2B82A

Crystal structure of apha class b acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate bound to the catalytic metal at 1.2 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
SPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords class B acid phosphatase
publication title A structure-based proposal for the catalytic mechanism of the bacterial acid phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 73
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b82A00
2GHQA 3EF0A 3OCYA 4KNWA 3AR2A 4CNQA 1SU4A 1AQ6A 1WR8A 1S8OA 5AVYA 2AMYA 2FDRA 3QGMA 4Y2TA 1VFPA 2PKEA 2FPWA 1U7OA 3NRJA 3ZWKA 2R8YA 3UM9A 3AR3A 3AR9A 3B9RA 5ALWA 2HSZA 1RKVA 4XPZA 2FPRA 1RLOA 1TE2A 2G1AA 2PQ0A 2YY6A 3QUBA 2P11A 3NANA 5ALHA 3OCXA 5IT4A 4UMDA 4YCNA 2Q4TA 3QXGA 1T5SA 2HF2A 2W11A 3E8MA 3N28A 4Y2YA 4QJBA 3SKYA 1Z5UA 3BWVA 1Z4MA 4HGOA 1TJ3A 3U7GA 2HEGA 2QLTA 4L6AA 4IFTA 1RPZA 4Y2JA 3WKAA 2ZBGA 3L0CA 5AKIA 3PGLA 2GMWA 1IWOA 3IB6A 5AKYA 4CF5A 3W5DA 3TLMA 2W43A 2JARA 2Q4RA 2EAUA 4J03A 5AW5A 1VJ5A 5AVXA 3KDPA 2WHEA 1NRWA 3ZUPA 2X4DA 1YNSA 3W5AA 2IOFK 4NABA 2YN4A 3QYPA 3U7FB 3L8EA 5AM1A 5AI8A 2BDUA 4Y2SA 4UU1A 3IJ5A 3E84A 1X42A 4UMEA 5ALOA 4BEVA 1ZD4A 2C8KA 4UASA 2FUEA 2G09A 2YMQA 5AI6A 2RBKA 1N8NA 2MU1A 4ZEVA 1Z4OA 5AW3A 1L7OA 2O9JA 3QUQA 4Y2UA 1ZS9A 5AVQA 3AR8A 3FGOA 4CF3A 2G80A 1U2TA 1Z4PX 1YDFA 2AGVA 3EWIA 3L1UA 2FPXA 3QU4A 3QU5A 4YGYA 2ZOSA 1U7PA 3ONNA 4KN8A 5ALUA 2YMPA 2Q5EA 5ALRA 2CFRA 5ALKA 4HGNA 1QQ6A 4BEWA 5AM5A 4UM7A 5ALVA 2FUCA 5ALFA 3UMCA 1ZD2P 1L6RA 1XPJA 4JB3A 4F72A 5AKXA 4L6CA 5ALMA 4NWIA 2RB5A 1RMTA 3QX7A 5AW4A 5AI4A 3D6JA 4C4SA 3QLEA 4XQ0A 3SF0A 3FVVA 3ZVLA 1YMQA 1RC8A 2NO4A 3DDHA 1XP5A 3N5KA 4HGPA 4PNHA 5AVZA 3F9RA 4Y2XA 4EZEA 3NIWA 1L8LA 5AM0A 4KNVA 1RRCA 3ZI4A 2D2VA 4NAVA 3OCZA 4Y2VA 4KX3A 4BKMA 4YIHA 3MC1A 2B8EA 4F71A 5AI5A 2FPSA 2WM8A 2ZG6A 2JAWA 5AW7A 5ALDA 1Z4IA 2G06A 4NV0A 3ZTWA 4B6JA 4G9BA 3HLTA 1QYIA 2G0AA 4Y3UA 3ET5A 1RLMA 5ALYA 4EX6A 1RKQA 4MWOA 3SMVA 3B8EA 1RMQA 2AH5A 4Y2QA 3U26A 5ALEA 5AVTA 2HHLA 1RKUA 2CFTA 1U2SA 5T41A 4J2TA 3U7EB 5AVRA 1L7MA 3AR5A 1T9ZA 3U19A 3N8GA 3E81A 4UW9A 3FPSA 2ZBDA 1S2OA 2B8JA 2C88A 1LVHA 4ZEWA 1NF2A 1ZRNA 2PR7A 3ESQA 1WZCA 4H1WA 2GO7A 3WK9A 1YJ5A 3UMGA 5AIAA 2P27A 4HGQA 3L0BA 5AM4A 3L5KA 4HGRA 2RAVA 2RARA 3EF1A 5IS2A 3M9LA 1ZRMA 5AM2A 1PW5A 5ALQA 3ZX4A 3WKBA 2ZXEA 3I6BA 2HO4A 3L8FA 4BNDB 4C4RA 3NAMA 2EARA 1ZOLA 3WK6A 5AKJA 3DAOA 1ZJJA 3BA6A 2HF7A 3M1YA 4BBJA 2I55A 4OD0A 3MN1A 2P9JA 2WF5A 3CNHA 2I54A 3WK4A 3OCUA 2O2XA 1EK1A 5AM3A 3RFUA 1YS9A 3ZVNA 3WGUA 4UAVA 1CR6A 2R8EA 4DWOA 5AW6A 3N1UA 2OBBA 4Y2PA 1F5SA 2FPUA 3WKEA 1O08A 4AS3A 4GIBA 3L8GA 4I9FA 3QU2A 2W4MA 1ZD5A 2I7DA 3FM9A 2CN1A 1Q92A 2JAOA 3PGVA 3ZW7A 2YJ6A 2BDEA 4C4TA 2EATA 2JAUA 4EEKA 3CZ4A 3J7TA 2FEAA 3QNMA 1L7NA 2QYHA 5AKEA 5IT0A 3ZVMA 3FPBA 2HOQA 2C9MA 2CFSA 2IOHA 3L0YA 2FI1A 3QU9A 4CF4A 4Y2RA 2HX1A 3B9BA 4OFZA 3S6JA 1RQNA 3R09A 5A3RA 2NYVA 2WF9A 5AICA 4UATA 2B82A 4MUMA 3U13A 1SWVA 4G63A 4UMVA 2B0CA 2ZBFA 2I6XA 5ALXA 1RMYA 2B30A 2VKQA 2IOFA 4I9GA 5ALJA 3OTQA 3QU7A 3DNPA 3ZWDA 5ALTA 1U02A 3UMBA 3WKDA 3PCTA 4AS2A 5AVSA 2YBDA 2B1RA 1QH9A 4EENA 1CQZA 1QQ7A 4CE6A 1Z88A 1NNLA 3GYGA 1QQ5A 3WKCA 2OA0A 1VJRA 1Z4KA 5JJBA 2YJ3A 5AI0A 3AR6A 1Z4JA 4UM5A 3E58A 4UU0A 3SHQA 5ALNA 2R8ZA 3P96A 4BYGA 3VAYA 5ALIA 4EELA 3WK8A 3ET4A 5AKLA 1YV9A 4OHFA 3OPXA 5E0OA 2YJ4A 3A1CA 4DFDA 4HAIA 4RESA 2DQSA 3W5CA 3I76A 4BX0A 3ED5A 3A3YA 2HDOA 3MMZA 1RLTA 5AW2A 2IA5A 5AW0A 3I28A 2G08A 3EPRA 4IG4A 2ODAA 2IYEA 1TJ4A 2YFYA 2G07A 2WFAA 4L57A 3K1ZA 4YCLA 4FYPA 1Z5GA 4BNDA 1TJ5A 5AW8A 5ALPA 3NALA 2YJ5A 1Z4NA 5AKZA 2OYCA 4EX7A 4KX5A 3WGVA 4XE5A 2C4NA 4KYTA 3SD7A 5ALLA 5FP0A 4FE3A 4O8CA 2MSNA 1L8OA 2R8XA 4RETA 4UMFA 4DW8A 1T5TA 3HYCA 3W5BA 2WF7A 5AKGA 1KYTA 3OCVA 1SWWA 2AUTA 5AVUA 3KC2A 3A1EA 2I33A 1LTQA 3L8HA 1XVIA 5AKHA 2WF8A 4OCZA 1FEZA 3NUQA 2NO5A 1RDFA 3A1DA 4E88A 3N07A 4FFDA 1J8DA 3QUTA 3KOOA 4XOUA 1Q91A 5ALSA 4YCMA 4UARA 2BY4A 4HYTA 2OM6A 1MH9A 3NASA 5AK6A 3ESRA 2GFHA 3SKXA 3FZQA 4ZEXA 2GHTA 3L7YA 4GXTA 1O03A 3DV9A 5AHXA 3KD3A 4UAUA 1JUDA 1L7PA 2JGAA 3KZXA 3I1YA 2WF6A 3OCWA 2I34A 2HI0A 4QQFA 5AIBA 5AW9A 1J97A 5AK3A 5ALGA 2HCFA 3RF6A 3R9KA 3R4CA 1Z4QA 4NFLA 4BX2A 3WK5A 5ALZA 1WVIA 5AI9A 2YMMA 3IRUA 5A3SA 4JDPA 5AK5A 1EK2A 5AK4A 3KBBA 4DCCA 2YMLA 3MPOA 1ZD3A 4YH1A 3SLRA 3L1VA 2C8LA 5AKKA 1RQLA 3ZU6A 3U7HB 3QUCA 4AP9A 3AR7A 1Z4LA 5AW1A 2ZBEA 1N9KA 3ZX5A 2P69A 1TA0A 5A3QA 4YIKA 5AVVA 1Y8AA 3ZTYA 4BX3A 5AESA 2B1QA 1WPGA 5AVWA 3WK7A 3AR4A 1K1EA 3PDWA
chains in the Genus database with same CATH superfamily
