2B7LA

Crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
MKRVITYGTYDLLHYGHIELLRRAREMGDYLIVALSTDEFNQIKHKKSYYDYEQRKMMLESIRYVDLVIPEKGWGQKEDDVEKFDVDVFVMGHDWEGEFDFLKDKCEVIYLKRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CTP:glycerol-3-phosphate cytidylyltransferase from Staphylococcus aureus: examination of structural basis for kinetic mechanism.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords glycerol-3-phosphate cytidylyltransferase
total genus 39
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.39: Glycerol-3-phosphate cytidylyltransferase.
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2b7lA00
2JA2A 3MXTA 2V0CA 5K0TA 3FETA 3NV7A 3CLRD 1G8HA 1TYBE 1FYDA 3H05A 3CLSD 1G59A 1G8FA 5KCMA 4JZYA 4F4HA 3P0HA 2A88A 4MUFA 1T9GS 3M5WA 1LI5A 1R6XA 1T6ZA 1ULHA 3TNJA 4AQ7A 1KAQA 2CV1A 3OTWA 2QTRA 1KAMA 1KQPA 1O5TA 1OWOA 1YI8A 1EXDA 3IUEA 3ZJVA 1O95D 5FNZA 3FOCA 1U3DA 4K03A 4YBRA 2GOYA 1H3EA 3KT3A 1M8JA 1QRUA 4QREA 4EG3A 3CVWA 3ZJTA 1JZSA 3FHJA 1BS2A 5BNZA 2GKSA 2J5BA 4DDKA 5HG0A 1OD6A 4BWVA 5H16A 4ZCPA 2HGZA 2H29A 5DK4A 1J1UA 3ND7A 4WSOA 3H99A 5KWVA 1YIDA 2QUJA 3S3TA 3MUEA 1VBMA 1N2JA 1DNPA 1A8HA 2E89A 1F7VA 3GUZA 4KR6A 4NDAA 1IRXA 1MAUA 1VBKA 1J09A 1FFYA 3IMGA 3N2YA 2J4DA 3AG6A 4MUJA 3D6UA 3FIUA 5DASA 1N2EA 4DJAA 3PNYA 2PZBA 1Q19A 4DDMA 2A1UB 1U7XA 3P0IA 1EFPA 1QJCA 1ZH0A 2ZUFA 2CSXA 1LI7A 2QJFA 3SEZA 1D2RA 1T6XA 3AIIA 1EJ2A 1KH1A 1XJQA 2CYAA 2PIDA 1N2GA 2A86A 3PNBA 3Q10A 4MLPA 4R2MA 4DDHA 3ZXSA 4JFAA 3SEQA 4RPIA 4EG1A 2PG3A 4MWBA 3IOBA 1K4MA 2NSYA 2X1MA 3PRHA 3UC5A 2CYCA 2BTEA 1OWPA 1R6UA 2QJOA 1N75A 5H7XA 1H3NA 4YP5A 3IUBA 3RK1A 1I6KA 3TZLA 1KP2A 3CVVA 1NSYA 2YXNA 4WNYA 4ND6A 1S4MA 3Q4GA 1Q11A 3ZXIA 3QTBA 5IHXA 1GN8A 4MAFA 4L2IB 2YWBA 3VGJA 2PFSA 3CA8A 3NBAA 1NUPA 1GTRA 1I2DA 1F9AA 2YWCA 1CT9A 1F4LA 3ND6A 3QE4A 1KORA 1QQTA 3G5AA 4MUHA 3P0JA 3KT0A 1Y42X 4EFKA 4E1AA 4OJMX 1QRTA 2QUIA 2A4MA 2Z09A 3COVA 1KQNA 3UMVA 4L2IA 2WB2A 4MW9A 4GU5A 1UFVA 3FY4A 2R5WA 2IELA 2NZ2A 2CV0A 4MW5A 4I6JA 1WXFA 4ZT5A 2Z08A 3DV2A 3DO8A 3VRHA 1JIIA 1KKUA 4MULA 4EG4A 4R2LA 3SP1A 1R6TA 2OV4A 4NAHA 5DB4A 2YY5A 3MMXA 2VTBA 1OBHA 1MB2A 3COWA 2DR2A 2X3FA 3F3MA 1O94D 3IODA 4U7JA 4DE5A 2PZAA 4MW4A 1JZQA 1IHOA 1NUTA 1JIJA 1M8KA 1N77A 3E27A 4XFJA 1K92A 1O94C 4CQNA 1OWMA 4MW0A 4MUGA 3CLUD 4EG5A 1YIAA 4J76A 1GZUA 1XNHA 2C5SA 1QNFA 3FH0A 4XFDA 1EUYA 2A7XA 4G6ZA 4QBTA 1NI5A 1WXHA 3DLAA 3ND5A 1N2IA 1O96B 4ZT6A 4ARIA 1KH2A 1EE1A 4MUEA 3COYA 1ZJWA 2CUZA 1JMVA 2D54A 3IMEA 3P52A 4Q16A 3COZA 1JHDA 2HZ7A 2TS1A 2WQ6A 2E21A 4EG7A 1I6LA 4KPUA 1WXGA 3A2KA 1IH8A 2DPLA 4HPWA 1J70A 1N2OA 1WQ4A 1ZH6A 3OP1A 2ZUEA 1WXIA 4MVWA 3G6KA 3TQIA 4JXZA 3IVCA 2A1TR 3Q12A 4NX2A 3ZIUA 4DNXA 3INNA 4K0RA 4EF6A 3DPIA 4DLPA 4G5YA 3IVGA 1M83A 4ZCQA 1O97D 4ZT2A 4X0EA 3SYTA 4MVYA 4MWCA 2JAXA 1KP3A 1NUSA 1J20A 3AFHA 2DUMA 2AZXA 4YP7A 2QTNA 4PBTA 3KFLA 4S1OA 3FWKA 3ZUGA 1NURA 1U0BB 3BL5A 1J1ZA 2IJGX 2VXOA 1VL2A 1WZ2A 1H1TA 5LM3A 1O6BA 2WQ7A 2X0KA 1N78A 3GMIA 1V8FA 2CV2A 3FG9A 2VTBB 3ISJA 3TQOA 1PFYA 4U8HA 3N9IA 4PY2A 2PXHA 3HMQA 4ZCTA 1WKBA 4A91A 4XSVA 3AG5A 1RQGA 1Q77A 3IOCA 4YMIA 5KHAA 3UOWA 1QRSA 4MWDA 1O97C 1GPMA 1OWLA 2O5RA 1IQRA 1WOYA 4HK4A 2J09A 1M8FA 5EKDA 2QUKA 3MLBA 1MRZA 1OBCA 3NBKA 3ZGZA 4KKVA 4U63A 3HGMA 4GRIA 1M1ZA 3RBAA 4HJXA 2V0GA 1EFVB 5FO1A 1JIKA 4NZPA 2AKEA 1QU3A 1OWNA 3HV0A 2BYTA 4MVXA 1NUUA 2ZP1A 1PG0A 4FZJA 4MUIA 1X8XA 3U1VA 1G8GA 2A84A 3CVYA 3CLUC 2D5BA 2X1LA 1P7PA 1YUMA 3LE8A 1K97A 1KR2A 1IFXA 1N3LA 1JGTA 3X1MA 4EG6A 1IVSA 4MWEA 1GLNA 3N8HA 1MBZA 3KT6A 2EJCA 4MUKA 4ZT7A 5LLTA 3LOQA 1QTQA 3HZRA 1U7DA 1KQOA 3AL0C 4KPUB 2EL7A 4CT0A 1O0BA 2E18A 3ELBA 5TGTA 1IQ0A 1PFUA 3IOEA 1PFVA 5LFAA 5IJXA 1TYDE 1TQ8A 4G5FA 1TFUA 4ZCRA 1MB9A 1X6VA 3PXUA 3N05A 4MVCA 4MW7A 1N2HA 3L93A 1N2BA 1COZA 3QTTA 3CR8A 3SZGA 4RUKA 3IDFA 2B7LA 1JEDA 4ARCA 2HMAA 1NZJA 3ILVA 4MUNA 3D6VA 5JBNA 2A1TS 4I6EA 2CYBA 1PG2A 2O8VA 1VLHA 1V47A 3IH5A 1WJGA 1KH3A 1O0CA 2AG6A 1WXEA 4OUDB 1YUNA 2PZ8A 3H9BA 5DEOA 2J07A 4H3SA 1EFPB 1B6TA 3K32A 1N1DA 5TEWA 1T9GR 1J21A 3JXEA 4MW1A 1MJHA 1PFWA 1NYLA 3TZEA 4PBSA 1I6MA 1NUQA 3FNRA 2XRZA 3GLVA 5J58A 3CLRC 1ILEA 3CLTC 3A04A 4JYZA 1F7UA 4KR7A 4ZT4A 1M8PA 5J59A 3CLTD 3G59A 4CDMA 3CVUA 4ZT3A 1VBNA 5TS2A 3TS1A 1TYCA 1MOPA 1GTSA 1TEZA 3KT8A 4OUDA 1YULA 1O95C 1LW7A 2JANA 2DLCX 4UZEA 2Z3VA 2GM3A 5HUHA 2QUHA 3A05A 4QRDA 1SURA 1GAXA 4PBRA 5F23A 1EUQA 5J5AA 2CT8A 2QJTA 4AS1A 1XNJA 3HL4A 3ZJUA 4I6GA 5AHWA 2J08A 3FI0A 1K4KA 3AKZA 2IP1A 2CFOA 4TS1A 2E0IA 4R0NA 2OQ2A 2RD2A 1JECA 2RE8A 3UK2A 2XRYA 1MC1A 3RFFA 3RJZA 3SZ3A 4P2BA 2WSIA 3IVXA 1HYBA 3X1JA 3X1KA 1JEEA 3H97A 3CVXA 2A1UA 4Q93A 4YP6A 5TEVA 4MQ6A 1TYAE 1IQUA 3RK0A 3RHSA 3PNVA 4ZCSA 3K9WA 4EGAA 3IMCA 1H3FA 4ND7A 3A4IA 3C8ZA 1XNGA 4J75A 2QTMA 1M8GA 3UY4A 1O96A 3MLAA 1WY5A 2H2AA 4CDNA 3LCJA 1WQ3A 4NATA 2DERA 4HJRA 2I1LA 4F3RA 5HUJA 5K0SA 4KR9A 1EFVA 3HFJA 4EG8A 3L92A 1QU2A 4NAUA 4MW2A 3I05A 5FO0A 3FDXA 3H9CA 4JXXA 3SDBA 1Q15A 1NP7A 2DEUA 1ZUNA 3CLSC 2G36A 3VU8A 4MW6A 2D13A 1U3CA 4UZFA 1JILA 2DETA 2DXIA 1MAWA 1T6YA
