2B82A

Crystal structure of apha class b acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate bound to the catalytic metal at 1.2 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
b'SPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords class B acid phosphatase
publication title A structure-based proposal for the catalytic mechanism of the bacterial acid phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 73
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b82A00
2WF6A 4BEVA 1RMTA 2R8ZA 5A3QA 5AW4A 5AK4A 3FPBA 3ESQA 1Z88A 5AI9A 3AR4A 2G06A 4UAVA 5AIAA 3PCTA 5T41A 3AR7A 1XP5A 2YJ6A 3U7FB 3QUTA 3B9RA 5AVXA 2Q4TA 3WK9A 5AVWA 4UATA 1RLTA 1WVIA 2DQSA 5JJBA 3U19A 1RQNA 3L8HA 3ED5A 2I33A 5AW6A 5AVYA 3ONNA 2MU1A 3QUCA 2FUEA 2HF2A 2GFHA 3N1UA 2W4MA 5A3RA 1ZS9A 5AKKA 1J97A 2JARA 5AKLA 2WF7A 5ALLA 2OYCA 3M9LA 2ZBGA 2JGAA 1N9KA 4NWIA 2OM6A 3FVVA 2FPRA 2FPWA 4IFTA 2HI0A 4Y2PA 4E88A 3AR8A 1L7MA 3MC1A 1L7NA 3QU2A 4BKMA 3KBBA 2ZBEA 5ALJA 3OCZA 2B8EA 4XPZA 3ZI4A 5ALGA 4DCCA 1JUDA 2FPXA 3L5KA 4G63A 5ALHA 2HF7A 2P9JA 2W43A 2R8YA 4HGOA 1VFPA 3IRUA 2FPUA 5AW0A 4YCNA 5AK3A 3KC2A 1PW5A 1Z4OA 4RESA 4F71A 2G09A 3QLEA 1RPZA 4HYTA 1Z4LA 4UU1A 1O03A 3NASA 2R8XA 3I6BA 5AM1A 3SMVA 3ET5A 2VKQA 2C88A 5AKGA 4H1WA 3VAYA 4UAUA 2FDRA 4I9FA 3I1YA 5ALPA 2WF8A 3KOOA 4CE6A 4C4SA 1Q92A 1L7OA 4AS3A 4BYGA 4FFDA 1YJ5A 2B0CA 3QYPA 4EENA 2FEAA 5ALKA 3L1VA 4C4TA 3ZX5A 1ZD4A 2Q4RA 3W5DA 3QUQA 2AH5A 1EK2A 3WKBA 1Z4KA 3FM9A 3M1YA 1F5SA 2IA5A 3L0BA 2RBKA 5ALWA 3KDPA 3W5CA 4ZEVA 3L8GA 5ALYA 2FUCA 1ZRMA 1RDFA 5AM2A 2NO4A 2QYHA 2HSZA 3DV9A 3F9RA 3QU5A 1Q91A 5AVSA 3WK7A 2GMWA 1X42A 3ET4A 4NV0A 4J2TA 1NRWA 4UASA 1ZRNA 4YIHA 3AR6A 3KZXA 2B1QA 1S8OA 1RLMA 2I34A 5AI5A 3NIWA 2O9JA 3CZ4A 1T5TA 2P69A 5AKHA 3HLTA 5IS2A 4QQFA 3E81A 1SWWA 3DAOA 4UM5A 1RKQA 3BWVA 2FI1A 1YDFA 4XE5A 4Y2YA 1Z4MA 2CFTA 3W5BA 3ZX4A 2GO7A 1SWVA 2C9MA 2BDUA 1ZD2P 4Y2UA 4F72A 4AP9A 1MH9A 4NFLA 3I76A 1S2OA 3EPRA 2QLTA 4OD0A 4FYPA 3RFUA 4YCLA 1Z5UA 3QX7A 2HEGA 1Z5GA 1U7PA 2FPSA 2G07A 3L7YA 2YBDA 5ALZA 4IG4A 5AI6A 5AVZA 1U02A 4Y2QA 1J8DA 3ZVMA 2W11A 2CN1A 2RARA 3ZW7A 4L6AA 4KNWA 3R09A 3NUQA 5AW3A 1Z4PX 1YV9A 5AI4A 3TLMA 2C8LA 5AKEA 3ZWKA 2OBBA 1QQ7A 1K1EA 5ALQA 4EELA 2CFSA 5AKZA 1YNSA 2P27A 2WM8A 4L6CA 5ALXA 1L8OA 3W5AA 1VJRA 3ZTYA 4EZEA 5AW9A 4HGPA 5AI0A 5AM0A 3SKXA 2EARA 2YFYA 4KNVA 3UMGA 5ALNA 3E8MA 3EF1A 4BEWA 3B9BA 3QXGA 3S6JA 2HOQA 2B82A 1L8LA 4HAIA 4I9GA 5ALEA 2YY6A 2HCFA 2AGVA 2EAUA 5AESA 5AVRA 1FEZA 4DW8A 3ZU6A 2CFRA 4CF5A 3OCYA 2RB5A 3UMBA 1XVIA 1QQ6A 3NAMA 4GIBA 3A1CA 3L0CA 3K1ZA 3EWIA 1U2TA 3DNPA 4UMEA 4Y3UA 1U7OA 4BNDA 5AIBA 2PKEA 1Y8AA 3OPXA 3B8EA 2B30A 5AVUA 4FE3A 3L0YA 5AKYA 5IT4A 1TJ3A 5AM4A 5IT0A 5AI8A 3OCUA 1RQLA 2B1RA 2YJ3A 1EK1A 4UMDA 4UU0A 3RF6A 5ALTA 1NF2A 3AR9A 2OA0A 3DDHA 3QU9A 4KYTA 4EX6A 3A3YA 4L57A 1Z4IA 4PNHA 3SF0A 2YMLA 3ZVLA 3L8EA 2YMQA 3PDWA 2PQ0A 3U7EB 3WKCA 1TE2A 2WFAA 1QYIA 5AKIA 1U2SA 4ZEWA 4YGYA 4DFDA 1LTQA 2YJ5A 5AVQA 4OCZA 5ALRA 4BX2A 3D6JA 3MPOA 1O08A 2ZG6A 4RETA 1KYTA 2G08A 5AK6A 3R4CA 4YCMA 3R9KA 3N8GA 2C4NA 3UM9A 4Y2XA 3J7TA 2EATA 4OFZA 3WGVA 1ZOLA 3AR2A 2X4DA 3WKEA 1AQ6A 2I7DA 1TJ4A 3WGUA 1QH9A 1RRCA 2HO4A 2GHTA 2NO5A 1XPJA 3OCVA 3FGOA 3SKYA 4YH1A 4BX3A 2JAUA 4MUMA 2HDOA 4BX0A 5AW5A 2WF9A 4DWOA 4Y2RA 2IOFA 3N07A 3FZQA 5ALSA 4MWOA 1YS9A 4Y2SA 1ZJJA 2HHLA 4G9BA 1NNLA 3SHQA 1CQZA 3ZTWA 4JDPA 5AW7A 5AKXA 3AR5A 2BDEA 3A1DA 1RMYA 3NALA 2O2XA 4KX5A 5ALMA 4UM7A 4CF3A 3L8FA 3WK8A 3U7GA 2YMMA 2B8JA 4O8CA 1RLOA 3QUBA 3U26A 4OHFA 2D2VA 2G1AA 3QU7A 1ZD5A 5AHXA 1WZCA 4XQ0A 5A3SA 4UMFA 4XOUA 1T5SA 4UW9A 2G80A 2YJ4A 4Y2VA 5ALFA 3U13A 5AM3A 2YN4A 2AUTA 2P11A 1Z4JA 3BA6A 4CF4A 5ALOA 2C8KA 3OCXA 1IWOA 4UMVA 1Z4QA 1T9ZA 3P96A 4J03A 4Y2JA 3QGMA 3WKDA 2ZBDA 1Z4NA 1L6RA 1RKUA 1WPGA 3EF0A 3IB6A 3ESRA 2ZOSA 3U7HB 5AM5A 5AK5A 3CNHA 5E0OA 5AVVA 4HGRA 1ZD3A 2IOHA 4HGNA 3QNMA 3WK4A 3L1UA 5AW1A 1LVHA 2ODAA 2I6XA 2R8EA 5ALDA 3ZWDA 2WF5A 4GXTA 5ALUA 3E58A 4ZEXA 4BBJA 4KX3A 2AMYA 3WKAA 4EEKA 3KD3A 3E84A 4QJBA 1RKVA 2IOFK 3I28A 2RAVA 3OTQA 4NAVA 5ALIA 5AICA 1RMQA 4AS2A 2I54A 2PR7A 3WK5A 1TJ5A 3N5KA 5ALVA 3GYGA 3SLRA 3NANA 4UARA 1RC8A 3PGVA 1CR6A 1L7PA 2JAWA 4C4RA 5AW2A 2BY4A 4NABA 1QQ5A 2IYEA 3MN1A 1WR8A 3HYCA 5FP0A 5AVTA 3ZVNA 3QU4A 5AKJA 2NYVA 3IJ5A 4YIKA 3WK6A 2JAOA 3N28A 3MMZA 4B6JA 2G0AA 2MSNA 4EX7A 1TA0A 2Q5EA 2I55A 3OCWA 3FPSA 2WHEA 3PGLA 5AW8A 4JB3A 1SU4A 4HGQA 3SD7A 2ZBFA 3NRJA 1VJ5A 3A1EA 2ZXEA 4Y2TA 4BNDB 2YMPA 3UMCA 4CNQA 2GHQA 1YMQA 2HX1A 3ZUPA 1N8NA 4KN8A 3AR3A
chains in the Genus database with same CATH superfamily