3DB2A 5TPZA 3EF0A 1S0UA 1IJFA 1V45E 2UAGA 1DRJA 1V9LA 3DM9B 3DQPA 2G17A 4A82A 1JPJA 4PAGA 3WAGA 4BFSA 1M83A 1AQ6A 4M53A 4F4IA 2GGSA 2MYUA 3W2GA 1OE0A 2W2MA 3OQVA 2UUBB 3VR5A 3MAGA 4BQQA 1E0AA 1IE3A 1KFBB 2PKEA 3BD7A 3WWPA 2OCGA 4KLRA 1EGQA 2FPIA 1JJIA 3B3GA 3Q1KA 1XHLA 3RUAA 1Q57A 1JB9A 1QX4A 4OQMA 1OT3A 4OL0A 1E96A 4NBTA 2NUTA 1HORA 5INTA 4BIMA 5L3QB 4F96A 2G36A 4W6ZA 3DLTA 4QDKA 1E3TA 1RLOA 6Q21A 4QXPA 3VZQA 3IBFA 4BP1A 1SVUA 3KXDA 1ZICA 3I4CA 4C14A 4S1PA 4TV9A 4B6RA 1LRKA 1YSCA 3UQYS 3TAUA 2XEXA 4R83A 5DASA 2ZIXB 1JBEA 3I4FA 1Z56C 2X15A 1GAQA 4R8RA 4MWCA 4BLUA 4MA0A 1T15A 2QTVB 1U2GA 3CNLA 3RVLA 3ZTTA 3IHWA 1E2HA 1QHNA 2BE7A 5AHKA 1JQ5A 1CRQA 3GEBA 5BSGA 4IFTA 1N36B 4DDTA 4Y2JA 2ZBGA 3OF3A 2QI9F 3CNOA 2ZZMA 4PQRA 1VA5A 3PVSA 1YVEI 4JIMA 2V7BA 2REOA 3D5EA 4MYRA 4X20B 2GH1A 3O8QB 5D3QA 1RHJA 3ZBQA 5G41A 2PZAA 1VCOA 2OZLB 4B81A 1ZAKA 5AW5A 2P3SA 1HRKA 2QRKA 4LQDA 5FHRA 4JC0A 5T4EA 3KLBA 1SUDA 2BZGA 4A2PA 3NPAA 1JZSA 3OT1A 3TK1A 4CQMD 1TQ4A 2I3AA 4GWGA 3W5AA 1WQ3A 1KQ3A 3K1TA 3INTA 4MHOA 5JAPA 1JHRA 2BHNA 2ZJ7A 3PDHA 4PX2A 1ATZA 5AI8A 1O1YA 2WM3A 2CKMA 4ARCA 2NPIA 3G89A 4UASA 1KEEB 1V5IA 3NBUA 1VIYA 2HDNB 3PPVA 4JFRA 5COAA 3EISA 2H2AA 2RBKA 1EGHA 1OX6A 1V47A 1YR9A 2I65A 1S2GA 3KPJA 3F5QA 3N8KA 1KEZA 4MR7B 4UAJA 4Y7DA 4RDXA 3UJHA 3TBHA 1TOAA 3K31A 3NHBA 1HG1A 4FMPA 3NH9A 5JPIA 1SKQA 1RTKA 2B2NA 4TUYF 2M2IA 4XLLA 2RGDA 2Y1XA 1IM2A 2YVQA 5DH9A 4X91A 2ZYIA 4ZZ2A 1RQXA 2ZJ5A 3RC9A 3EDYA 1TTQB 3WHKA 1QGDA 5FI0B 5CCEA 4QJ3A 4KQ1A 5BN4B 1KKLA 1RZ3A 1D1QA 3DWIA 4HMPA 4RKQA 4F8YA 3WJ7A 2JANA 4F06A 1RXSA 4OXYA 5KMGB 2GUGA 5J4YA 1JQKA 4IOKA 1OLSB 1TUGA 1OHHD 1MG0A 2GYWA 1Q3HA 5FQNA 4BMSA 4TMTA 1AMOA 1RM4A 2HJSA 3EPKA 1NP7A 2J4FA 1KYIA 1JSZA 1ZD2P 5I7VA 1L6RA 4E4YA 4L8GA 4ZVLA 1N7GA 5JCZA 2UUCB 2OHJA 4G9EA 5DMXA 4F11A 1V35A 3Q3EA 1DARA 2JK1A 4BE9A 1MXFA 5LP6B 1QH1A 1O95A 1UZMA 3D3QA 4GD3Q 3FVQA 3WXBA 4XWTA 1PUJA 3GT4A 1ZU5A 2P6RA 3OQIB 3RSQA 1WV0A 2QKYA 4PFQA 1HZJA 4FP9A 3ZV3A 4C03A 1LF0A 4DLPA 3AVPA 4OXIA 4UFOA 4F2PA 3O2QB 3E9YA 5E95A 2K2WA 3FGNA 4PNHA 4EB6B 2ZJ8A 1FLDA 1A1VA 3O1JC 2PJRA 2OV4A 4IO0A 2QY9A 4KNVA 3TIFA 4YPOA 2JLAA 3LP6A 1Y89A 3KDAA 3KQYA 2ZUTA 1C4XA 2VHCA 1QCCA 3D1JA 4LDJA 1CDEA 1TIKA 1MDFA 2GNOA 5FTLA 4JOBA 1BE0A 4DUGD 2B8EA 3EGCA 2QEQA 5DSXA 1ISMA 4CM9D 5J4HA 3L06A 1TC2A 2JFGA 3NC4A 4UD2A 1SR8A 1EP3B 3HCWA 5M3BA 4NV0A 1P9OA 2ONZA 3H99A 1MD9A 3B6KA 4MTLA 1QYIA 3BK7A 2HC9A 4NI5A 4FN4A 4GHWA 4WNIA 3UXHA 3ET5A 4KMSA 3ZOKA 2GCPA 3GUZA 4M9RA 1UQRA 3AIOA 5T64A 4PLHA 4TKUB 1V37A 5ALEA 1IZ0A 2VZ8A 3SC3A 3V2HA 4NBVA 3NHSA 1NN3A 3DV2A 5IJAA 4KQ6A 5HDBB 4BLPA 3PSHA 1ZKDA 4MLCA 1U7HA 4S2UA 4BNTA 1B23P 4BAUA 2QPLA 2OCLA 3FYHA 4HYQA 2ZIXA 1O96B 4MTCA 1CLUA 3DM5A 4I36A 2A5LA 5IABA 1P2DA 1S6YA 3RG8A 2QTVA 1NF2A 3G9TA 3ESQA 4XB2A 3W04A 4YX9A 4QAQA 4YRQA 1U2QA 3QPUA 4U7PB 4V1CA 3WL3A 3TMAA 1X70A 5CMLA 2UU9B 1O6BA 2ZB3A 4G1MB 2G7MC 3RTDA 1JFFB 1R4NB 2QTCA 4JSYA 4D0NA 3BCRA 3TLGA 2VK2A 5BMOA 1XZPA 1Q12A 1YZVA 4RK0A 4CLRA 4I4IA 4BN0A 3O8QA 4EHHA 2UZ4A 3UB2A 3WS7A 2OZLA 4CLHA 1JW9B 1PW5A 1VMEA 3AXSA 4KJXA 1YCFA 1KIAA 4KP7A 2BF7A 2JJ2D 2ZETA 4AJ1A 4JB8A 4B82A 4Z9AA 4CKBB 2UVDA 4OBBA 2BBWA 3MVEA 4PAWA 5F7ZA 1LDYA 3VTAA 4J0EA 4N0PA 1YA6A 1BFUA 1PP4A 3HKBB 3IOCA 1H8HA 1N0UA 1V1JA 2L17A 3HI6A 5I9BA 2W2LD 4KUGA 3SOZA 4BBJA 1XEXB 4MQEB 1NUUA 3P1JA 2P9JA 1APBA 1BVYF 3BFPA 1KEEA 3SYNA 2MT9A 2VUTA 2I7XA 2PMWB 2PCJA 3DKPA 4BUCA 4ZHQB 1NIJA 2YS6A 3VAAA 4CIBA 4KXMA 3FTEA 4MR7A 2H08A 4MGIR 3LKVA 2ZE7A 1OAAA 1LWNA 3VSBA 1C0EA 2DKOA 3L82B 3QVTA 3HYLA 2ZVJA 5LBIA 2QR5A 2RHTA 4DCUA 2AEEA 1E0KA 2A58A 3SZRA 1NQWA 2J4CA 4MWGA 2CV1A 4RKYA 1ZD5A 2PX0A 3HNOA 5DI9A 4MLPA 1H2ZA 3KUXA 1Q92A 5BW6B 1K6IA 3UEOA 4Q7QA 4D45A 3N5CA 4KXWA 5BN4A 1T36B 3LLVA 2Q4EA 1EX6A 3ER9A 5SZJA 3TYXA 3H6GA 3KU1A 4K46A 3FNGA 3O5AA 3WISA 3K6SB 1OLSA 5BRAA 2WAOA 5AKEA 3OUZA 3A31A 1B00A 4JT9A 1DZIA 3R20A 4GI3A 1T1SA 3OIDA 4GPTA 1NVWQ 4CF4A 3SQXA 4W7SA 1EFKA 2OZKA 5AKIA 1NGSA 5E9WA 4K9SA 2HLHA 3SCZA 4MQ4A 1ZK4A 1GPMA 3ZLBA 4RZ2A 1D5CA 3LUDA 3X2FA 1GVNB 4QOJA 4DSTA 2ZATA 3UATA 4MUMA 3A4NA 1Z5NA 3L7CA 4LWOA 1DP4A 2A88A 3WL5A 4L8FA 4LGVA 4U7HA 4DJFC 2FOXA 4UFPA 3TFOA 1WOYA 5KAMA 1ZM7A 1V25A 3PNMA 3U81A 3IP9A 3AGQA 1V39A 3QVKA 4R1OA 5LYJB 1PLJA 1GKYA 3LUJA 3QV1A 2XCLA 4N8SA 4NYJQ 1MO5A 1P1JA 1WZEA 1M1UA 1YQ9A 1UBOS 3MOIA 1Q3TA 2EF1A 1QHFA 3QY9A 4LF6B 1OYVA 2B83A 1BG6A 2FJUA 1P6XA 4M98A 3TQIA 3RBXA 3K0CA 3CNEA 2WLSA 3GFQA 4RIIA 5G02A 1LC3A 1RE0A 4LTMA 4LGCA 4WJKB 1KJWA 4MUBA 3LZ6A 2NZWA 2WUGA 2ZWOA 1E2LA 1XCGB 2V7XA 3GJ3A 1QRDA 3NYWA 4GRIA 1FP7A 1NUAA 1U3WA 1XGKA 2YZMA 1GIAA 1SJ9A 1NN0A 3FHOA 4QE3A 2XTNA 1AZSC 2ZYDA 1P0QA 1F06A 4N3BA 1M1XB 4BMNA 3DOFA 5DLPA 4BO1A 3M4NA 4TKUA 2NVOA 3AOGA 5JDCA 2QT0A 3VNAA 1HDZA 3GUYA 1C2TA 1EDEA 1G7TA 1XAGA 4QSHA 3ZDAA 2VZ0A 1P5RA 2ZU6A 4JBWA 2ZXUA 3WGMA 2ZYVX 3MWFA 2W8ZA 1V7QA 4LOHA 1PJBA 3NPMA 3W8DA 4ZMSA 1S8FA 2BMEA 3JRXA 1K4MA 3OQPA 4LI0A 2ZUCA 3BVPA 4AUNA 1H1DA 3IODA 5C5IA 4AROA 3U3RA 2QY6A 4LRTB 2E6KA 2P2GA 2V6FA 3B51X 3C3YA 4L73A 4QPDA 4QELA 2WWFA 4R69A 2VHZA 2XVYA 3MAJA 1YRYE 3NWBA 4OA8A 4AZSA 4YCJA 3O47A 4AAYA 4OSEA 4B3JA 4AJ2A 1Z34A 2H4FA 4OJYA 3QKSA 3RS3A 3EA4A 3OA2A 1EX1A 4JLPA 1XK6A 4Y1GA 3ZWOA 5HKBA 2H3HA 1JFFA 2C2MA 1R4NA 2QL6A 5KTSA 3N75A 1A98A 2OY0A 3AJRA 4HO1X 1D8AA 2VHTA 3CRW1 3IAUA 4M1TA 4OX9B 3D1VA 4MUJA 2CVQA 2YW2A 1JAYA 1QPBA 4HLUA 4Z99A 3EXFA 2VZLA 3QJ5A 2HL6A 4RIEA 3BMCB 5I9LA 2FSVA 3MQ4A 1CPYA 1V6CA 1FY2A 2FFRA 2H2WA 3AEQB 3EGEA 3IKMB 3K73O 4YCSA 2HMUA 4FZJA 4WLFA 4NU8X 1XTVA 2D2FA 1TA4A 2P7HA 