chains in the Genus database with same CATH superfamily
2ZTVA 4WMLA 2OCBA 3SIRA 3W3AH 3HO1A 1YNSA 3O82A 3R3HA 4I81A 2TMKA 2Q2NA 1ZNYA 4AYXA 1R15A 3WWPA 2PHZA 5E7QA 4C3VA 2QXYA 1TYBE 2E4XA 5H0IA 1K9VF 1T1JA 2B4KA 3CQ9A 2YQ5A 1TZ2A 3ELWA 4TL6A 4XCXA 1USVA 4IIBA 4O29A 3ZE7A 4B32A 4XCVA 3PDCA 4PYRA 1LI5A 2O06A 3PGA1 1MAVA 2HI0A 3G2HA 4WXYB 2R96A 3GP5A 2OXRA 3ES9A 1RCUA 1J07A 2V7BA 4MR8A 3QG1A 1YACA 1ZD3A 4CM6A 2O23A 3PD0A 3RVBA 3V32A 3CUWA 4BX8A 5HILA 4KI7A 3O8LA 2IZ1A 2P9QA 2NU9B 5FNZA 3CUTA 5E6RA 2DT5A 4K03A 1ODLA 2EIXA 1KS9A 4F56A 5JS2A 5BR1A 3RRJA 3EHEA 4EECA 4TMYA 3UJ3X 5JBIA 3CVWA 5GJBA 3WWOA 3P20A 2GXAA 1E3LA 1KOFA 4BO6A 1A9XB 2P9GA 3BMOB 4HAIA 5IVIA 3UJBA 2DWUA 3CH4B 1I2CA 2NQ8A 2FQ1A 1NT2A 2V6FA 5CB8A 3HCBA 3STVA 5C37A 4LI0A 3HR7A 3BMXA 5LQUA 3S3TA 1CE8A 1VBMA 2FF5A 2HPVA 2EKDA 1SXHA 2F9LA 1PN3A 1QQ6A 3AF4A 3D0KA 3PWZA 1N57A 4YRDA 1FYVA 2YJNA 4NDAA 5FX2A 1N1EA 4UCWA 1NGSA 5DISB 4MIYA 1CDDA 1XFDA 2C5HA 4L0MA 2WHXA 3L4EA 3N2ZB 4ZD6A 1N34B 4Y2HA 4ECAA 2WF9A 1IWOA 3AETA 5CFPA 4H6VA 4ARUA 3R6LA 3REQB 3WISA 4KQJA 1DFGA 1DT3A 1GIAA 2D7JA 4M8KA 2R751 5THQA 1W94A 4D56A 2L2QA 1MF7A 2VDPB 3GV0A 5IC5A 3K31A 1GL9B 4M0CA 4YMHA 4DS3A 1WVIA 4CQLA 3EIWA 4YRIA 4R3UC 2O0HA 3D8UA 3GN1A 1IK6A 3EARA 4FHCA 1AG9A 1PT6A 4UMDA 5EI5A 4K5QA 2UVPB 1DXQA 4TZKA 1GQSA 3BERA 3AH8A 2Z0MA 3PQCA 3T6KA 1XJQA 2HIGA 4CR6A 4DCJA 2Z8ZA 3TJMA 1FIUA 5HM6A 1CR1A 4D9IA 3HSYA 1TKAA 1VL8A 3AJRA 4TRRA 1T0JB 4AMZA 1YQGA 3SS7X 4ETIA 4YHHB 3I9V1 3FOEC 1BDIA 4JL5A 2WKPA 4I5GA 1VB5A 2P4EA 3MT0A 3WKBA 4AZSA 2X8JA 5HCIA 1JF8A 2P27A 4I9GA 1DEXA 1LVUA 3AHEA 4MRNA 3AUAA 5CJPA 1RM4A 4B6GA 4WINA 2O2ZA 3IR5A 1Y1SA 4WDRA 4PRYA 4GOMD 4W8HA 2F1RA 3L6OO 1HEUA 1R9JA 3RARA 3EDRA 3T61A 4NKRA 2Z58A 4IF4A 2XPCA 4WE3A 3ZZNA 2FFHA 3RADC 3BX1A 2AW5A 1WUKS 4M89A 1XD2A 3NHSA 2QTWB 1W1IA 2ZJYA 3DWIA 2E82A 3FYHA 1A88A 4TWIA 4KFSA 3FOAA 5FUMA 1RBMA 1EB8A 1EDEA 1FRQA 3CBGA 4KWTA 2O7QA 4EPRA 2PS9A 4JT8A 2GERA 2WBLC 2QNBA 4CM3A 4JLOA 1SBZA 3JSAA 1ZONA 1P29A 4MWZA 5ARCA 1N2SA 1ZBDA 3A4YA 3LO5A 4JR1A 4R8RA 1ZHHA 3A1EA 3M81A 1NMQA 3P27A 2CUNA 2C2GA 2RHRA 4KO3S 3S2GA 4LDQA 4B6OA 4BU0A 1U8CB 3GT7A 1TKRA 3BUSA 2Q3FA 3KVYA 5EP3A 4ESOA 3RS3A 1JIIA 2AFHA 6ABPA 2RSLA 2PZGA 5JAQA 1RBYA 3KYCB 5KAMA 4UTRA 3LAWA 2Q6LA 4J0KA 4TSFD 1HQDA 1J0AA 1GNLA 4P5DA 5A5DA 1BXRA 5CURA 1MKYA 3L8EA 3B6EA 1CQJA 1II8A 4BECA 4DMGA 4I8DA 1XZMA 4UXIA 1BH2A 1ZHOA 1ICEA 2ZYRA 4UM7A 4YJ3F 5T41A 1FJHA 3D8SA 2X1HA 2PUVA 3NTOA 4F72A 3KJQA 4RLFA 2WTNA 3FPAA 1MJNA 2YV5A 3G23A 4LQ4A 2BGMA 4JITA 4U7FA 3BL6A 3BCRA 3LI2A 3UVEA 5JCJA 5JRZA 1VKOA 2YMLA 5A03A 4L4YA 1OWMA 2P3LA 3D7SA 2FZLA 3CEAA 2IOFK 4YJDA 3UYKA 1DX6A 1RAGA 1KO4A 1XNHA 5K6TA 1M1YE 2JFNA 4DVJA 3JQ9C 4JEIA 2QQ5A 3SHQA 2A7XA 1Z74A 3DLPX 3EVNA 4KIFA 1LPPA 1I4DD 3JYPA 5E0OA 1ORHA 5DSTA 4CIYA 1PYDA 1F38A 5ARDA 3ZV6A 2BGRA 4AJ1A 5JNVA 4G41A 1WD5A 5BMVA 3I73A 3FB1A 1O96B 2Y3IA 3MWDB 4Y2VA 4HX5A 3SXUA 1P7WA 4ARSA 2ZRCA 4HLCA 2IXDA 4Y2UA 3AVWA 2OZLA 1ORDA 2XITA 3OQHA 3Q6IA 2D54A 2R4UA 3AU8A 1PGNA 3E35A 4LDPA 3AKYA 1BAPA 4BLOA 4YVFA 2VH5R 4FHZA 2WJJA 3DMNA 4IGAA 4HDRB 4BS9A 1KAOA 1DEHA 2VNHA 3AB3A 3UF0A 2VTDA 3U4IA 3WWZA 3DOCA 4JR2A 1U6IA 1QMPA 3K4HA 2NXCA 3L77A 3N0VA 3WGMA 3CH6A 3KTOA 3PFCA 4Z4HA 2BEKA 2YY6A 4PC2A 3PHBE 5C7YA 3QY0A 2OBLA 2HXSA 2V1XA 4JH0A 1K6XA 4EI7A 4NRDA 4LMRA 5SZKB 3OP1A 1NQWA 2RHLA 4R7GA 1RKXA 2HFJA 4LYAA 4XGRA 3OHMA 4YMSA 2WABA 3AYXB 1BD3A 4N3CA 1POWA 4D4IA 2DKNA 2H1WA 2PBRA 4F9TA 3WS7A 3IQIX 4P4NA 4S0XA 1ZZGA 2ZI4A 3M1AA 5AVYA 1SXGA 3HR8A 1T6BY 4JC0A 3IVGA 1GV1A 1CYDA 1NRJB 3UV7A 1HOXA 5JJ5A 3A25A 4C9BA 4X0EA 3I53A 1I3CA 4MVYA 1FP2A 1SHJA 3DNPA 3I62A 1G19A 1GY8A 3I28A 2PKRA 1AZSC 4RTPA 4LPSA 2QRGA 5A9RA 3OFKA 3I2GA 3AFHA 4HWTA 2DGDA 2HUPA 2Q3DA 4EG0A 1DCTA 3OJ0A 3CLKA 3CNQS 4O2BF 2HSEA 2PQ6A 1C0LA 4EL5A 4J0IA 1E4EA 5CIWA 4YTEA 4BRZA 4Z8XA 3CGWA 4FK8A 1XWFA 2XUQA 4B81A 1LPNA 4MQLA 1CG6A 1XU9A 4IEFB 1HX7A 3PEWA 2V5UA 4NZ9A 3G9XA 2WQ7A 3QVGB 2NAPA 2PMBA 1EX6A 4H17A 3A36A 3EA4A 1L5VA 4KBFA 2HMSA 2VDWB 4MKFA 1KAHA 1J23A 5KQSA 1S2IA 1BKDR 3PFIA 4QDUA 3ET4A 4IFEA 2D74A 3BSSA 2HKIA 5DHUA 1SKYE 1Z73A 2AG8A 3ZLTA 3T7IA 4YRSA 4YMIA 3W1WA 2P4QA 2B1IA 4U9IS 4YCNA 3TZKA 1XQ1A 1CJVC 4KXVA 1JA9A 1CW2B 1O97C 4QEZA 1R4ZA 2P6NA 3ETLA 2M6KA 4AJ9A 2HK6A 1GPYA 4GUAA 2FPOA 3MBOA 3KLNA 3ECAA 1A8QA 2ZI9A 1YZNA 4WDQA 1PG5A 3T1NA 5TXGA 1OBCA 1ZXBA 3MWEA 4ZP1A 3H75A 5ILGA 3BRQA 3LXUX 3CF4G 4I4NA 2ZE7A 3HGMA 3M49A 3KO8A 1GQYA 2H7CA 2HQ1A 3IPAA 4A0GA 3L40A 4MYUA 4TLBA 3EGEA 1P1HA 1E9EA 3ADPA 3GCWA 3U19A 4MYSA 2I99A 3PRYA 3QU4A 2FUKA 3AZQA 3PICA 1QXSA 4A0RA 1Q1AA 4OF4A 1VPLA 3E1SA 5LQAA 1NXQA 2ZTMA 1COWD 1S2OA 3L7DA 3M5PA 1F1BA 3ON5A 4N7MA 4Q3BA 3JQCA 4U0KA 3RTCA 3UHOA 3ZZMA 1WCWA 5JC1A 5J1TB 5FEMA 1YQQA 3J7AC 1QKKA 1JR3A 1X7XA 4OB7A 4C5BA 5FWAA 2EJCA 1ZCAA 3LOQA 2X2EA 2YCLA 3F8WA 2ST1A 4O63O 2P67A 1QLJA 2V7WA 1KQOA 3CJRA 4RV5A 2O57A 5BOVA 3SQOA 4GMFA 5BWOA 1JIQA 2EL7A 2FZVA 4CT0A 3QNWA 5KYYB 5F2OA 2Q0QA 2OECA 2VHEA 2ZAGA 5HJEA 1WW3A 3AEQB 2ZWMA 1J25A 1V4NA 1SKBA 4FM9A 1KHHA 1RYHA 2A0UA 2DQKA 1WXWA 5IP5A 5BY2A 2A58A 1DT5A 2BLNA 3R5TA 