1ETHA 4L9WA 4RZQA 5G0WA 3UJHA 4B6RA 3DOFA 1YCGA 3TRHA 3QEBZ 3NATA 1I1QB 1TF7A 1HK7A 4OHYA 4J7XA 3K4PA 3I5YA 1XFAA 1P1BA 3OPVA 5K0LA 2HD4A 3CSUA 4CDRA 3Q8LA 2WICA 5DNUA 5B12A 5LJLA 4FBLA 1I3CA 4D6XA 3IAHA 1S4QA 1I01A 4WRRA 4KJXA 4JDUA 2HMYB 3RAPR 1YZNA 2PYDA 1T8PA 2EJTA 2WJ4A 4CMEA 5BOSA 5BUQA 2KM1A 5B6JA 4DEYA 3IL2A 5DWQA 4RHFA 1CP2A 4Y1EA 4LXQA 2I0FA 4I0WB 4JLVA 3F7OA 3HCOA 4WNCA 2IF0A 4WXEA 5K0BA 3QEJA 2GEBA 2KMLA 2C4TA 2DF8A 5DXJA 3ONNA 5JSUA 1FFCA 2FVYA 1F3OA 1VL8A 2Q21A 4J3NA 4O2BF 4ZVSA 4MUJA 2D1QA 2XQIA 1WU8A 3PNSA 3ZW8A 2YRXA 3MQFA 4OQMA 2IX9A 5DBIA 3RS5A 4Z3KA 4FFNA 4FN5A 3VHXB 1U1FA 3CH7A 3PC6A 3EDYA 3Q1LA 4C4XA 1VDMA 3I0MA 1M1YB 1ENPA 3D9QX 4GM0A 4Q3AA 5ALLA 1M2FA 1X8XA 4EI8A 2ADMA 2HBRA 5I9IA 2COUA 4Q4JB 2AKEA 3UWOA 4E5NA 2FPWA 2GJKA 5J4HA 3MCWA 2QV7A 3UAVA 1XD2A 2IS6A 1KQGA 1BGWA 4HLUC 5E6SB 2RHDA 4MR8A 3HRKA 1CVLA 1NW7A 2ZBEA 3ID6C 4GYJA 3QVXA 3RSOA 3TCXB 1E3MA 3C0KA 1FP4B 2XADA 2PZ8A 1GFIA 3HCNA 1DKRA 5J59A 3UENA 2CKMA 2FPXA 3BWDD 2O8CA 4OJTA 3WWZA 4EMSA 3G2NA 4HWOA 2G0NA 4M9CA 4Z9XA 3TM5A 3CO0S 5D3MB 3USCS 4IIXA 4B09A 4YY3B 3PNOA 4WCFB 1NQTA 1K7CA 1O9HA 2PH7A 4NP6A 4PC7A 1ONOA 2RGWA 4FFBA 1W8IA 2Q7OE 4EK9A 1RZRD 3TECE 3I2IA 1M1XB 1PJQA 3SN6A 4G86A 1TU4A 1ZWLA 2E2WA 4IRUB 3RG2A 1EFHA 2Q07A 3HKDB 4BMNA 1P91A 4OM8A 2CF6A 5A6SB 1WKVA 4MUAA 5DM2A 3RVBA 1EAMA 3G7SA 3Q7RA 4LXYA 1L7BA 3T5MA 5B6IA 5BR7A 3SJAA 4KL8S 4MR9B 5CDGA 1OVMA 4MQEB 3PXGA 5JD6A 5JFTA 2P40A 3NVMB 4NC9A 2O8VA 4WCFC 4CQMB 2C88A 1CLEA 1HURA 3N2EA 1I30A 4FOLA 4NMLA 3MYRA 3DBRB 4K6FA 4KSYA 5F5LA 3VZQA 4A6XA 5SY4A 3I1YA 3TCNA 1Z2EA 4CBVA 1Q3TA 3BILA 1T1JA 5JIBA 5LKRA 1NJ5A 3BSFA 3BIWA 3HB0A 2HREA 1K5GA 3QLUC 4Q3CA 4Q37A 3ZWMA 3I9NA 1Z5NA 3ZZMA 4EKIA 3TQQA 4N3CA 4RQBA 2JAXA 3W7VA 1V8BA 4X60A 1QF9A 5ECWA 2OKCA 1SZCA 5BV7A 2A7QA 3R1IA 2P2YA 4WLVA 5F2NA 3AFIA 1NUPA 1CS0B 3G6KA 1YL7A 1XZIA 4XWTA 1QVRA 4O4JB 2NU9B 5T57A 1SVIA 1NVWQ 2PRIA 3DEIA 3W5DA 3T7SA 4GKBA 4RY0A 1T2DA 1I0IA 4DC1A 4F60A 4BQEA 1R0KA 1GQQA 1MFZA 1VE7A 4H7PA 3MELA 1U2EA 2DH5A 1OHHA 4I3FA 4RAQA 4UE3S 3DE2X 5EPEA 1U9IC 4Y30A 2H6EA 4AYWA 2I1LA 1E61A 3T7RA 4Z8XA 1UFQA 4R8SA 2HSZA 4UUOA 2JCYA 3RHTA 1VBKA 2Q3HA 4DRXB 3E23A 4OXRA 4NDAA 4XGKA 5NULA 2FN4A 2LTAA 5BXYA 5JRJA 5K51A 1WQ4A 4U2EA 5MGBA 3GZNB 1ICEA 2UZIR 3FZYA 3V80A 4JD5A 2VDRB 2X0FA 2F4VB 4N76A 1UC5B 1KEEA 1P6UA 3U3DA 3F49S 5KTNA 4PZCA 1USUA 3UK2A 5JXWA 1R50A 1IHUA 3WLKX 3DZCA 5G0UA 1M8GA 5DRTA 2P4EA 1U8YA 2F1KA 4KXFB 1S0UA 1SWWA 3QKRA 5FBWB 4YUZA 5B30A 3WFJA 4RW0A 2HXYA 1AKWA 1Z68A 3IEPA 4YR9A 3FVWA 3AEQB 4K28A 3NUGA 3O7MA 4HNQA 1CUCA 3OAAD 2ATVA 4JP2A 5J4VA 2OQVA 1D6MA 1FNNA 4M6WA 1YVEI 4FT2A 3NHAA 2NXNA 1FQWA 1NAIA 3QVKA 4FQ8A 2VXYA 1MZPA 1FSZA 3T54A 1U9YA 3N53A 1X80A 1A9RA 1X77A 2P3LA 4BC1A 4QUJA 1D8AA 3F4LA 2PGLA 4LJLA 4ZAYA 5LVAA 5HKLA 4S1WA 5CLLA 1JDBB 4OBBA 4R2MA 1NATA 3S2SA 2P8SA 2Z2JA 5DEIA 4TL7A 3NHMA 3TTWA 5M04A 1B93A 4OKNA 1XTJA 4ZAWA 1W94A 3C6BA 4GXNA 4Q93A 2I9PA 3I42A 1X7DA 1I2ZA 3IDAA 4FFSA 4FJ1A 2UYYA 2ZYDA 2XYGA 3HCDA 1BE1A 3EYAA 3BKWA 2CVHA 2AEMA 1T29A 4MQMA 3NIDB 1QQ7A 2UU9B 2V4ZA 3FUTA 1K1EA 2C99A 2AE2A 2WZBA 2YVKA 1KDYA 1JDBC 2ATCA 2P68A 4JUFA 2IS4A 3I6IA 2J3QA 2XE8A 1E6EA 1FDUA 3RJZA 2YOHA 1UP6A 2H59A 5DK6A 2XE6A 3PZRA 2QNIA 1U1CA 4MUFA 5AXCA 2JH8A 2Z43A 5FNZA 1LNSA 4CN9A 4ZC8A 1ZOPA 1P33A 3RC9A 5C4IA 3BK1A 3IE0A 3IJEB 1WXIA 2A88A 2FW9A 3IX7A 4O2LA 2JLZA 2X58A 4TLCA 1GV0A 2VWPA 3HXOA 2YZ7A 1LDEA 3ELBA 5DULA 1BX0A 1W93A 1YB1A 1K5PA 2CXHA 4GNRA 4ZQGA 3UMGA 4WBNB 4BEWA 4ZCPA 3F96A 3N7AA 1A97A 2J7KA 2Q3FA 3SYTA 3KELA 2X2OA 3S6JA 1NSTA 2BPOA 3O4JA 4PZ9A 3AQ4A 5G3YA 5CU7A 4E13A 1Z0DA 3B85A 1U3WA 3HA2A 1REQB 1L6IA 4F9GA 1U4NA 4ML3A 2PMBA 5IJ0A 5JCJD 4BMVA 5EJ6A 1AKRA 1KR2A 3FDZB 2ZZNA 4E4RA 4EJFA 4N3BA 3JPYA 4AWXA 1F8FA 3O91A 4GZ5A 3WGGA 1I6KA 2R8OA 4FIZA 5CFMA 4XVRA 5DGXA 1Q15A 3C7CB 1QQ6A 3KQSA 4H77A 5E38A 4DWWA 1YIDA 3EDQA 2X3FA 3HWWA 2ZIGA 3QPBA 4R1NA 3B9QA 1K8XB 3IA2A 1DTWB 3LSTA 5FHQA 2RAUA 2ZVQX 3GXBA 3OQBA 2NTJA 4M2LA 1I5EA 4NYIQ 3U3XA 4URFA 4ZPJA 1VLHA 3KEGA 3P52A 2OD9A 4ONEA 2JEOA 2WDPA 2IYRA 3F3KA 4QHTA 4KPYA 1Q2XA 1TRHA 1E89A 2ZSEA 4AJEA 5F98A 1DO8A 2NSYA 3MB5A 5B3LA 2RHBA 3ZJYA 5CJJA 1G66A 5KYKA 3CUSA 3K8ZA 4H6VA 1T10A 3O47A 3CVYA 1OZGA 1U2PA 3QG5A 2WSYB 2EVWX 4LDPA 4AUNA 4ETNA 1SKBA 3VU8A 4S3MA 1ORWA 2ZR0A 2XGOA 4PQEA 2UKDA 1MOPA 3AY7A 3EISA 3M3HA 5CDFE 2WMOB 2G9RA 3DL2A 1E4EB 1E5QA 2J3HA 5TF0A 1FXSA 2B2NA 3L8EA 3NAGA 5LQSA 2PKWA 4TV9F 1WCYA 4WGGA 1I6MA 4QBKA 4R54A 2CGEA 2HU8A 2SKEA 2V7VA 4HJRA 1NNSA 2XVYA 1JAHA 2I5PO 1TD9A 5CYPA 5I7FA 5DTQA 1K98A 3O95A 4F5DA 1CZHA 1B74A 1SHUX 1N6NA 5C5DA 4Y1FA 1U2SA 4RE5A 1Q0HA 4D45A 1RRVA 3HCWA 3HB9A 4JJ8A 1YH3A 1ZUWA 4QOHA 1G18A 4JI5B 1R5OA 5CEFA 5B36A 1P7YA 3Q15C 3KU1A 1NFRA 3JZMA 1GG9A 4KACA 1T0HB 2G08A 2P2NA 5C1IA 1AKUA 1YJCA 2WJJA 5K8VA 5HE8A 2HA2A 2IHKA 4Y2XA 1W29A 2FCAA 5CHEA 5A4AA 5JSHA 5C31A 5D85A 4TWJA 3TMKA 3LQQA 3BSSA 3V1KA 3WIBA 1ZXLA 5AFSA 3OVMA 1G3IA 2QL9A 4HWGA 4RVUA 4UFPA 1NP3A 1XTPA 1R0ZA 1PEAA 2ZRPA 5H1YA 5HFNA 6REQB 3VVLA 1WHTA 3F8TA 4YAFA 3CONA 4E1AA 4RD6A 1B00A 1X1AA 3Q98A 3DTVA 5JDIC 3GFRA 1RRCA 2OC9A 3IBCA 1A3CA 4WV3A 1NW5A 3DOJA 2F2TA 4BX0A 4INPA 4KO1S 3EGIA 1RZVA 3NG1A 1IYZA 2A5DA 3GPDG 2X9VA 3FF1A 3OIVA 3JR7A 4U9HS 1HE8B 2AEFA 3TTUA 1G41A 5JS1A 2WFMA 5JAZA 3N07A 2G9ZA 2PSEA 5DJ5A 3LCVB 2NVWA 3TI9A 4UEKA 2OVFA 2FMHA 3QE4A 4G5RA 5EINA 5ABPA 3Q7QA 5AT1A 4AMUA 3ZVRA 2LNDA 5K4AA 4CM9A 3FDJA 1ZCZA 1EDOA 1EFPA 5KCMA 2QU8A 1U2QA 3EGVA 4B2YA 3WYAA 1ZK1A 2HCJB 2I03A 3K9QO 3VSAA 4BO8A 1FFXA 3T0IA 2D2XA 3H1BA 