2HWUA 3AI1A 1EFRA 1K75A 1EBBA 2XWQA 3GJ0A 3M7IA 2WNHA 2L18A 4B8YA 4DNXA 1JNXX 5H02A 2VYVD 3GEGA 5FL7D 2GJ9A 5FLEX 1XEXA 3RIYA 4G0OA 3V4ZA 1EIWA 4UCWA 3TQSA 1C3VA 2HMYB 2P2LA 3L2OB 4OATA 3ZWWA 2BSXA 2WF7A 5AKGA 3D8BA 1G3UA 3GXBA 5DT9A 1U9IC 1T8UA 3D2BA 2Q9CA 4ZCPA 1LPBB 3IVCA 1OLOA 4ZOAA 3EVAA 4C4XA 1UP6A 3KSUA 1F38A 3G1UA 1PFVA 1RWMA 2E0IA 1ZMXA 1I2CA 4LDQA 1LKZA 3D59A 2QOEA 1P60A 3GRVA 3ZI7A 4F91B 2KQUA 5TE9A 4MB0A 5EPEA 5HGJA 1I7NA 1ONBA 2AXNA 1T36A 2PTHA 1R37A 1II8B 5FI5A 1K3UB 1VYUA 1DIRA 3B5JA 4LYJA 3UH1A 3JTEA 4PYKA 3MJTA 4AJIA 1JXAA 2QJRA 3MMXA 4DB4A 5JOQA 3K6SA 1SG9A 4ESHA 1WCV1 1U8AA 4QDTA 1A4UA 2EC5A 4L7QA 4Q3NA 4P3KA 5E9AA 3N0VA 4P7JA 5KU7A 1AUVA 2KSQA 3WJ2A 1WEHA 1TQ8A 3F4KA 4IZHA 1UBTS 4KUHA 5T6MA 1JHMA 4AJPA 4G97A 3GCWA 4IMIB 3JVIA 4BMYA 1U5CA 5KNBD 2PY6A 3U4QB 1JQ3A 2Q29A 1CRZA 2OD2A 4N5IX 3S70A 5K8TA 5DGHA 4W1QA 3PEFA 1E5LA 1A4RA 1NVAA 4CM3A 4DYDA 1NIPA 4LS3A 1E9CA 4EMUA 4MUFA 4FSXA 3BXZA 3U1TA 1B4DA 3E05A 5AHXA 5ELXA 2R7NA 3VC3A 1RWNA 2UDPA 3KPYA 3P45A 4ZI7F 1XLTA 1M33A 3DVSX 3ITDA 4HQFA 4L51A 4XA8A 5LYJA 1RYEA 1E9EA 2HI0A 3E3NA 3GPDG 4EPTA 2WR8A 5H80A 1E8DA 1BKDR 3LX5A 3AESB 1BQEA 4MXDA 3UCFA 4KO8A 3FZEA 2B4AA 1F8YA 2RG1A 4MJLA 1H0RA 4ITVA 4HN2A 2XA1A 2G9RA 4KWTA 3G2HA 3BAZA 1FP2A 2GCEA 1FS4A 1UMDB 1WVIA 2GJKA 3C8HA 3Q5GA 3TOSA 1RT9A 1W75A 5DNAA 3E5RA 4B34A 3NB0A 1KVRA 1WVGA 5EHNA 4M88A 1SOUA 1ZD3A 4BMZA 5KYVA 1IBCA 1KU6A 4CTMA 5HTOA 3GMIA 1JLHA 3QUCA 4RY8A 2O8EB 2ZI7A 1NVVQ 1P7ZA 4KJZA 2FKAA 4DDWA 6AT1A 1E7MA 5EKTA 3BWEA 1E99A 3GT7A 3AEYA 2VIIA 3L7OA 1HNWB 3V3TA 1NU8A 2VDJA 3A36A 2CD7A 4UM8B 2BM9A 2CEKA 4K26A 2XMPA 3HXMA 4CIXA 4DL9A 1GSIA 1OZHA 1RYFA 2PKXA 5KQRA 1PI3A 4OHBA 2RKWA 4KNWA 1G6KA 2EYUA 4FWBA 4LWZA 3NVKI 1BN6A 1OBFO 1AS2A 5JAIA 1AU9A 5D87A 3MTEA 3IUMA 2FDRA 5D01A 4JENA 5L6MB 5FX2A 3LLMA 1LNSA 1YULA 5FPYA 1DT5A 1INLA 2A5DA 4IHQA 4QVGA 4TWAA 4U6QA 2BZ0A 2X19A 3PQ6A 4N4AA 1E89A 4BTLA 1ZN2A 5HZMA 2XB2A 1XJ5A 3HJAA 4LHEA 5E2IA 5EFZA 4IOJA 3TCNA 3ABZA 2I4OA 2W2VA 2W8BB 1BXZA 2PUWA 3UMRA 5BNIA 2CXUA 4WXYB 1W5TA 3MUOA 3QBVA 2JFWA 4OKSA 3BTSA 3VNUA 4ZA2A 2DAPA 3WB9A 3IAAA 3SSAA 1YAHA 3W5UA 5EN4A 3BMCA 1ODJA 3NRCA 1VPLA 1Z13A 5F5XA 3EEQA 2OC9A 1KBOA 2GWRA 2VJMA 3MMPA 1J49A 2JCYA 3QXXA 1KY5A 3QXGA 5JU6A 1D5WA 3HFJA 5EP4A 3UWDA 2GXSA 3FX2A 3A4MA 4KUEA 1YZYA 2IVFA 3BWVA 3LXMA 3EBLA 4TSKA 1LSOA 4R2WA 5CJJA 4HMOA 3LPLA 3PTAA 2PX5A 3VI3B 2LW7A 4JLOA 4L76A 4A0RA 1WUHS 1LLQA 1ZEJA 1SCJA 1WM1A 2JBAA 2WYUA 3DOHA 2WUWE 4GXNA 4QEZA 3FYCA 4V3CA 4B5KA 1IN5A 3ONWA 1KZ7B 3EYAA 4U00A 4XUCA 3AJAA 2Y4NA 4RNDB 4RD0A 1DAMA 3MCTA 5EE9A 4YREA 3RK4A 3PL1A 2EAUA 1XNRB 1V8OA 1M5UA 5EJIA 2YL2A 3MWKA 3KIPA 3A1NA 2IY7A 4OKIA 1SBIA 3GJ6A 1MOQA 3M6VA 1DS6A 4R2XA 4B5LA 4JXJA 3IXQA 1VSUA 4GLOA 1LNZA 4H7HA 1Y48E 3Q7IA 3ERCA 1YKFA 4RAQA 4F3RA 4Y1FA 5IAAA 1FFSA 1GGNA 2PWPA 2B21A 2QGZA 3IJ5A 3F5MA 3JQPA 1VDZA 1D6JA 4M0KA 1EK6A 1CY6A 2DRIA 2PZMA 4QJ5A 2C99A 4NR0A 3MGKA 3QEOA 1PR5A 5JCJD 5KJ6A 3FNBA 4H18A 1I2AA 4Q02A 2P4SA 1K3TA 4MV3A 1NMSA 1GDHA 1WB9A 2BRUC 4RTOA 1SXHA 2QX8A 3K09A 2RGUA 4HB2A 5KKAA 1WU7A 2IF2A 4A6EA 2JD2A 2CLIB 2XZLA 2SKEA 3V32A 5KKNB 4KXLA 5AVQA 5EE1A 1NW8A 3ETGA 4QWMA 4RZUA 4RMGA 5G4LA 3EQ7A 4WOPA 1M8KA 2JB9A 3FW1A 3RC3A 4UTOA 5JH7B 2V03A 4A2WA 5MN4A 1QO0A 1X2EA 1I94B 2IP2A 3M6IA 3KQKA 4UJ5A 1GNVA 2BKUA 2X8JB 2HH9A 3HP1A 1DAOA 2C61A 4KN6A 2FF7A 2G5CA 4F8EA 2IXDA 1C0KA 4BEWA 2CLOB 1FYXA 3AESA 4P3NA 3CTPA 4B3RB 1KZ1A 4TT3A 4GSLA 4DA8A 3P2IA 1GL3A 2OHXA 4N3NA 5JS2A 3WXMA 3GH1A 2NO0A 1Y7IA 2HU2A 4QHSA 1RCFA 3JASB 4JBHA 4EG1A 2PQ6A 2ZIFA 2UZ1B 3HKCB 3O8OB 2XT9A 3PFCA 4LOJA 5BSMA 1CHDA 3W8FA 3IDSA 3NWEA 5TGDA 4YMGA 4K2AA 5D3ZA 1UMDA 3Q3CA 5D7NA 1LBIA 3S27A 3TF5A 5HM6A 4D8YA 4G09A 4O3FA 2XKJE 3CMCO 3F0TA 4NV3A 4NHEA 1T6BY 2CMKA 3RADC 3D8UA 4Z5XA 1MB4A 1X87A 4MV0A 4UHDA 5FPSA 1Y6QA 3LQ1A 2NO4A 3KXKA 4HWRA 3V48A 3ZVLA 3QBTA 2H7VA 2MSCB 3LX8A 3Q2OA 2C7PA 5DM2A 2QAGC 5CT9A 1Z5WA 4WK2B 3G88A 1KQPA 4X6XA 2FW6A 1SXIA 1GDTA 2B4YA 3MRXA 2XA9A 1L8LA 3M6UA 1ZZEA 3LBYA 2OOKA 3MQFA 2MSKA 3BSYA 3L0PA 3NT4A 4RJLA 4CM8B 1V8ZA 2ZGVA 1PT6A 3KTOA 3LU1A 4G4IA 2O3JA 3W2TA 2WDPA 4V03A 3ZV6A 3EAFA 1TW2A 2WM8A 4XW2A 1FTNA 3DE4X 3ITEA 3V8VA 4Z2YA 4U2BA 3V4OA 2GO1A 4X66B 1AKUA 2VPQA 4ALMA 1RYDA 1Y5RA 2ON6A 4F85A 2JHGA 3FNIA 2F3RA 1WZIA 2ODNA 3VUEA 4LVOA 4LV6A 3UJAA 2W8BA 1VM6A 1UCFA 2R1ZA 3ZXUB 4IH4A 3IERA 1VZ3A 2MCFA 3HCBA 2HHLA 3OESA 3GRYA 2CFTA 4DZZA 5KNDD 2O7NA 3JD0A 2FOLA 4P3OA 3U7EB 1WUKS 3ICQB 4NIMA 3EQ6A 2GBGA 2QBYB 5ALTA 4J3FA 1PV1A 2FE4A 3FB4A 5PGMA 4YP6A 2UYYA 2HA7A 1GPYA 2W71A 3O4HA 1NT4A 3BXPA 2X8AA 4M49A 3M81A 2CJWA 3E82A 2PR7A 1JHOA 2EVWX 3QW2A 5L4SA 3WLMA 1YUBA 1VGQA 3ENWA 2DQYA 4Y0AA 1Z63A 3KD2A 1VE5A 2JIZA 2P4HX 3LFTA 3MCUA 5IJ9B 3F67A 3I6ZA 1GPBA 1N3YA 2D5IA 3PQ5A 3SZOA 3EUEA 1QH0A 4GW3A 2JLUA 2VDMB 2ZJZA 4KQ9A 4L08A 4X64B 1G0OA 1PWZA 2YV5A 4OHUA 4BVJA 4P82A 3M82A 4B71A 3BSFA 2YNMA 5JJCA 4WW0A 1M5TA 2EZTA 1YHNA 1MW9X 4RK1A 4RPHA 3VZSA 5AKJA 3WK6A 4N6NA 3Q11A 1L5GB 1XF9A 3RYHB 5KNCA 5KTKA 2P9FA 3Q7PA 4EVRA 1EHCA 3SEQA 3ZK9A 1HM5A 1O5IA 