3LSH A;  5LHI A;  4YFK F;  2L9R A;  3OYC A;  4I6Z A;  2COM A;  2E36 A;  3BTL A;  3FM5 A;  1IXS B;  3OYA A;  5E8I A;  3L00 A;  1J0R A;  3BQY A;  2OUM A;  2Y0S N;  2R7D A;  5DD4 A;  1ZRF A;  5K7F A;  2IA2 A;  1BBY A;  2RN7 A;  3EUK L;  2I10 A;  4NC8 A;  1S72 I;  3ZOB A;  1SD4 A;  4BJ6 C;  1PP7 U;  1IDZ A;  2FQ3 A;  3PIP F;  2JA2 A;  1AHD P;  2V9K A;  1Z21 A;  2W57 A;  4XOP A;  2VQL A;  4CHU A;  1K4T A;  2DMU A;  2DMP A;  5EZH A;  3DKX A;  2HGC A;  1A04 A;  1OCO H;  3S1Q J;  2WAD A;  1ERD A;  1QO0 D;  2RQP A;  3VYU B;  3ABT A;  2VC0 A;  1GT0 C;  2DA2 A;  2DN0 A;  3GFJ A;  4A12 A;  1LFB A;  1I27 A;  3FMQ A;  1LEB A;  2PMZ N;  2XUB A;  2PQ8 A;  3OY9 A;  1FNN A;  1AA7 A;  4L9V A;  3N97 A;  4M3E A;  1R49 A;  5IYC J;  3KEY A;  2K4J A;  3GEZ A;  3I55 I;  4DW6 A;  1ZR2 A;  2COB A;  3K4L A;  2GA1 A;  1IN8 A;  3K70 C;  2AXL A;  1JKP C;  1T0F A;  3HM5 A;  3TOB A;  4AVZ A;  2HVQ A;  4RLF A;  2C6Y A;  3SFI A;  1OCZ H;  1RI7 A;  1XN7 A;  1PP8 F;  1TL8 A;  1JE8 A;  1SFU A;  1R71 A;  2BVM A;  2IS4 A;  2WTE A;  2ZO4 A;  1U9O A;  1W4M A;  1GXQ A;  2W4S A;  2X6Y A;  3DWL E;  3LL7 A;  1H88 C;  1ZYR F;  1YW8 A;  2DU9 A;  1FTZ A;  1RES A;  4KMU X;  3HRM A;  3PM1 A;  1KZH A;  4BNC A;  2HXI A;  3IKT A;  4BYY A;  3S1R J;  3WU2 C;  5DEQ A;  3CP8 A;  4Y15 A;  1VQ4 I;  4KN4 X;  2V1D A;  1WSU A;  1XC5 A;  5J1R A;  2R4G A;  3WTZ A;  3R60 A;  1ETK A;  1P4A A;  1BI3 A;  5LEK A;  2XHK A;  1Y6I A;  3GTG J;  1Z7L A;  3DU6 A;  2X85 A;  4JYK A;  2ESN A;  1DP7 P;  1WH5 A;  2JT1 A;  1P4W A;  3TW6 A;  1GXP A;  4A0X A;  3E5Q A;  4EQQ A;  1XG1 A;  3CF5 F;  1LKX A;  2RNJ A;  2NVX J;  3HRU A;  3IWF A;  5FJ8 J;  5B1B H;  5DUI A;  4UY8 I;  4RDU A;  2IS2 A;  2PMU A;  2KIM A;  3HSF A;  3WTS C;  3G1O A;  3W6J B;  1U8B A;  4C2U A;  4PJ0 C;  4YEJ A;  1RPW A;  1WWX A;  3MAJ A;  4CCN A;  2E5N A;  3ZMZ A;  1Q1V A;  3KYC B;  4Y17 A;  2I5U A;  3ML6 A;  2LY1 A;  3LNQ A;  2EV5 A;  1ZK8 A;  5CYV A;  5LGN A;  4A3B J;  3E3V A;  2X6X A;  