3L9WA 4ENVA 1N2HA 2XWPA 4J6EA 3OPMA 4OXYA 4Y1GA 1L5LA 3STXA 2Q6LA 5K8JB 4O4LB 3EC7A 4E2WA 2DLDA 4PHTA 2JAQA 2RHCA 1Z12A 4V3CA 5L8VA 3NC0C 4KR3A 1KHTA 1E5LA 1FCJA 4QXAA 4JUIA 1Z7GA 3S1SA 3FPCA 4A2CA 3ZXSA 1ST2A 4RA6B 1G20B 2JANA 4WINA 3P94A 1C1XA 3PFFA 5AHXA 1QO0D 3JWIA 2PIDA 5EGNA 1EXVA 1PF7E 2OG2A 1J07A 2IODA 3PNQA 4J90A 1DZIA 3CEJA 1QRRA 4ACAA 1LXCA 5C5EA 2CF5A 3G2OA 4MR7B 3F71A 2MMGA 3BL6A 4FOOA 5C52B 5JY6A 4R8KA 2E85A 5EWJA 3BA6A 5G02A 3AC0A 1ZMRA 5A5DA 1OFUX 2OLJA 5CYFA 4QYWA 1IWOA 3VR2D 1EK6A 3SLGA 3RSSA 1ZR4A 3AVTA 5C4GB 3O4IA 1TTTA 4D57A 2F1IA 4FX5A 3VMMA 5FA8A 2ZFUA 3BEDA 5AJWA 4AY5A 1IUNA 5JPIA 2VP6A 4TXJA 3D6FA 4EL5A 1GGEA 2UVQA 1K6XA 5JEEA 4RTMA 3RROA 8OHMA 2PGXA 2EDAA 4DR4B 2FSVA 3NTOA 2OOSA 3RYFB 1O6CA 1WTCA 2E6KA 4EKNB 2IOHA 1JYFA 3FTDA 2OV4A 1PX2A 1J90A 1RI4A 2JCGA 2FEMA 3BE4A 3GNQA 3PGJA 2ZI3A 3C6MA 5JDCC 4B40A 2XGJA 3VNVA 1H2BA 1IAVA 2ISSD 1TW3A 1KZHA 1NUSA 1TCAA 1YZVA 2QTHA 3BQMB 3D6AA 3PL5A 1TQ2A 4F8JA 1OE0A 2HKIA 4F8EA 3DYBA 1CSEE 3ASVA 3PPYA 4RO0A 2DBZA 3IDQA 5LNK6 1QE3A 1W0CA 3TUZC 3G7UA 2H1CA 1X1EA 1C2YA 4DCSA 1ZMBA 4LNAA 1HH4A 1MOZA 3ZDBA 2Q0SA 2V9ZA 3QENA 3PIDA 2FDCA 4W9NA 3C48A 1XD9A 4P58A 1BIFA 4DNFA 3HVIA 5DMXA 1TYEB 3KXDA 5H3LA 2MR6A 4GOMD 3QXXA 4UDOA 4CMAA 2C9BA 2ZXFA 4I9HA 2XW6A 4ZZ1A 4KQMA 5AW2A 4XJTA 1I4LD 5A71A 5JSKA 5THKA 4DLTA 3PA6A 3MOGA 4TQUS 1JQKA 2MSKA 1K86A 4UZEA 5EUBA 1QIIA 2Q3CA 3KZCA 4MYCA 4II3A 2V7QD 4LRSB 2Y1GA 4QO8A 3X1KA 1DCMA 2WBLC 1G16A 4ZCIA 4NECA 3SX4A 5IVHA 3KYJB 4KFUA 3VGJA 5CAEA 2ZS9A 4CEHA 4DIMA 4U7FA 1F2DA 2CSUA 2B4TO 2VSXA 3IALA 3Q3GE 1T0PA 3HRHA 1U2ZA 3CJRA 1OI3A 4ZQEA 3A1EA 2EFYA 3R5FA 4TT3A 2V59A 3L49A 2YMPA 2E49A 2DPLA 3RIMA 2ZWVA 4ON9A 4WECA 4F3RA 1G8MA 1U2RA 3P9SA 4HWTA 4NU6A 2CCJA 4R1UA 3OIDA 3DNMA 4XLLA 1O0CA 2JJ1D 4KVGA 1V26A 2X2EA 4M7OA 2BFCA 1J00A 4LXTA 4TS9A 2RFLA 4YCDA 5LLDA 4QM7A 1N2OA 4J4BA 1NVVQ 2O0HA 5CDSA 4BEVA 3UF0A 3ZXUB 4AULA 1B2RA 1CQJA 1XEAA 4FYHA 2W6JD 1MPXA 4R2IA 4NSNA 4NKRA 1IH8A 1XEWX 1KBQA 2A59A 2FRDA 4XB1A 4Y6RA 1YR6A 4REOA 5E6UB 3LI2A 5DHQA 4CHGA 4E7PA 2G06A 1NYQA 4XDYA 2LZ0A 1WJGA 3PCTA 2RI0A 3AZQA 3O8BA 4JJAA 1F0PA 4KXYA 2YWRA 4OQXA 4ZREA 4A8JB 3CT6A 3TQRA 1F2UA 3ZZNA 4R83A 3UW1A 2Q9UA 3IUNA 3PKIA 3RVKA 2HNBA 2BGMA 1RWWA 3TX6A 2VPXA 3T7IA 1KAEA 2A9RA 3UFBA 4AW9A 4BLRA 5JR3A 1Y8RA 4M98A 1M6VB 1L5WA 3SEZA 2LXNA 3HKEB 3NTRA 5EY5B 4YJ3F 3UWKA 4A8JC 2MU1A 2ZUBA 5TXGA 3BXFA 2PZAA 2GFHA 2UVPB 4BNKA 4W5QA 1WPXA 5HBRA 1QVVA 3DULA 1ZS9A 2H1SA 5BSTA 1R2QA 3H2GA 1I33A 4IQGA 2JARA 2VDQB 4O4HA 4WMLA 2HJHA 2MDTA 3INNA 2IHUA 3PQFA 2GBGA 4DBLE 3SR0A 3O0DA 1P18A 1GRVA 5CIQA 5K0GA 3VO8A 4DKJA 3IUEA 2Z8XA 2O8EB 4NWIA 3MG9A 1RI2A 2MMCA 4EGFA 1YQQA 2QV0A 3DHVA 1JB9A 3F3YA 3F97A 5GAJA 2QTNA 3EGWA 2PMWB 2PYIA 3GCXA 1TGVA 5I3CA 3NHFA 5LPNA 4AJIA 3OE4A 4ZOLA 1L7MA 1KIMA 3ENNA 3EZFA 4N54A 5KTKA 3OCZA 2B8EA 1SC6A 1IC6A 1KO8A 3QKUA 4GOXA 4RKQA 1PYGA 1XMIA 5LBUA 3I01M 4JJKA 1H1TA 3RUDA 4F04A 4ZYZA 2L0XA 2MHCA 3K3PA 3L5KA 3B36A 4O2AA 4CV0A 1ICIA 4F3YA 1V45E 4B3GA 4KZPA 2VNAA 4YT5A 1OYOA 1UOEA 2XA9A 4NCXA 1UOQA 2FSFA 1GUDA 3DR5A 4CUZA 4LF8B 5JT1A 3H0EA 2IWRA 1EESA 3GBPA 1QIDA 4TRRA 5IC5A 5ILQA 4O08A 3LL7A 2HDHA 1PW5A 2IXEA 1TT5B 3FUUA 5B7GA 1N1GA 2GB4A 1B42A 5I8ZA 3G59A 2O1SA 4IXWA 5L7WA 4G4JA 4N5DA 5BNWA 1K0FA 2O48X 3EA5A 1NV9A 3HWRA 1O03A 4BMZA 1CNFA 1MV5A 1XLTC 4QDUA 4GDFA 2ECFA 5LMUB 3H0CA 5AKGA 3PHIA 1BMDA 1AN0A 1YSCA 2Q5LA 4NE9A 5K0NA 1J7KA 4AXBA 3TG2A 1TPYA 1XCMA 1CKEA 3H7IA 1F0NA 1HDEA 1Y7IA 1RJ9A 3EG9A 4KXVA 4YMIA 5DK4A 5A7GA 3MILA 4M1EA 3WDSA 2HF8A 4RHXA 1E7YA 3L05A 4ZHQF 3KM0A 1YZTA 1FUIA 5FF9A 1RWNA 2OXIA 1YJ5A 1XJ5A 1LA2A 2B0CA 3ETHA 4OL0A 1YA4A 1FFSA 3D5EA 4W8OA 5ALKA 1HT3A 3REOA 3EQ2A 1OH7A 1KFEB 4CFZA 1MJFA 4HNAA 1VPEA 2QL6A 1R9NA 2QJWA 3BFPA 4GHWA 4QYTA 4MVXA 4WK0B 4YECA 1XHFA 1J22A 3DOHA 3VPGA 2IYVA 1XMOB 1WCWA 2KW5A 3FSEA 4HXYA 4MS1A 1Y0BA 2EJWA 4YJHB 2B78A 4H7DA 4Y0VA 5TF4A 2CW5A 4LY3A 1BEEA 5GZ3A 2BH2A 1GTG1 2BGLA 1IHPA 1LC3A 1OI7A 3NIBA 1GGFA 3FTNA 2XKJE 4A2PA 4CT0A 4DUPA 3ZHRA 1BU8A 1M2NA 2QX6A 2X7JA 1M74A 3PX2A 1ATIA 2VA8A 2QYHA 2XSZA 4YXFA 4TMYA 3TNYA 3KKQA 3WK7A 2GMWA 1MU0A 3K72B 3Q12A 3VZRA 2O6HA 1JG3A 3EGXB 3FOCA 3SS7X 3WBFA 3HJBA 4NBUA 4D3ZA 4ZMSA 4CLRA 3IP8A 2PQ2A 4MVWA 3BHMA 4G36A 5GONA 2H18A 4O1IA 4ICIA 3FNEA 4PNPA 2VN8A 3L1JA 4DLUA 2BWJA 3BWEA 1T5TA 4XW2A 4ZVNA 1C7FA 2C5BA 1DC4A 1JXOA 1QC5B 1F4PA 3BWCA 3GEEA 4M8LA 3ZQJA 3ZCTA 4BLQA 1L3BA 2BZGA 2OGTA 3A1SA 5G4KA 1M1NB 3KOWA 1QH8B 2VYCA 3QI7A 1ECCA 5THXA 2PYZA 1A5BB 1OXBB 4O02B 4AKEA 1DQPA 3GDFA 3AXSA 5EE1A 2OK7A 1HG1A 3F6EX 3JZFA 1T4GA 2ILTA 2V7WA 3KZOA 4JR0A 4NEQA 2YL2A 4ZAZA 3K35A 3TSZA 4AP9A 5AK0A 4C0SA 4GICA 2QBYB 3JATB 3K0BA 2XA2A 3JYQA 2WINI 1ZH4A 4MDHA 2HEGA 1RABA 3ZU3A 4IMJB 1NN1A 2VYQA 3CF4A 1Z45A 3EMDA 3SQOA 2CHQA 1TTPB 3REQB 1VPDA 2G9VA 5EESA 5EQTA 4YMUA 2EIXA 3W8DA 4IG4A 2H29A 3PC2A 4ZAGA 1PTJC 2WG2A 1Y37A 3M6MD 1DS6A 3RKUA 4DM7A 4RPIA 4DZZA 1SBYA 3WLQA 1DRJA 3U7RA 1TM2A 1PKXA 3KQPA 2W8BB 3KRTA 1IBLB 2JH9A 3PEYA 5LQRA 5GJWC 4CR8A 1PQPA 4JSRA 4BLWA 5A4FS 1RW4A 2JEYA 3F5MA 