4EW2A 4MW6A 2DHEA 3OOYA 4OQQA 3HI4A 1AUQA 4U4AA 1NFQA 1AS0A 1P1KA 2J3MA 2POCA 2Y93A 3IT2A 3RSCA 7REQB 3A3OA 1NL3A 2JAPA 1DG1G 3OCUA 3UAGA 3UMYA 2C97A 3EF3A 3DYBA 3AVUA 2ZRBA 3PL5A 2WKWA 1ISFA 1P3JA 1OI3A 1ODTC 1L0BA 1D0IA 2OBBA 1N2IA 4C0SA 5IMSA 4J49A 2J0QA 1BC5A 4LZJA 4TROA 1UH5A 2ZBUA 4LEIA 1PJ4A 4POOA 1U5BB 2I5PO 3FJYA 4JP2A 3WA7A 2JKYA 4MUYA 1IJKA 2C2YA 3L8GA 4RZXA 3GVCA 2V4MA 2FPOA 2AFRA 5CCXA 3H9QA 1EA5A 1FDRA 4KACA 4TMKA 1U0BB 5C8DA 1R4MA 3NATA 3MS7A 2X8JA 4I50B 4ZQFA 4E5SA 3OU2A 1VE6A 1QUEA 2BFCA 3G68A 4JELA 1P61B 2QYHA 3ZKAA 3ZVMA 1YFKA 4M8KA 4B85A 1JS1X 1Q0TA 4FHDA 1KAHA 1PF7E 4WX2B 1W4RA 3ZOZA 4GEKA 2HX1A 3IQWA 3WHPA 5ES4B 4HNGA 3PZBA 3HKCA 3LNCA 1JJAA 2SECE 3K4PA 3O8OA 1GFIA 2Q9UA 3T4XA 3TZKA 1DAPA 1Y1KE 2C5HA 4G0PA 4TQ9A 2MIIA 4LIPD 5HPYB 3PEVA 1QQBA 1DTWB 1TAQA 2QU7A 5FNVA 5IJZA 4B3FX 3F8SA 2HJRA 2PKYX 4RIGA 2NN3C 2V7QD 4N8EA 3IKTA 5CLJA 2G4VA 3D3WB 3LPCA 2B0CA 3C7DB 1QG2A 1L5QA 1W36D 2VLIA 5ALJA 2QPAA 1P4AA 1H4VB 2AEMA 2V96A 3ZBPA 1R50A 1RSZA 1W0JD 1YDEA 5IAKA 1BU5A 4YRZA 3GPLA 4MICA 4RVFA 3H8SA 2VF2A 5K99A 5F33A 1GPNA 2CHEA 3C6ZA 4AZ0B 1PFWA 1CX9B 1CZHA 5K0BA 4PFKA 4RVUA 3NGLA 3Q8LA 3FSEA 4YP7A 4DV2B 4WDQA 4C0AC 5CFZA 1CQIB 4PNEA 2JD0A 2VNKA 1US8B 3TD9A 1CJTC 1LK5A 1Q74A 3DH0A 3CQ9A 2HA2A 3BJZA 3H4IA 3TL6A 3WSVA 4FDVA 1SBYA 4PZYA 3KX2A 5JQWA 1WXEA 2R5FA 3GX1A 3KAPA 1RBZA 5I8ZA 1JVBA 2WI8A 3SG0A 3QVLA 3LS2A 3VH3A 5TQJA 2EQBA 1H66A 3N87A 4E1VA 2FF5A 4YFYA 2DHQA 2XAAA 4ZT3A 5FPPA 1EG7A 1N75A 4HNSA 2Q9AA 4RPCA 5CU7A 3W06A 3ZDBA 1FU7A 2SBTA 1SGWA 5CRIA 4ZGWA 4RTLA 1K2WA 2DT5A 3FPHA 5JMWA 4CHTA 1EJ6A 3FI9A 3AQIA 4OHFA 2QBYA 4HEJA 1H1LB 1A9TA 2HB6A 3HY6A 3LHIA 4AURA 2XD4A 3C1TA 4RLSA 1GN8A 4IX1A 1U7UA 1RRVA 3WQSB 4H3HB 4LECA 1IOWA 1CEQA 4TV8F 1EBFA 2ZI9A 4H16A 3IPXA 5EMMA 5AW0A 1PZMA 4KPYA 1DQRA 3P9CA 2BUAA 4J8PA 4P54A 1P3DA 4YPVA 4IG4A 1X1BA 4CCYB 2JFVA 3WRXA 3LUBA 4YNBA 3HH8A 5F4ZA 4ND8B 1TD1A 4Q66C 1L4GA 1UJMA 1P2GA 4C5BA 1QIIA 5I4IA 1D0SA 4E5YA 4U6SA 1QF7A 1UBMS 3PCRB 3WWZA 3P9NA 4X95A 4ND3A 3K9FC 5K3BA 2ZDQA 3D7KA 4LJ9A 2ZRMA 1JU4A 4Y30A 5ICEA 1JKMA 1RWQA 3DO6A 3PE4A 1HUQA 2W2KA 3DMTA 4XGRA 4WCFB 3TH5A 3S0JA 3BDAA 1J6UA 1KI1A 4I2VA 1FMTA 2BGRA 3KWFA 4YWHA 1PQPA 3RYHA 3ANTA 4EY8A 2WWGA 2XA2A 3DCJA 5D84A 1CUGA 1Q1QA 3UMJA 5A0TA 4RETA 2EW1A 4IJKA 4HDRA 7REQA 3K70B 5CFLA 4LISA 5EQJB 4E15A 5KVCA 3ORFA 3QSYA 3IQXA 4YYEA 1KI9A 4IOMA 4Z0TA 2FEOA 5L3VA 2OQ2A 2QTLA 3HY3A 1IBMB 3F6SA 2DLCX 1PJTA 3RIHA 3ZBUA 1D1SA 4OUDB 1XU7A 3BRCA 3HXKA 3KKMA 2D2EA 1Q2XA 4IXWA 1JQDA 1U5BA 4KQ2A 4B6OA 1CXZA 2WC1A 1SG0A 4RMIA 1CY4A 1QDEA 3A1DA 4KMRA 4P3XA 5F21A 1AO0A 4URFA 2FDCA 2OL4A 1BS9A 1BWSA 4XOUA 5D5QA 3WGLA 4ZT5A 2IL1A 4OLHA 1E7WA 4QYIA 1YIAA 5AOVA 3SIPA 4I50A 4B4UA 4OV6B 4CF6A 3LAWA 1WCIB 1XMSA 4TMXA 2H11A 1NXWA 3GMDA 4LQCA 1UFKA 3SXUB 2P9ZA 4N40A 3C98A 2JCSA 3KT8A 1EWTA 4XUDA 2REXB 3QRWA 3M3HA 2AJBA 3INRA 3KZVA 3CPHA 3C3DA 3OIUA 5CURA 5C1DA 1DBIA 2JLRA 5EXXA 4U02A 2MTBA 3ESRA 2JF0A 3A9TA 4CT4B 3C5CA 2LP4Y 4Z4CA 5LZ4A 3KQWA 3LSYA 3JXEA 4AMZA 1ICEA 4NMMA 3VSEA 3HL4A 1DTWA 1ZHHA 1NWHA 3CWQA 4FKMA 1XTKA 5EESA 5A0FA 2C03A 1P0CA 5DYWA 2WTMA 4DDMA 1NVMB 1JUDA 3A26A 3TBFA 3D3WA 1E1YA 4U2DA 5TQ2B 4D4LA 3MIZA 4IIJF 2I34A 3TGWA 1Z75A 5A2QA 4FEGA 5JFGA 5LKAA 5AIBA 4HMQA 2Q1TA 2OV1A 2FK7A 3QI7A 1UBFA 4J3JA 1W96A 2AEJA 4AFNA 1G3MA 2DWOA 2RMKA 3LCRA 1H0SA 5AOAA 5HCIA 3FYUB 2ZTVA 2QVGA 1Q1BA 2JA2A 1RPJA 3U7JA 3OJFA 1Q15A 2QL5A 3FCOA 3HDGA 3HYRA 1LGYA 2ETVA 5DFAA 2ZUFA 2VNHA 4CGZA 3D6NB 4YHBA 1CQIA 2Y9MB 5HZKA 1IG3A 4XSHA 1M2VB 1G4HA 1US8A 4PWZA 4INPA 1SQGA 5JNRA 4GXQA 2Q6LA 1T2AA 2IBTA 3KWLA 4H6VA 1PD0A 1DFIA 1S3SA 3G8DA 3GLUA 3I9NA 3PEWA 1SC1A 1XZDA 3LWZA 1OA1A 1QTRA 1N9KA 2B4RO 4IH9A 4XSGA 4BBZA 4C22A 4WN3A 4AG5A 1A0OA 2DC1A 4F7WA 3G2NA 3K9HA 4YIKA 5AVVA 2QTHA 2F55A 4BXOB 2Y66A 1UDCA 4GGOA 1OXMA 4IINA 2Y1OA 1TCUA 3BMQA 1YMUA 4A16A 1V7ZA 3CR3C 4ADSG 4AW9A 1TXGA 2UYQA 4L8WB 1Y5MA 1JH8A 4IIFA 1OFHA 1S02A 1U2DC 2CZQA 4WASA 3DT6A 5AVJA 3VVCA 5C0OE 1H1LA 5D85A 5I4KA 3KLOA 3D2LA 5FTJA 4D9JA 1SCNE 5L3ZA 2O8FA 2QI9C 4J1TC 3N0WA 2V0GA 1YL5A 3W3AH 2GEUA 2NO1A 4BKUA 4DDVA 2F00A 3K9WA 4G5HA 1HMYA 1EXNA 4JQOA 2CFCA 4EB8A 2WA2A 3M89A 1OTHA 1L5KA 1ZEMA 2E37A 4I6GA 2NZXA 4R0VA 2P78A 1TCBA 2PA0A 3ACCA 5HIKA 3TEMA 3LBIA 3IURA 3Q10A 2VXCA 3KJFA 4CCYA 4HLCA 1WMFA 2QD5A 3GRRA 4WKNA 1TIPA 1Q84A 3ETJA 3IUEA 4FYHA 4ND8A 5F1YA 5LFAA 1JSXA 4LGMA 3FSGA 4KXQA 3OZGA 4B7ZA 4LX8A 4H7PA 4TYQA 4H6PA 4CLEA 5ALHA 1KSFX 4QXMA 1WUYA 1FJXA 3MINB 4U0KA 3V6LA 2W11A 4GZLA 4DLAA 4WCFA 2UZIR 1GCGA 4H15A 4NPHA 4XOIA 4FT4A 4BP9A 5BSFA 1Z5UA 1GT6A 3QKWA 4L85A 3AB3A 5TMBA 4J94A 4HGOA 4KDRA 2N46A 4R71A 3I5YA 5FLYA 3STXA 1OPXA 1L4MA 2FG7C 4UHBA 3AWIA 2FQXA 3CSSA 2HMAA 2V7VA 3T4PA 3CZPA 4FX5A 2QAIA 4LV5B 4AZ3B 3JQDA 3RTCA 4FOPA 1PTJC 2ZYRA 3BQMB 4U5QA 3WKAA 3HNRA 3A4YA 1JQJC 1K8YB 4MVXA 1LLCA 2NM0A 3LHKA 4UZFA 4MV1A 2FEMA 3FUUA 5B6IA 3GJRA 5IXSA 2VT6A 1A9YA 5REQB 3L8DA 1BXRB 4OUDA 4BZPA 5B2FA 4CLDA 4D3SA 5BURA 3NTOA 2O5EA 4Z7JA 2X2EA 4YQFA 1U9YA 1M0EA 1CQJB 5LD2B 2GPSA 5DEOA 1YR1A 2I2WA 3K2BA 