3NYQA 1XKTA 2PKCA 4J1QA 3RRYA 4DRYA 5E7JA 3MINA 4GUDA 4NU5A 4HKTA 5EHNA 1KA9H 1ZUHA 2DUJA 4YR9A 5HZKA 2FY8A 1W25A 4AG6A 3NNDA 1ADFA 1OXMA 2VHTA 3H4VA 3HUDA 3TWOA 4YXWD 3OCUA 2ZRGA 4V38A 3WWEA 1MXFA 4QUDA 3ROGA 4WY5A 4W5NA 1SVOA 3BN3A 3CLVA 3PXBA 4YFYA 4I6EA 2ZUWA 1JJIA 3P9NA 1NQUA 1WF6A 2PKEA 4JASB 3I3OA 5E9JA 3VC7A 3WMRA 4L9AA 5EJGA 5KTRA 4G0WA 1HO3A 1NLUA 4BB0A 2IV7A 4G5SA 5KYGA 4DJDC 4OUDB 1A8UA 2RGCA 1Z12A 4V0NA 1M2FA 1U4SA 1ECCA 4L95C 5GJCA 3R74A 1NRIA 4O4JF 3SBOA 3W7AA 3I92A 4ZA2A 2EG5A 2NMVA 2JFHA 2QZSA 3W3AD 4NJMA 1IZ9A 1ULSA 1KSGA 4FB5A 4G1FA 3BZUA 4K9RA 3KQTA 2PU5A 5K3SA 3CLRC 4V0SA 3NGLA 4BYMA 2ZYSA 4KQCA 2VQFB 4FYXA 4TYYA 1HEIA 2A7QA 2Z43A 3OQVA 1H42A 3IE2A 3Q0IA 1OR8A 3RS5A 2ZJOA 3UUWA 4BGUA 2PPLA 2BE9A 1JWAB 2EW1A 4LUCA 5T67A 5A4DA 5L3SA 1VYHA 2C3OA 3GEDA 1CR6A 1ZIDA 5LOVB 2C98A 3DZDA 3HTXA 2E48A 3TS1A 3D2LA 1F2UB 2W2QA 4FC6A 1CRQA 3Q2OA 1G5PA 4ZV9A 4OUDA 3EN0A 2VATA 2PMFA 2C4NA 3V1LA 3A28A 3Q2IA 3OJLA 4QOEA 4CM9D 5CA1B 2DLCX 1D1SA 2WNIA 1R0CA 2R85A 2YVLA 4MVJD 5CLIA 2P9TA 2Q3BA 5B1EA 4O02B 4OMFG 3VYWA 2E1PA 1XEWX 3E8XA 5KYWB 3DFKA 4GECA 5DI3B 4HAUA 2YXPX 4BPBA 4UTXA 2C1EA 5THKA 5IMSA 1EXNA 4C4TA 5B2ZA 5A5EA 5AW3A 3RR2A 4DV7B 1TXGA 3GLTA 2I65A 4ODIA 3P9QA 1QPBA 2VPYA 1CUJA 1ZIXA 1VE7A 2AVDA 4PPGA 1EHIA 1RR6A 2Z6VA 4TQUS 1FX1A 1IY1A 2QZ4A 3FI0A 1BE6A 4QFBA 3REOA 1AH2A 1Z75A 3PHCA 3GZNA 3MIIA 1DDGA 1KPHA 3MHTA 3RHFA 1KK0A 2NUPB 4LYHA 2VJDA 5GONB 5EKTA 4EQ6A 1Z4KA 3OIGA 3AR4A 5HOEA 4W5OA 3ZDCA 2QIPA 5K8TA 1CY4A 4OGWA 2DMRA 3HCWA 4RS3A 3H2IA 1KMQA 5KNLA 1IMJA 1BC5A 3GFPA 3RFFA 2IHJA 5CT9A 2ODAA 4UUMA 2IBSA 2JGMA 2ZRHA 3LBHA 5A1JA 4WOCA 1P0QA 3FKJA 4TPKA 2YZNA 3ZDBA 2AOXA 1S96A 4OHKA 4JQCA 4CQMD 5F3DA 5D5QA 5CM2Z 3L7JA 1Z28A 3UAXA 4PWYA 3VDNB 4EP1A 1N8KA 4JN6B 4YP6A 1WDKA 4UHBA 2MSLA 3H11A 2BGTA 4CKBA 1UOPA 4HAVA 4PTYA 5F73A 1F8XA 2B3TA 5PGMA 1JDSA 1JEQA 1ODIA 1YOBA 4MGYR 5KKCA 3VJLA 1FSGA 1XTRA 2JD0A 3LKVA 4OHUA 3WIOA 4C03A 3JYQA 5FNVB 3BWBA 1TDJA 3JW8A 4KE6A 3E9QA 4GPIB 1Y6ZA 2AD1A 3NHUA 4QOSA 2N3ZA 4YRZA 5I9TA 1SPBS 3K70C 1FBNA 3BAFA 1YRBA 4Z1MD 2H2AA 1ZWLA 4YC7A 1F2DA 3CJTA 2PYIA 3L8DA 4TKLA 1OH7A 1K75A 4MI9A 5JG7A 4B75A 1V1MA 3BFPA 3OJOA 5AKLA 5DPMA 5ANRB 4HEHA 5JFOA 5AHKA 4MW2A 1HM5A 1I5EA 4CTNA 1KU6A 1ST2A 4JS0A 2EFHB 2ZUCA 1XZAA 1Z2OX 1WCYA 1DKRA 4MWGA 5H59A 1NP7A 1GWNA 3SDBA 3WRXA 4CMAA 4F21A 4YV2A 1CHDA 2DEUA 2WFMA 2L17A 3CLSC 5MGBA 3SNKA 1SAYA 3B8HA 2OGWA 2G0NA 2QP4A 3WK7A 1EIWA 4TWAA 3WWDA 3ZE8A 2PCLA 2RJ3A 5DBOA 4CM4A 3M83A 3VUFA 1DQYA 3QSGA 1AKUA 4XSGA 1U0JA 3WLAA 1R6BX 4OIMA 1G8HA 3KOYA 4RJTA 5C5EA 5K45A 2XVZA 5FL7D 3BEOA 3ECSA 3KUUA 3MS4A 4DXDA 2XA1A 1Q0RA 1M66A 1P33A 3UH1A 2OAP1 2IFTA 2OO7A 3LRTA 3TNJA 3A2LA 2Z57A 5G4LA 1GFSA 3W9SA 1JA0A 2C4TA 4Q9NA 5E1DA 3HJUA 3KXIA 1S5PA 5E6SA 4E5SA 9MHTA 1XAIA 2JS7A 1KARA 3LT0A 3O3NB 3V3TA 2IDKA 2UVQA 4NP6A 5LFAA 4LK3A 3DMDA 3PTZA 2HHHB 5F4BA 1E94E 1PBTA 1UKZA 1Y5MA 2G09A 1TZMA 2GXSA 4MPJA 4MMYB 5DNUA 5E38A 3RU9A 1NVUQ 3KPYA 3LX5A 1DEOA 2F3TA 5IH7A 5JBQA 2ZXUA 2WDZA 2ZJ8A 3KZVA 4XWYA 2O2JA 4DBZA 4MV9A 2Y1XA 1OD6A 1RZVA 2ZCJA 3IXMA 1J1UA 13PKA 4JLJA 3F5MA 5KWVA 1SXJD 1AKMA 2H08A 1P62B 4UAJA 2QUJA 1TUBA 5DP1A 2VI5A 1RYZA 1DNPA 1XZPA 2JAHA 4NFLA 5LD2C 3KVOA 4CN9A 4G85A 1CJSA 1YZUA 3FPCA 4LGVA 3JQDA 2ZS8A 4XIYA 4COKA 1VMKA 3AF6A 3EVZA 3SQMA 2J67A 2OT3B 4P7KA 2HK8A 5LR6A 5HX7A 2ZRIA 1MMFB 3FIUA 2R44A 1PJZA 3JD0A 2V7TA 2JIZD 3KSUA 3LW8A 3FNIA 5CVCA 4Z0TA 4XX0B 4NPAA 1GPDG 2GKOA 4KRGA 3T5GA 5FD8A 1R2QA 4CMIB 4FE4A 1QJCA 2Q99A 3DDNA 1TX4B 1ZH0A 1LRKA 1U0RA 2GX6A 1EAMA 1ZOPA 3SI7A 1GTMA 1KDVA 4ZYTA 1D2RA 1YTLA 2WM3A 1T6XA 1G64A 3C14C 1PJTA 4FFBA 4ZI5A 1EDZA 1EJ2A 2X0DA 2RD2A 1KVUA 1HYEA 3ZE1B 3UWOA 1OHHA 3ZXSA 2FE4A 5DFAA 4C0QC 4C21A 4ZYYA 2ATVA 5CXUA 3ER8A 4MUXA 3G8AA 1Z2CA 2VAWA 1K4MA 4K6KA 2V8OA 3ESXA 3BG5A 4MS3A 2BTEA 1JEOA 3C4JA 3BQ9A 1JZTA 4WOPA 4JB2A 4JLKA 2C2KA 2FPXA 4FMBB 3UT5B 1XQ6A 4UBMA 2IRWA 3G1TA 2ZU6A 5LQDA 5AJWA 3WLPA 3AFMA 1GKLA 4E11A 2EVWX 3VR5H 3WAKA 2ZSHA 3DULA 1RZRD 1RHRA 1DBWA 2EFJA 1WSWA 1CZKA 1JBEA 1PT8A 2I7TA 3A37A 3V48A 2UXCB 4U6SA 4U2BA 1Y5LA 4RM3A 3GD5A 1IL0A 3AHDA 1WUIS 2FR8A 4J91A 2WZBA 2FSHA 2OD7A 3KSBC 3I0NA 4F4CA 3M1YA 4BGDA 1XSEA 2HBRA 2B94A 2AFIA 1O9BA 1XRRA 1ZK0A 3BE6A 3WNDA 4G56A 2FMTA 1U8YA 2OAGA 2XA9A 3DZIA 4EEXA 1U4NA 1Q91A 4RETA 3OCYA 4B73A 3WYDA 4EFKA 1SCBA 2HLDA 4UEOA 4YRCA 2X5KO 1KJJA 2WMNB 5F78A 4CG1A 4US0R 2WIAA 1CU1A 4AKIA 4MV7A 4YUYA 4C0LA 1UDWA 1O5IA 1UFVA 2Z98A 1G2OA 2JDIA 3LUFA 2P9EA 3N2NA 3HRHA 5EWMB 3W77A 2E87A 2YJZA 3BK1A 1FEZA 3RVKA 1M72A 1ZINA 1UIRA 4B7XA 5E7MA 3VRHA 3HJCA 3E1GA 2WZCA 4DKXA 2ODQA 3IEVA 5DM0A 3GNQA 3FJYA 4A5SA 3ADOA 3GRYA 1MHTA 2H4ZA 3L1JA 4I19A 1QHSA 1YTUA 5D87A 2VDMB 3KS9A 3L4KA 2GTHA 3WL7A 1TCUA 2ECOA 2JI9A 3JZDA 2GEBA 1I4TD 4YMVA 4XB1A 1E1QA 1W19A 1XL0A 2FB9A 2HK7A 2VQEB 2H0AA 2J0EA 1USKA 1GPAA 2P8SA 4FYJA 2VEDA 4LSMA 1XMIA 5EMLA 3DAHA 2FN4A 4IZHA 3SX0A 1G6KA 1UT8A 1VJTA 1Z0UA 4HGZA 1FFDA 1ZMOA 3EAQA 4LRSB 4HZUA 4S2UA 1P9LA 1DC4A 1YHNA 4XUCA 3EH1A 2IUFA 2FQYA 2JVKA 3QE0A 2HDOA 4QXMA 1RAFA 1NI4A 4YMWA 4AS3A 3SS9X 