3M6IA 2CFSA 1R6XA 4KO2S 4RCYA 4URUR 3EEIA 4EZBA 1JQ3A 4E1VA 1W581 2ZTLA 5IASA 1U5CA 3CLTD 3GMDA 3QWBA 1XEFA 1DPGA 1GEGA 1RQPA 4EOGA 3ASUA 1Y7HA 1HE1C 2BHTA 3R5JA 5AW9A 1SA0B 3VBCA 1Y5LA 2HWWA 3L43A 4NZZA 5SICE 2YDXA 3OPNA 3G9QA 3A2LA 4J1QA 2YCBA 1BDJA 3DBOB 1JR6A 1QDEA 1AK1A 4LCEA 2QTCA 5ESRA 5K99A 4NBLA 2FPLA 2A0UA 3FHLA 2X8WA 4KMOA 4PNZA 3IQEA 4PX2A 3OF2A 4ZANA 1GUYA 3L7CA 3PB3A 3UN1A 1AK9A 5HFAA 5B3JC 1EGQA 4DQ0A 4W1PA 1T2UA 3WMGA 5IDWA 5ELXA 2GK7A 2FYTA 5IYZB 1SUAA 2AD5A 2WVAA 4DW8A 1IPEA 1OT5A 4MI9A 5TQ2B 1EUQA 3KVVA 1QB7A 3DE4X 1GAQA 2RB5A 2F8MA 2XNDA 2YNMA 2HMUA 2ZE7A 4L5CA 6CHYA 7ABPA 1DWUA 1J0BA 2O1WA 3IUSA 2NVBA 1GQ2A 4KBGA 3WX0A 4UXJA 4BPRA 1F4VA 1Z7BA 1N5RA 3GJQA 1KFBB 1KVUA 3IIIA 4NQRA 2WIKA 5HOQA 4BFWA 3QE9Y 4I9NA 1NOIA 4EITA 1JG2A 3RVQA 4BLSA 3CXRA 4EGJA 4B7ZA 1BJRE 5IT4A 3F4KA 1JHRA 2WWWA 1YJAA 1A98A 4MGKR 4FCCA 5CM9C 1RCTE 1UKYA 4G2NA 1S01A 4XQEA 3U61B 1UBGA 1SZPA 3GI1A 1AKVA 1W2HA 1XXHE 4WSOA 4CW7A 5CD1A 1XLVA 3LDFA 3DMHA 3RTBA 3U16A 3KTAA 3OQHA 1E0SA 4C20A 2H1VA 4RTSA 4FOTA 1HL3A 3TEMA 1ZI9A 3DDUA 4LK3A 1PBTA 2G25A 2XMRA 3NHSA 4D96A 2OA0A 3DDHA 4ZO6A 4JLWA 4MGYR 2C42A 5EHNA 4L57A 5DBFA 1O95D 4ZT4A 1MO4A 2AC2A 2FZKA 4ND1A 6AT1A 2W2MA 4TXNA 1EA5A 4UCXA 1KS9A 3DC2A 4DEXA 2XXAB 4RPGA 1NVMB 3QVLA 1RCFA 2A1TS 4O6VA 3ONFA 1UFKA 1FDWA 3CN7A 3U7EB 3WKCA 4M4SA 3PFCA 2HSJA 3G2MA 3EFHA 4Q01A 5EE9A 2QW0X 3BMCA 1JHDA 5K8TA 3GWGA 3WVNA 1MC1A 2HBQA 3R0JA 1E5TA 2GN1A 1L4BA 3UOAB 2AVNA 2G9NA 2ETVA 5ALRA 2CNNA 1BA3A 3GJ3A 1F14A 2JJ8A 3OQVA 3NHJA 1NJGA 1FUEA 3VVMA 2JFUA 4FLMA 3GBVA 1E6KA 1UBNA 4NF2A 4EECA 1QP0A 1G21E 2J9YB 2WEKA 4X85A 2O8BB 1O0BA 3D4BA 4W6ZA 3RVMA 2IP4A 4BNJA 2XUAA 3DEYX 2PD3A 3TGPA 3GPIA 2V55B 1B14A 2DHDA 2WSMA 2E5WA 2BEKA 2VPIA 3QPWA 1OGYA 4GSYA 3DBHB 5GJCA 1UC8A 16PKA 1V1RB 2DLCX 1IEWA 1IIBA 1M34A 1T3HA 4PYIA 1OMOA 1N7JA 4JI4B 2C97A 4YH1A 3R3WA 3ESYA 3BS4A 4ZALA 4JI6B 4FEYA 3SQNA 4CM8B 3TSAA 3I2JA 4I6GA 2PKCA 3LLMA 5LWQA 4EO4A 3TBHA 2H9AA 4ARZB 1APBA 1ZPDA 2PMFA 1TX4B 1Q0TA 2CJYA 1Z6XA 5F23A 4B7XA 3IIJA 4FYMA 2PKXA 1J5EB 2TYSB 5EZQA 5IK2A 1G4UR 4LAFA 4B33A 3V7FA 1JIXA 4DQLA 2R00C 2GDJA 2WR8A 1C30B 4CCSA 4I8IA 4GGMX 1Q50A 5BSVA 3EF3A 3K6SA 2Z1DA 1ND5A 3C3KA 2ORED 3RFCA 3L4BC 2VK2A 4MITA 4PX5A 1ODJA 4EYOA 3AR5A 4Q18A 1NXXA 2P4QA 3F2IA 4R31A 4YP1A 5KVQA 3LZ6A 4ESVA 4G0WA 4WHMA 3A2NA 1NUTA 4IMRA 1TZ2A 1UBKS 2FJUA 2ZT7A 4FW9A 4UM7A 1YBFA 1XA0A 4LV6A 3M81A 1QBGA 3KTOA 5F73A 5K8UA 1UPFA 2C2ZA 1KE2A 5LU8A 5CB4B 1J25A 2AT1A 3AUYA 4K3UA 3GARA 4LZJA 3UUFA 2IEAA 4NJOA 4O4IF 1CRLA 4AZ0A 1G7TA 4HWKA 1BCRA 1WAMA 1NR5A 3ND6A 3RUIA 1N3IA 5JQGF 4MQBA 4JUBA 3WAGA 1MJGA 3EZXA 4YV2A 1BTOA 1UINA 1YRAA 1C7JA 5IUKC 3LLSA 5J1TB 2V7GA 3K30A 3A6JA 3ORFA 4JJ4A 3OZRA 1XPOA 3MINB 4GMKA 3LCCA 3HYSA 1F8GA 3QFCA 1CBUA 2GZ3A 1SIUA 1T8TA 3R3XA 3UXYA 3F8WA 1YDMA 4DTCA 3PE3A 1N2CB 4UTRA 3NI2A 2B69A 5HQTA 1L6RA 2BM8A 5TGTA 1L7XA 4N1AA 3TVYA 3K1TA 5K1ZA 2DKOA 2HJGA 4TV8F 1VOTA 3MGGA 3NHPA 3L0ZA 5INTA 1IUPA 5FUQA 3CJQA 2Z5VA 1NAHA 2G1UA 4M7WA 1GQSA 2I4IA 3DMRA 4O63O 4R1MA 4PLHA 2QUJA 4E3WA 4CU2A 1GCIA 2PT7A 3FD8A 1MH1A 2Y1DA 1VL6A 2IPLA 3VTAA 1C9DB 3V3KA 3VR5D 4UJ3A 4XYBA 5FORA 4QL3A 1IN4A 2BGUA 3L0PA 1I9CA 4RGBA 1K63A 1QO7A 2G82A 1H2FA 3VR3A 1EP9A 1ES9A 3FSRA 2R7AA 4NARA 1R3UA 3PDHA 1MG5A 5TSDA 3SF8B 4D6YA 1IBMB 4HN9A 1Y8CA 3QBJA 1ODFA 4REQB 5FTKA 4A8HA 2FEPA 3DBLB 3KD3A 3E84A 4NOLA 2IOFK 1S3GA 4QJBA 3UOGA 4Q00A 4RH1A 1R12A 4X94A 1U1IA 4E5PA 1G8YA 2HO5A 2COKA 1O96B 2LIVA 1KH2A 3KHUA 2HRZA 3N5KA 3HBLA 3QTTA 1FRNA 4FDUA 3H9GA 3NLLA 1UMBB 2C7VA 1E4YA 2QMHA 1EX1A 1IAQA 3GGSA 4YRQA 3COPA 4HVLA 1NBWB 2CXNA 1UDBA 1DHTA 2ZVPX 4QA9A 5BMVB 3TDNA 4C4RA 5KMGA 2GKOA 1QQ5A 1U90A 4LA4A 5FLKA 1PGOA 4D9GA 1WM1A 1R9GA 3QEMB 3RO7A 5FR2A 3NWEA 1E2UA 1EQ2A 4M9QA 4R6XA 4YTEA 3M5PA 4F3NA 3DFKA 4EY5A 5DN6A 3LPMA 3IBYA 1DFIA 2GEDA 4PIPA 1DC5A 4C0KA 1EFKA 4RF2A 1EHYA 1VSBA 1BHSA 5DHFA 1BYIA 4X7RA 6GPBA 5JJCA 4MDYA 1ZX1A 5EWLB 3H4MA 1Q2UA 4L07A 3IVCA 3NXSA 1PG2A 2ZBFA 2AK3A 2GAOA 2PGAA 1W0KD 1DOZA 1R8XA 2XYQA 4QTUB 2B6HA 2BJVA 3CUTA 1G5FA 2AG1A 4I19A 4JCCA 5CX4A 3OMLA 1E66A 3ESDA 1UBCA 2PEYA 5AJYA 2H1FA 2XDQB 1TU0A 1SXJE 4AT1A 1N8NA 2B4KA 3GV0A 3GDHA 3EVFA 3QH4A 5U1PA 3S2GA 2IF2A 2VUIB 1ZHOA 3FY4A 1FFWA 5H4GA 5LQDA 221PA 2R8ZA 2YW9A 5JASA 1UEXC 2BJHA 3BTOA 4HNUA 5HR5A 1T1IA 2Q5QA 4JJFA 3V48A 3B53X 3AR4A 1B0ZA 1LQTA 3WGJA 1OLXB 3DM9B 1LDYA 4DG9A 1H23A 2IIQA 4CV1A 5K03A 1EWYA 2A78A 4A8PA 1FSPA 1RPJA 2D2FA 4LV8B 4AY4A 2QMZA 2V7EA 2VYND 3A1FA 4HOYA 3HTXA 2C61A 2BC9A 1M0WA 4MK4A 5L3SA 4C76A 2GD0A 2OBNA 1YI0A 2X1VA 5E8RA 4OI2A 1FSSA 1ODSA 4G0QA 4AYXA 2XDAA 3KL2A 5H83A 3VU0A 1M2OA 1CJKC 1F1JA 1HT2E 2YICA 4L02A 4JCOA 4UKDA 3OQPA 4RL4A 1NSYA 4IJUA 1FDOA 1C9EA 1AXGA 1UP4A 3JQFC 4BJ6A 5AVYA 2HB6A 4E6EA 2B5WA 2ZW9A 3MCUA 1RXWA 2ATIA 3H65A 3L7DA 1I5OA 1UANA 2E9SA 1H1DA 4ENUA 2V4MA 3BDVA 3JQBA 3AFGA 1PWZA 4BQSA 1YXMA 4EAAA 3IDSA 2O06A 3W5UA 4CT4B 2EX0A 4DMRA 1OI4A 8ATCA 4MUXA 2AJ8A 4CQMD 2CXRA 4JHXA 3LBYA 2IIPA 5FI3A 3KWLA 4A0QA 2C7PA 3DWEX 1DC7A 1FFHA 4YV1A 3D6VA 4XVCA 2AKAB 4Z5XA 