4BHC A;  2OJE D;  2DK5 A;  3R0J A;  2B7E A;  2JA8 J;  5ICE A;  3ZGK A;  3ISP A;  3FBI B;  2BEO A;  1P7I A;  5K5R A;  1ZGJ A;  3FHZ A;  1B9M A;  3KX2 A;  5FLX Z;  4WK8 F;  1B72 A;  3HBL A;  5KK1 A;  4ABZ A;  4PJL A;  3NQO A;  3S2W A;  4AIH A;  1WHU A;  4A3E J;  5D8K B;  2DFF A;  2HOE A;  2IS6 A;  3HIF A;  3LA2 A;  1UMQ A;  4WXD A;  1BW5 A;  3UR3 C;  3CCU I;  2MC3 A;  4BL0 B;  3MZH A;  2VT3 A;  4XN0 A;  1R22 A;  4XL9 A;  1YYV A;  3JRG A;  1QPI A;  4GGG A;  1WVR A;  2K9S A;  2HS5 A;  2ZFW A;  3WOD F;  3L1P A;  1ON2 A;  4HBL A;  4Q5S F;  3GW2 A;  2HOS A;  2X6W A;  2RQQ A;  4IEJ A;  3PO2 J;  4XSZ F;  4A5N A;  2VXZ A;  4P55 A;  3PNT A;  2DBB A;  3L2R A;  5C3E J;  4A3L J;  4I0A A;  3CZ6 A;  5TJJ A;  1Z9C A;  3J81 K;  3GTQ J;  1JUM A;  2L5Q A;  4Q48 A;  1G3Y A;  3L2C A;  1O3Q A;  3VEP A;  2V1U A;  3VDX A;  1UCR A;  3I58 A;  2LF7 A;  1YIT I;  2A5W A;  2GXB A;  1K6Y A;  1QHH D;  3FXQ A;  1T38 A;  1TQM A;  2MW8 A;  5F1J A;  4FTH A;  4GYG A;  4UHT A;  1JTX A;  2PG4 A;  3K6G A;  3CES A;  1A35 A;  2HQR A;  3FWE A;  3K4K A;  4OAY A;  5EGO B;  3FHN A;  1FMW A;  3PIO F;  3GLX A;  1T08 B;  3WTV C;  2Z16 A;  2KDO A;  2M1B A;  4ETS A;  1IF1 A;  1SD6 A;  2JN6 A;  3KLO A;  3IAM 2;  1MW7 A;  1Y8Q B;  3M8F A;  1ZG3 A;  2HQN A;  2JZY A;  2PMZ A;  3P7N A;  3QPH A;  1ORK A;  3SDB A;  2DJN A;  3OYM A;  2J5P A;  1FC3 A;  3BZC A;  1U5T A;  4A69 C;  4OMZ A;  2HOT A;  2LG4 A;  3CJQ B;  1IRX A;  1EV7 A;  1WPK A;  4F92 B;  3JCU C;  4PUS A;  1SVL A;  5IT3 A;  1BL0 A;  3M4O J;  5A2Q K;  2R7Q A;  4IKF A;  1JHH A;  4BKX A;  1OMI A;  1BOA A;  1A5J A;  3ZMU A;  5D4R A;  2P5K A;  5CVI A;  4QIW N;  4EM1 A;  1HDD C;  2VJ4 A;  3CJR B;  3CUO A;  3WTW C;  4EM2 A;  1UAA A;  4WX9 A;  2UWM A;  3A01 B;  4GXO A;  3AFH A;  2HNH A;  4M6Y A;  3ZQI A;  3ELK A;  2V1N A;  3CUQ C;  1ON1 A;  3CF2 A;  2D45 A;  1F43 A;  5GP9 A;  1BM9 A;  3DEU A;  2X9D A;  2R7U A;  3N4M A;  3HOX J;  1SMY F;  4PJJ A;  4HRI A;  5K1Y A;  1P6R A;  4KYW A;  