1DWOA 2Y99A 5BN3B 4OTZA 1E6MA 1QNFA 5GY7A 3SX4A 3OU2A 4OJNA 3V8VA 2QZ9A 3K72B 3KPVA 4C0WA 1O77A 4P9NA 3U3DA 5KNBD 4EARA 3GXOA 4RPHA 3QVMA 4URHA 4EJFA 4IJVA 3GVIA 4UHFA 4Z4CA 5K0EA 4WADA 3AHFA 3B6MA 3LGXA 4OSOA 1OQAA 1XD2B 2YWEA 1WXHA 1NV8A 1LLUA 1H1LB 2EKPA 1CCWA 1D9ZA 3I5XA 2GBGA 4ARVA 4R16A 5J5CA 3OP4A 4KMOA 2Z9BA 3GDFA 3LTEA 3K0CA 3MPUA 3GELA 4FT4A 4BO1A 3EZ6A 3T9CA 3OQMA 3A9UA 4I5IA 1S01A 3H1TA 5TMEA 1B3RA 1CZHA 1Q92A 2DBYA 1UZMA 1F8YA 1Y5NA 1O57A 3PIRA 4JL6A 4RTSA 1RLOA 2Q0HA 4KHZA 4ER5A 3IEMA 3GAZA 1IY2A 2IA5A 3QXHA 2BI7A 4HQ0A 2X8JB 1L4MA 2G67A 3JV7A 1XVIA 3DXYA 3ASUA 4JBHA 1CSEE 4LNHA 5L6LB 5PNTA 4J3JA 3BF7A 4KDRA 3EC7A 2C42A 1ENYA 1U3UA 3F5SA 3KDPA 4LJ8A 5KOIA 2ARKA 1GUAA 1KI6A 1NOIA 1XKXA 4EW2A 4ITUA 4FOPA 4B84A 3V7WA 2XZOA 1HETA 4PYOA 4HPWA 4XPIB 1IDOA 2OO5A 3C7DB 3D3NA 2OCGA 3HJAA 5LQCA 3CZ4A 3PYLA 2O3SA 4ALNA 2I3DA 3A1VA 2I87A 3NBXX 2UUPA 5AI9A 4ZXFA 4B4OA 5B6IA 1NAHA 5H1YA 1L7EA 4QUGA 4W1QA 4IGIA 2LPMA 2IW1A 1V3TA 3Q7EA 4TUYB 1XVVA 3H2YA 4F6LA 3VX3A 2WIKA 3KU1A 4E5NA 1BFDA 1Q0PA 5EMJA 1YA6A 2EERA 1NT4A 3QU7A 3KG2A 3LHSA 3RIEA 5KJ1A 2BCEA 4Y2YA 1T2VA 3VZCA 5HW0A 2GDJA 3QUSA 4LNAA 4EOGA 4GEGA 1OV6A 3E2IA 2CFSA 1O6FA 2I1VB 4IMRA 3ZBQA 1RHQA 2YQ4A 4LZOA 2ZDHA 2WUGA 3ICCA 4X65B 1R4MA 4B3TB 1VHWA 1BHJA 4D7AA 4O4LF 5LBIA 3T1YB 3SJCA 1ENPA 3LZ6A 4EPXA 5BVHB 3R8FA 4PPYA 2XKAA 5CUQA 2GEFA 5CX1B 4EPYA 4RKFA 1RXWA 4GKJB 1ZVMA 1A5AB 2VNJA 1DAPA 4HGOA 1HDOA 2PQ0A 2VXOA 1OX4B 3I76A 3TSWA 3VR2D 4DSTA 4KLAA 4RD1A 1XLVA 4E2YA 3VTAA 5JXWA 4M7RA 3GMIA 4JJZA 2R60A 1ZY2A 2VTBB 2PCJA 5SY9A 1Z4JA 2FUEA 4KWCA 4QVKA 1QWOA 1U65A 4RDIA 2IIBA 1QV7A 4UQPA 5AVVA 4X6LA 2QYSA 1JFFB 2OVBA 2YH2A 3QW4B 4INJA 2Q1SA 4JQZA 3ZNOA 4C4PA 4E88A 4DA4A 3HCPA 4I1YA 3AG5A 1JR2A 4BB6A 1SU6A 4IRMA 2CXUA 2XDQB 2ZR0A 3QKRB 1XN4A 3IEUA 4PAMA 3VPCA 2AZ4A 4QTTB 1RPTA 5KHAA 4Z1OA 1FMCA 2QAGB 4JKOA 1HC7A 3NNSA 1YGPA 3O47A 5KOHA 3WGZA 4HN9A 4V2UA 2XYPA 3NU1A 4YN3A 5BSWA 5HR5A 2D5CA 4EUSA 5IT9A 2UDPA 4ASUA 5E95A 4BRUA 1XZQA 3BDVA 4Q4DA 3ILYA 4CDRA 3LC7O 3ZLJA 4P92A 1G9XA 1Z0IA 3O84A 2I6TA 3ZIDA 1DQPA 1M0SA 2NPIA 5DP2A 1JE1A 3L4BA 2VJMA 5BVGA 4GNRA 2X4LA 4DV3B 2DKFA 5H80A 1PG0A 2ZBFA 2C3UA 2IEBA 1P5FA 1IN6A 4BFTA 4NJMB 3ESBA 5AKGA 5TNXA 4BC1A 5A4IS 5J1SB 1Z4PX 4LMBA 4QPCA 5EE5B 3VYVA 2VYCA 3X1MA 4G0YA 4C20A 4QODA 4GWGA 1CZUA 2NTNA 2YV4A 3F49S 5IC6A 4AWBA 8GPBA 3TNDA 1G291 2WVAA 1X9IA 1CUIA 3TIVA 1U5BB 4M60A 2W2KA 6PFKA 4KLZA 3DTVA 3NCTA 3WSVA 3JD1A 2JLQA 1M0WA 1I80A 1PJBA 2HCBA 3UUFA 1B6SA 2P2CA 4YA6A 1V45E 1W48A 4KAJA 3ELBA 4R54A 3OPXA 4X24A 5LNK1 1T2EA 2SICE 2FLWA 3LPDA 1IN1A 4YV1A 3PC6A 4RVDA 2APJA 3ZTTA 1XMVA 1LPBB 1TKCA 3EEIA 1TFUA 3GPDG 1QFZA 1HSZA 3N74A 5D3MB 2MMCA 3ULKA 3ZU6A 1FLAA 1PZXA 5I4CA 2ADMA 1N2HA 1SRRA 1N2BA 4MB2A 2OXCA 2ZTLA 3V8QA 2HOQA 4I4TA 5IEBA 5KQPA 4BEVA 2I6GA 3EGXA 4OGKA 5F7ZA 3LDUA 4ARCA 1M74A 1Y5IA 4QNMA 4AIIA 1AS3A 1GUZA 1NNUA 1DKQA 2WTBA 3ZWPA 1QHHA 1AIPA 3LPMA 4EUHA 5IF3A 2CYBA 3T5PA 1VLHA 3P2OA 3SJZA 3ZI7A 3D5TA 1W0KD 1K86A 1YHYA 3HVUA 5AICA 4C4OA 1O0CA 1OI7A 1P9OA 2FSVC 4LTMA 3GLHA 2P9JA 1TF7A 4YRFA 1YDHA 2H54A 3RSZA 5KS2A 1WPQA 1NBOA 3C0KA 3V4LA 1LDNA 2OY0A 1X92A 1UPAA 2GI4A 1J21A 2FXVA 4JLBA 4D46A 4GRDA 4W99A 4AP6A 1O6CA 2GASA 4ILEA 4NBUA 2PL1A 2XVMA 3NYIA 1ZR2A 1SUBA 4N65A 2JPDA 4R9UC 1DWPA 2YWFA 1GYPA 3AJ9A 4E2XA 4UTPA 4QGGA 2YNMD 3DYVA 1KDPA 1ZI6A 1BQEA 1REQA 4HUQB 1M8PA 1O1YA 1P9RA 2BF7A 1TJYA 1WMSA 2VDLB 5AI8A 4FBGA 5K4GA 2QTHA 1GP2A 1MVOA 3O3MB 4ZT3A 1KTIA 4M55A 2F17A 4B6PA 1JLLB 1CUXA 4JROA 2DKOA 2O3JA 4HCJA 1O95C 1Q7CA 1DQSA 3D2BA 4TV8B 1ECBA 3CRQA 1C9EA 2X19A 3DHEA 1EBBA 4UZEA 4P32A 2Z3VA 1UFKA 4PSAA 5A5FA 1ZP6A 3R09A 5FEUA 1C1XA 1J0DA 3ESDA 2VK1A 3BHJA 3AR7A 3E9MA 4HLNA 4E5VA 3C6XA 2J3MA 1GGKA 2VHCA 2ZT5A 1XZGA 2AEMA 2Q3HA 5HRUA 1FDSA 3H2JA 1NXPA 3HKBB 3HZHA 1E6UA 1TLFA 3WRVA 2DTXA 2DUNA 4R05A 2ZUBA 1AKNA 2CSUA 2YJ3A 5LBUA 4LEIA 4K87A 3D7RA 3JY6A 4LHVA 5CTJA 5L7YA 3BA1A 1NXVA 3WAJA 4R2JA 4LS3A 4RV9A 1JAHA 1IHYA 4JI7B 2Q5IA 1P1CA 2IYZA 3KJGA 1HFJA 3T7RA 5HGJA 1FP6A 1B00A 2ZJ0A 4EH1A 3G2QA 4DYDA 1P81A 3GP8A 1GL6A 1T3SA 5JD6A 3N2IA 2X22A 1UCFA 3DBLB 2FJPA 1W34A 1PFGA 1MPTA 3E22B 4BNYA 1LQTA 3F74A 4BJ5A 1YJQA 4QTXA 3D7KA 2ID7A 1L7VC 1BMDA 1E5LA 2H18A 5BSUA 1YR2A 2O3QA 3GFTA 1RTTA 2N47A 4R84A 3ONVA 3AJ8A 1DSSG 2Q2VA 5DDIP 2PVSA 3QYAA 2XB6A 1H8ED 5E0KB 1TTQB 4OI2A 3F9RA 4K28A 3V2IA 2Z2XA 3X1WA 3HBFA 4GF5A 1OROA 1LXCA 3R3ZA 3WA7A 1U11A 2Z5FA 1SRQA 2Q2OA 3CEJA 2HF9A 3BCHA 3LK6A 3WLNA 1RWBA 5L8VA 2GFQA 3FJ1A 3GNLA 3W6OA 4J75A 4RTRA 1BXGB 2FHPA 5FOXA 4GDFA 4B6QA 1T1EA 1EEXB 1UBHS 4IIJB 3E5MA 4ZYWA 4QTUB 1UL1X 4LOKA 5FWYA 2KI5A 4HWPA 3LGSA 1C9JA 5EFZA 1T91A 3AV3A 3PJGA 8ABPA 3PFBA 4W4TA 4MRMA 3L92A 1QVZA 3WHPA 5JXJA 4D26A 4PVCA 4J1SA 3VHXB 1BQ4A 2J41A 1GG8A 4XTRA 1F6WA 4CU2A 2JG3A 3GFFA 2VYVD 2WWIA 2QLLA 5JHGB 3AERB 3R77A 1LLDA 1ZUNA 1NM5A 3S99A 2VXYA 2X4GA 4IQFA 1DEAA 1U80A 2YV3A 2OXEA 5BPHA 2WVHA 4ND8B 1Z6QA 2CEKA 3NHWA 4QHTA 3Q8LA 1ORVA 1PK8A 3IAM1 2JLRA 3F0TA 2G28A 5IDQA 3JU3A 3QFFA 3WZ2A 4FVTA 4OL0A 2QN8A 4M9ZA 4NL4H 4B35A 2I3ZA 4L3VA 4RMGA 