3TS1A 4A8TA 4IWXA 4KBFA 3ROTA 2C78A 3O82A 4Y2PA 3UHPA 2QUBA 4QRHA 1NULA 1VBMA 2JD1A 2JFYA 1I2CA 3F4BA 3I5AA 3TD9A 1DV2A 2R1TA 4GBGA 4BKMA 2G70A 4PSAA 4W8GA 3TGWA 4N6NA 4RSHA 3IO3A 1AN9A 5B3AA 3LC1O 3NOQA 3A1VA 2GK6A 4OB6A 4X64B 5CK4A 3Q8KA 1SKYB 2W4IA 3FNFA 5CCEA 5ALHA 4WXMA 4Q39A 3U9LA 3ABOB 3OZIA 1NNI1 5F1OA 1QHEA 1KJQA 1PNTA 1AKTA 1FDRA 1U0TA 2R8YA 1P0PA 3GDGA 1TQDA 1P5HA 4HGOA 5FT9A 2XNJA 3P9RA 4F45A 1V4VA 5BW8A 2GFQA 1NQOA 3BDIA 4TVOA 5GOTA 5IAGA 1YRYE 3L6RA 5ECGC 1JDJA 1U0SY 3B3AA 4AJ9A 4WNYA 1FOEB 3QV2A 4K9PA 4Z3DA 3DMTA 4NHOA 5CTAA 4DRYA 2G09A 2CT8A 3MJHA 3HG7A 1H5QA 2RH4A 3FSGD 1ENYA 1I1NA 4O8ZA 3O3NB 1D0SA 5CNIA 4IQ8A 2G67A 1O57A 1T6YA 1Z4LA 4MGIR 3PGA1 5GZ6A 1EFVA 3N0VA 4DQDA 2VTBA 2ACWA 2B4AA 2XXBA 3I6BA 4JLMA 4N6GA 2FUNB 4Q3LA 3LDAA 2XMGA 1QAMA 2VKQA 3PFHA 4JP8A 4L7VA 4X7BA 1WKBA 4I8XA 4WQMA 2J4FA 4CVNA 3SWWA 3EAQA 5IKEA 2BMWA 4MVCA 3ZWCA 3BAZA 1WOYA 2I3AA 4F2GA 3IP1A 3OPYI 2QVXX 4QAJA 5HJ5A 4MIYA 4XB2A 4WZBA 4UUBA 2HW8A 5I3ZA 2BF7A 4U9UA 2FWIA 4JFAA 3W06A 3W5SA 3T5TA 3L4KA 2DSTA 2NZ2A 2C57A 5KX5A 3NAZA 3LMKA 1L5VA 5ENVA 2DFDA 3FLBA 3FJ1A 3GPCA 4RVNA 3SJUA 1B1CA 1OI2A 2VHJA 1LQ2A 1KPIA 2O3JA 4IV5A 4PVCA 1BWQA 2WK1A 3Q3JB 1KIAA 4IDPA 2J41A 1I2AA 5MN6A 2BBTA 3C8UA 1GCOA 2IZ0A 3FFTA 2BFEA 3O8LA 4J0QA 1C3OA 4WCVA 4QDOA 2YZKA 4D9KA 3DZDA 3UZUA 1FYDA 1TUBB 2RBKA 5DH9A 3UT5A 3S68A 1J1UA 2E1RA 5EKUA 4L85A 3W5CA 2BH9A 1T8UA 5I7EA 4Q1VA 3SDBA 2HRBA 3MOSA 2VSNA 4UHHA 1X2BA 2UXCB 2VAXA 5DDIP 3BIXA 2X1LA 4KN6A 3C5HA 5AM2A 4GECA 1GPMA 3EEOA 4DRZA 1MQSA 4JXJA 4PZ0A 5D7BA 1IZ8A 2IUUA 1SMKA 3PA8A 4FUQA 1Z0FA 2FY8A 3SC2B 3EFOB 1T9GR 3MMNA 4FSHA 4PZEA 2PFGA 3LD9A 2ZZKA 3B6EA 3KPVA 3N2IA 4MB6A 1YFZA 4QU0A 4ED9A 3OO0A 1JEEA 1W1WA 4HQKA 1QFZA 1JN0A 4UNNA 1A4RA 4P4SA 4M9SA 3OLQA 1OYVA 3DCYA 4K88A 2HPZA 1Q20A 2C5AA 3QF4B 3ZOZA 1R5NA 3AJEA 4YT2A 1C4KA 1RHRA 3DEHA 3DE5X 1T15A 1KETA 2CFTA 4JB0A 5HRUA 3P32A 3GQVA 3OZGA 1E79D 4X1KA 1BKYA 4KKVA 4ESOA 5DBEX 4L8VA 1Y42X 1QM5A 4G4SO 2ZRIA 1GRCA 1XAHA 1UR5A 4YJFB 5I9TA 5HKAA 3PUVA 1RWOA 1YVUA 1P5RA 1ESNA 1I24A 1M33A 3DVAB 3AIOA 3QF7A 4NZ9A 3RFUA 2JHFA 2PJUA 4BNGA 4C1NA 4L2IA 4EVRA 4ZZ0A 2OXTA 3RVNA 1JAZA 4EO7A 5FNVF 1L4FA 2HPHA 3IXMA 4KGZA 3ROMA 1VYHA 1JDTA 1TQHA 3LO5A 1QONA 2RHLA 4LE2A 2PZKA 4PYQA 1O0SA 5HIKA 2OESA 4XFDA 3WAJA 1TK2A 1UK6A 4L8FA 1NVXQ 3QXHA 3GP8A 4JBYA 2V03A 3BM5A 4AXXA 4RIEA 4KNWA 4ZTBA 4AJJA 1KF0A 5MN5A 1RHQA 3U4MA 3QPAA 2WAOA 1MC8A 3I9V1 4DS3A 3AUTA 1CQPA 1SCJA 5D2CA 1I4WA 1CUGA 3VYRB 1TTHA 1UBUS 2RC6A 4D42A 5BUZA 2Q28A 4RACA 5HUQA 4C2BA 2WB2A 4P6VF 2CYCA 2PUHA 3RYTC 1RXCA 1EWVA 5JI2E 1UWCA 1JSRA 1FFGA 1GGJA 2CDNA 2CB9A 3H2HA 5FOTA 4JL6A 2A9KA 4PYOA 3BMOB 2YJZA 4K03A 3VSDA 2BSQA 4QLBA 1M2VB 4I55F 4RENA 5T8KC 3K96A 4RDIA 1T0JB 4Z7QB 1XF9A 2R60A 5DTMA 2HJSA 4KITB 4XVQA 2JCVA 1O9BA 2V3VA 1O1YA 3LHKA 4MCIA 4WUTA 3HMKA 1SC9A 4Q34A 4UBOA 1EHIA 1GZ6A 4KKXB 1QKJA 4ZI7B 1GNTA 4D4KA 4NPAA 2PJZA 4HAIA 2QRGA 3AHHA 4I9GA 5ALEA 3TFQA 2YY6A 2JJMA 5LP6A 4HEA6 5I9BA 3WLSA 3FSJX 3AO0B 1ZN9A 1A96A 2WTMA 3E7PA 3P2KA 3R74A 2H5IA 4GI3A 2H4YA 2FW6A 1N5IA 1V7CA 1UBEA 3H9BA 3QZUA 4TMZA 5HX7A 4ND8B 1R9MA 1J33A 4X8MA 4D4IA 4X6XA 4WZAA 1Y4ZA 4ZKDA 4C0WA 3NNDA 2DC1A 1NDQA 2ODWA 5JNWA 1HFEL 3S4YA 4HS9A 3P26A 2ID4A 5JRZA 3K6RA 2PCJA 4YGXB 2W9XA 3FGZA 4DXAA 3OLXA 5AVUA 3UWMA 3B51X 2W6CX 1XA4A 1X7WA 4NZYA 3A9CA 2YCLA 2AMJA 3PRKE 1DO2A 1ZJ4A 5IMSA 4MVJD 4E5KA 3KAPA 1R16A 2IS1A 1XLWA 3RODA 1Z6TA 2FLWA 2JFNA 3AF4A 1V9CA 1YIOA 5IAKA 4U00A 4B9AA 4BMDA 2CD7A 2GRAA 1UADA 1WXEA 1N6OA 2EERA 4PCUA 2YFQA 1M10A 3GLKA 1UUFA 4H0FA 2QX4A 3HDGA 4MMZB 4G1FA 3RWMB 1MCZA 4BNVA 5EJ5A 4ZT6A 2UV8A 4QG7A 1FF9A 2BR5A 4ZVMA 3FRHA 3SF0A 1XQ1A 1KKUA 1Z6PA 4QPCA 1XIVA 1MA0A 2ZI6A 3L1IA 4DC9A 4TLLB 4KWIA 5CFZA 2EW8A 5GJBA 3FNRA 5DM4A 2BM1A 3TXYA 2FN8A 1E94E 4RVDA 4CIVA 3GH1A 1ZK3A 2CXUA 3R7DA 1TAUA 1XNJA 3CPSA 3IEUA 2D1FA 4G8BA 5U4QA 3MWGA 3GLIB 4B75A 1EFTA 3D1VA 1Q0ZA 3DDCA 5AVQA 2AW5A 4BX2A 4BEJA 2VHZA 5TQ0A 4C87A 2J6IA 3AI1A 3GAFA 3JQ9C 1Z0ZA 3R3JA 4KIGA 5HVNA 4MPTA 1ISHA 1WHSA 4EJSB 1RI3A 1DCFA 1TGYA 1I51A 1T3TA 1B6TA 4OOFA 2WJAA 1N3LA 1Z8HA 2EATA 3N05A 3S2YA 1T2NA 1A4IA 2MYNA 4HPWA 4L15A 3WWOA 3MXTA 1SB9A 3PXDA 1VI6A 4OFXA 2XOXA 3TLZA 3PBKA 4Z53A 4GAEA 1IY8A 1O7JA 1SVLA 4FPXA 3THXA 2WPDD 3G68A 2ZI7A 1XJQA 4GM4A 4LSMA 4ZJYA 5JZVA 2MYUA 1F6WA 2JI8A 3Q5EA 4EJSC 1B0AA 2JI6A 3R8XA 3T95A 2GGSA 2WYOA 4CMIB 4H3SA 4G9EA 1ZVVA 2J33A 3CNOA 2GCPA 1LBSA 5AHRA 5K3FB 5E3HA 2ISQA 3GLUA 3PDUA 1MB9A 2H1RA 3QVOA 3V97A 3VSBA 1RWPA 1JEQA 1GAEO 1BD3A 1U2GA 5DBHX 3K2EA 1D1QA 2ZI5A 4JC4A 4DV2B 3F74A 4IZOA 1AZSC 2HA5A 3FPAA 4OHMA 2Z4SA 4Y2SA 1NBAA 4IXMA 4C4YA 3OIWA 4RZXA 1CG6A 4WGFA 1UK9A 2O2IA 1EB8A 5DW0A 3P9ZA 4Q4AB 3NP7A 3QKWA 3QYJA 3WZLA 4L0CA 2RK6A 3A4NA 1ZP6A 4D02A 4YS6A 1AZLA 3A1DA 4YT8A 4X61A 1DQNA 5AOAA 3SSMA 4U7TB 1B26A 4QX6A 4FDAA 3WHLA 2HL6A 1Q7RA 2PLWA 1M72A 4HDNA 2Z08A 3VUEA 3N86A 1AGNA 2SCUA 1XSEA 4C88A 3E9NA 1PL7A 2GZ1A 2R6GA 3RTAA 4K1XA 3RTDA 1J2RA 1D5CA 2ZJ6A 3OEWA 3D4PA 1RLOA 1MDBA 3QUBA 2HRRA 2OORC 2IHJA 2PXCA 4I50B 4IIUA 5C1BA 5KQRA 