2B83A

A single amino acid substitution in the clostridium beijerinckii alcohol dehydrogenase is critical for thermostabilization
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFPQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single proline substitution is critical for the thermostabilization of Clostridium beijerinckii alcohol dehydrogenase.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
molecule keywords NADP-dependent alcohol dehydrogenase
total genus 122
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2b83A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2b83A01
1B8UA 4DPLA 4IGFA 4WLNA 4ND4A 3D64A 1I33A 5JPIA 1NPDA 4YB8A 4DBVO 1TVEA 2QRKA 5AOVA 1I2ZA 3EZYA 1SOWA 4AJ4A 3A14A 4CMHA 1CJCA 2NADA 4ALLA 5K6AC 2C54A 3IS3A 1YQDA 4LVCA 2Y1OA 4A03A 2AA3A 3W4JA 1C1XA 1MLDA 1XEAA 2UYYA 2WYUA 4YAJA 2WWRA 1SB9A 3Q2KA 3GG2A 4PG4A 4W99A 3OIGA 3JQ9A 3PZBA 1DC6A 3JYOA 4FR5A 3G17A 4A2CA 4BV9A 2Q2QA 4DC0A 4GAEA 1PQPA 3VDRA 3GAZA 2NVWA 4CQMA 3OA0A 4L73A 3W6ZA 2RAFA 4YJFA 1DFIA 1OZAA 1YQXA 4U6SA 1H6CA 3RUDA 2FHSA 2VNAA 2I6TA 1P1RA 1SCUA 4IS2A 3UXYA 2BFPA 3PJEA 4O0LA 1R4MB 4YA6A 4YPOA 3D4PA 4J9VA 5B12A 1Q0HA 4OIMA 3PQFA 3M1AA 2QZZA 2BGLA 5THKA 1FDVA 3ON5A 5JLAA 4P4NA 1MUUA 4YYZA 1GV1A 2C2YA 4PGFA 4FOSA 1VC2A 3Q0EA 4K1LA 3WQQA 1U3UA 2C7VA 3S1LA 1WPQA 1ZCJA 1ZSNA 4FCCA 5EINA 3RIHA 3HZZA 4RZHA 3BMOA 3GGGA 2Q99A 4JROA 4YJHA 2CUKA 5CHEA 1RJWA 1I8TA 4IDAA 2J3JA 1GL3A 1T2EA 4MP3A 1NFQA 1R4NB 4GWKA 4MO2A 4CM9A 5IDYA 1BW9A 1WDLA 4CM8A 3M2TA 4O63O 2D5CA 1PGOA 2VZ8A 4NR0A 3PQDA 1F0YA 3D0OA 3CZMA 3MJEA 3RUCA 3FI9A 1Z82A 2IEBA 1YJ8A 1A7AA 4RO0A 3G1TA 3NDJA 4Q3EA 3Q3CA 1YB4A 5A9SB 4TVBA 1HDCA 3LT1A 1E6UA 5JE8A 1O0SA 1LQTA 4DWVA 1CQJA 3VPSA 4CV3A 4H7PA 3O8QA 5CDUA 2VNSA 3GLQA 