3VC1A 3KKEA 2ZTSA 4WL0A 1XCGB 2RI0A 1ULUA 3OPNA 3UHFA 3CLRD 2QMQA 4LNUA 2QL6A 1E99A 4U0JA 5C51B 1MRNA 3FWHA 1WDTA 1N5LA 2A67A 4LC1A 4PVDA 4A36A 4HPXB 2HA0A 1T9GS 2CJPA 3GQBA 1GA6A 4FIDA 5CLLA 1IZZA 2VT2A 1V16A 5IBQA 2PSHA 1SKQA 5MN5A 2QTRA 2IPLA 2CV1A 6REQA 2RAPA 4E70A 2Q0SA 1A77A 4R98A 5ICMA 2FVYA 4J3NA 5AM3A 2DWOA 2B21A 1Z37A 2ZYVX 2EW8A 2O2YA 3AJDA 3CNLA 4BASA 1RMTA 4MJ7A 2HEGA 4KSYA 4XD7A 1Y6RA 3LKBA 1FFEA 4IH4A 1TF5A 4ZJUA 3L82B 3QBDA 1HY3A 1Y4SA 1V95A 4LE1A 2D06A 2PGOA 1FRVA 4TTPA 2M6RA 5HG0A 1CF4A 5HE8A 2XBLA 5SYMA 4GKKB 1VL0A 3A6FA 2Z04A 2PA0A 1K06A 3AVOA 3JRNA 3ND7A 3NDJA 4L50A 3UGTA 3U9SA 1ZH8A 4D6XA 3QA3E 1DKPA 2WJ6A 4YUVA 2JFZA 4UNPA 2HBQA 4Q00A 4OFXA 3GVPA 3R20A 1ND6A 2WZQA 5HKLA 1T2DA 3EVAA 3IIEA 3W2IA 5KYVA 3WFZA 4BFVA 3UHPA 5BWLA 1ENZA 2DP4E 1XTTA 4D80A 4G9EA 2VXCA 1EBUA 1UXKA 2WFAA 2WDPA 1HURA 1T5BA 2TECE 4MARA 3IKJA 3OKAA 5BMOA 2EHDA 2PZBA 2IYRA 3MMPA 5CD1A 4R5HA 2IXEA 2YZGA 1VECA 3ZE6A 2A4KA 2ERXA 2G8NA 1IC6A 3T1QA 1GUBA 3MWGA 4GQIA 2WWYA 2EZUA 3HL0A 4GS5A 3FOFC 4EDHA 3D6AA 3LXMA 1Q1QA 2VUSA 3HB4X 2GK3A 3JVUA 3K8ZA 4R0MA 4HDSB 2CFCA 4LY0A 5DW0A 3GRAA 4IGKA 2CFRA 1NVVR 4QWWA 3B51X 4S1VA 1F0KA 2FJUA 2IZZA 1Z22A 4AJHA 4ZOCA 4AKGA 1FMLA 3D6HA 4RANA 4YRBA 5KU1A 16PKA 3VR1A 2VIIA 3IOBA 4UVIA 3QHAA 2YYAA 3PVCA 4CM5A 5J4HA 2XEXA 1R0KA 1VGVA 1ES9A 2XQIA 2YIDA 4HP8A 2BM9A 3UATA 2ZBGA 2ZUDA 4LI3X 3X1ZA 10MHA 3AGPA 3OT5A 3TZLA 5IUJC 1EGVB 4BNWA 1NNSA 2VPWA 3O4VA 3SZOA 2HYDA 2WHPB 3HU2A 5JMTA 1MG5A 1YVPA 4OLFA 2QYHA 1R8SA 1TVCA 2YWBA 3FVWA 5CA0B 4Y9RA 1DDIA 3NBAA 1H2YA 3T7CA 1KFBB 1CT9A 2RI6A 4A7PA 3PLAE 4O1MA 3ZDYB 4FBLA 4NBSA 3TI7A 2WJHA 1HTWA 1XG5A 3E9DA 5E4FA 5KPJA 2H4YA 3BFVA 4BLSA 4UQLA 2HD4A 4R71A 2YUTA 1TTHA 3TLBA 2J7PA 4C1NA 5BYJA 4LJRA 1U9CA 1UK7A 1X8KA 3IIJA 4G5XA 2BUCA 3COVA 1A95A 4GPAA 4AXXA 1FUKA 4UEQA 4B6SA 4C0SA 5TVGA 3IALA 1NULA 2O9JA 4G89A 5FQNA 3KPWA 2IELA 3RYIB 1PTKA 1J0EA 4I6JA 1KMHA 3IS3A 3OCWA 3QPDA 4ACBA 5BMVF 2PSEA 2ZBUA 2OBYA 3M1IA 4HNAB 4R8MA 4YJFB 1IN5A 1P75A 1BWQA 2V1UA 2XCQA 4PGHA 2HJVA 3SP1A 1DU4A 2X6QA 3U4HA 4URYR 4MO2A 3JRXA 3DHVA 3OZRA 4QPZA 4CJXA 1RP1A 2J9GA 2TMDA 4EKIA 4WCFC 2HZBA 3ZX4A 4A0HA 4ARZB 3COWA 2QAGC 2HMYB 3CWCA 4D9CA 4D5EA 5FWNA 2HL6A 2BR3A 2JFYA 4XI9A 4RJ2A 5IM4F 1NUTA 5D84A 1JIJA 1O0SA 2P65A 1WAMA 2VHZA 2WE8A 2Y6VA 3E22A 4KOAA 2Y0DA 3BULA 3N0WA 2X23A 1UPXA 4FW9A 4KXQA 4B6RA 4CM8A 3GT3A 5DJ5A 5FR1A 4UBOA 1TK2A 4I2VA 1UWVA 1DOAA 2X0IA 2NVOA 4H16A 4ER6A 2FKNA 5ESDA 1U7ZA 4XYLA 4AW9A 1JDJA 4EO7A 4ALIA 4ZALA 2VQDA 1NQXA 4A03A 1YFLA 2XWBF 4PO1A 3RIHA 2INGX 2FKAA 2R2GA 3CEHA 4ZAZA 3G0CA 3QFTA 5L7WA 4Z54A 2NU8B 4LJ4A 1W0JD 1A76A 1V7QA 1R0LA 3OIYA 3VNBA 2IX3A 3G5UA 3PX2A 3S1AA 5BN5A 1MC8A 1TK3A 4MP8A 3WRYA 3HYNA 7MHTA 1GU1A 2VP4A 4LAFA 2CD9A 3CZQA 4DR4B 4RFVA 3LVQE 4ZMBA 2Q5CA 3DKRA 4YRNA 4YP0A 1L3BA 4D98A 5CX4A 1N4DA 2HXYA 3PZRA 1LPSA 2C61A 4WLVA 1JR4A 3RS8A 5A3SA 5JQGF 2Q1WA 1R0BA 1V8PA 4K9PA 4JUDX 1EIZA 5K9ZA 1HG0A 2Q4RA 5EIWA 1IZ7A 3IMEA 2JGDA 3C3AA 2BONA 4WZBE 2FN8A 4ZDIA 1KERA 3NG1A 3OT1A 3UMSA 4CV0A 1T2AA 3S27A 2P2GA 4DLSA 3WTCA 2SHKA 3KVVA 1CY7A 3RF7A 2NQ2C 2PH3A 5J4YA 4NPHA 1GQOA 4GZ3A 2KSQA 4DSZA 1IDN1 1F0YA 4G1CA 4R8VA 1EA7A 1Z8HA 4PYNA 4C2UA 3MFQA 4KE7A 3OZSA 1V6AA 4PZEA 4CTJA 4LDZA 1O6ZA 1T0PA 2QD4A 2VAVA 4P6VF 3TSOA 5HMMA 4IOJA 2WSMA 5LDGA 3SXJA 2VCHA 3IURA 4C43A 3LW7A 4YV0A 3ISTA 3NWEA 4XM2A 4IKEA 1XPRA 2VBIA 1C3OB 4EW1A 3FMPB 4M9XA 2AFHE 2A1TR 4X1OA 3K6JA 2FSPA 4CLRB 4AKTA 2OM2A 5C8YF 2NYUA 1WR8A 5AOCA 5ITZA 4KLCA 1KTVA 1ZJ5A 2HF8A 3FAKA 3HBLA 5B5SA 4CF7A 3I1YA 3NO4A 4IRXA 5CDHA 2PGNA 1G3IA 2FR0A 4MV1A 4TTAA 2C31A 4IZ6A 4M22A 5EIBC 2B8NA 4F2WA 1ISMA 3WBBA 5GJVC 2ORWA 1MU0A 3OE7D 5LKRA 4UTNA 4AY4A 4TLDA 4QOJA 4OBBA 3ICEA 4BZZA 4B3HA 1GPJA 1RJ9A 1JAZA 1Y3DE 3FBWA 2IJGX 3KBOA 4HR7A 3OTHA 5ALPA 4EW6A 5LMUB 1W76A 3OT4A 4G0NA 4MYDA 2CCJA 3GVXA 3I2YX 4KRYA 2W70A 4HWKA 3EPHA 4MQ4A 5AUNB 5CYPA 4OHMA 1X80B 3RVNA 3H1PA 3VOTA 2RONA 5AR1A 3GBPA 1ATIA 2C04A 3OIWA 4YRLA 4QU5A 3RGWS 4B40A 4M1OA 4OQQA 4A91A 3NYRA 5B3JA 5JAZA 1VSQA 3PZBA 4Y7DA 3OF5A 3O8OA 4L8YA 3F47A 2R7KA 5F4ZA 4DYHA 4OQXA 4TTIA 5T4FA 1QH0A 3GY0A 3IJPA 3N7TA 5BT9A 1MH1A 4OX9B 2BFNA 3QK7A 2IYLD 4IH9A 5EE3A 2XXAB 3UW1A 4HV4A 1ZJ4A 1LLQA 3U7JA 4TTJA 4HDCA 2C7BA 4PXSA 3I64A 3SIWA 5C80A 1WBDA 4BOYA 2ZVDA 4PG6A 2GBFA 2QTFA 4BTEA 3L4JA 3KD3A 1LRJA 3SS8A 3DBRA 1EFVB 2IQIA 4QUEA 4AI6A 2YJTD 1MZPA 1PFQA 1I10A 3TLZA 1JJ7A 4MVXA 3ZN2A 1W30A 4N0QA 2A33A 1BJRE 4DV5B 4PN3A 4CEIA 4J2HA 5FYQA 4DREA 4D8WA 1CDZA 4JEUA 1SVKA 4IFBA 1E4VA 1ZWKA 3SVLA 1JGTA 3L1IA 2V5AA 1DJOA 4H1HA 1FDOA 3VR4H 1YBHA 4WXMA 4BLPA 5EWJA 3SPXA 2DE0X 2GETA 4EHLA 4WOKA 5LLTA 3PK0A 1NC1A 2BAGA 2FWIA 2YHIA 3GO4A 4AS2A 4DMCA 3KQHA 4QFCA 1ZAKA 1VE3A 3EZ2A 1DBIA 2HO4A 1D5WA 1QHXA 4N39A 3ZGLA 1N2CB 2W0SA 2O3RA 3TD2A 4BYGA 1S2GA 1FVHA 2EFDB 4W6QA 4XE5A 5BXQC 1G8KA 4TS4A 4MVCA 2J3LA 3QTTA 3HNOA 1T8TA 2KS6A 3HCCA 1CEEA 1G1AA 1I4WA 1R66A 3L07A 1KE2A 2QD5A 1IHXA 3IRUA 2QX6A 4RD4A 2VSQA 4LMPA 3VVBA 1P39A 5HKAA 4AY6A 5DBIA 2I9PA 3U6KA 3JQGA 1U2QA 1YMUA 5L3VA 4Z4FA 2CHVA 1SHLA 1H2WA 1V47A 