1XB4 A;  2XRL A;  1KQ8 A;  2EB7 A;  1I1G A;  1TC3 C;  1D5V A;  2XPW A;  1GHC A;  3IH3 A;  2CU7 A;  2M4K A;  3LQR A;  1J2X A;  5DD8 A;  3SEZ A;  2W82 A;  4CCO A;  3FK6 A;  3GCM A;  3L2W A;  1SC7 A;  3ROU A;  4BEH B;  2KT0 A;  5DCF A;  1VQ7 I;  4HLX A;  4KA4 A;  2E5Z A;  3FXJ A;  1SEU A;  2E19 A;  4NQW B;  2P0W A;  2MYS A;  4D5C A;  1MBH A;  2HDD A;  4UUS B;  1S8N A;  1R1T A;  2NVY J;  4Y7N J;  4CXF A;  5EG0 B;  3EET A;  2O3F A;  4A0Y A;  4E70 A;  3QWL A;  3DPU A;  2L7F P;  4BXX J;  4LB5 A;  3BG9 A;  3KZI C;  3C2G A;  2R7T A;  1MMS A;  2LK2 A;  1MNM C;  2ZJQ F;  1GVD A;  1XMK A;  3H9J A;  5E1X A;  1QRY A;  5LLQ A;  5E18 F;  4KNY A;  5EEA A;  3ASN H;  4D9J A;  1SAU A;  3TP0 A;  4M3G A;  2YU3 A;  5E3L A;  2QSG X;  3OV8 A;  1DGR M;  3BRO A;  4FE4 A;  4BXF A;  2ESH A;  4HF2 A;  2VLA A;  3M9A A;  1AU7 A;  2VPR A;  3CJT B;  1T39 A;  4LB6 B;  5GAE J;  4WXH A;  5JHF A;  2L3D A;  2RAE A;  1ULY A;  2ZBK A;  3QPL A;  2XIG A;  5F0C A;  1J59 A;  2DFH A;  1BR4 A;  3BJA A;  3D5S C;  2QVO A;  3F0C A;  1RKW A;  1ZQ3 P;  1WGX A;  4IL6 C;  4XKB A;  3ZQG A;  2QUF A;  2IGO A;  4EEF G;  4KN7 X;  5LBQ A;  4BE0 A;  4S0H B;  2HEO A;  1HST A;  2CH0 A;  4Y4R A;  4M3F A;  3IKV A;  1X4P A;  1APL C;  3PUB A;  1YX3 A;  1IXC A;  1PYV A;  3FMS A;  2LYC A;  4UB6 C;  5E8G A;  1D0Z A;  4XRM A;  3E6D A;  3W6K B;  2VAS A;  4XKW A;  1B6A A;  4D1Q A;  1HSJ A;  1GUU A;  1CF7 B;  3GME A;  1U8R A;  1R36 A;  1RZ4 A;  2HI3 A;  3X2Q H;  2HYF A;  3IP4 B;  2Z1D A;  1ETQ A;  4HF0 A;  1WZ2 A;  4I09 A;  3U21 A;  3REO A;  1HW5 A;  2EFQ A;  2K9L A;  3T5X A;  3HKZ N;  1E0E A;  5LD2 C;  3BTC A;  2G7H A;  1IO2 A;  4WWC A;  4FX0 A;  1GVJ A;  4ZTJ A;  4HPQ A;  3QU6 A;  3RJP A;  4BQN A;  4G7H F;  2Y69 H;  1VF9 A;  1B59 A;  4ZDP A;  1XGM A;  1AKH B;  4ZZD A;  2QA4 I;  1TQP A;  1TLH B;  2OTL I;  2KZV A;  1BW6 A;  2M45 A;  2FML A;  3VB2 A;  1UFM A;  3G1L A;  4PCQ A;  1HW2 A;  3O2P E;  4OIR F;  2GXG A;  3H9G A;  3Q3S A;  1WQ2 A;  2KRC A;  