5HBRA 5A03A 4E21A 5JNLA 1GUYA 1Y9EA 2H63A 2JFHA 2P2SA 3RC1A 1LNQA 1TT5B 1ZSYA 3AI2A 2OORA 3MJ4A 3I9MA 4RPGA 3GRPA 4NK5A 2VYVA 3H3JA 3WYEA 2BI8A 3BHJA 3EZLA 1YVEI 2CDBA 3OICA 3B1JA 1MX3A 1U7HA 1LBEA 1MGOA 4HADA 3TNLA 1XU7A 1NTOA 3QSGA 2HCTA 3RUEA 3K9QO 3C1TA 3DAPA 1H0KA 5TF4A 2O3QA 4A27A 4BNTA 5BT9A 5L45A 4DMLA 2X5KO 2VRCD 1NVMB 3TDKA 2JCVA 1U7TA 3WLFA 3AM5A 1Y6JA 4RPHA 5BSEA 3CXRA 1ORRA 2FSSA 3RBXA 4E6PA 3RBZA 1J5PA 4YDRA 3EMKA 1QP8A 1V3UA 4CV0A 2GO1A 4PLHA 3VOSA 3PQEA 2PWZA 5T57A 4ZQEA 1ULSA 5AXDA 4KWHA 4RF5A 4LSMA 2EEZA 3BYZA 3JD2A 1PS0A 2F1KA 3OIDA 3DBRA 3LF1A 4W6ZA 1TXGA 3KB6A 1N1EA 1X7GA 3WSVA 2JCYA 3DZJA 3F6YA 1DLJA 1GADO 2HMTA 3JQ6A 3S8MA 2CVQA 1DO8A 4BV8A 2NTVA 3S2IA 4BMVA 2WE8A 5I9MA 2IZ1A 4OQZA 2YV2A 3EC7A 2W2LD 3U3XA 4NJMB 4NQZA 1KBZA 2X8LA 1E7SA 5BNIA 1N7HA 4JJGA 3ITKA 2VWGA 3DO5A 1EVYA 4XJSA 4O1MA 1QYXA 1XWFA 3GZNA 4BO2A 1E3WA 4IDDA 3RUFA 3H5AA 2DUWA 5BSHA 1NPTO 4AG3A 4HFRA 4GKBA 3VPFA 4BKOA 4Z0PA 5DULA 3HSKA 3HG7A 1GCUA 3DZHA 4EEXA 2WE7A 4XRGA 1RM0A 4DIFA 4WGGA 1KEVA 1MP0A 2W2KB 1NHWA 3TZCA 1Z7EA 4FJ2A 3ZWCA 3BIOA 5L9AA 5K1SA 3PTZA 7ADHA 3SXPA 4G65A 1WAMA 2I9PA 1F8FA 4TRNA 3K5PA 2V6GA 1HYHA 1Q0LA 2C59A 3H9JA 4MOWA 1GEGA 4KQXA 4FFPA 1PJ3A 1VRWA 3O38A 4Y6SA 2X58A 5CFZA 2X1HA 3E9QA 3JQBA 4Y6RA 3WIDA 2OGUA 2ZK7A 1Y8QA 3COSA 3U4IA 3OEWA 5EN4A 5JCXA 2HRZA 1PGJA 2ZYGA 5ENDA 1MXFA 1QKIA 2X0RA 4PFJA 1P33A 3VVCA 2X0IA 3WGHA 3GVPA 1JLLA 4DQXA 5IG2A 2W2LA 5K6AA 1F17A 3DZKA 3RBVA 4TKLA 4R3NA 4BGIA 4C7JA 3DMTC 2EF1A 1UXIA 1VLLA 3QVOA 1X14A 5LC1A 2D59A 1T2FA 1P0FA 1KC3A 2PKQP 4UREA 1W8DA 4J43A 4E5KA 4WUVA 4GX2A 3WXBA 5T6BA 1LSOA 4XYBA 2EHDA 4ILKA 2Y0DA 1LSSA 4LMPA 2JKVA 3AOGA 2G1UA 2X9GA 1U9JA 3HDQA 2O2YA 4AVYA 5IFLA 2SCUA 3PHLA 1PJLA 4IM7A 2GLXA 4XEHA 4Q3DA 3VTZA 5G0UA 