2GHRA 3RG2A 3AM4A 2QVCA 2GZ3A 2JFVA 3EAFA 4PRLA 1UK9A 1C7JA 2GK4A 1ORRA 4FCCA 1UK8A 4NS1A 5A6SA 1NKTA 1E7SA 2G82A 5KNCA 1KI1A 4ZDKA 4Z8YA 5TEWA 1T9GR 5KC9A 5KNBA 5GM1A 5G3YA 4DCUA 1HRDA 4GKAA 1AM4D 5LZ9A 5LP6B 1M6HA 2VSYA 1U28C 1TZCA 1Z5WA 2ATEA 2K5UA 2W90A 2WWXA 4U7GA 3QE2A 3OMXA 2G4VA 3FZQA 3Q6MA 4N4AA 1PR4A 2JD2A 2AN5A 2AOWA 2AE1A 3O38A 4HADA 4P4LA 5KDDA 2CLFB 1OGIA 1SUAA 1VDZA 4CDMA 2NT4A 1BXZA 2ORVA 1E3EA 2QYTA 1B0ZA 3MT8A 4OXXA 2GDZA 1A9TA 4TTQA 2R1VA 5ALWA 2VBFA 3V1UA 4D02A 4EYQA 2DLDA 2WF7A 4ANFA 1Z0KA 4XB2A 3CRRA 4LECA 3TQTA 5MHTA 1JHOA 1YULA 3ZOKA 2CMFA 3C97A 3TTUA 3CPEA 3EZGA 3NT5A 4KZPA 1XE3A 1U7HA 3R5FA 5J2UB 1ZCJA 4E3ZA 3RYCB 1KXJA 2NW6A 1QTQA 5HUHA 1G42A 1G6Q1 1DRKA 4CTKA 2P77A 1JHAA 3A05A 3ANSA 4ITVA 2IIQA 4OGGA 5C32A 4G0QA 2DFNA 4K26A 4FOTA 3WTBA 1MABA 3DV0B 1IY0A 3BDIA 3KELA 4EHDA 3NC0C 4DLTA 4BWFB 1EUQA 1KI8A 1MB4A 4Q3AA 4X9XA 1WO8A 1VZ2A 1PK9A 2RG1A 3LP5A 4HL6A 2VHYA 5TF4A 4I55F 3DM9B 3HL4A 5F3WB 3ZV3A 2O20A 2LDBA 1TAGA 3ZCXA 4J1TA 1I7SB 3B7WA 4KDEA 3EXEA 4HNTA 4J7UA 1M2VB 4MOWA 2IEIA 2FU5C 1NQTA 4RVNA 3AP2A 1U9JA 1SKMA 1NE2A 1QVAA 4PS0A 5C4IA 2YJ6A 4JI1B 4URFA 1II0A 1IXZA 1L7XA 4PQRA 3WB0A 4A1OA 2E1RA 4EF4A 1DC7A 4NFYA 2RE8A 1PJLA 2I22A 1WW2A 2E49A 4YGYA 1E1KA 3B1WA 5T7BA 4DXAA 5J2UF 1EVYA 2FMIA 3FR7A 4D41A 4IV5A 4EJSC 5JH7B 5CMLA 2PL3A 3DA8A 4G4SO 2A9QA 1W49A 2WWVD 4FGLA 4RQUA 4GPTA 5KYNA 3ICQB 1U4OA 1DC5A 1E8MA 1Z5VA 4BKRA 1VI6A 3PT9A 3SFZA 2BHTA 3PUJA 1M73E 2Q5FA 1P4GA 1NN0A 2ATCA 4HDKA 1AGPA 3KOMA 4X8MA 3V4ZA 1OI3A 2ZQZA 4MXDA 4K9DA 4ZOLA 3PX7A 4L57A 3S29A 2CW5A 4F4UA 2HM7A 1EGHA 1QAMA 1L5FA 1RQXA 4P81A 1NNI1 4EKGA 5JQGB 2QMUA 2WG0A 2OGSA 1NR1A 1S3SA 1ODFA 3AR2A 1XK6A 2ZW9A 3DTNA 3QW2A 2OO3A 2YXEA 4DIOA 1NN5A 4AZ3A 2ZSFA 4CODB 3ANXA 1P31A 4BV2A 3EBOA 4HBZA 1NFQA 3GAAA 3PSAA 1GKYA 1NJGA 1NQVA 1PL7A 4HEQA 1P1FA 3DL2A 3UQYS 4OHFA 3B48A 2GCGA 4R7ZA 2XQFA 3DUFA 4A0FA 3P5SA 2ZK7A 5SZHB 1XDGA 5TJ9A 5LC1A 3TTTA 4KITB 3H9CA 5HFNA 1AGXA 1W85A 1NWHA 1CLUA 1FP7A 1G3QA 2EG9A 2LUOA 3K70D 3AUKA 1RI5A 1DJQA 1YGYA 1ADYA 3VU8A 4A8JC 1P72A 4B7AA 1U3CA 3UK6A 3UA3A 3ILSA 3INTA 3WGJA 4Y6QA 1S8FA 2OKGA 3HN6A 4NENB 5FWYB 3U56A 5K0JA 3OY7A 3JQBA 2FP4A 3MXTA 5TGZA 4B3GA 4D25A 3C39A 3N8NA 2QROA 5B3JC 5HA5A 1HRKA 5A4MS 1DRWA 4UW9A 4NECA 1QHEA 4U7TB 4F4HA 1ZI8A 1RS0A 4XGQA 4ND1A 3FOBA 1X2BA 3DLHA 1XYYA 1PKXA 2OKCA 5C3UA 2I2AA 3MYRA 1Y48E 3HKCB 2K7FA 3K9GA 1TCVA 3Q11A 4Z2AA 3OTWA 5BW4A 8LDHA 4FWBA 1DX9A 2YV1A 2D4HA 2ENUA 1O4WA 1YA4A 3DVQX 3BWEA 1AGYA 5LJLA 3SQDA 5CIQA 1O95D 1X1BA 3THXB 2JLXA 1ICIA 2G6TA 2CXSA 5CNJA 4A10A 4LF5B 1XTSA 3BXXA 1JQKA 2GAIA 4XLTA 4YRJA 4G9GA 3OQ1A 1DG9A 4YJ2B 2PKQO 4BLQA 2H6EA 2JGFA 2VDOB 2X9VA 2Y9MB 4BKPA 1X7WA 1FLVA 1BDBA 1RYYA 1JHZA 1N6LA 4JVNA 3TVYA 4AMGA 2HA4A 1YDGA 3H0CA 2QD2A 5BQ3A 5LCXA 1LDBA 4AMUA 1RFLA 1J2JA 1VL6A 3FHCB 2CGEA 2F55A 4EI2A 4A8JA 2VZEA 4Y98A 4LXTA 4C22A 4Y1RB 2IS6A 2R8BA 3KXDA 3NOQA 1GDTA 2C3MA 5H3LA 4BQPA 2P9BA 2UKDA 4J03A 2DECA 3E84A 5C8XA 3TD9A 1GVNB 2OCAA 3N2YA 3NIWA 1KYYA 3QM1A 1DCMA 5B1HA 3U09A 3UFXA 1T34A 4C7VA 2ZUVA 3EJWA 4CUZA 1YE5A 4RMJA 4QC2A 3R7WA 4A26A 5EEGA 3F8TA 5AI0A 2YFKA 3M70A 4E22A 3JWEA 5D00A 4KCGA 3BIXA 3O1IC 5EQDA 5G1PA 3CTPA 4RHUA 2QBYA 5JSQA 1ZGCA 1I24A 2P6RA 1ULZA 2I78A 4ZOLB 4YCSA 1JKXA 1L1QA 1NVAA 2QM8A 3WIDA 2LNDA 3PNBA 2OPHA 3L0IB 4KXXA 3ZWMA 5BV0A 4Y2PA 1C2TA 5FA6A 1QIDA 3A4LA 3CUYA 4MPRA 1WU8A 1S1MA 2X1MA 4LIPD 4F5EA 1UPBA 2C2HA 4JDUA 4YROA 1TYZA 4BMVA 1SD2A 4DUYB 2P40A 5GP1A 5H7XA 4ZYXA 4KN9S 3MN1A 1ULTA 3VVLA 3CUKA 4EPWA 5C7IO 3EFBA 1T3HA 1E2GA 1L7AA 4KQ1A 2ES4A 2WA1A 1FC0A 1T1SA 3PB3A 5H3HA 4B7CA 5M34A 4ONEA 1W4ZA 5KSOA 1KBOA 4HAWA 4Z49A 1ZOIA 4FDVA 5FLEX 3K9BA 2XBUA 3I6ZA 4L2IB 3B52X 3VGJA 5TIIA 2JJQA 2RAFA 4IJUA 1KDTA 4O4IA 2NXJA 1L5LA 2XWQA 3UZUA 3IUPA 4EKEA 2P2SA 1RQNA 2J4FA 3QA9A 1BEUB 2IQ5A 3KCNA 2IHTA 3UUGA 4AROA 3KP1A 4FLEA 5HKKD 3UJCA 8AT1A 4IDQA 3V4PB 5JNLA 4F1JA 2KX7A 1Z3CA 5KINB 4ZREA 3OICA 3LFHA 3K9NA 4Q3DA 2W9XA 4XSHA 3P9IA 1JQ5A 3DB1A 2JGEA 2EQBA 2GESA 3NASA 4G36A 4KV7A 4P33A 2WMOB 4ZOEA 5DLEA 1XN1A 4G81A 1VHJA 2WILA 4M0KA 4X20A 3I61A 1E0JA 1GL3A 4WNIA 2I34A 1OYWA 1XK7A 3HXQA 3CX3A 3G68A 2PWBA 2C8KA 4JQOA 1AA9A 3E03A 5DOVA 2AXQA 2RGUA 3EZXA 1Q1EA 1R6TA 3JQFA 4R2LA 3A0UA 4A23A 3M2TA 1Q7TA 3H11B 4YALA 3GLFB 3L0YA 5DNCA 1Z15A 4OXKA 1UKEA 2D8AA 1UINA 4DJ5X 1XZIA 1E66A 4IDNA 2GZMA 3IODA 5ECWA 3RIYA 3SLGA 1QHHB 2PD6A 1X1AA 2OGTA 3NTQA 3KXLA 4EJ2A 2X77A 1Q1GA 1E2BA 3ZWXA 1T5IA 3BAZA 5DULA 1EXMA 3ZKWB 3PC4A 2H4FA 2YCBA 4TYQA 1THMA 3S68A 1CD5A 2VG8A 3DB2A 4OLJA 1JDBB 4DN6A 1PV2A 4O4HB 1LNSA 1UBRS 2I29A 1P74A 3OKPA 4IV8A 2AJ8A 2NO9A 2WWTA 4MUGA 2IY8A 1Z5UA 4ZQEA 4ZAGA 1GZUA 3EQ7A 5ALNA 2QVXX 4DMUB 3KLPX 3L6RA 2X9QA 1KJQA 3BD6A 5DMXA 3AF5A 5IVDA 2QSZA 1L4FA 2ZAIA 5CDFE 4G6ZA 3M33A 2CDBA 1C30A 3AIKA 5EP1A 1LDGA 4JB3A 4YRKA 2FX3A 4YJ2F 4D43A 4P3KA 1NOJA 1UBCA 4FYKA 5IZCC 4XWAA 1MT0A 3BZWA 2FYTA 1W9HA 2ISSD 4ZC8A 3LBNA 5HQ3A 1D2MA 2FOIA 4HH1A 2BEVB 2ZEJA 3HGQA 1K5GA 3K0AA 2VCEA 4LQDA 1KMNA 1ZJWA 1SOMA 4PC1A 2QU8A 5JDIC 4DV0B 1MORA 4ZHQF 1K8YB 3H8VA 4M0DA 2WUWE 