3JR9 A;  2VE8 A;  3CP2 A;  4QPQ A;  1FX7 A;  2JVG A;  5F08 A;  5EGO A;  1OYY A;  1UG2 A;  4FT8 A;  3ZMS A;  4OIP F;  5C4X J;  1SFE A;  4XIC A;  1RR8 C;  2OD5 A;  4BAY A;  3AG2 H;  3H3U A;  3G71 I;  3K1M A;  1LEA A;  1JKR C;  4F93 B;  1FEX A;  2F2E A;  5IOZ A;  1NTC A;  1MMG A;  1MBK A;  1ZLJ A;  3QYF A;  1ITY A;  3TMO A;  2AS5 F;  1J9I A;  4M6X A;  3W2W A;  4IOC F;  2IGN A;  3BWG A;  5CVJ A;  4U87 A;  3VOD A;  2RVC A;  1RRJ A;  1ETV A;  4IPA A;  2H8W A;  3MKY B;  3TO9 A;  3LMM A;  4NDL A;  1P92 A;  3O8G A;  2MBF A;  2CYY A;  3MMY B;  2OAZ A;  4F55 A;  1QU3 A;  3S32 A;  3F9K A;  2CFX A;  2FBH A;  3D5R C;  3UKG A;  4G12 A;  3FDY A;  2WWY A;  5DYM A;  2V1X A;  5J8C A;  3A01 A;  3H9Q A;  4NNJ A;  4IOA F;  1G3W A;  1IGN A;  2WV0 A;  2CRG A;  4JX6 A;  2EPF A;  2F5E A;  2KIU A;  5L3F A;  4X0G A;  5HNH A;  3OYL A;  2JVH A;  4HX4 A;  4NBQ A;  3PFY A;  4M9S A;  1H9G A;  2NAZ A;  2JSC A;  3ZMD A;  1Z1D A;  2Q1Z B;  1W5S A;  4U7D A;  1REP C;  2FXA A;  3E5X A;  3K7A J;  2L54 A;  2KJC A;  4EJW A;  1DGW Y;  4W1U A;  2MSY A;  2FBK A;  1GDT A;  1LDJ A;  1TNS A;  4HEA 2;  4EGY A;  2BHY A;  3H5R A;  1W36 C;  3H5N A;  4BEH A;  1F9N A;  4L5I A;  3GVA A;  1EA3 A;  2GIZ A;  1KYW A;  2ELK A;  5FKL A;  3ECO A;  4DYQ A;  2L2O A;  4UUS A;  4KJZ A;  2M8G X;  5LRR A;  1OYI A;  4FET A;  1YO5 C;  3HGY A;  2HVR A;  2DOF A;  4HQM A;  4HZF A;  3LSM A;  3I59 B;  4A93 J;  3K1P A;  3OYH A;  4A3K J;  1WI3 A;  3QP5 A;  3HTS B;  2ZSI B;  3FMR A;  4Y13 A;  4BXU A;  2K40 A;  4ZYD A;  4HA8 A;  2R5Z B;  1XCB A;  5FLX K;  4ZC3 A;  1VQ5 I;  2XGD A;  3ZXS A;  2M7B A;  2DFE A;  4C2M J;  2XSJ C;  2LDU A;  5E1W A;  5D6E A;  4GFB A;  1FOX A;  3F21 A;  3C7J A;  3O8H A;  4LLG F;  2BY2 A;  2PMH A;  1ETO A;  3OYB A;  1G4D A;  3U2R A;  1YRN B;  1E2X A;  1YHQ I;  5B3S H;  3BG7 A;  2IXS A;  4E7Z A;  4BHB A;  4I76 A;  4ENJ A;  2KQR A;  2FX0 A;  2V9P A;  2HKX A;  2LLK A;  4CCJ A;  2XDV A;  4XR6 A;  2O03 A;  4EMS A;  2CW8 A;  3OYK A;  3S15 