4PLPA 5BR7A 1VSUA 4AJLA 4LSWA 4MP6A 2Y0CA 3FPLA 1NBOA 4AICA 4RLHA 1BGVA 3IKVA 1U4SA 5HRUA 2VHVA 2CVOA 2UVDA 3PIIA 4MVJG 4WNIA 3DBLA 4I08A 1KEUA 5JC8A 4LVUA 2CDAA 4YRBA 1YGYA 5G2OA 1X7HA 3F47A 4BO6A 1NVTA 4PZCA 3ST7A 5DNAA 1Z74A 3D5TA 3KM0A 3WGTA 3VH2A 1HE3A 5A04A 2PD6A 2UAGA 4Z3DA 3UN1A 5FI5A 4PG6A 4WKGA 2VYNA 3UH1A 2O7SA 2H9IA 4UULA 3FTPA 2GDZA 4A26A 1JTVA 3ONFA 3ZWNA 1A4IA 3IJPA 3WMWA 1ZJZA 1I36A 1DIRA 4BO9A 2FY8A 4CV1A 3JQ7B 4BO5A 4AJEA 1I0ZA 1KETA 1DSSG 1EVZA 3DC2A 3FTNA 4BNXA 4CM9D 4IDGA 1MC4A 1FDUA 2OXIA 2OHXA 4OQYA 5KIAA 1I2CA 3E82A 2BGMA 3ZW9A 2NTNA 3JSAA 2V6BA 2EJVA 4E5YA 1U8XX 4L76A 4CM3A 1I3MA 1BW9B 3BMCA 1SNYA 4L9RA 4CM5A 3X2EA 3E9NA 2FZEA 2RHRA 5B1YA 5L4NA 2CMDA 4XR9A 4CMBA 1LLQA 2ZTUA 1O6ZA 3VZPA 1Y8RB 3PWSA 3ENNA 3D3EA 4CQMD 2IYOA 1B26A 1DC4A 5B4VA 1Z7BA 3DONA 3HB5X 4PLVA 4YQZA 3OJ0A 1N5DA 3PLRA 1B3RA 3V1YA 4CQLB 1HRDA 1VJ1A 4ALMA 4CMIA 1D4FA 3JD0A 3GNSA 1ISMA 1PR3A 1U4OA 3LF2A 3F1KA 5CDGA 3TJRA 3HDYA 4G81A 3SJUA 4ALJA 1GR0A 1P1KA 3OM9A 3TZQA 4PLYA 2GRAA 3TN7A 2Y1FA 3NGXA 2ZCVA 3BMQB 2I3GA 2AEMA 1DAOA 2VRCA 1P1HA 5A9RA 1U3WA 2RIRA 4M8SA 3KVOA 2Y99A 3ZWVA 2QYTA 5U9CA 3G49A 4KTVE 1DC3A 3GFGA 4EUFA 3CE6A 5KKAA 1EBUA 2IYPA 1PGNA 3ZGYA 1DPGA 2GYYA 3UW3A 4BKQA 2NM0A 2P5YA 3D1LA 1WDMA 3RU7A 4CLHA 3S2EA 5CEJA 3DBHB 2GN9A 4RVGA 3JQEA 1AHIA 3A28A 5LDHA 3UVEA 5ILGA 3QV1A 2AG5A 2GASA 4MIOA 5I8ZA 4E5PA 4W7HA 4FW8A 3BTVA 3NDIA 1ZK1A 2OP1A 1R66A 5ER9A 2Q1WA 1LEHA 5JYEA 5TT1A 3TZHA 3JYLA 4R5MA 1DRWA 1E5QA 3ICPA 4TQGA 3D3WB 3ZZNA 3HDHA 4BO4A 3I9JA 2ZYDA 3LYLA 4XGNA 4O5OA 2W98A 1M66A 2XF8A 2C82A 2YY7A 1AGNA 2C07A 5TRTA 3U0BA 4DTIA 1R15A 4XB1A 5DP1A 3GMDA 1UDCA 4KUHA 3OBBA 1LJ8A 1DXYA 1HEUA 2BFOA 4XX0A 4YAGA 1IYZA 1ZMTA 3HFGA 4XGIA 1HYGA 5EIOA 2QYSA 5EMHA 4MKXA 1UXHA 3KHUA 