4NC9A 4R41A 3KHUA 4FN5A 2ZPUA 2EEPA 3UN1A 4H7KA 2WQ6A 1H2FA 1MDFA 1T9DA 2H1HA 3BQNB 1H2HA 5A6VA 2QTGA 3KSDO 3R7AA 4OQZA 4L08A 1IYZA 3LQ4A 5HTKA 5FLXA 4LCEA 3JQ7A 2SKDA 4PGGA 1HE4A 3A6JA 3LC0A 3RUPA 4DLLA 4EAAA 4P93A 2I71A 2JIRA 4PSUA 4B9AA 5FPSA 3GCDA 3KUDA 3ZNNA 5K4HA 2B9VA 3IUMA 2O48X 2DY0A 3FPHA 1C29B 1W36B 1LY1A 4XUGB 3RVQA 1RD4A 1QDUA 1WKCA 2FP4B 5AJHA 1L5HA 1LSJA 4WHMA 2L0XA 1M2NA 4PNPA 1ECLA 3W06A 3EEFA 1IUPA 2EGGA 4EWLA 3S2SA 3RVMA 2ZTUA 4FYYA 4OYLA 4LE2A 1WCIB 4QQNA 3F9CA 1JWBB 3QELB 4DDTA 4U3JB 2RGNA 3EWAA 3OZ7A 2WNSA 4GBJA 3V1TC 5JU6A 3ICPA 5AW9A 5CT4A 1FFXB 3OC0A 3MUOA 1MJ5A 1B4DA 4MWCA 3PC2A 3FIJA 3Q9NA 1M2EA 2DQSA 2VHQA 1Y9DA 4PRKA 3W9BA 2DUMA 3ZKWA 4AWAA 1DKNA 1QANA 2QTNA 4MRRA 5LDHA 3TRJA 4OJYA 1DIBA 1T9BA 4H60A 1IJBA 1HBJA 5ICFA 4KNVA 5IUKC 1X1QA 4OL9A 5FR2A 3ZI0A 4BVEA 2PO5A 4CLRA 4O2AF 3RC8A 2W2PA 4X20B 1YIOA 2WAOA 5BN4A 4IDDA 4AP9A 1XLTC 4DEVA 4RHYA 5FH9A 2R6R1 5HDBB 2BEWA 1CERA 1PZNA 4G1VA 3A6HA 1EM8A 3JVEA 1BHSA 3G2IA 1DIGA 1H0HA 4MPTA 4TN5A 5C18A 3PUXA 3QLVA 1JG4A 2YOFA 3N2KA 2AK3A 1UEJA 4IR7A 2GO1A 4L15A 2FUG1 1D6JA 1QIEA 1T3ZA 3HBMA 3SOPA 1G55A 4NMMA 1I6WA 2J3QA 1X77A 2W43A 5DT2A 2ODNA 1AD2A 4TVKA 4QA9A 1Q16A 1QRSA 2ZR8A 4K3VA 4MAMA 1GCUA 2CXTA 1GPMA 4LXUA 2AWNA 3LXXA 3RUFA 2DBVO 5I9SA 3RYFB 4V1CI 4U63A 3BIFA 1H1LA 3QP9A 4GRIA 4OYHA 4FHFA 3DQQA 4BZPA 3P2YA 4QJBA 2UUOA 4QBGB 4BBZA 5JQWA 1RZRA 2PUEA 2XUKA 4GD3Q 4KK4A 3RJ9A 3IR7A 1NW5A 4UVHA 4LQLA 4QELA 1YRAA 1AS2A 3DO6A 4GOJA 2FPWA 1OCEA 1SUIA 2NV2B 1Q83A 4BMXA 3T9FA 2WHRA 3ZK9A 2A84A 1KY2A 4EDFA 3TEMA 3C6ZA 1F48A 1MX5A 5AMXA 1ORTA 2V65A 4NV0A 2G5TA 1EFTA 1IFXA 5FI1B 4ZVNA 2WD7B 1N6OA 5DWVA 1NPDA 2VHVA 1DBQA 2XUIA 4EQ6B 2PUCA 3AUTA 3FSGA 2A8YA 3GIDA 4MWEA 4WQMA 1QYVA 1MBZA 3KJZA 3EIQA 3ZV4A 4J4BA 4OEHA 1WBBA 2PL5A 3FVQA 4M1YA 4KO1S 1JLHA 1PGJA 1UC9A 1X0VA 2ZVPX 3OOYA 3KQOA 2M2IA 2MIIA 4Q19A 5AK0A 3W8FA 4CEJB 3AL0C 4FC7A 1CUGA 2CD7A 2VF7A 3DPUA 5H4GA 4DKJA 2HU8A 2PT9A 1G9TA 1SUPA 4HNQA 3RQSA 4AM8A 4EMBA 4QZVA 2WAYA 4EYKA 3BXOA 3I0ZA 2CJWA 4BLUA 1PFVA 3U17A 4XQ0A 5JS8A 4JI2B 2WOOA 4GBMA 5KOJB 3DZBA 4JK3A 3UT0A 5CPFA 2CBXA 1JKFA 3OI7A 3ELDA 4GMDA 1P7CA 1K89A 3WOHA 2I76A 3AONB 3R24A 2J6CA 3U37A 2Z4SA 2XWPA 3I12A 3I5AA 4CZ2A 5HS4A 5T4EA 4G2NA 3PXGA 3WKAA 1HNWB 1DQRA 2REQB 4IHQA 3B2NA 1VMDA 4CGYA 2BR5A 6Q21A 4CIAA 5JNTA 1L6RA 5FBHA 4N47A 1Q0TA 1OBFO 2Z2YA 3FOWA 1IUKA 4HZUB 1NDUA 3PCXA 5TB5A 3TJZA 3WWCA 1ZOOA 4LF4B 5IVPA 1ZC4A 2DR3A 3HB9A 1SY7A 1GOTA 4IQ8A 2J9RA 4HVTA 4AWXA 2OCKA 3DNMA 1G20E 1DG1G 5EERA 4LZLA 3U3XA 3ICVA 3FFXA 2VKQA 3HEBA 3GQVA 3B1VA 1MO2A 3U3JA 4X41A 1I6MA 2JVIA 3N7UA 1TQDA 4D9FA 3AI2A 1M54A 3TXAA 2BMFA 7REQA 4OHCA 5DBGA 2PN1A 5JEEA 1JPUA 1L5KA 3QWHA 1ST3A 3C1TA 3DBOB 2R8PA 4M86A 2NZUG 3DOOA 1QJ4A 1XXHE 5U4XA 3G59A 1XEWY 1PQ4A 3QKRA 2EFCB 4EIWA 3GLGA 4O8CA 1LKZA 2H5JA 2WYVA 1E2HA 4JGIA 4L6CA 5TSDA 4I1UA 1E89A 2KLBA 4RIHA 4QTYA 2OPBA 4IUYA 1SOVA 2QLNA 2RMKA 1VG9B 4OXQA 4ZQBA 4ZEVA 5CEEA 1VL1A 1ODCA 1T4CA 5HFJA 3ZVMA 2ZRAA 3I34X 4EX7A 4D8XA 4IDOA 1E4OA 4P80A 4MR8B 1JAIA 4RTOA 4MYHA 4AF8A 1JRLA 3TLXA 3NR2A 2Z2IA 4C7BA 5BNIA 3SGLA 4EYGA 5JTTA 5KJFA 2QVLA 1YZHA 2FSFA 3KCQA 1RLMA 4JBGA 1DL5A 1NX6A 5LXTB 1WSBA 2QV7A 2ZLBA 1UJ5A 1YCDA 1QFYA 2CB9A 3AKZA 2IBMA 1JH9A 3LA8A 1NVEA 2Z5GA 3VAAA 1DEKA 4YJKA 1L4YA 2E0IA 4A0QA 1OMOA 5I7SA 1PWEA 1XRMA 3ABRB 1B8OA 3DXZA 3HHEA 3L7LA 4MIKA 4QDOA 5ALOA 1X94A 2ZT8A 4KZKA 5AM0A 3C16C 4I36A 1IJEA 1GEEA 1T0BA 1ZCFA 3G9ZA 4CMBA 3SZ3A 5D2CA 2WSIA 1QHNA 4QYXA 1JP7A 2Y67A 2ZAOA 4GXNA 4D9NA 1O9GA 3DFMA 3A3NA 3G7SA 5G1OA 3L0ZA 3RVDA 4RVUA 3PD7A 5BYBA 4J0HA 4PHFA 1LC0A 3LCUA 2X0NA 1DTEA 3EDMA 3EVBA 1HLPA 4LN1A 4ND4A 4X97A 3BJZA 3TLYA 3ZYCA 1IM5A 2VZLA 2GCEA 1IQUA 2XTNA 2HMTA 3LRPA 3M89A 4LW8A 3VR6D 4WZAE 3PNVA 1ZKMA 2EZ8A 2HU7A 4E7PA 4JI4B 2F8TA 1K3TA 1U0FA 1V5WA 5TMDA 1XLUA 1UFRA 2HQSA 1P1KA 2CLSA 4L4UA 4N3BA 5LB4A 2YASA 5JAOA 1SQ6A 1DKMA 1H5NA 2MYNA 3D43A 2XCLA 1QBKC 3I8XA 2EC5A 2IZ6A 4LJ6A 5AXAA 3UENA 3TECE 1LTHR 1NY6A 2EXXA 3VSEA 4U2EA 4CYMA 3GXBA 5JJIA 1CEYA 3I9OA 2FNAA 4F7DA 2XJ4A 3GUUA 3T9EA 2D00A 5L3QB 4KGZA 3QYJA 1C3JA 3G88A 4NFSA 3C6MA 1ABFA 3ETHA 2G5CA 2R84A 4YCMA 5I51A 2JF0A 1TO2E 1S8NA 2O4UX 1Z47A 1JW9B 2R11A 3P45A 4YONB 2OHXA 4I55A 4Z9XA 3PFFA 5DXAA 3GEPA 1N6KA 4L51A 3LMKA 4IUBS 1M5RA 4JC4A 1BHQ1 2FWBA 3D54D 3HJNA 1JLLA 4OAOA 2CLMB 3I37X 2B8JA 3A4MA 4JUCA 2WIGA 3OZAA 2OYRA 5AKKA 2AMYA 2WYOA 3LWDA 3OECA 4UZFA 2XX3A 4Q18A 2L42A 3H3XA 2V6BA 5CVTA 3H3JA 4B3IA 3UJ6A 2WAXA 4P38A 4BV3A 5FDFA 2GN8A 4TV8A 1H2ZA 2QM3A 3PX3A 1SXJC 3DTVD 1DINA 1SHTX 2FWPA 3VZSA 4C14A 1Q0ZA 2HSJA 2ZRBA 1LRLA 3CZ9A 5CVDA 5ECYA 5EE1A 5HS6A 1JYEA 2PLAA 1Z7YA 1TEXA 1X38A 2GWRA 2JIBA 2XEDA 1THTA 1OB5A 1A82A 2H00A 3OJEA 3U0BA 1V1RA 4Q0MA 3Q88A 4QATA 2ZU0C 3VHLB 2ZRNA 1V11B 2IEZA 4G1UC 3T0GA 5EE0A 1KJ9A 1N5RA 1ZRSA 4N82A 2BTOA 3RIGA 4MHTA 1D5CA 4REQB 1H9AA 5CK4A 1SU8A 4B43A 3L0SA 2CDAA 4ZC1A 2WJPA 2OMEA 3A9WA 3P4XA 4X1IB 2RK3A 1H05A 1O2DA 3A32A 2BUAA 4N40A 3ROKA 1IBRA 3I2FA 2HH9A 1SZCA 1ZUIA 4FDLA 1HDGO 1XDZA 5TT1A 4AO8A 2YWRA 1KMIY 3MGAA 3K0CC 3L8MA 3O8BA 