J;  1MGT A;  3JSO A;  4HV5 A;  3TL4 X;  2W85 A;  4UVA A;  2JWT A;  3G6E I;  4LG3 A;  2GIV A;  4H4K C;  3UNG C;  2E1M C;  1DQU A;  2ISY A;  2QQB A;  1EH8 A;  3DCF A;  1VQO I;  2CO5 A;  4KIT B;  5F0H A;  1T8I A;  5ILU A;  2ID6 A;  5K7H A;  3ZQF A;  4LIT A;  3OWT A;  4LLL A;  3EYI A;  5FKM A;  3HKZ A;  4HX8 A;  3JRA A;  1J7K A;  1Y1V J;  2KIQ A;  4IHW A;  2M5W A;  3CUQ B;  3AG1 H;  2DW4 A;  1CF7 A;  3RPU A;  1X3Z B;  3E7L A;  1S6L A;  5K5O A;  2IA0 A;  4GCV A;  3I53 A;  5CQG A;  6PAX A;  4BH9 A;  1UJ8 A;  1QPM A;  3JRF A;  4IQJ A;  3SXY A;  4HAM A;  2K85 A;  3A2K A;  3H92 A;  1V5E A;  4MFD A;  3OOU A;  4ZYA A;  4DBQ A;  1T56 A;  2O7O A;  1U3E M;  3HRS A;  2K7L A;  3PFI A;  1OCT C;  1J5Y A;  1YX5 A;  4L9T A;  2P6T A;  4XN3 A;  3PL8 A;  3HHG A;  3HHH A;  4M3B A;  3OS2 A;  2JK3 A;  3B6A A;  3D0S A;  1O3S A;  1OR7 A;  2JMW A;  3E1S A;  5FFZ A;  4M71 A;  4XK4 A;  4ENN A;  3VFZ A;  4XMY A;  4XOR A;  1MZB A;  2VT2 A;  2NS0 A;  3KZZ A;  5FB2 A;  2O61 A;  4B4C A;  1WKM A;  1I3Q J;  1UHM A;  4RGS A;  1DPR A;  1YG2 A;  3WE2 A;  1XDU A;  1L3L A;  2G9W A;  3H36 A;  4CZC A;  2FE3 A;  2OV7 A;  1BR1 A;  2QF7 A;  4XRS A;  1YJN I;  1TW3 A;  2PFB A;  1LPQ A;  4OOI A;  2PJP A;  3HPH A;  2GLO A;  2W84 A;  2HQA A;  5L3G A;  4CSW A;  4CZZ A;  1OCP A;  1MKM A;  4XKC A;  2R5Y B;  1B8I B;  2G7U A;  1QA6 A;  2JRT A;  5IYD J;  3M8J A;  2R92 J;  3BG3 A;  3HOW J;  3OYG A;  1MDM B;  1XMX A;  1SVM A;  2HXO A;  2P8T A;  2LR8 A;  2R7S A;  1PUF B;  2PN6 A;  5CVU A;  4C30 A;  4EM0 B;  1AOY A;  1Y8R B;  1MJB A;  3HYI A;  2AQE A;  2OC6 A;  2Y0M A;  4KT5 C;  2E1C A;  1R7J A;  3BR6 A;  3S3N A;  4B3X A;  5DUK A;  3FIS A;  3MQ0 A;  3JW4 A;  2NS7 A;  1I1S A;  5L3B A;  5M3F J;  1G3T A;  4MO7 A;  4OIO F;  4UXN A;  3B02 A;  3BR3 A;  2RV8 A;  1L0O C;  1X1A A;  2ZCW A;  3K69 A;  2YX7 A;  2DI3 A;  1IW7 F;  4BU2 A;  1D0Y A;  4HW0 A;  5BQT A;  3DTE A;  2DOD A;  1TT5 B;  1VQ9 I;  2IS1 A;  1TW2 A;  2E60 A;  2NVU B;  3FXM A;  5F6F