1HYEA 1I2BA 4ZICA 4IQ8A 3FNFA 4X54A 3R6DA 2XOXA 1ENPA 4J7XA 3I4FA 1E1NA 2EKQA 4MJLA 5EESA 4D3FA 4XIJA 3U4DA 4KP7A 2NQ8A 1ADBA 4ZGWA 3WTCA 4NMHA 3P19A 2NU7A 3DHEA 3OJOA 4JP2A 4MIYA 2OMEA 1A72A 4AJHA 4DYDA 2E4AA 5EL0A 3KO8A 1ULUA 2GERA 1OFGA 1WW8A 4GVLA 3RSHA 1CYDA 3OH8A 1E6WA 2H5LA 2QIOA 1H9AA 4OM8A 4XD2A 4B3JA 1QXSA 2GD1O 2B5VA 3QRWA 4MIEA 3WNQA 4RGBA 2J8ZA 3ZN2A 4R3WA 4S3MA 3IL2A 1VE9A 3E8XA 5G0SA 2A9FA 3ANNA 3S2FA 5A06A 4NU5A 3H9EO 3ZWWA 4HKTA 4EI2A 3WGIA 4CL8A 2AMFA 5TJHA 1AE1A 1YOVA 2NQTA 5JS6A 3KXDA 5HA5A 3VPXA 2VUSA 2Y1EA 4J49A 3HDJA 2OL4A 2D0IA 1QG6A 3JV7A 5DCUA 2ZTVA 1LC3A 1H6AA 1YBMA 2VHWA 2VUTA 5CEFA 1MXHA 2W4QA 3WFJA 3H9QA 5GY7A 3TSCA 3TL2A 3UCFA 2PZJA 3OQ6A 3U49A 4L4SA 3JD1A 1ISJA 4RV9A 4IPTA 4PG5A 5F3RA 3ANLA 3K8ZA 4J1NA 5L40A 4ZJUA 5G4LA 4WCFC 2O3RA 3ONEA 1N9GA 4IUYA 4GSLA 5IDQA 1HZJA 1T2CA 4YRAA 3RWBA 1R4NA 3BTOA 1SEVA 3MEQA 4L0QA 1P0CA 4B7UA 2F00A 3GPIA 1D3AA 2YZ7A 4LGVA 4NHEA 4AJKA 4S1VA 4M86A 2PKQO 4PLWA 2ZYAA 1IPFA 1N92A 2RH4A 1NR7A 1T25A 1LX6A 3RFXA 4PG8A 5DN9A 3I6QA 3SC6A 1R0LA 4DIOA 2I76A 3F9IA 4CMIB 4CMCA 3N74A 4Q9NA 3RKUA 2X9NA 2P4QA 3DMTA 3F5SA 1KERA 3BA1A 1UP4A 3L4SO 3T7EA 4E31A 1HT0A 3IDSA 1BMDA 4FN4A 2A94A 4FJ1A 4DGSA 4Z9FA 1DHTA 4R9RA 3NTOA 1K6XA 2G0TA 3V1TC 1PJCA 4FC7A 2FR1A 1E1MA 3ETGA 3WJ7A 3B1FA 4EITA 5KWEA 4BNUA 2J3KA 3K2EA 1Z75A 2FR0A 3H3FA 4RZIA 4ZQGA 1PS8A 3HWRA 2P68A 2OOSA 1OC2A 4YR9A 4EJ0A 1B0AA 4J91A 4CUKA 3AUUA 1JDJA 3GHHA 3DB2A 5TSDA 1I30A 4NBWA 1JN0A 4DUPA 5C37A 4NG5A 3VVBA 1QMGA 3GK3A 2OUIA 3JQBC 2Y0EA 3LC2O 1MC5A 3FCOA 2IE0A 3NTQA 3UOGA 3WS7A 5I8WA 4NJMA 2O23A 1QORA 4E2XA 2FMUA 1X7DA 3UICA 1U5CA 1UAYA 1I3NA 1EQUA 1HKUA 1M75A 5KVVA 3QQPA 1X13A 2NVBA 4TVOA 3ETEA 4NFSA 3WQRA 4BNIA 4CM7A 1ENOA 1K6IA 3RC2A 2JHFA 2DBVO 3KV3O 5JAZA 