4LJKA 1SHJA 2A0WA 4ZYLA 1B6GA 1E66A 3BL5A 2A59A 3PQ7A 4J90A 1WDKA 1ZH0A 2BFMA 2OBYA 3C3MA 3QYPA 4NABA 5K4AA 3ZZNA 5B5SA 3EXIB 2W6JA 4GFDA 1TVKB 4BKOA 5ITSA 1YGYA 2RI0A 1X42A 1XNHA 3ORRA 1IU9A 5JECA 1AZLA 3FRIA 4BAZA 1K6XA 2PX3A 1OROA 2J67A 1P44A 2PQ2A 4JI7B 2G09A 1IY0A 1Z35A 2YMQA 3VX3A 4X85A 3Q88A 4EO9A 2BM8A 5FTNA 1KKUA 4CV3A 2QRGA 2F1RA 5DLYA 4ON9A 3JYPA 1W2HA 2CBZA 4FDTA 2C2ZA 2AW3A 4IHJA 4BE4A 5JC1A 3KSAC 2OXFA 2X40A 4E30A 2OD9A 3B70A 1WHSA 1H4TA 3C6BA 3N39C 3LQKA 1PEYA 5FUVA 4ETNA 3DLHA 4A36A 1NTRA 4LG1A 5EIAA 3N53A 5FJJA 1JBKA 4LNHA 2Q5EA 2WFLB 1ORTA 1Y6RA 2PT9A 1ZW6A 5TQ2A 4ZRMA 2JH8A 4WK6A 4LXTA 1QQ6A 3WIOA 1Z7GA 4UCFA 2R2AA 3N6VA 1N2HA 1KO4A 3JWEA 2GI4A 2R6HA 5DM0A 4HQKA 2PE5A 5ALFA 4W5TA 4WADA 4Q3LA 3S2UA 1Y1QA 4A8HA 3FYUA 4FW8A 4NXNB 4RJTA 1QV9A 1BMFD 2P1DA 3OPVA 5DF1A 5GY7A 1SHLA 5TRTA 5IYZF 5K8CA 5DXAA 1IXSB 1SCUA 1V4VA 3PJDA 1DCFA 1LDNA 3OA0A 4RKRA 1M2VA 1LWOA 1P7CA 2HIAA 3GQBB 1GFSA 2VPWA 3IT3A 1N77A 3E3AA 1HNZB 4BLOA 5KVVA 2HSEA 1KC3A 4DBLC 1PR0A 3KAQA 4QASA 1IOVA 1XDUA 5EKXA 3VAZA 1YOVA 1F2UB 3REOA 5F7OA 1GA1A 4BJHB 1NJ1A 2R1TB 3K0AA 2ZRAA 5AVZA 2GK7A 3DW1X 1BWRA 3H1EA 3WYEA 2MHCA 4MRPA 2Z1MA 4Z4QA 2BFEB 1KI2A 4LRWA 4KAXA 3N86A 4NV1A 4P98A 1ZJ6A 4LHVA 2D2VA 2IYAA 2QRLA 3O1IC 1DUSA 2GZDA 2NSLA 1FNDA 1IIBA 3K1JA 4Y2VA 5HJ5A 1J2JA 2C0CA 4OYHA 5COBA 4IVQA 2BEUA 3RWOA 1M6VA 1FYVA 2FWBA 2WIBA 1U1GA 5EIFA 2I4TA 4JJAA 1E6KA 4NSNA 3MLBA 2Z8ZA 4MKRA 2Y6VA 2PD6A 2IHVA 5EC8A 4J0GA 5JNWA 3OG9A 3WZLA 1TEVA 2WINI 5AD1A 5FYQA 4G9BA 3NUGA 2Y1EA 2G0AA 2LUOA 3ZGVA 2JLVA 3U09A 5DOZA 5J59A 5CBKA 5ALYA 4YV7A 4ZYVA 3U1VA 4UREA 2E21A 2PSJA 2YHUA 4G9GA 2VDUE 4Y67A 4BFLA 1ZISA 3BX1A 3WIUA 1I3NA 5ITWA 4RFSB 1Q11A 1GVHA 1P4GA 2CF6A 4EYKA 4HJRA 3RRZA 5BWNA 1RKUA 3AH8A 1LK7A 2V74B 3RS2A 1RZVA 3GLHE 3GW8A 2HWXA 3D0QA 3L01A 2YOHA 1KOFA 1GA4A 2JGLA 4GQIA 2J6CA 4HS9A 2AOTB 2P9HA 2Q21A 3H2IA 3FF1A 1PZFA 3IDQA 4NHOA 4RHTA 5EJFA 4C7JA 5JT1A 4N0DA 1UAAA 1UAYA 1AMUA 2HJHA 5HMLA 2ATEA 2WB4A 3R44A 4HP8A 4CEIB 4JEHA 2G1KA 3WA6A 5LLTA 1QVAA 1P62B 1TF2A 2OG1A 4GYWA 1Y82A 4IRMA 4OHVA 4CUZA 4NESA 2SICE 2GO7A 3G6KA 4FYIA 2DPYA 5CHYA 3FRHA 3LY9A 4AMVA 2LRHA 4FZRA 2P27A 1UWCA 4KWHA 1POWA 5AM4A 2NO9A 3SQDA 1OI2A 5DWQA 4C89A 4DSUA 3AY3A 1NZJA 2ZBRA 1UODA 4KXYA 2DEUA 2JCGA 5REQA 3DYIA 1BXRA 2B98A 2EX4A 2VDKB 1PNTA 3DOJA 3L7KA 4TYMA 5KTOA 4GM0A 4MVYA 1CUZA 3EBOA 3PX2A 3WP1B 1CQJA 2GERA 3MIIA 4JUIA 3NAMA 5FWXA 4BQEA 5ITVA 1SUFA 4GMFA 1N6OA 4KFTA 1EP1B 4HV4A 1J4AA 2QD3A 2QD1A 3EXIA 3M1YA 3WRYC 1TVKA 4AYWA 2H1IA 3TQCA 4O4JF 2IHKA 3O0DA 5FWDA 3PPWA 4EGQA 2BN4A 3PC4A 1TLFA 3LHDA 3HJCA 5IC6A 3GG2A 1JHDA 1T3GA 2R6DA 2A86A 2WP8J 4TQGA 4G0QA 3WK4A 1QCYA 3DONA 4PVCA 3SQMA 2R6R1 3FMIA 3M6WA 1TTHA 2NSYA 3M5PA 3LYLA 4V0QA 3UICA 1AB5A 2GLXA 5LB4A 4Y2PA 2HBQA 1SC4A 1DTEA 1L7VC 4I55A 4MS1B 1F5SA 3HKDB 2B25A 4TXJA 1D1TA 4D1YA 4F4FA 3OTWA 4U0JA 3S8EA 4GIBA 8MHTA 3ZEIA 1CG6A 1ZOOA 3WNDA 1EINA 2I62A 2CEAA 1JKJA 2QYTA 1NR5A 1WPQA 3IUJA 4ENTA 2ZZKA 1ZOIA 2WFLA 3QFSA 2OG2A 4KOAA 2HPZA 1U0NA 1SO8A 2ISQA 3H2SA 3CT4A 1HT0A 2FUG1 3TSCA 4DG5A 1N0WA 1P5JA 5IT0A 1J2RA 1OFUX 1W73A 3ZCXA 2YC4C 1X7WB 3WIDA 5LLSA 1PT8A 4Y2RA 1VI6A 1KJ9A 4G8JA 4PY2A 3GLHA 5K8LA 1YS2X 3ZD8A 2QUHA 2WB2A 4L0DA 3CVVA 4FMBB 3CZ9A 3IVXA 3OLVA 3AVXA 1BCRB 3TRIA 3KJIA 3GQBA 1CV2A 1SHUX 3QP9A 1K4KA 2HXGA 2GS9A 2QW1A 5EXDA 2X7HA 1UXIA 1S2LA 4UHKA 5DNVA 4X8LA 5JNUA 1SWVA 5TPZD 821PA 2HT6A 1UBGA 1WETA 2B1JA 1KK1A 2ZE5A 3X43A 2XKKA 1W5BA 1F2UA 3E5MA 4YJHB 4ZI3A 1KORA 3S29A 3AF0A 2R1TA 1MU0A 3AUFA 3NHZA 3ZPXA 5BSVA 4BJ5A 3SBEA 2P62A 1XTUA 3ZEAA 1Y6GA 4ZXPA 4M60A 1XD8A 2EJUA 2XSZA 1CUDA 4NK4A 4BO7A 3QQ5A 1U02A 3RSSA 2Q46A 3WVNA 4C01A 3MRSA 5DHSA 2G5PA 5KQGA 1ML3A 3NXKA 1K7EB 2HUPA 1KGSA 3F8WA 5FV7A 1Y33E 2D0IA 3SLGA 3MOGA 2JBWA 3ZE1B 1EJ2A 1T1RA 5DGCA 3M9XA 4K28A 1PCXA 2JFOA 3P0JA 1CJSA 4AIRA 4JBGA 1TTPB 3EH2A 1CYEA 1KZGB 5P21A 2PAFA 3V2UA 4BMXA 4J07A 3NU1A 4M1ZA 2DFPA 2GSDA 3MWEB 4RHUA 5F23A 2H18A 1SXQA 3CHYA 3ETLA 3UGKA 2C42A 3F5SA 5KIAA 4TTRA 1E3JA 5LDDC 3ZHVA 3VAYA 4Q6BA 5J2UB 3DOEA 3H42B 1JPUA 4ZFNA 3NTXA 3GRKA 4B46A 3LUKA 1RADA 1NQVA 1ZLYA 2V54A 1X1AA 1EFUA 4IXMA 2ETXA 3O31A 4GNRA 4HXFB 3TQTA 2AOTA 3OPXA 4OL9A 3A1CA 2OSVA 4TV9F 3SQOA 2BBTA 2INGX 3MT0A 2C77A 4CI0B 4W5NA 2ZR7A 1XZIA 4JEMA 3TTXA 3ZGNA 4GICA 3PFIA 2IGTA 3SVLA 3O95A 4ZYZA 1D2RA 1UEIA 4PBTA 2BEWB 3OQJA 3PTLA 5DXFA 1OQAA 2HK8A 2J9RA 5K0GA 3BHNA 3FCCA 4U39A 3FA2A 2WMDA 4RF3A 4NE2A 1WDWB 1M7HA 3I2YX 2V1XA 1PNVA 1TCVA 2WWHA 3FHLA 5B55A 3QOWA 1NYLA 4BO5A 2ZDGA 2PCLA 2EG5A 4J2HA 3C6KA 1O6ZA 3ETDA 1A2OA 2HHJA 1OXTA 1KYYA 3PYXA 5J58A 1ABEA 4YROA 5AOBA 5JNTA 1MC1A 5BRJA 2Z4RA 4LJSA 4DWJA 4YAJA 2XTAA 1LZLA 1GARA 3H1AA 4EI8A 4G6ZA 1BVRA 3P9QA 1QP8A 4QUBA 3ZD7A 1E2NA 2W6ZA 1UKCA 4FBGA 2AXQA 1IDOA 1H9AA 2FVYA 1O5OA 4RH1A 4Y2GA 5ALLA 2BCGY 1NVBA 3I5AA 4MUKA 2H7YA 4UTXA 3OD5A 3L4KA 5KZMB 3RTGA 2JAXA 1W5SA 4I1UA 5P8WA 1OMOA 2DFDA 1JWBB 4W9NA 4Z49A 1T5TA 3IOYA 4GPIB 2I2XB 2Z98A 1SWWA 3B89A 4TTPA 1VIAA 2OORC 5HR5A 2WUFA 2ZBVA 1CERA 3HO8A 1YASA 4RENA 5CJ2A 1H0KA 2PMKA 5CT5A 3V4PB 