A;  3R0A A;  1N75 A;  3R6S A;  2IP2 A;  3BZK A;  1TWA J;  2A6T A;  3OL3 A;  4QPO A;  4HV6 A;  3CTA A;  3F8M A;  2O8X A;  3P9C A;  1LFU P;  1JKO C;  1ZKG A;  2PBI A;  3J7Z I;  2L7M P;  2ZNZ A;  3I59 A;  2E71 A;  3F3X A;  9ANT A;  4G6D A;  1YQA A;  5CVR A;  4MHG A;  2LRD A;  4DYC A;  3VYT B;  2VC1 A;  1V55 H;  3CME I;  3CMA I;  1OCR H;  2HTJ A;  4E4H A;  3CMY A;  3R61 A;  4J19 A;  3EUH C;  4AYB N;  2MH9 A;  2ADU A;  4GO1 A;  3FIW A;  2B0L A;  5DTD A;  2R5Z A;  1U2W A;  2L9N A;  4KIB A;  4PSW A;  5IPA A;  2V6C A;  3U9G A;  1MBF A;  3HTU A;  3M1C A;  4C9Y A;  4I0B A;  1Z3Y A;  4JK1 X;  5GAG J;  1XGO A;  2FF4 A;  2LH9 A;  2QSF X;  4RMN A;  4XRF A;  2Z2S B;  3TO7 A;  3GTO J;  2K3P A;  1U0J A;  2AQF A;  2HFH A;  5CJ9 A;  4I99 C;  1FBU A;  2DDA A;  3E6M A;  4LLN A;  3VYR B;  1I6X A;  3RYR A;  3E6C C;  2RNG A;  1OIS A;  2NNY A;  3S1M J;  3BR0 A;  1D5Y A;  2HDW A;  2FA5 A;  2BGC A;  2IVM A;  2LTP A;  2P4W A;  3I4M J;  3GTJ J;  3BC8 A;  4IQ4 A;  2CV1 A;  2WAQ N;  4YFX F;  3BLY A;  3SJM A;  3WTX C;  1ZG1 A;  2K9M A;  2QQA A;  2CS3 A;  3HRT A;  5HLI A;  2DAO A;  2O0Y A;  3PO3 J;  2L01 A;  1ZRD A;  2XGC A;  3CUQ A;  3MZ8 A;  1YTY A;  2X6O A;  1FPQ A;  4BBR J;  1F36 A;  2OZU A;  2VON A;  1ZHF A;  2N8G A;  2DT7 B;  5B66 C;  1I6H J;  4XLA A;  2XAG A;  4DYR A;  4XQF A;  2CSO A;  4UUV A;  5LEJ A;  2BV6 A;  3GYH X;  3S3M A;  5M5W J;  3A4C A;  1D8K A;  2GZW A;  4MGR A;  3AKZ A;  3CJN A;  2X0L A;  3VYS B;  2YS9 A;  4Y52 J;  2DO7 A;  4WXC A;  3ZN0 A;  1FYL A;  2MC4 A;  2MLK A;  3K70 D;  3ZPL A;  4HYE A;  2K9N A;  4Y3O A;  4BS9 A;  4CA0 A;  4CDG A;  2GXA A;  4WF2 A;  1FSH A;  4P96 A;  5FLM J;  3KET A;  2QWW A;  2X1C A;  2Y75 A;  3RPU D;  3BOQ A;  1VND A;  3TW7 A;  1JT0 A;  3A1Y A;  3OIQ A;  4BE1 A;  2QBY A;  3C18 A;  5M3M J;  3ZQQ A;  3F8N A;  1X3U A;  1MSF C;  5FRN A;  4AM3 A;  3TGN A;  1Y1W J;  1K61 A;  1T98 A;  3G1M A;  3LAP A;  4A0Z A;  3Q0V A;  2AXT C;  1VZ0 A;  1VQM I;  2VJJ A;  2EIM H;  5J47 