1CIVA 1GUFA 2FP4A 2EWMA 1B8VA 2Y93A 1IOLA 4HNHA 1R12A 2QZ9A 5IF3A 4YT4A 4GQAA 4FC6A 3KZVA 3C1OA 1O94A 2WJPA 1CQIA 2EW8A 3M6IA 1FMCA 1U2GA 1E1LA 3G3EA 3PPIA 1A9YA 1C14A 2IRWA 1JU9A 4MKZA 3AU8A 3IC5A 1FJHA 3QHAA 1EUDA 3K92A 4HFMA 4KOAA 3OF2A 4BNWA 3AOEC 3WMXA 3MJCA 1ZNQO 3GY0A 2HAEA 4XIYA 1ADFA 1BRMA 3H5RA 3T4XA 3H9GA 1LDNA 4PVDA 3IUPA 2NU6A 4XRRA 3BHIA 4WECA 2AE1A 4F6CA 5GZ1A 3GDOA 3OQBA 3L6DA 2Y1DA 4TZTA 3QP9A 1BXZA 3GGOA 2V6MA 1E7QA 3O9ZA 1LQUA 3FR8A 3LT0A 3AWDA 4MINA 4Y67A 3ZNPA 1UP7A 1ENYA 1BDMA 2R00C 3VHRA 1G0NA 3Q2IA 3CH6A 3P7MA 1CETA 2NVUA 3KYDA 2X86A 2D5AA 4I5EA 3JQGB 5A5FA 3IKTA 5JXWA 2EGHA 2ZATA 1NQOA 5L51A 3DWFA 3W4IA 3EYWA 3DEYX 3DXFA 4TROA 2CY0A 3KYCB 1P1IA 4JXKA 4CMKA 4E2YA 3P2YA 4Z0HO 4GLOA 2B4QA 3A4VA 4MVJA 2QRJA 1ZBQA 1KVUA 1DOHA 3FD8A 3VPGA 1DJQA 1ZFNA 2G17A 1JVSA 4NJOA 2X0NA 3ZNQA 3JTMA 4XKJA 1YQGA 3IP1A 4UVIA 2WTBA 1SC6A 3PXXA 2I99A 1GPJA 4Q39A 5JAMA 4P4LA 1BWSA 4IINA 4O6VA 4UVHA 1Z6ZA 1VKOA 4UUOA 3PI7A 1IPEA 3FRJA 4J1SA 4YEDA 3ROPA 1ZK2A 4JP3A 3INTA 4K6CA 5LDGA 2EG9A 1NVGA 2WSBA 5FF9A 5A05A 1VL0A 5BNFA 4CLRA 5L4SA 4WLEA 3G1UA 1V0JA 4K9DA 2GNAA 4J0EA 4CM4B 2PGJA 4NNJA 1ADGA 3Q1LA 4Z9XA 3HQ4O 2EKLA 3QJ5A 1YL5A 4GI2A 2DUUA 1Y81A 5ITWA 2FWMX 3AI1A 4EUHA 1A7KA 3QLJA 4IDFA 4DMMA 4QSMA 3PJDA 5JAIA 3SLKA 4R54A 2B4TO 3AW9A 3G0OA 5TX7A 1AHHA 5TC4A 1PIWA 1TT5A 3TFOA 3C7DB 1Z45A 4WLFA 1SEPA 1Y5RA 3E18A 3QY9A 5FEUA 4CMEA 2VHYA 2NNLD 3PJGA 4OKIA 1N9GB 3GN1A 1PJBA 1PL7A 2GGSA 1U3VA 1G1AA 3TWOA 1JAYA 4WCDA 3EY4A 4OHUA 4UVDA 2X5JO 2WMDA 4W7IA 3R1IA 1CERA 1KIFA 3RKRA 1H5QA 4BNNA 1DDOA 2GN8A 1T4DA 2ZTMA 1VM6A 2HMUA 3SX2A 2E82A 5DBIA 4ZN6A 2HO5A 3GRKA 5DF1A 5FI3A 4L8VA 1C1DB 3ROQA 2ZQZA 3GAFA 1R16A 3WOHA 4Y8VA 3NJ8A 4ZU3A 1Y5MA 3PJFA 5U1PA 4DYVA 3GVXA 4F3YA 1F14A 3H2SA 