4M9UA 2YXPX 1ZD5A 2J6CA 1JXAA 3AM5A 4DIOA 2C9CA 2W2LD 3K8YA 4I1IA 2GF9A 3ZU5A 1YRBA 2VO1A 1H8HD 3OCJA 2IYXA 3OX1A 1OF1A 3I2HA 3K09C 3RIYA 4FLFA 4BFYA 1K2WA 1GZDA 1QNFA 4W99A 5HQ3A 5JROA 1QHSA 5KHLB 5BRNA 1W87A 4G89A 1A82A 1F0KA 1G5HA 1IMOA 1IRIA 2PV0A 3E3MA 2B0JA 2VJYA 3UC9A 1QWOA 1LTKA 2HQOA 2A57A 2BFFB 4U7GA 5CB0A 3T4EA 3ZIAD 1GEEA 1DWOA 1WDMA 4NCIA 4IP0A 3BL5A 3KHKA 3GT4A 1R3DA 4IOLA 1Z4NA 5EUQB 1CUFA 1JALA 3WRYA 3ZLBA 2GJ9A 2PY6A 2QGZA 4QDKA 2FEXA 3NBUA 2G4VA 1N6RA 2QLMA 3PGMA 4O4JF 4EG6A 1HLGA 2BE7A 2FAXA 1CPYA 1AVTA 1WPGA 1ZM3A 4YMWA 1R8JA 2ZPTX 3QE2A 4LZAA 2P6OA 1DBIA 1FLNA 4Q66C 4MW0A 1EI9A 3QJGA 1PJTA 1EFRA 5BN4B 5AVVA 4GMDA 4YONB 4AZ3B 3ABSB 5I9NA 1E9CA 3AH8A 4HGNA 1YR1A 2VA9A 5GM1A 1DLJA 2AOWA 2Y1XA 1ZVKA 4LCJA 4BB0A 4B44A 4LX0A 3DE6X 3JVIA 4NBTA 5KNCD 3C16C 4ZAFA 1Q74A 2VXBA 4HD8A 5TMPA 4OXNA 3NJ8A 2IYAA 1YR8A 1O2DA 1F2VA 1ORIA 3MZ0A 2X77A 4LQCA 4BJHB 2IBSA 3H18A 3UPUA 2WF5A 3DLHA 1RYMA 1HZJA 3I30X 2FZLA 2YHSA 4KLCA 1ISPA 3WLNA 3GCWA 1ZM4A 2G40A 2ODBA 2WHYA 3UHOA 2XYPA 4B2IA 3A7DA 3BMXA 3MTDA 3MF4A 4TUYB 3O9ZA 3VPDA 3UT6A 1W46A 3W3AA 4WA7A 2F9FA 1P5JA 3DOUA 4AS2A 1XNHA 2IEDA 2ZRAA 4H08A 5D3QA 3WL8A 1VM6A 4U2GA 1K97A 4RLQA 1R0YA 3GYGA 1DZ3A 3O74A 3FPHA 4FGUA 4JBXA 4KCGA 4RLHA 4WNAB 5CK5A 3PRJA 4DDMA 5CW1A 4B3HA 1SRRA 4NHEA 3IIMA 4GLFA 2GF2A 1JHOA 4OFBA 1OIWA 4YRCA 3TYXA 2EGHA 4US0R 1GN9A 4PXSA 3X2FA 3GRPA 1AQJA 4C7OA 3KHTA 5K2OA 2H4ZA 3Q7IA 4L9SA 4JLDA 4NENB 2QORA 2VJCA 1IHDA 3LF1A 2MSNA 1UMDB 2ZRCA 3INYA 1PD1A 5K3EA 1X94A 5CVVA 3U1VA 4X45A 2I55A 3ZJVA 4PAWA 1KO1A 3GRZA 4M8IA 1H2ZA 5EJ2A 3ZHQA 3K05A 3FCOA 3WMXA 5EYPA 3DMPA 4HGQA 5IAEA 1J5PA 4GE3A 1HEYA 4FDVA 2JLVA 4OYHA 2P35A 3MERA 5FH9A 1RCUA 3FYUA 5A9SA 1WIWA 3RC3A 1L5OA 1N1MA 3GW8A 4R71A 1YFLA 2EZ4A 4BRUA 5IT9A 3RI3A 1WUKS 1CUEA 4E4YA 3S8EA 2PIAA 1XZBA 2FP3A 2PUAA 5DLQC 3JWGA 3NHZA 3MK31 5BQ3A 4RLFA 3L18A 3SM3A 4QJ3A 5ER9A 3FUWA 3LZDA 1TMYA 4HUQA 3WJ7A 1O89A 1VKRA 1NZDA 3VR6D 1CX9B 2W70A 4DSNA 1XZFA 1E69A 5BVHA 3E15A 1V96A 3CSSA 4YUYA 3CV3A 3ELUA 2GK3A 3LAWA 3WQRA 5A6VA 1E18A 1ZIYA 2X8JB 4KR0A 5K7SA 1IDOA 2EXXA 2ORIA 2YHBA 2AK2A 2GCOB 3BL8A 3NX4A 3TWOA 4HGYA 4WBNF 2YJ6A 2R5FA 3KXPA 2OQ2A 2WT9A 4FFMA 4D5EA 4W5HA 4BQQA 5CB4A 1XZLA 3ESAA 1TT7A 1ENOA 1I4TD 3LPNA 4PYJA 4NATA 1ZNYA 1HPLA 3NRCA 1LX7A 3T4UA 4IJVA 5H3HA 1RQNA 4UTXA 3ZQKA 4B79A 4DJJA 2I4RA 4A0GA 5A2QA 1H1LB 1TQ6A 3GMIA 4COKA 1JB1A 1Z8NA 4Z0HO 1MTZA 4L16A 2J7PA 3FOWA 3M5CA 2VTKA 4YT4A 1DKMA 2Q6KA 1COZA 3JW8A 1CE8B 1Y4DE 1CQXA 2FPGA 4QOSA 3ZXIA 3D3QA 1STOA 4U7PB 1ZONA 2WWGA 3C6QA 5EIBD 3K70B 1SIWA 2YC2C 3WB2A 5FWYB 1Z0SA 1S9DA 1XTUA 4AU1A 4NMMA 4Q21A 3D3WA 4XIIA 2OYCA 3VU9B 4UEWA 4AIRA 5KNBD 2WKPA 3QTBA 2VHUA 2BEWB 1M6NA 3D2BA 3FCYA 1H3NA 4JBGA 3HHEA 5BSFA 4MUGA 3RS4A 3RBVA 4JI8B 2PVSA 2VDMB 2E4XA 2XCQA 1RZRA 5AXDA 3ENQA 4FNOA 2NUPB 4N8SA 1ONNA 3F6BX 3SM9A 3K70C 1MEJA 2REQA 2I6QA 5B1DA 3BF8A 5K0SA 1L8AA 1GJRA 1TYDE 1IB0A 1WXGA 1JBKA 4I5DA 1PYOA 1B8OA 1SUPA 2CK3A 3ZDFA 3DQZA 5K8IA 5JPCA 2QNRA 2BGRA 4OUDB 4Q1BA 4D9FA 3JWPA 3PHJA 2BKXA 2C4MA 5ADVA 5LL6P 1ZHFA 5A4JA 1N0UA 1NW9B 3ICWA 3G8YA 5LYJB 1ECLA 1Z5VA 1RXIA 1P9LA 4ARAA 1VLQA 2V3WA 1MJNA 1DMRA 1FL9A 1Z0JA 4LEIA 4LXIA 3LOPA 4NH4A 1GDTA 2AX4A 2GPAA 2C7GA 2WZDA 4PGMA 2AZTA 3TX2A 3WLOA 1FP6A 1HE4A 2A6PA 1ADFA 1OU4A 1AX9A 4IDGA 4OY3A 1MF7A 5AM1A 2Q99A 2V6JA 2Z04A 5COAA 1WG8A 3TTVA 1FU8A 1AMOA 4JJ7A 3WYCA 4R1TA 2PWYA 4PZLA 4QLOA 4YJGB 5BNTA 2DSNA 1OGJA 4P3NA 4ZWNA 5HTKA 4XDHA 5KYXB 4PO8A 4MVJF 4WVFA 4MKIA 1TCBA 4QXPA 4CE6A 1PZFA 1JVNA 2OCIA 5H0IA 4HAYA 4ZYYA 2PXHA 1BQ4A 1N8KA 3AXTA 4KG7A 3I58A 1ECGA 1TZKA 1XU4A 2XUHA 2Z9BA 4E5UA 1DAMA 5DMHA 1LBIA 3JD4A 2WYVA 1PHRA 4CM7A 4TKMA 3I1JA 2VCHA 1T36A 2HQSA 3K0CC 2HTEA 5KKAA 1I3LA 1PDOA 1P9OA 2IU6A 2JRLA 1QG6A 1J2TA 3B89A 3T34A 2BBOA 3MQ4A 2PJDA 4H6WA 1Z4KA 1FDTA 3ACBA 4A73A 4EI2A 2L19A 2EJUA 2RGEA 4TLMB 3ZDXB 4G67A 3VNRA 2IPMA 3GCZA 3DW1X 5LKAA 1J09A 3LWDA 5ALYA 1ITZA 4U3JB 1NYLA 3M83A 5J5CA 4EB3A 2L18A 1T4DA 4TYQA 4LI0A 1YMVA 4NY1A 4JLKA 3WMWA 1KK2A 3FFXA 5KOJA 2VJMA 2IL1A 3FCSB 4P93A 2ZI4A 4E09A 3B20A 1YQGA 2OUIA 4BASA 3COZA 3QLTA 1VJDA 1VP9A 3F5FA 1HETA 2BR4A 4GC5A 4CGZA 1NR7A 3L7AA 3NETA 3OC6A 4J29A 5LB4A 5TS2A 3OAAA 4UNPA 1K7XB 1ZLXA 3OZTA 4O4LF 5E95A 3H19A 1QANA 1X7XB 4WLFA 4F4JA 1A9QA 5EHZA 1YQTA 2WHQA 4JX8A 2O9JA 3SSOA 1FX0A 1PT7A 1VE6A 2BFBA 4LDNA 2C59A 1YB7A 1PL0A 3KSZO 3A6KA 2Z3VA 1T8WA 4JBNA 3FW1A 4EYGA 1VHJA 2X6RA 2Q1TA 4NX2A 4XIGS 3TXXA 1MAVA 5K01A 1US8A 2HMSA 2CJFA 2GO7A 2C9MA 4FEAA 4TLEA 2BDUA 2P9TA 1E63A 3G02A 3FZNA 3JAKB 5D1HA 4KQKA 1TUGA 1ORVA 1BXGA 3OZWA 2SNIE 4JGBA 4Q9IA 3R3HA 4KI7A 4OD0A 4TN1A 4QC2A 5JZSA 3AF2A 3DEFA 3OKPA 1ADGA 4WLEA 4PCVA 3THRA 2FPIA 2YWGA 4G81A 2AOXA 1CYDA 2VDPB 2RH8A 2Y68A 3L7YA 3QA9A 1YD7A 4JL8A 3ROFA 5TIIA 4XR4A 5C8YA 2GEFA 1CDZA 4M37A 5AVZA 1KA9H 3ZVMA 1J39A 5BW4A 1OBFO 4HX5A 3WRXA 4BFLA 3O4HA 4K9MA 3DAPA 3ZE0B 5B2ZA 4ZCQA 1LK0A 1ZD8A 4F96A 3NUQA 1KOGA 5AW3A 1CR4A 3L04A 2GN4A 3ONDA 5AI4A 1ABEA 1WUTA 4NL4H 3TLMA 4BQRA 5CH5A 4LPKA 4YMHA 1AF4A 1CY6A 3Q9UA 4QUEA 3W2EA 1ZY2A 5BQOA 