3AX6A 2AN5A 4IDDA 3BWMA 1YZKA 4CMHA 4ZAGA 2RAPA 2VDOB 2YZ2A 2RH9B 5E4YA 2GLUA 2PO7A 4MS1A 1H2RS 4EAQA 3DBHB 2CWWA 3IQDB 2D06A 3C3AA 3E2MA 3OVMA 4B45A 2BFWA 3HBLA 1MTZA 2QUKA 4HADA 3PIDA 2BTEA 1RBMA 1J5XA 4X6UA 1E2FA 3R0JA 2B4KA 3BICA 1N8KA 1ZCFA 1F12A 4FFSA 5KSPA 2WVJA 3PNPA 4L0QA 4BOYA 4X61A 4KHPB 1NLZA 1A9SA 3DZFA 5JUWA 1BD3A 3OEHA 4Q1VA 1O8BA 5AJYA 4AXBA 2CL0X 1FZQA 2PKRA 2A84A 2FWIA 4YMWA 3MJVA 3DMPA 3JQRA 3RF7A 1W7AA 5LZ8A 5GIOE 1P2VA 5FQOA 4NULA 3HB1A 5JG7A 5ITZB 1JX6A 1I0ZA 3CCFA 1VL1A 2XB8A 3GEMA 1FOEB 4TTVA 4R3UC 2E4AA 2HXSA 2YICA 3I42A 3IVAA 1QWOA 1JDNA 1NJGA 4IKEA 4MVJH 4UAGA 3CZCA 3TFQA 4MCHA 4ZI5A 1JDPA 4NZOA 3X3HA 2FEXA 4PLYA 1MW8X 1B8OA 2REQA 1JEJA 1CQWA 3L49A 3TRFA 4UBIA 3MFYA 4JASB 1TO2E 5CP8A 1LSUA 1WEKA 2QLFA 2YVAA 4BNNA 4PO9A 2Z2YA 4A1OA 1HDCA 4BGEA 3FWZA 4NYIQ 3D6VA 5JI2E 3IMGA 4PG7A 3N7TA 3CGWA 3JYOA 4KXVA 1F4VA 5IBPA 2DKNA 2BGKA 1WW2A 3G5MA 4BQFA 4ZYTA 5KWIA 5B2ZA 2XY4A 4N6GA 3KJGA 3T1VA 4S0ZA 4HAVA 2QRUA 3FPCA 3QXHA 4V02A 4I8IA 4X6LA 5C32A 2QN6A 3SAJA 5THQA 4JP8A 4YYZA 3AI7A 4BLRA 3GJ7A 2QTWB 4KE8A 2HPAA 1T5OA 2EKQA 3LZCA 4D8XA 3O1HB 3OX2A 4ZODA 1KU0A 4FFRA 4YALA 3TW6A 3VBEA 2VK8A 4RW0A 4YH1A 3L1VA 4GX5A 3ADCA 3GELA 3SHVA 3L40A 3AR7A 1M1YB 4HPJB 2IYXA 3NI2A 2P69A 1XMOB 2DUWA 2A35A 2QJOA 5I8WA 3RG2A 5ESWA 2PV7A 3UT5A 1AQYA 5IKPA 1JEAA 3RIXA 2QGNA 3SX4A 2P6MA 1DKLA 4TSRA 3KSZO 4KSCA 5JWOA 4KWIA 1YBMA 3H3JA 2XBUA 3KOUA 3OSUA 1K1EA 2J09A 4X7PA 5AWFC 4DNFA 3WICA 2R25B 3UGTA 1R5OA 2FEPA 2ONCA 2QB5A 3NT2A 4P80A 4Q9DA 3OUUA 4QIHA 3V80A 2BGTA 4RDCA 2CLHB 3OZAA 5I9TA 3GLSA 5HKKD 1N8TA 4BTEA 5AVYA 3L07A 1HL7A 3N70A 3T1YB 4NCHA 4DJAA 4LY0A 5EJMA 3OCCA 3T3PB 4QDJA 3B2EA 1UBNA 3DQZA 3R3XA 4L3VA 5BW5A 4E32A 1ITZA 1G3RA 2R8YA 2WMYA 2QRVB 4IGFA 3ORSA 3PJFA 3WGKA 3B9RA 2Q5CA 3SJUA 2Z8YA 1G6OA 3AJ9A 1AD2A 2GPNA 2GZMA 3ISJA 4HWTA 4RSRA 3UMFA 1TE2A 5EJ7A 1HV8A 1ACJA 1V3VA 1FNCA 1OGIA 3DEFA 4WZBB 2XTMA 4KPEC 5LXTB 2R7AA 2AK2A 3EZ2A 3OCXA 4QTTB 3RSFA 1RHMA 5KVAA 2ZT7A 3JWGA 2O8DB 3IHTA 5JCPA 4P36A 1FUEA 1T0UA 2N42A 5A5DA 5LUBA 3C7AA 4OBWA 5JZSA 5A9SB 2ZJ3A 1XNQB 1NZDA 2ZJ2A 2OPHA 2QJTA 4CMEC 3I83A 5LLDA 3P52A 1TAHA 4BNZA 1I4EB 1FP6A 2CHFA 1N7JA 4EO7A 1XQYA 4EQ6B 5GIPE 3OFNA 3NKVA 4DMUB 3B7GA 3BD9A 4TQUS 2YCLA 5CIQA 3T5DA 4MS3B 5TARA 3J7AC 2P0AA 3ENVA 5JXJA 4L07A 3I1JA 4TRJA 4F46A 3DEYX 3BKWA 3AI3A 1NVVR 1Y1TA 2ECPA 3SNKA 1GRCA 1NRXA 1MQ8B 1NW4A 1PYGA 3MCVA 4KLZA 4TLCA 4LJ5A 1CB0A 1WMEA 1FBNA 2ZUUA 3CN9A 3QVWA 3ZDFA 4PG8A 3AKYA 1HZZA 2HNBA 1CFZA 2Y1KA 4POAA 1WE2A 2EJWA 3A58B 2IOFK 2VHVA 3OM8A 3RVMA 3TNYA 1NV9A 3IBYA 2YFHA 1TKCA 2W9XA 4KIJA 4D5EA 4C1NA 4Y2SA 1EYZA 5SV2A 1YS4A 2DSTA 3JZFA 3G1TA 4QQNA 3IPLA 3JWJA 3FCAA 1AKVA 3KEOA 3P0EA 4U7DA 3MUNA 1DBSA 2UYOA 4JJ4A 2VP6A 4I1VA 4AF6A 1EK5A 3X1XA 3KQOA 1K7YA 1Q2UA 3UWMA 4NC9A 1FS6A 3P19A 4DIEA 2X5JO 1NFRA 1DMSA 1RJ9B 4EJSB 1G2IA 2P3QA 2R7KA 2EZ4A 1OTXA 4ZARA 4KR9A 4IIEA 3ZCPA 2G80A 3PVZA 3JAWB 1U2TA 3OHSX 1T2UA 3C5HA 3IAHA 3M5CA 2CNDA 4CFSA 2W37A 1JVNA 1TZBA 1Q7GA 3OJLA 3BD8A 4PFSA 4R8LA 1W5EA 3BTVA 3KBOA 4GGPA 3OMXA 3TLAA 4BQIA 1OX5A 4DARA 1F6WA 2CLSA 4OAOA 4GDFA 4K9QA 3WHLA 3WTBA 1CULC 2IPAB 2PKCA 5FBQB 1G2OA 4OPMA 4RHCA 2XCRB 4IPTA 1LV7A 4ZKEA 4JMLA 2FMHA 4PSCA 3WDMA 2PAAA 2NV6A 4AF7A 4GPAA 1MAUA 2HREA 1EUCA 2PQMA 5HK9A 4M0LA 1NVTA 5TQ0B 1DC5A 4YACA 2G6BA 1SUAA 1QIKA 4JYAB 2PS9A 4R4JA 1QG6A 2ODEA 1J0XO 4MQBA 3CKMA 5LQDA 1OX4B 3A9SA 2AOVA 4YJKA 3ZJVA 2A5GA 3GJZA 4AUEA 3IR7A 4WCVA 2ZJBA 5IBCA 2NGRA 4MINA 3BWYA 3UHFA 2EHJA 3SSNA 3WLHA 3BWCA 3A6KA 1E59A 1NMXA 4KEAA 5L4NA 4GI1A 1N6HA 1YMQA 4G81A 2I2CA 4FYVA 4X71A 1BEEA 2JFHA 2Q6VA 1BNCA 1IBKB 2GBFA 3MJ4A 3T8YA 1P75A 1T6ZA 2ZSUA 1D7OA 5FKJA 5A6VA 2VCHA 1TUEA 3KJZA 1Y5NA 3HABA 1RRCA 4F60A 1VSBA 4ND6A 2XUKA 4GBMA 2IBSA 1KSJA 4OFWA 1P29A 3S5JA 3Q3IA 4R01A 4B3XA 4DJJA 1D6MA 4F4HA 2BTQB 2NXJA 2XCOA 1VHQA 3K15A 3A9RA 3QKTA 4IHAA 2GKSA 1WG8A 3FJ1A 1Q0SA 3AHCA 2EKLA 1IM5A 1AB6A 1L5RA 2GWHA 3SC4A 2CMFA 2QMYA 2V97A 2WVAA 2J0UB 1JHYA 4M55A 4R05A 4B31A 1UP7A 4ZOCA 2WPNA 4BWVA 2Y1DA 1TYCA 3PENA 4ZI2A 2O7RA 4DIUA 1MRZA 1WQ1R 4Q1FA 1OBHA 4IZ6A 5EINA 3HV0A 2OBXA 3ANLA 4YASA 1EESA 1O4WA 1JEQA 2QG9A 2FXVA 3PNSA 3AL0C 4HNRA 1JYEA 1XU9A 3KKPA 2HBYA 1AJEA 1PG0A 2O1SA 2I4LA 4ASUA 4ZK6A 1T9ZA 1H2FA 5K0ZA 1COZA 4U3JA 2DMRA 2O8DA 4G85A 1EVKA 3BH0A 1U8TA 1PLKA 4I8XA 4EMTA 3QBJA 1QIGA 4BO4A 3UAOA 1ZD1A 2HZ7A 1C41A 2XMQA 4HH4A 4C9BA 4EZBA 5A9RA 2CLLB 4BO0A 4P86A 2K6GA 5LBTA 1EE2A 4PPQA 1G60A 3K0KA 1XTJA 5C1IA 4CTKA 2I3GA 1ZI8A 3WWEA 2G5TA 4EQ6A 1Y8ZA 4IIGA 2WTNA 3AUJB 4HGQA 3HDHA 1PWYE 4IGIA 1FQWA 3CLHA 4AMGA 4MS3A 3GFOA 4OMFG 2IYQA 2ODTX 4Q9HA 4YI5A 4LHYA 4G0WA 1YMVA 1B8UA 2F64A 4Q3AA 3FBTA 1CUEA 5A1TA 3Q7TA 3ND8A 2QAGA 4IDEA 4LTDA 5CTAA 4NZMA 1YZUA 3QVUA 2HA4A 2QSYA 4D9BA 1QGOA 3FSJX 3I6BA 2X6RA 2A0UA 3CWZA 4UE6A 4H60A 4IDGA 1BO6A 3LH5A 4EY4A 4N12A 1USKA 1EUYA 4MVJP 1X19A 3R0IA 3EASA 4PX9A 3ONDA 3C3XA 4WH0A 2X23A 7AT1A 5EMLA 3U3DA 5B12A 1NE7A 3H2YA 2IBMA 3HJTA 1Z0UA 2HF7A 3G1WA 2GZ3A 3MRTA 1Y8RA 3MB5A 4LVUA 1OXBB 4MV6A 1W4CA 6ABPA 3Q8KA 1E1NA 1KPHA 1FTSA 