1GCOA 1HDOA 4NK4A 3VH4A 1E3SA 1C0LA 3WYBA 5L95A 3CUKA 5L7YA 4XR4A 2W2KA 3MWEB 4E33A 1HL3A 1QYDA 2EERA 4WCFA 2VCYA 5JYDA 4EBFA 3RAJA 1ID1A 4RVSA 2Y1CA 3B70A 3HJAA 3WB9A 3DHYA 2NV6A 1WDKA 3AY3A 5TLSA 1NX6A 1S7CA 3DAGA 3LDHA 3VC7A 4XDYA 2PK3A 5A9TA 2B36A 4UEOA 3I83A 4B79A 4BO3A 1WMAA 2B69A 1LSUA 4RVDA 5AYVA 4RF3A 4A0SA 2PFGA 3HNPA 4OOFA 1DEHA 1H2HA 3PHHA 1D1TA 1IULA 1C0KA 3UGKA 1NAHA 1VJ0A 4NFYA 3Q9UA 1PZGA 1EK6A 1P45A 3KSDO 4WLVA 1T24A 2NU8A 4ZHSA 3RCBA 2YHIB 4GGPA 4R68A 3U9LA 4RPLA 4AJJA 2AG8A 4HBGA 4I5GA 3CINA 3UUWA 4IJUA 3VTFA 3IUSA 4AJPA 4U0KA 3BHMA 3GF4A 4YQYA 4EGFA 2B5WA 1C3VA 1NYTA 3E1KA 4D3SA 3WG9A 1HZZA 8ADHA 3IP3A 5BNTA 5COAA 1X0VA 4M54A 4DVJA 1NQTA 3DZBA 1HSOA 3GN2A 4J3FA 4R1SA 4CMEC 4JJFA 4IDBA 2PD3A 3UHAA 3FBTA 4OOEA 3WX0A 4XYMA 4JCOA 5CG1A 4YAIA 4U7WA 2AEJA 1OBFO 1V6AA 4B4VA 3RVDA 4KWIA 4CQLA 1SO8A 1P3DA 3MJVA 4E4YA 2D1YA 1N8KA 3U09A 1ZXBA 2J6IA 1K6JA 2BHLA 2Q1SA 4INAA 4OL9A 1OC4A 1A71A 5DZSA 1E77A 1JVBA 1KY4A 1K2WA 1R37A 2DTXA 2H1SA 2Z5LA 4FS3A 3H5NA 4YT5A 2QX7A 5G4KB 2WYWA 3HN7A 3SLGA 4DRYA 1ZUD1 2O50A 3HB4X 2GPTA 2W90A 4HP8A 1LRLA 1B15A 1H94A 3ZHBA 1QLHA 4BKUA 3K73O 4JBIA 1YB5A 2B37A 2X22A 2V65A 2O2SA 3B20A 3BTSA 5TGDA 3WNVA 4TRJA 3EVNA 4ZQFA 4IQGA 4CM1A 4H3VA 4FJ0A 4B4WA 1FK8A 2NU9A 3MTJA 4PLTA 5DBGA 1E5LA 4ALIA 1ZK3A 3VZRA 3W8FA 2JJYA 4JBGA 3WBFA 2PA3A 3SEFA 5JCJD 1GDHA 5IXYA 1XIVA 3JQAA 4ZVVA 4ID9A 2FSVA 2DC1A 2O3SA 2PH3A 5L7TA 3KEQA 5GZ6A 4BMNA 4H16A 1GQYA 3GPDG 3I9OA 1JWBB 1F06A 1K89A 2PZLA 4FD3A 5I9NA 1GV0A 1PZFA 4XYGA 3PYMA 1L1FA 4U8GA 1E7RA 3KUXA 1OMOA 1K0UA 4GMGA 3ZCXA 1PL8A 4IZHA 3QVWA 1RM5A 3FN4A 4YACA 3SC4A 1GZ4A 3CZRA 4E30A 4YJGA 1TEHA 1T1RA 5JW6A 1E3WB 3NRCA 1B14A 2EP5A 1BTOA 4BO0A 4PLZA 5DT9A 4PRKA 2VWPA 2CFCA 1PX0A 3JQAB 3Q11A 2GZ2A 4M87A 4MVJF 