A;  4OWR B;  2KHM A;  3CD6 I;  3BP8 A;  2HPM A;  2LBF B;  2NOJ B;  4XID A;  3GZN B;  3CLO A;  2M7A A;  5IT9 Z;  4J00 A;  3ASO H;  2IA1 A;  1PUF A;  5HDN A;  3CLQ A;  3H0D A;  1DU0 A;  3KE2 A;  2Y2Z A;  3SFZ A;  1S7A A;  2WB1 N;  3GX4 X;  2Y30 A;  4L5E A;  2ISZ A;  1X2N A;  2KRF A;  3DBL B;  2Y0S A;  1DDN A;  1TZL A;  4Q4Z F;  5DM6 F;  5BOX A;  2LKX A;  1TBX A;  4N4O B;  1USS A;  2E1M B;  2MLG A;  5C44 J;  4U0W A;  1JUP A;  5JI6 A;  3QQA A;  1TNT A;  3CCS I;  3W2A A;  3KYD B;  2Z3Y A;  1HXD A;  1SD5 A;  2NVT J;  3CO7 C;  2CJJ A;  3WE3 A;  3I4P A;  1BI2 A;  1XTA A;  2YX4 A;  4PGG A;  3PSF A;  5IP7 J;  1DUX C;  4KUM A;  4R8H A;  5FKN A;  3BJ6 A;  3WG7 H;  1LDK B;  1TWF J;  3TBI A;  3U1D A;  2JPB A;  3J7A Y;  2QSH X;  2ZXJ A;  4IHX A;  1X1C A;  3K2Z A;  2HYG D;  3VSL A;  4E7L A;  1YW9 A;  3NAR A;  1K83 J;  2UXN A;  2EA4 A;  4AYB A;  3DP7 A;  3H0G J;  2XVC A;  2MD0 A;  4XLN F;  1EKE A;  2EH3 A;  1FJL A;  1UHW A;  1BOB A;  2L7Z A;  3OYF A;  5KVR A;  3TED A;  2L7K A;  3HUG B;  3KP3 A;  1FYM A;  4XRS G;  2EIN H;  2PX9 A;  3GZ6 A;  5BS6 A;  5GPC A;  2D5V A;  4MEY F;  3V8K A;  1T0F C;  2GAU A;  3L7W A;  4AU7 A;  2DYR H;  2DQL A;  3JAM Z;  2XPU A;  2A05 A;  3LOC A;  4K2E A;  3BG6 A;  3C1D A;  4JX4 A;  4IHV A;  2OBP A;  2BOL A;  1I5Z A;  3FX3 A;  2WY8 Q;  5IP9 J;  1ETW A;  1JTY A;  4RAF A;  4KFC A;  3OSG A;  3S3O A;  1VQ6 I;  4FAS D;  2BE5 F;  3ZN1 A;  2CQ7 A;  2V4J C;  3B6C A;  4M9Z A;  2BXY A;  4KIC A;  4F52 A;  2E7X A;  1FIA A;  4LJZ F;  4D5F A;  2WAQ A;  3P9I A;  2H8R A;  2X1E A;  3KLN A;  5ICF A;  5IY5 H;  4PK4 A;  1R1V A;  2R93 J;  2H09 A;  3S1N J;  3CO6 C;  5HVQ C;  3DBH B;  1T95 A;  2MGQ A;  2JTV A;  2R7O A;  1Z6T A;  3RYP A;  3V7R A;  5HNF A;  1R5I D;  2FUG 2;  2QKL B;  3OMY A;  2I8D A;  4YFN F;  3HPG A;  1O4X A;  2LVS A;  3C3W A;  1BR2 A;  2ICW G;  1MND A;  3OYD A;  4IRI A;  4RB0 A;  2NNN A;  4W97 A;  4IX7 A;  3SZT A;  2Y9Z A;  2H27 A;  2QGU A;  2F4M B;  3CDI A;  4LOC A;  3TKY