2A7XA 2VR1A 1E1MA 2OT3B 3NP9A 3UHJA 1N92A 2AR9A 2DTEA 2E18A 2ZS9A 3VR2A 3AONB 3K32A 3WDLA 4BVBA 4C1BA 3IIIA 2ROQA 5AM3A 2KS6A 4CUKA 2B7LA 1JMVA 4NICA 3SJCA 2Z6AA 5DEIA 1JU3A 1GEEA 1LPAB 3PDIA 1RRMA 3DDSA 3FAZA 4L9SA 4WA7A 1SNYA 3NYIA 1KYZA 4J1QA 4N5HX 3D3EA 5IKXA 1QQTA 2GJ4A 2QTZA 4BASA 2WZDA 3GQVA 4G1UC 4LWPA 1YE5A 2HXYA 2Y0DA 2NADA 1P33A 2B4TO 2EL9A 1UJ6A 2H51A 3N8IA 3HKEA 3OPMA 4WXRA 4R9VA 2W4MA 3DNFA 4XGIA 4IIHA 1EI9A 4LMAA 2YXBA 3S28A 3VZBA 4EPWA 1PVDA 1V11B 4NE7A 1XRJA 1N34B 2BGGA 1ZESA 1CIJA 3ZU2A 4FWTA 1VIMA 4DC9A 5B37A 5LYJF 3ILXA 1UKAA 2GBPA 4M21A 4NNJA 4AKEA 4LHZA 4WIAA 4DLZA 4EVSA 2RGGA 4R6XA 5A4DA 5I8PA 3WZMA 1W36C 3V42A 4W1SA 2C9MA 5FOVA 1KOLA 3SBXA 4EHJA 2TMYA 4TTQA 4AJOA 1U6IA 4EFKA 4EECA 3L0YA 4FUQA 2W6NA 4RANA 2Q8NA 4O3MA 1G98A 2RHHA 3L46A 2QW0X 4A4DA 3TW8B 2XDAA 5IEJA 4BNUA 1OX4A 3Q0IA 4GLFA 2VDLB 1OPRA 2A4KA 3PLRA 3MS2A 2ECQA 4QBHA 3A05A 2IPOA 4P5DA 3S68A 4URZR 3GP8A 5DYYA 4C88A 2P2DA 2XZTA 5BV1A 4DV4B 1V6SA 2QP4A 2Q45A 2PWAA 3MGBA 2X14A 1O87A 3NC0C 5AUPB 3CPSA 3H3FA 1FRZA 2DH5A 3C3JA 4QGFA 1TGYA 3G5UA 3LUCA 1V71A 4NPAA 3H8VA 4TXLA 4EFMA 3BZWA 3UPUA 1B3BA 2BI4A 4B8ZA 5KYXB 1U0LA 2H7XA 5LOVA 4NKRA 1J8YF 1KOJA 1TEHA 3ECAA 3ZCQA 4C7XA 3OZVA 3DL7A 1T9DA 3TTWA 2X41A 1AZWA 1H05A 1IFXA 2BTQA 2PV0A 3FDIA 3OX1A 4JCOA 4Q7LA 3HU2A 2PSEA 4V2UA 1AQUA 1DFGA 4WACA 2FLVA 3R9IA 1Q14A 1QQ7A 2GYVA 4KVFA 5L3RA 1YD7A 2PA3A 1DPGA 2W4QA 1CUJA 2KJQA 3A10A 2IDKA 4GT1A 2C5BA 2OUIA 3PF8A 4G1FA 4PZCA 2FV8A 2J0UA 4P4GA 2NVBA 3GMTA 4EG6A 3IR5A 3QZUA 3IQZA 2OECA 3LE8A 4N7BA 4O1MA 4MEAA 2WHRA 1ZRHA 4Q4JA 4I5IA 1SEVA 4G5FA 2VO1A 1NVEA 2AUMA 3ZJUA 1H6AA 4LVNA 5B30A 2MINA 4GMKA 5EXPA 1XWFA 4FNOA 5CVJA 1WB4A 5TF4A 4UEJA 3AV0B 3UWKA 2QN3A 2XMDA 4H1UA 1TPZA 1E2UA 2N0SA 1Z16A 2OFXA 2FWPA 2VRCD 3VC2A 3RSZA 3KQQA 4HAIA 1UFOA 2XZPA 4BVFA 3W5CA 3JQFA 3LT0A 4OB8A 1JNYA 4U9HS 4HB0A 2WMNB 1E7QA 4OQXA 1DXQA 2RI6A 4EK9A 3OZSA 1FNBA 3RS9A 1G2QA 3HYSA 3LCCA 4A0FA 5JV5A 1SC9A 2BONA 2JFQA 3VKVA 2ZZNA 3TIGA 4OXRA 3VZDA 4WEQA 3L7LA 3DVQX 3MAAC 5TY0A 5BNWA 1X38A 3ODGA 4HEA6 2AVDA 4EITA 3QA9A 2VUIB 4XARA 4I3HA 1MPTA 2X3UA 1NVDA 3F5DA 4TWBA 4IP0A 3EIFA 4NU0A 5FV4A 1J8FA 1J09A 1AS3A 3NTQA 4BO8A 1LPNA 2OV6A 3BH6A 3QTTA 3E7WA 5TT1A 1TQ6A 5AKZA 1ZR2A 3CRMA 3D4LA 3K1AA 1XTQA 1R0BA 2C2XA 1LLUA 5TQVA 1DKPA 1Y98A 1ZDMA 3PUVA 5CA0B 1XBTA 2J07A 2MYTA 4ZJUA 4MQFA 1KYTA 1MX5A 1Q1AA 2C9OA 1YRLA 5BNZA 4BNXA 3FFTA 3K16A 1LDGA 2YRWA 2OQIA 3L8MA 4LNUB 4B3GA 4Y1RA 4BV8A 1RAEA 1F48A 3O1LA 1K66A 1QTIA 1U4SA 5F78A 1LDBA 1QBGA 3GROA 1QYXA 4MVCA 2Y2VA 4TT3D 2P3LA 3X2EA 1F7VA 3K0FB 1L7XA 5BUZA 1VL5A 1E3QA 3L84A 3ROEA 3ZE0B 4DRXA 1QFYA 4DYVA 3KOOA 1S01A 2P41A 2PXCA 2Z0MA 5BSUA 3HCRA 1A9PA 1H42A 4IF4A 5E7IA 3SGLA 1KIFA 1FFYA 5HE8A 2CNNA 3DE5X 3ZXXA 1F2VA 1Z74A 2ZJ0A 3ORHA 1DJQA 4Y6SA 4ACAA 4A2QA 1FUUA 1XMJA 2WNIA 3QBEA 3QF4B 4CMCA 1CDDA 3CZRA 1NI3A 4BQOA 4F1WA 3V6MA 3QW4B 2DT8A 2PSHA 3RH0A 2ZTMA 3LQ4A 2OCIA 1O94D 4OB7A 5DNUA 5IRCD 3QLTA 4MPPA 4QFMA 3KKKA 1CRLA 2XXJA 3SKXA 4BB9A 4UDXX 4L3WA 4ZMBA 4D25A 3G2LA 5IJWA 4E6PA 5HRCA 1VPDA 3M49A 4QM6A 4R54A 4E31A 1K5PA 3A6EA 2VFAA 2ZB8A 3UOWA 5B36A 8ABPA 5IDQA 1FS5A 3K6KA 4I66A 4L74A 5HBGA 3KYCA 1GXSA 3DV9A 4W5RA 2WTAA 4TN1A 3BMOB 1NMQA 3HM9A 2ORYA 1XCBA 1QMPA 3FR8A 4JLAA 1F9EA 1ETUA 1NM5C 3OE1A 3VUFA 1FXWA 3Q12A 2BF4A 2JIQA 3MW8A 3UTDA 3LCVB 3OF5A 2J33A 3ITNA 2I03A 3ITKA 3GRUA 4HQNA 5G53C 3KZMA 3SEAA 4LE2A 4HXEB 4PLCA 3LO8A 2ISSD 1NKTA 4L5IA 3SYLA 3Q3VA 3I04M 4A91A 4UDNA 1DCKA 3UBMA 1DX9A 1ULUA 1ZI9A 2WIFA 5FBRB 1O6CA 4OGGA 1V16B 1BWPA 3ZHBA 1CZKA 5BVHA 2GYYA 2Z1DA 3IRUA 4ZHSA 3RGWS 3N7UA 4C29A 1IYZA 3Q3JB 2WHXA 5IWAB 4RJJA 2ZUWA 1OYYA 4RZSA 1ZA2A 2IW1A 3FOBA 3H5NA 2P1RA 4AB1A 2IPMA 2DBVO 1TF7A 1Y5LA 2E49A 4J0KA 2OZPA 4NYMQ 4ZKDA 2C84A 1GLGA 2EJVA 3GIWA 4RKFA 1KQNA 3V8NA 4BQPA 3I9KA 3OICA 4JL6A 5EHQA 4B84A 4BC1A 4MV4A 1ZJZA 1XTBA 2GZ1A 1AQIA 1VHTA 4ARUA 1ZCAA 3PUXA 4M86A 1GKKA 4KSYA 1PNQA 2GHQA 1DVRA 1RQ2A 3H2BA 3LHSA 4O2AB 1BZYA 1NR1A 2JIZD 5C7OO 4CNQA 3GCZA 5K51A 1XZQA 3OZCA 4Q24A 3HUTA 3R40A 4DLXA 5FOUA 3PS9A 2AQIA 3SYTA 4JJIA 3ORYA 1VFPA 2OHIA 4C6RA 1C14A 4G1EB 4W99A 1GGKA 4XI9A 2XUGA 2YNMD 4F92B 1CLEA 1SKUA 1W59A 3ROFA 2FW1A 4KBFA 5KNCD 3RS7A 1SBHA 2YWCA 4RVOA 2MDTA 1RWXA 3RKRA 2FLWA 3PNKA 4LXGA 4YMLA 1NBOA 2Q5JA 4OGLA 1N4DA 2A92A 5LQAA 3I64A 3BE4A 3SE0A 1JFRA 3AUUA 3IPRA 2VHJA 3QVJA 2JEZA 1A27A 1ZD8A 1XL0A 2XZDA 3NVDA 3I2GA 4X60A 1CNFA 4PEVA 4CJXA 3MBIA 3AVQA 1I10A 4MAFA 4H3SA 5DK4A 5B3AA 1WL8A 4FBMA 4ZAFA 5H0IA 3NDIA 1SZJG 4L6AA 5CA0A 4M1WA 3OWOA 4ESVA 3G9QA 4BGVA 1U8UA 2I1VB 4FMCB 2RDMA 4IYRA 2N1BA 3PKIA 4ZYXA 2IY9A 3PGLA 2D1SA 2NIPA 1VL2A 2FDXA 4D57A 3DFUA 2FKNA 4LNUA 4PLPA 5AKYA 1GADO 3W5DA 5AR1A 3QPVA 5KJEA 2YYZA 1NRWA 5ILQA 1IUKA 2AZDA 1IUPA 2X4DA 4FFMA 2BFBB 3QEMA 4EEXA 2X4IA 2AYXA 2EBWA 3K0FA 4IJWA 3BFVA 4PRYA 4QQRA 3RVJA 3JAMA 1Q1ZA 3HG7A 1CF4A 3C2QA 5MFPA 5EIXA 3WLLA 3U7FB 2JLYA 1L5SA 1RKXA 3LP5A 2BE9A 2C2HA 2YOGA 3ES9A 4I46A 1R3DA 1CD5A 1M2JA 4WBNA 5B1IA 3HO1A 1OVMA 5DHAA 5EE0A 2HCJB 2IYSA 3VGPA 2VQEB 4WFQA 2ADFA 2XB9A 5EY5B 