4KRXA 3M6LA 5C7LO 2EZUA 3AOEA 1GAXA 5DHRA 1YNSA 4CKBA 2P1ZA 3FB1A 2WM8A 2AF4C 1RQGA 3H86A 5F76A 2Y1KA 1GLGA 2XEXA 4LYDA 3N2KA 1RYFA 1TEXA 3D2AA 4UBJA 2FHSA 1J99A 3G9UA 3HM2A 4QKQA 1QFYA 5CXUA 4IOKA 3BREA 2CY0A 2IPXA 4JT4A 2VS1A 3GLFE 1PE0A 3OETA 5ADHA 2H5EA 3FHOA 4DR3B 1MW9X 2QI9C 3QXGA 3S2IA 2B82A 1NT4A 4EY3A 2XCSB 1E3WA 1U8FO 2IZOA 1KVQA 3A28A 2FV8A 5FA5A 4DARA 4BY9E 5K4HA 2JGRA 1PZHA 4L9RA 3RVDA 3C74A 4LOHA 1NBOA 1JTVA 1DG9A 1FEZA 3DPSA 3EDMA 4WERA 4NAUA 3BX1A 3ZY4A 2CFRA 3KKKA 3AKDA 3AESB 3HR8A 3OCYA 4FILA 1QIFA 5JZOA 4B6PA 2OHGA 2EOAA 1TYAE 4CJXA 3GL9A 1DIBA 3MJTA 3EUWA 2VNHA 2CL0X 3OFNA 3QFRA 4UUMA 2N75A 1UJMA 2PX0A 1ZI6A 5CMLA 3ZKWB 2Q2QA 2QTMA 3IMCA 1ZK2A 2X86A 1H4SA 3P5BA 2R1VB 1UBOS 4DJFC 4BNDA 1GSIA 1Y8AA 4ENTA 3B82A 2DTXA 3PPXA 3MWDB 4EYQA 1JEAA 1WD7A 2XEDA 1PR1A 3HXLA 3GJRA 4GQBA 1QFJA 4J0CA 4EB0A 2W42A 3HY4A 4CM6A 1WVGA 4WWHA 3K9NA 1TVMA 5SYMA 2I7VA 5KNDH 1D0IA 3RUAA 4Y6OA 2ZUWA 1EK1A 5JWRA 4B48A 3IURA 4NU5A 4ETMA 1TYCA 1KP2A 2QWXA 1TLFA 2EP8A 3EVDA 3RF6A 2IK8A 1D4AA 1OAAA 1T3GA 3KXKA 2R7KA 2FXVA 4JU8A 1T3ZA 1SY7A 5KDDA 4XAQA 2YX1A 3GFPA 3QY9A 1JJVA 5PGMA 4DIBA 1CD5A 1T9BA 5HDQA 1Z4IA 5TPWB 4EPWA 5B1YA 5BWBA 1E6CA 4K86A 5BSMA 4JR1A 5KOIA 2QGFA 1WPRA 2I3BA 4MWDA 1N7HA 1FZTA 3NTLA 4CETA 2OY0A 3BHNA 4CKCA 2NVOA 3NVDA 3QBEA 1N2ZA 1ZBQA 3LX5A 3O8DA 3VTFA 5HWSA 5GV7A 4LJAA 1EZ4A 1VGQA 2VJPA 4OMCA 2JS7A 4F12A 5CA0A 1Q84A 3OEED 1ZG3A 4PX9A 2WJZB 4JXKA 4BECA 1M34E 4BGDA 3FPKA 4MRMA 4BE9A 1LX6A 3JSXA 1OD6A 4KYIB 4LE0A 1DQSA 2A1UB 5LA6B 2RB4A 3AWDA 5CCDA 5FI0B 3WV4A 4DIEA 3U4CA 4Z7JA 3UJ6A 5AUNB 1GFZA 3DVLA 3GZ4A 3IQWA 3TIVA 1Y8ZA 4EDFA 1IBCA 1PR3A 3KOYA 2PWPA 4OXXA 4V0QA 2H5JA 1CZOA 1CWUA 2A9QA 2HPVA 3C3AA 2H2HA 3ETGA 3ILYA 4LF5B 1KI1A 2HLDD 3Q3EA 4LRWA 1QG4A 4ZAXA 4HADA 4R1SA 5AJXA 4X92A 1LRKA 5JWHA 3SIWA 3G2JA 4TQ9A 1TJ4A 1HFKA 3DOEA 2YV1A 2QS9A 1QH9A 2MYPA 4C0XA 2X0KA 4LYAA 1H0SA 3AI2A 3E6AA 5HKOA 5LZ7A 3SSNA 2GT1A 4O0MA 4E2FA 3RAGA 2ZZMA 4NJMB 4C0AC 1SN7A 1I10A 4KPUB 2ZJZA 3QXCA 3T8YA 4EZIA 4R7GA 3QELA 1RACA 2G04A 2R3SA 2REXB 5KI6A 4KQCA 2E4YA 3W2HA 1ADYA 1PI3A 1X7ZA 2KWIA 3BXPA 1RAIA 3HPRA 4Y2RA 4DYVA 1ZH0A 2P6RA 1M73E 1M6EX 2FR8A 3DT6A 5TRTA 1ZNZA 1TZCA 3LKDA 4OFWA 3WWPA 2VHTA 2FP4B 3QE0A 4GZ3A 4M0DA 5KYWB 1JEDA 1OTHA 2ZRLA 3HU5A 2J07A 3QPCA 4IDHA 4UCQA 4U6SA 3UAOA 1ZRHA 3SHQA 2QX8A 1JHVA 4PAGA 3M82A 1KE1A 3UATA 1GT91 3E22B 3HJAA 3CH4B 4KWTA 3U7QA 3KB6A 3K6KA 3O21A 2V3CC 3BTUA 4KAJA 4G0UA 2O2YA 1JIUA 1IG0A 3LE8A 4HC4A 4FMDB 3CEPB 5C7YA 3OPYA 1D8TA 1WWKA 4R8RA 3WOVA 4PAOA 3M5DA 2OK8A 4MRRA 2NUAB 4KX5A 2VTEA 2WJ3A 4JC5A 1WVMA 1Y7LA 2XWSA 4XWGA 5H8WA 4HAUA 5JO0A 4Q3BA 2ODEA 4HDRA 2GEUA 2YVLA 3TNJA 4GX1A 5DISB 5J9FA 4HV4A 4YCSA 3VR2A 4CGYA 1EVEA 2A0WA 4HB4A 1Z0IA 4XM1A 3IR7A 1XCGB 3KT8A 3I62A 5CVTA 3GEDA 3LCJA 1KR5A 1NOJA 3ZGNA 5SYNA 3WTCA 1L5FA 2BKUA 4J91A 3QVGA 4HEHA 5KJEA 4NG4A 4ENRA 5LUAA 1UKAA 3DL4A 2Y8EA 4UW9A 5AJVB 1SCNE 1W85B 2YJ4A 5ALFA 1AU9A 2H2AA 3GEGA 3SE0A 4A26A 3SIPA 4QGBA 1SG9A 3T06B 1QOQB 1SQ5A 1ZCAA 3CWZA 3JQ8A 3NIFB 4CMCA 3Q6MA 1PS8A 4GGPA 4D81A 4Q3NA 3DAYA 4R40A 5EPUA 2JATA 5IUJC 3PJRA 3UK7A 1SPXA 2CMDA 2QD3A 5FL3A 1FX1A 3UJBA 4D82A 3DCIA 1M8JA 1LRJA 3FCEA 4ZXPA 2EHJA 3UGJA 3HSSA 3AUUA 4HDCA 1N8SA 4MWZA 1A9PA 3BD7A 3DW3X 4JLAA 4EQZA 3T7TA 2NYAA 4WESA 3EGDA 5DNAA 1GL3A 4EWLA 3H3JA 1E1LA 3O75A 5E0OA 1M54A 2KYRA 4PANA 1A8UA 5LDGA 5HUHA 1I8TA 1YR9A 4UOZA 2ZETA 2XODA 3K9LA 1U94A 2PGDA 4DTIA 1QCDA 5CNKA 1CEYA 2Q5IA 3O4VA 4JSYA 3OX2A 2PGOA 4DR2B 2F3SA 2V6IA 2D5CA 5FWDA 4BTLA 3JRXA 3VISA 4J7AA 2YFKA 2ZRJA 3DLTA 1L9XA 1QHGA 3M3PA 4GU5A 3MAGA 4RNDB 5D3KA 3WGLA 3EIQA 3E58A 2Q2NA 3CG4A 3DDZX 2B7LA 3HGQA 3UMVA 3JARA 4D97A 1AZWA 5E2IA 2WWVD 4GP9A 3WKAA 5JSYA 1P8AA 2NUBA 1QIMA 2J09A 4B47A 1GQRA 2IGBA 4PC6A 5IF9A 1GL7A 3SPXA 2GAJA 4BFSA 5FPTA 3SIXA 1U0RA 2VUTA 4BVGA 1UWKA 2O7VA 5L3QB 1V95A 3WK5A 5EZYA 5IFLA 1TJ5A 4FWTA 3T1YB 5JCOC 1IUOA 4JHLA 3N59A 3THYB 4DMGA 4JBIA 1KOJA 4Q6WA 3D1JA 3I04M 4LCBA 4IVPA 4HNVA 1KYZA 3I0ZA 4C43A 1EUCB 3HZRA 3ZD8A 4NAHA 1JQBA 2ODQA 1GKIA 3H6HA 5KJ1A 2DOKA 2J9ZB 2P41A 4Q9JA 4QHSA 4MUNA 4RD2A 3UHJA 1KJ9A 3NT4A 2B1JA 3NBQA 2JAOA 4WFIA 3UWSA 5KQMA 5L4SA 4KQ2A 1HFWA 4DC0A 1VMIA 1E3LA 4UDYX 1KMQA 2PRJA 3FPGA 4D0SA 1AXEA 1X86B 2WHEA 3AFMA 3EXIB 2XTNA 2PKQP 4ZOCA 3P9CA 2CBZA 5C8ZA 3OHMA 1ZR2A 5TEWA 3PJEA 4NBWA 2W6JA 1DX9A 4AY2A 2WD7A 4MVJI 2I62A 3K0HA 2R87A 2VUUA 1Z38A 2MWMA 5KU1A 2BELA 3H83A 4RF5A 1YOVA 1E7MA 1VCMA 4QATA 3NS7A 2UUCB 1E64A 3S99A 4JQYA 4ERNA 121PA 4HRVA 3RUHA 4YP6A 2C2GA 3O4FA 1YT5A 1XE3A 1F1BA 3HKCA 4QDJA 3QTLA 4BNFA 4EATA 3A70A 1W48A 2R4UA 2VF4X 3WNBA 3NKVA 4G09A 4P7KA 2ZR7A 1P1JA 3NEYA 2Z2ZA 4KTTE 4W1SA 1E9EA 1UPBA 2HYIC 2YYAA 2YXDA 4K2AA 1GTMA 5JXGA 2QTTA 2RCNA 2W90A 3UA3A 4OLHA 1FNMA 1LK5A 4GBMA 2IYTA 3D02A 1LGYA 1W47A 1C3JA 1YZ3A 2GPTA 1SBIA 1DT3A 3VH4A 1DDIA 1SKUA 1U1DA 4MPRA 4KMRA 3SBEA 1U28C 4RUKA 1JAIA 3RFFA 3SR3A 3PC3A 4J16A 3V1NA 3WK9A 1JEYB 2Q0QA 1KFCB 2VAPA 3OPQA 3I8XA 5EMJA 5IYZF 3O0TA 1FVFA 4TM8A 1MFPA 3A6PC 4XSVA 2B4QA 2WJ6A 1L5QA 3JQ7B 1X9GA 2EWMA 2BHNA 2VJQA 