A;  2NRA C;  3Q9V A;  4LK1 F;  3BG5 A;  1H8A C;  2XAU A;  4RGR A;  1Z77 A;  4ZZL A;  2CQQ A;  1JKQ C;  4LK0 F;  3F8B A;  3NRV A;  2VIX A;  3ERE D;  2OZ6 A;  3T8R A;  4B44 A;  3CCE I;  4J01 A;  5D6F A;  3SZG A;  1X3W B;  3C2B A;  2EV6 A;  2IGK A;  1R5G A;  3KP6 A;  4CH7 A;  4O3M A;  3I4N J;  4ZJZ A;  1F1Z A;  2OCE A;  3RIR A;  4AUX A;  2VQH A;  4IXA A;  2CV2 A;  4G7O F;  3WTY C;  2P81 A;  1IJW C;  1WCM J;  1PJR A;  4ESF A;  4WCG A;  2GBY A;  3HOT A;  1OCC H;  3C2H A;  3T8T A;  2UUZ A;  4DIQ A;  2OCC H;  3IWZ A;  3PSI A;  3V4G A;  5GPA A;  4ZYG A;  4U0V A;  3J7A O;  1QZZ A;  2XB5 A;  3EDP A;  3G3Z A;  4R79 A;  2WAF A;  5ERI A;  5E3O A;  3E6B A;  1O7L A;  1E3P A;  5KAF C;  4ON0 A;  1MH4 A;  1MBG A;  1UZC A;  3AL0 C;  2B63 J;  1IAW A;  3HGG A;  2HDC A;  3KEQ A;  1EH7 A;  2ZXW H;  1SAX A;  2BBY A;  3HG9 A;  1WJF A;  2OA4 A;  2F5D A;  1U78 A;  2LBF A;  1SFX A;  3LQQ A;  1YJ9 I;  1BJZ A;  1NH3 A;  1V3F A;  1B9N A;  4M73 A;  3RQ4 A;  3HOZ J;  2VBW A;  1YLF A;  3NWT A;  2P6S A;  3BCA A;  2VJI A;  2DJI A;  3WG9 A;  2FSW A;  4LMY A;  4EGZ A;  2DDB A;  4P5O A;  2GQQ A;  3MN2 A;  2QQ8 A;  4V2G A;  4XOT A;  3S2H J;  1D8J A;  1S5L C;  1YW7 A;  2P5V A;  1UST A;  2DTZ A;  2E2J J;  1E3H A;  4HNV A;  1W0U A;  2JUC A;  4IHT A;  3DKW A;  3I5U A;  4V2F A;  2CUE A;  4A5M A;  3S2D J;  1OLT A;  4QWQ A;  1J75 A;  4HQE A;  3JRI A;  2FRH A;  2VKV A;  2GOM A;  5EDN A;  4IO9 F;  2VXD A;  3GFM A;  1VQL I;  3QYE A;  1U5T C;  3I64 A;  4B47 A;  2DT6 A;  3QU3 A;  2KP6 A;  5FD5 A;  2Q8K A;  3WHB A;  2VOP A;  3E0J B;  3QAH A;  2IEK A;  2F48 A;  3CDH A;  1LFP A;  1VQP I;  2IRF G;  4BQO A;  2H1L A;  1R1U A;  1G8X A;  1ZTR A;  2FOW A;  3ZR8 X;  4EJU A;  2OTJ I;  4MQV A; 
#chains in the Genus database with same CATH homology
 2DOD A;  2JUC A;  2KFD A;  2KIQ A;  2KZG A;  2L9V A;  1UZC A;  2CQN A;  2K85 A;  4FQG A;  2E71 A;  2DOE A;  2LKS A;  2B7E A;  2DOF A;  2KIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...