3I52A 4O0LA 2CL5A 2QUIA 3IAS1 4QECA 1ZNQO 4EDFA 4BO2A 1LDEA 1KFKB 3G23A 4R1TA 3U17A 4JVNA 4MKGA 1X39A 2DCMA 1HGXA 2AX3A 5F1OA 2J31A 3SE7A 4ID3A 4U63A 4TT8A 1RXIA 3EZ7A 4KGDA 4PE5B 1ECBA 1I51A 5IT9A 1YDFA 2WD8A 3ZS8A 1KEVA 2FB9A 1GAJA 5FNVF 2ONKA 5HZHA 1UOEA 2BUCA 3BMOA 1MCZA 2VC2B 5D8DA 5ALKA 1C8BA 1KYQA 5JSZA 1U1IA 5LWHA 2ST1A 4G23A 1QH8B 2O7QA 2QUJA 3KAKA 3ON5A 4Y9SA 1T26A 3ONFA 4HF7A 3FDZA 4L72A 2RHWA 4MUEA 1MLDA 3TI7A 2XTJA 2M32A 1TW3A 3NM4A 1UP4A 4KTTE 3TKLA 3IVMA 1DRVA 3OTGA 2WG2A 4JBNA 3VV2A 4F72A 3K05A 1Z0IA 1RCTE 3ODPA 1V16A 5TJ9A 1S4QA 4W5HA 5J2TB 3AF1A 2C59A 3NH6A 3W2EA 3NFYA 4FB5A 2Q8PA 4QG3A 3KT3A 3UV7A 2WSBA 1PYDA 1Q20A 1R18A 3LIPA 2K7ZA 3P9PA 1A82A 4WN9B 2WT4A 2J3LA 1R15A 3IT1A 4KAAA 2IT1A 4O4HB 3GMSA 4IJVA 3SVZA 1CS0B 3ZE2B 2ZUVA 1ESMA 2V4ZA 4LOIA 1KMHA 3Q9LA 1W19A 3TB4A 4F3KA 2FUKA 1VGVA 1ZM3A 4FCWA 3UA4A 3U7QB 2VPZA 4HZUA 4GWKA 3UN1A 1BSVA 1NXSA 3NIWA 4DNOA 1CZUA 2GBLA 3GJYA 2WJYA 5F2OA 4AJ9A 4BX9A 4ENWA 1QX3A 2RIPA 1GNLA 3DKRA 2YWEA 4ILEA 3E35A 3HM2A 4L6IA 2V5UA 5D5HA 4O2AA 1TECE 3RASA 3ZCTA 3D3JA 2YVLA 1D4ZA 1AKMA 2PL1A 3N9IA 1YA4A 3PXAA 4KC0A 2X8LA 5AW7A 3DTVB 3OE4A 1SXPA 3UWOA 4QGBA 5F76A 1B43A 1THTA 2CCKA 2A1IA 4MNTA 4QJIA 4RTRA 1FUIA 1L3IA 5CXSA 5FCDA 1PW7A 4XM0A 4Y3UA 3T9EA 4ACBA 3QELB 5DSZA 1YFZA 4RE6A 4ZN6A 3T3OA 3AU8A 3L6UA 4ZAZA 1M1NB 4M9QA 4AY2A 1XA4A 2Z30A 1QHSA 3M83A 4IJMA 1YHYA 2GNAA 3HZOA 4U7WA 5JS8A 4C4PA 2IPLA 1AX9A 1CBUA 2GQ0A 2RIRA 4ZO9A 2ZLBA 2Q6IA 5LA6B 1A7JA 2QUAA 4CIVA 4UBJA 3ROPA 2H8GA 2M6RA 3LKZA 1BVUA 1IB6A 1GPDG 4FX2A 4OY3A 4PCUA 3IIKA 2Z8XA 3HR4A 2PLRA 4ZEWA 3DFZA 5JD6A 2R3SA 2OHGA 3LYHA 3DBIA 3ENZA 4JKOA 1Q1NA 4JUFA 1B0AA 3OKFA 5K6AC 2QQFA 3TNLA 3R9XB 1WZCA 5CDTA 4EARA 3RSLA 1IVSA 3KL2A 2WSYB 5DI3B 3ZV5A 3BCHA 5GPBA 4P4UA 1CY7A 3UXYA 2HLPA 1WVMA 3G8BA 2AZTA 2QNRA 4DUGA 1DC4A 3G7NA 5JPDA 1AGPA 4QFBA 2F1KA 2R6AA 3DFMA 3KEFA 1YKSA 3LVBA 1M74A 2A14A 3CRVA 2A57A 5AM2A 3VHQA 2GZHA 1FL9A 4JOCA 3T9AA 2B8TA 2NZUG 4K9OA 2E87A 3JWHA 1OV6A 3WKBA 5HIIA 3L18A 1N25A 2ZAYA 2BFBA 2D0OB 4FFOA 1U2ZA 4AT1A 4CMJA 2OHVA 1GZ7A 3RQSA 5EP3A 4DA9A 3R4VA 5ANRB 4L8LA 1O3YA 4LXQA 5CEEA 3UANA 1BRTA 4RU1A 4W1PA 4XVQA 2HADA 3JPYA 1TK2A 2I55A 3AJDA 2WK1A 1HMPA 3BMNB 3DDNA 3CNHA 4I5DA 1F8XA 4B75A 3WRVA 1FRNA 4FEAA 1F6DA 1GZ3A 1DJLA 2IY8A 4B6SA 1YS9A 1GQRA 1FDWA 1O97D 4DV0B 4A8TA 4ILKA 2X4GA 4DWOA 1ZK2A 1Q83A 4GMDA 5AW6A 3N1UA 5DTJA 1FQJA 1SUPA 2YHIA 4YRFA 4JQZA 1FJ2A 1H5QA 2EYQA 1B16A 1WNFA 2L0XA 3L7AA 3YASA 4K1XA 4JLJA 3IP8A 1AUOA 2GJAA 4XLTA 2AG0A 3KR1A 1UQTA 2HT1A 3DZKA 5DGIA 1J7JA 2CN1A 4L95C 5DTQA 3GVIA 5HJ7A 2XYVA 5A4AA 1C9KA 3ROQA 4Z4GA 3MRVA 5C4GB 3F7MA 1FP4B 4W7IA 4RXTA 5BYKA 1X1CA 3M2TA 5FUWA 1QH8A 4EW6A 3OC6A 2DX7A 1G20B 2JJ2A 4Z9FA 4YLYA 1TT5B 5ICCA 4PIMA 1T9GR 3BGOS 4X0EA 4YJGA 4N54A 2C5FA 4ZOLA 2IKSA 2IOHA 4HPXB 1L4EA 1CFJA 1A97A 1W76A 1RKBA 5CYGA 1CUUA 2NU6B 3VNRA 2W2LA 1XUOA 3GGJA 4W5WA 1YI0A 3NBXX 2Q4BA 2YDYA 3ED1A 4ZWNA 1GG5A 5J2TA 3BH7A 1Z6YA 3ZD9A 3ZZ0A 3F3MA 5BWLA 1QHHA 3NCHA 3OP1A 4DJ5X 2NQTA 1XFDA 2PTGA 2QMHA 2Q99A 4GPBA 2XYGA 3CM0A 4RTNA 1AM4D 4MEBA 1UKBA 4QOHA 4WN9A 3JQAB 3EVTA 4H27A 1SU8A 2RGEA 3WMEA 2HKIA 1AQNA 1G8JA 3HO6A 1SUSA 3WL8A 5EZ6B 1P7YA 2GKGA 4B2YA 3AUSA 3U7QA 1E6LA 2CXSA 3OETA 4ZCRA 4NS1A 4BGDA 3OTQA 1U8YA 1T3TA 1AKWA 2JRCA 4GOKA 4GKKB 3W1VA 3X1ZA 3C24A 2HGSA 2L82A 3OE5A 1XZEA 3GDFA 3DUFA 4RABA 1SQ0A 3RT9A 2AC7A 4DR2B 1U2GC 2VOEA 4NJMB 5DDIP 1ZPDA 5F7JA 1ADYA 1C9JA 1GG8A 2O1XA 3QITA 1EE1A 3CH5A 3K92A 3U4CA 3ZYZA 2ZIAA 5LNK6 1W48A 1DAIA 3UAZA 2JDID 1KI6B 2H1VA 2X2FA 3ETNA 4A0QA 4A73A 1B1CA 3H87A 4II2A 2XQGA 3GN1A 1KI3A 4J4HA 2IDJA 2OAGA 3AUXA 3QELA 2W83A 4ZCTA 5I4CA 2B8WA 4EFDA 5D00A 3CV3A 4FQ5A 3FCEA 1JQBA 1T9GS 4A15A 4FFLA 4KBGA 1ZJ5A 4O0MA 1JEEA 1EJBA 3Q7SA 4PPFA 5DM1A 5DWDA 1OTYA 2IEYA 2DWQA 3ET4A 4Q9AA 2BR4A 4ZDJA 2Q1UA 2BFDB 2WJHA 3K70D 2FSSA 5CW2A 2JIPA 2PFSA 2FQ1A 4NCJA 3ZDDA 3IQGX 3INGA 3HRHA 4D42A 4EY5A 1SULA 3CX6A 3TZQA 1E5VA 5LQCA 5J1SB 1UZNA 4UHEA 2ZR8A 3PLNA 2OO3A 2PR2A 2EL7A 3H97A 3HP7A 4OGWA 5J5AA 1QCZA 1RVV1 2EU8A 2XNJA 2FSFA 4I6JA 2ZB7A 4JC5A 5FUXA 4J7AA 5SY6A 1JG1A 1KNXA 1Z83A 3JALA 1QU2A 1TJ4A 4MKIA 5DLEA 3QVOA 2R9VA 5FBWB 4CCWA 4MGYR 2PUEA 1WABA 4I1SA 4OA5A 4OQZA 1D4AA 3X44A 2R6ZA 1IJBA 2GHRA 2SCUB 3LUFA 6REQA 1H2AS 1EGVB 3P9YA 5GOZA 1KP3A 4ERXA 2VUSA 4F5DA 1QC5B 3ND6A 4YRMA 4OHKA 3OZDA 3ASVA 3AUYA 2GA8A 3DJYA 4E4RA 3C7KA 3PPIA 2H4XA 3W90A 2YVKA 5CVVA 4YJ3B 3NW9A 3ESBA 1B0ZA 3RS4A 3EW7A 1WMSA 2NZ8A 2XWBF 3B36A 3BMNA 3VISA 5B4TA 2DHDA 5T7BA 3NVMB 2D8MA 1C3OB 1NXTA 3O84A 3QLUC 3EGIA 3HYCA 5D1HA 1A5ZA 4D8WA 3QBDA 3OUTA 1O95C 4CKXA 4WNAB 4RACA 3N3AC 3EZFA 4RPJA 3BFKA 4RHYA 3A1EA 4GG1A 5CLIA 3V3KA 4B40A 1LTQA 4CMIB 3Q5EA 4G24A 1RC0A 4NBWA 3JV7A 1K08A 3DDWA 4IHJF 1L4HA 3BWXA 4MPDA 4GZMA 2QRJA 3C15C 1ULHA 4HFNA 4OREX 2QX4A 3ML1A 3NEPX 4GOXA 4MCJA 2NO5A 4Z0HO 2VAVA 5H3CA 3KQUA 5CR9A 2H31A 2RH4A 4TMWA 3VYVA 2A9RA 1G5TA 2SNIE 5A4JA 3NTLA 3V8PA 3T5TA 16PKA 2A0YA 4CV2A 2AOUB 2ZBQA 3F96A 1D04A 1XK7A 3DT9A 4DMRA 2C3OA 4R9RA 2PH5A 3C6YA 2O2GA 1NLUA 2O3QA 5DPMA 1MO2A