1RPAA 2Q6IA 4LJ6A 1RAAA 3JQAA 4G1CA 4D1YA 4B3BA 5C37A 5A3RA 2XCIA 4RTLA 3TR0A 5JNRA 2WHRA 3TJZA 2C5FA 5ESXA 5HIJA 4R0MA 4DLKA 2WD8A 2G76A 5GV8A 3IKTA 5HF9A 4QFDA 4BP1A 5JYBA 2VDNB 4GKAA 3C24A 1N5LA 3N5CA 2QL7A 2RAPA 1H2WA 4MMXB 4RHTA 3UK0A 2VP0A 1T5LA 1PJRA 2FPRA 2NO9A 1WV0A 1SCBA 3EVEA 3K0AA 2FW0A 3K1AA 4GWGA 5HQJA 4BIIA 5FOXA 1H0KA 5K4GA 2C94A 2IEZA 1VRVA 2PX2A 4G25A 4RGVA 5L45A 1V6CA 4X65B 4NFSA 5EIOA 4HBGA 4RV5A 4GOND 5TMDA 1U65A 5J1SB 2J5RA 2AZ4A 2YY5A 3L07A 4H7JA 2R6R1 1O58A 3Q3CA 4DCCA 4HXGA 3M0EA 4P4LA 2GNAA 1KBZA 1R88A 1WXFA 4JODA 3V9PA 1WXWA 4PAQA 4LC1A 4MS4B 1YS2X 5FPYA 2GILA 2ODNA 4RTPA 3MTJA 3RYIA 3EMBA 1WUIS 2R5NA 2ZVDA 4MVJP 2BHLA 2QSZA 1XRPA 5BWLA 4B84A 4B3SB 1OYWA 3OEHD 4AD8A 4P4GA 3ZYCA 1X0XA 2DR0A 4JYAB 1OGIA 1E2HA 3P2JA 4JENA 5C18A 3K53A 4AUEA 1V8PA 2X7XA 3DWGA 3U31A 2P5TB 3K9WA 1NBHA 4HYTA 4CKWA 3EPKA 1F8XA 2GN9A 4MKRA 3MWYW 4D3FA 4UUNA 3RT1A 3H6KA 1EINA 1RZ3A 4N82A 3LS2A 1K8RA 2BW0A 3QKSB 1G5RA 4I9FA 1KSHA 2Z57A 4DQKA 1LPMA 3G2PA 2RGBA 2N3ZA 2WF8A 3TLJA 2G3YA 1RHKA 2RGNC 3TLAA 8LDHA 2HU7A 5BUCA 3RS9A 4DLAA 4F3KA 2VATA 1VECA 1KMIY 3MHPA 2ON6A 5JAOA 4F5EA 2ZJFA 3O1HB 1U63A 3TIGA 5M7EA 1EWKA 2FOXA 3RYHA 1SQSA 1PFQA 4YPFA 4Q7EA 4JQSA 4DLLA 3C4JA 3I12A 5KYYB 2QU7A 1C1DB 2Q5FA 4MZDA 1JBEA 3WKBA 1BSVA 4XCVA 3M1YA 3W7BA 2XUFA 5KYUA 1Z29A 3MWEA 4QYXA 4IS3A 3E5RA 1LPBB 2IEIA 3U4DA 1JJIA 4PHFA 1BGXT 5AO9A 1O5IA 2HUNA 8AT1A 1QGUA 1RDFA 4W9RA 4ZT7A 5KYVA 1SQ6A 4E94A 1RWKA 1KZ7B 4F06A 3IHWA 1T4CB 2FPKA 4MCAA 1X8LA 3RNLA 2XMSA 2GAIA 4NBNA 4YFYA 2TS1A 4RA9B 1T5OA 2C31A 5BSEA 2XUGA 3M33A 4GMHA 4Z51A 4ZQBA 1Y3IA 3AP1A 1QHNA 1SC4A 4AIIA 3LG2A 5CX1B 3TJMA 3GFVA 4GMGA 4DY4A 1N7IA 5E7IA 2UXDB 1HSOA 3DNFA 1ISGA 1PU2A 4CLHA 4JXXA 5DYTA 5JECA 1C7EA 5BV0A 2O05A 1E1CB 3NVAA 3FGPA 3LC2O 2ZJ7A 1LSOA 1RKQA 2FKAA 3MS4A 3H87A 3V4ZA 3JASB 1P31A 4OIMA 2P78A 4PGGA 5KC8A 3GLSA 4CI9A 2ZBRA 2DR2A 4FT4A 2W2KB 3O38A 2DGDA 3W5BA 3K9GA 3E05A 2XVXA 3A11A 5DX1A 1PR5A 2OSVA 4S12A 3GNTA 4P2GA 2QQFA 4ZJPA 1XELA 2ZDHA 1QK4A 2PMDA 3MWKA 1JSLA 3O8OA 4GI5A 1XBTA 4U5XA 3V4PB 3DG9A 1JBQA 1SD2A 1L8XA 3F6PA 5IZCA 2OLEA 2CXOA 2WFLB 3B8HA 3SQLA 3SYRA 4DNOA 2BMFA 4TYMA 5FA6A 2HQRA 4YK7A 2ZIVB 4ABTA 1SKQA 5LR6A 4MWTA 4D92A 1FSFA 5BYAA 1N1DA 4Q7JB 3WLIA 1MVOA 3HCEA 4KFTA 1KEWA 4CLXA 1MJ5A 5PNTA 5DNVA 2LPMA 2HJRA 3UAZA 1W75A 2QJRA 1JP7A 2QMEA 3WGKA 2VFAA 1N75A 2FMUA 2WYUA 5ALXA 3URKA 5MHTA 1FJHA 4EP1A 2CV1A 1CF4A 4YQZA 5DT9A 3G23A 5EEHA 1MUUA 3SXJA 5HS6A 3TFWA 5CBKA 2CB0A 3DTNA 2PNJA 1DBSA 1J9GA 2Z9DA 1VE9A 1ZMTA 1JU9A 3Q8XB 5CG1A 3A6ZA 3S7TA 4DIFA 4U1RA 4WOJA 2VHWA 4PAMA 2WYIA 3EF1A 6PFKA 1RLUA 1NBEA 5C80A 5CHYA 4C7KA 1E2KA 5DHSA 4EUEA 1WTAA 5CH8A 1Q12A 3DHNA 1Z7EA 2GVDC 2FN7A 1K8YB 2GM5A 2JIQA 1RD4A 1V16A 2ZDQA 3KPYA 3USES 4EHBA 4F9EA 5BNZA 5EJ7A 1IEXA 1Q6ZA 1UXHA 4TMKA 3VX3A 2GXQA 4JKIA 5K3SA 4YACA 3KUDA 3DLBA 2BHSA 4P3KA 4CF5A 1BMQA 1YACA 4FR0A 5BMVF 1XCBA 4DHEA 2F62A 3LUAA 4PR3A 4JU9A 1GG5A 5T6MA 3R76A 5JAMA 1UEJA 4LE1A 3Q88A 3BFXA 2WWFA 3F3SA 3FF4A 1XROA 4X0EA 4AAYA 5BOSB 2FMTA 3VBEA 4KE9A 3TR6A 3IPCA 5KOYA 1JTEA 4BO6A 3HVUA 5I7HA 4ID3A 1U7ZA 3ITDA 3I2YX 2QX9A 4B4KA 1NQ5A 1PVDA 4FS3A 4HPJB 4YCAA 3G0OA 1O95A 2PX6A 4LQDA 3WFIA 5I8WA 1K2VN 4OJKA 4B83A 4R0NA 5AM4A 4ALJA 5C3UA 2JFPA 1WO8A 5IW8A 4K0RA 4YAUA 2HHJA 2J0UA 2X5OA 2LBPA 3W8EA 1DXYA 2B8WA 4GPZA 5JHHB 3OIFA 1AHPA 3T99A 4LJYA 3HDVA 1Y9EA 2IYYA 1UZNA 3U3MA 4KGVA 2WU4A 3ZWKA 3ETLA 3U60B 3THWA 1BRTA 2GTIA 3I37X 3SHVA 1LBEA 4XQGA 3STHA 4GYWA 4DPMA 2R65A 2XTAA 5KC9A 2XLBA 5B64A 3WG9A 1Z34A 1IDN1 1M2EA 1YF3A 2WSBA 3B78A 3LW7A 3PDWA 1GOTA 4QULA 2K7ZA 2RHMA 1ORRA 1XD2B 3LUJA 4QEDA 3T9AA 3GB9A 1HDCA 2IKSA 3T5CA 4AMBA 4GX0A 1U81A 2EFGA 5B7QA 1NOKA 1KH3A 2Z56A 1L4EA 2HT6A 2VAWA 1MABA 5EWMA 1MD9A 3VJLA 5GGXA 2SHKA 2C29D 2Q5OA 3DXYA 3G1UA 3I2KA 4LNUA 3QQPA 4EUKA 4Q4DA 3CRMA 3VDNB 3O83A 1E6WA 2VCYA 3TAHA 2YASA 4MVJM 3FVQA 4X84A 3R3UA 2IEGA 1UAAA 1G8PA 1IFXA 1K5DA 2NT3A 4MX8A 4R8LA 3WHKA 1HTBA 1FDSA 2BTQA 5BQ5A 3EXG2 1PJCA 5AR1A 3I53A 3IEKA 3N8GA 1AGRA 1VIAA 2VSYA 1S6YA 3IR5A 2ZB2A 3LBNA 4ZYTA 2G4CA 2ZSBA 3UYKA 3H11A 3OOEA 1ZOLA 3F8SA 3V7UA 2GUGA 5JYCA 3UQYS 4FS8A 2FEOA 3PXEA 1Q11A 4JBWA 3FBGA 1FNSA 4HWSA 1L4KA 3FHCB 3HDQA 3OT1A 3OOJA 4J75A 5C7OO 2I91A 4UHKA 2PS0A 4X54A 1M8PA 2GWRA 1MEOA 1RWMA 2QTBA 5CFQA 4Z4IA 2IW3A 3J81k 1SH7A 3EEFA 4ZVLA 1UPTA 3A37A 1GG8A 2A92A 1XKTA 2OMEA 3A04A 3AEZA 3NPMA 3OJEA 4B6OA 1R6BX 3BULA 1NW8A 4JLBA 1L2TA 3PUXA 1U7HA 1BGVA 3I32A 2BMEA 4P83A 4ZQIA 3TAUA 3GN1A 5FTWA 3SEQA 3WGIA 2FPPB 2WJPA 4G0MA 1QBKC 1Q7TA 2ILVA 4AO6A 3IKJA 1U3VA 2GJ8A 4KE7A 4Z7OB 2IWHA 4YRRA 3SICE 3UJCA 1JPVA 2QN7A 1KFJB 4YP0A 5CBPB 5AW7A 1Y63A 3DWFA 4QT4A 1KY5A 4I55A 1PUIA 2C96A 4LKRA 4OYRA 5K0JA 2ZRFA 1M6YA 3ORHA 3NALA 3DLPX 3A10A 3MMSA 1Q1AA 1N2SA 3HU1A 1UAYA 1OXXK 3O3MB 2DQ4A 3S5UA 4C6TB 1N0IA 3QPVA 4WKGA 1T5DX 1Y6RA 2EF1A 2YZMA 2D62A 3K5PA 4LRYA 3WK8A 4A5SA 1HO3A 1NF9A 2VJOA 3OWOA 2BZ1A 3ZV3A 5KWIA 4GUAA 5ICCA 2QZPA 1BH2A 1RYBA 1N6LA 2PU5A 1ZUIA 4RAOA 4GRDA 5CIYA 1TYBE 2C07A 3ITEA 4RXMA 4BV9A 1PR6A 5DYYA 3ROPA 3ZWXA