1NN1A 2DHRA 3OFND 4CG2A 1Z5OA 3HKEA 4UFNA 4W5RA 1I1NA 4HQRA 1AJEA 4RZXA 3PUKA 2A0YA 2ZE5A 4GXRA 4G97A 2ONZA 4NAVA 4RABA 3GWZA 2Y4OA 4YDSA 4ZI7B 1UMCB 1PHRA 5AVWA 4HYEA 3OLVA 3HP4A 1TAHA 1KBQA 4J4TA 4BGEA 1R3UA 4WKCA 3TLMA 2O7SA 2PJUA 2WTMA 3MFYA 1TVKB 1Z0SA 3FLAA 3QRWA 3RAJA 5T4HA 5FUYA 1J2UA 1E6KA 4M1SA 2OV6A 4H18A 3D6UA 4HMOA 1JSLA 3A6KA 4TROA 3T7TA 4X85A 3UWDA 4BQFA 4GSKA 1YS2X 4ML3A 4D0SA 2ZRDA 5AVTA 1FVFA 3M82A 1C4OA 1L9KA 5JPDA 4G4GA 1Z7GA 3QUBA 1VIDA 1JKJA 3MWJA 1DELA 3UAWA 2YOHA 4HDNB 1TUGA 2GUGA 4CKYA 3V2HA 3P0RA 3IAHA 2R86A 2HV8A 4CPDA 1LI7A 1SIUA 4LRUA 4PAQA 2ZE6A 3PRJA 4PQEA 3WLOA 3GUVA 4CKWB 5ISMA 1CE8B 3FFWA 3S8YA 2Z6QA 1D2CA 4CDGA 4F2PA 1I33A 1QVWA 1XCLA 4DDHA 3ZH2A 4ZCIA 1M2OB 2AH5A 3CNHA 4Y9UA 1V48A 2P2YA 4NQRA 1U2EA 3B3GA 1OWPA 4YECA 2IVFA 2C03A 1PLLA 5ALEA 5CDUA 3M6UA 1Y4AE 4MCAA 4FB4A 3CVVA 1E2MA 1FVOA 1A9YA 1GG5A 1NSYA 1M1XB 1NHGA 2JA1A 2XV1A 3DT9A 3EDQA 4PIVA 1LV7A 3FHLA 1ZL0A 1AKVA 2N9UA 4TRMA 1TJ5A 3QTBA 5HBRA 4QM7A 3HDYA 4IILA 3WHLA 2HJWA 3QJYA 4HAXA 3JRWA 4RV4A 4QVGA 2A5YB 1X74A 1YF3A 3QQ5A 1K8ZB 1YR8A 2ILTA 4DQ0A 2HSZA 2VNAA 4N0MA 3RE1A 3UJ8A 4DT1A 1D7AA 1C8VB 4IMIB 4P0TA 4DRXA 1PWYE 4AX8A 1T4CB 2NSDA 1JWLA 2ZIVB 2ADOA 3HYLA 1XZEA 1Y42X 1KZYC 4DMMA 1JDTA 1U1DA 3LLSA 4NJOA 3FPGA 1WUTA 3GDOA 3RYTC 2D0DA 2NG1A 2XB4A 1AHNA 2VAPA 4PPNA 2H4WA 1IONA 2BFEB 4DAEA 2J5KA 3OQ6A 4O2AA 1YDFA 4NCKA 5EAIA 1SVWA 3G1UA 2QLBA 2P75A 2WR8A 3IMFA 4B87A 2CV0A 3WXBA 1AOXA 1LBEA 1NXTA 1YQDA 1JVBA 2B7CA 2V7UA 3IBCA 1OC4A 3M34A 2QOEA 4IXNA 4NBWA 4IW3B 3WMEA 1V1RB 4BO5A 3FUXA 4CM1A 3OM0A 5KNBH 1P6XA 3TF5A 2YY5A 4RK7A 2R4TA 1QG2A 4A8HA 3HN7A 2RK6A 3ZNPA 2W2XA 2AUMA 4P7JA 2AQ8A 1JAXA 1ZM2A 2VF2A 3D5QA 2F3QA 2WHYA 5EXPA 1JZQA 4GLBA 4OK3A 5ALLA 1KDRA 3M0EA 3IAS6 5D85A 4BNNA 1UQRA 3OF3A 4FCVA 5ALHA 2FG7C 1Z0DA 1ZM9A 1TO1E 3HVHA 3VZQA 5DHSA 4KR2A 1CTQA 3VTZA 1E9VA 1XLTA 3REGA 1R10A 4Q66C 3V2UA 4F86A 2FAXA 5E4TA 1ONPA 3IHKA 4NONA 4P3OA 3WHKA 2NXEA 4D79A 3FDJA 5FP0A 5IJ0B 5JTUA 1USGA 4UDOA 3WLIA 1JI0A 5FPQA 4FEEA 4X1YB 1J42A 4HUQA 3PTAA 1GYQA 4GQAA 4IVQA 4Q82A 3KWFA 2Y9PB 1MV8A 4JBLA 4RVFA 4HT3B 4MROA 3MJRA 3BMCB 3SSAA 5B2FA 2AL7A 4QXRA 3PE4A 1QKIA 2NAFA 2DFLA 4MWOA 1H94A 2RBKA 1FDIA 1EE1A 4KQHA 1KNQA 2CF6A 5F52A 4DNPA 2ZRFA 2P6MA 4HXFB 1QPZA 3PQ4A 4P98A 2JW5A 2NZWA 3OEYA 4M7WA 3BMQA 3VH4A 1E92A 4JT2A 3MC1A 4B83A 4GMHA 3EFEA 2D59A 4N7BA 1XU4A 4WBSA 3U31A 4CE6A 1XT6A 2Y6UA 4GOND 2PV0A 1ZMRA 4RA6B 2IY7A 3QLEA 2AMVA 4RJIA 3STUA 1B2RA 1AU9A 2Q1TA 4HEJA 1RC1A 4Y1RA 2GZRA 2HA7A 4I9NA 4EMUA 1F2TA 3FKSD 1WHTB 4I5EA 3GZNB 4R0VA 2E6UX 1V3QE 3IUQA 1N6IA 3WL8A 1CVRA 1E8NA 4PEVA 4FCTA 3NKVA 4IDGA 5AT1A 3M3PA 1KWKA 4BMNA 2J87A 2D0OB 4Z0NA 4B5LA 1N3BA 3OZTA 5JANA 2P2ZA 1JFTA 3GNSA 4BNXA 1APBA 1NR5A 3MTAA 1EVLA 1YR6A 4TMZA 5GONA 4EF6A 3DTYA 1IBCA 3ETJA 3LGAA 1W4AA 3LHIA 1HFWA 2NQTA 2BOVA 4FMDF 4DLPA 3C8DA 4L1KA 2DWCA 3OMLA 4FSHA 3VDXA 3S44A 3CNEA 3EVFA 2Q1UA 3NYWA 3PDWA 3RTGA 2Q9CA 1SN7A 3P9KA 1PDWA 1ZGHA 5CLFA 1QNLA 4RESA 5JAIA 4RTLA 1GFZA 4L5YA 4JLUA 3QKSB 4QXOA 2XQGA 1I7PA 5FCDA 4ED9A 1AKQA 4IEEA 2ZBRA 4CCSA 5MFPA 1JDNA 4JNKA 2Q1YA 4RHCA 2XMSA 4YRRA 1IATA 5DGDA 3NP9A 4IH1A 4K9LA 2FPGA 1Z5ZA 3LWBA 1N5OX 4Q47A 4YMLA 3ZVRA 1QRRA 4EGQA 3FAZA 3IGFA 3TI9A 2LXNA 1DRVA 3GRUA 3H9QA 3U44B 5GOTA 2FPSA 4NCIA 5ALGA 2R87A 3X3HA 3GFRA 3BDAA 4PZ9A 2XKBA 1RQGA 2DOKA 2Y76A 4IDFA 4GRAA 4C76A 3F97A 1Q77A 2BTQB 2ZUUA 3R3WA 1QIGA 5LOVA 2ZREA 4B6FA 1BNCA 5CDSA 3ZV7A 5BYAA 2H8GA 2I6QA 4O1HA 2JHCA 5GONF 2EFYA 3A31A 4A2QA 4WN9A 3WBFA 3HXPA 2HLNA 4MDFA 2C88A 2G9ZA 3QVJA 4NQZA 3N0TA 3DE5X 3KQWA 2J0UB 4JI3B 2P2DA 4DR7B 1PLKA 2UYOA 2A9FA 4U8GA 5KKNB 1PF7E 5ETJA 1JKJB 4WEQA 1U3VA 1CJMA 1ZICA 4O4JB 3HSKA 3MJVA 4MRMB 4R69A 2V0GA 1RM3A 1HFKA 2DFDA 3I2JA 4IKOA 2G5PA 3RT9A 3UAOA 4UVDA 4RHEA 1CZNA 2P7IA 1ZA2A 5FOUA 4CLDA 3E2PA 4P2GA 4YCJA 3EZ9A 2PR7A 3CXUA 2BCJQ 1YUMA 1HYHA 1OLUB 3DL7A 2DRIA 3GPCA 4K6CA 1HEYA 4QYIB 1EFKA 3AIMA 2C9ZA 3WY9A 1G8MA 4AQYB 3NP7A 3Q85A 4PGFA 2K2WA 5C8VA 3J81A 3NVKI 1KFEB 4GM4A 4DM3A 4KR3A 1F4PA 2X42A 4URUR 1AKTA 2FEOA 2ZKLA 5HQ3B 4DADA 2XMQA 1RVV1 2Z8YA 2CMGA 1YFKA 2GKGA 2Y2VA 1U98A 2Q29A 2UYYA 3N8KA 1LDYA 3FMVA 3SMQA 2I2BA 2WUEA 4Z9BA 1Z5PA 3GZ4A 3SE7A 4CVNA 5KNDH 2Y1GA 3NAMA 3QFRA 2KE5A 4H27A 4Z2YA 3JPWA 5BOSA 1N8TA 2VRBA 2VSXA 2ZIXB 2ZM5A 1UT6A 5AD1A 4CGZA 1GJRA 1HI9A 3FWNA 2YHIB 4P86A 1JUDA 3B53X 3BHNA 3PIIA 1TUBB 2WIBA 5IJXA 5C0OE 3TFOA 3KJEA 5HZGA 3OZXA 5AW7A 4J16C 3HNPA 1CP3A 1MB9A 3BH6A 4H3HB 4MIOA 3AJEA 4Q1EA 1O95A 1QIIA 5DHRA 4ESEA 5LQRA 1AGNA 2VP5A 1GQQA 2PS3A 3AY6A 4ZGGA 1Q21A 3GFSA 3IDFA 1JLSA 221PA 5M7EA 1PYGA 1JEDA 3JAKA 4B17A 2RK4A 2JBAA 4DV6B 1UUFA 1M34A 3T9AA 2X0EA 1P3Y1 5GV8A 3K9QO 2WD9A 4X66B 3I01M 3C7CB 1KYTA 1RPJA 2OENG 3VZPA 3ZDQA 1Y3BE 1C8BA 2J3DA 3WGTA 4ZYLA 5FAXA 1EZ1A 4HFJA 4QJIA 4HNGA 5CIYA 4INOA 2ZSJA 4IHJF 4Q9HA 1ZJ6A 3L04A 4X64B 2D5AA 4ETMA 2BM0A 2QTBA 4INPA 1BU8A 3KLOA 1G5RA 5K3FB 4E2FA 3O8CA 1PGPA 4NYMR 2V6GA 2XODA 4QPPA 1P4HA 2O2IA 1N1DA 4L73A 4QUJA 3HCFA 3JXEA 4R31A 4U4AA 3FVTA 3RUIA 2QE7D 3KKMA 2IYXA 1TM5E 1NUQA 3O8QB 4CCWA 4PX9A 3EE6A