5F21A 2JD2A 1FDTA 1J49A 3JQDA 4N5LA 3GGPA 3PHIA 1A5ZA 1DLIA 3NAQA 4RL6A 1F12A 3GG9A 1H2BA 1LLCA 2WD7B 1ZMOA 2P9EA 4YXFA 3OEYA 4H15A 3LC7O 1OAAA 3VDQA 3GVIA 3I9NA 4IGEA 2VWHA 4XDZA 4MVJE 5HWSA 4Y9DA 6ADHA 1HXHA 4KDEA 5C7IO 1VSVA 2GR9A 3AFMA 5K0ZA 1R0SA 1NWCA 3DHNA 5L4LA 1XELA 5C3MA 4YAKA 3IAHA 4P8RA 5F1PA 3L6EA 4II2A 4OSPA 2VRBA 1QRRA 3T7CA 3GQVA 1LLDA 2WD7A 4PZDA 4QECA 3E5RA 3WSWA 2HKIA 4I5DA 3W8EA 4OJNA 2BELA 3WGYA 4LMRA 4W9NC 3QWFA 1EUZA 4PVCA 5BSFA 3HUDA 2X23A 8LDHA 4CM4A 4BGEA 1M2WA 2HJSA 3K30A 4N18A 3GZNB 4DC1A 1EEHA 4R1UA 5ADHA 3H9UA 4NU6A 1M76A 2DKNA 4QX6A 2I3AA 1EBFA 3ORFA 4CLDA 2ZKLA 3PLNA 3EGOA 4BHTA 2I66A 1ZJYA 3LU1A 4KUEA 3OQ1A 3WIEA 1LTHR 2WDZA 3OJEA 1DIHA 3FNEA 1UJMA 2BFAA 4XA8A 1B2LA 2DT5A 3H2ZA 4CMAA 4URFA 4CLRB 3QWHA 4J6FA 2W8ZA 3ROMA 2R2GA 4CR7A 4I1IA 1XYGA 2ZIZA 2E6UX 1GZ6A 5ES3A 4B3IA 5F1OA 5H82A 5IZ4A 4UUMA 1NFFA 5A1TA 1GQ2A 5IDXA 1M6HA 5COQA 4BO1A 4GX5A 2J3HA 5JCJA 1HDRA 2A92A 2HK9A 3CEAA 3PRJA 4YT2A 5ICSA 2B83A 4CUJA 2HDHA 1NQ5A 4I9NA 3OJFA 2HSDA 4KQWA 5EERA 1AN9A 3TPCA 4Y6PA 4E2ZA 5C7LO 4OKNA 2OO5A 2AQ8A 4K28A 4R41A 3V2UA 3A1NA 4BGUA 5B37A 4IQ0A 4FOOA 5H83A 3V1UA 3BMNA 1DBVO 3ADOA 3PYXA 2NVUB 3PZRA 5IZCA 5CPBA 4W4TA 2GSDA 2FPIA 2DBZA 4YJGB 5JC1A 5CAEA 4AJNA 1UUFA 1VL8A 3HN2A 5AVOA 4LRSB 4FGWA 1A9ZA 3RC7A 1NWHA 4J2HA 2PTGA 4YVFA 1Q1NA 3UCEA 2X6TA 3ZU5A 4E13A 3BZUA 1VJTA 1R6DA 1Z73A 3BAZA 1BVRA 4B7CA 1Q7BA 1VL6A 2AEFA 4EDFA 1O8CA 1MG5A 3GDGA 4DPKA 4BS9A 4DXHA 1W6UA 4Z9YA 4JGBA 4OXNA 4D3DA 2JAHA 3VKUA 1KYQA 4OH1A 1SAYA 4DLAA 1WVGA 2HU2A 3WQSB 2A35A 3PEFA 4IJKA 1PJQA 2HQ1A 4YAEA 3SVTA 1DHRA 3KTDA 3V2HA 4BNFA 2DVMA 2JFFA 1UAGA 2BH9A 2Q2VA 3AY6A 4B3HA 1BHSA 1BXGB 2OBNA 2BI7A 3RU9A 3AI3A 3JQ7A 7MDHA 4Y98A 4DQVA 1QV7A 1I3LA 4E0BA 4NFHA 1JAXA 1RM4A 2IZ0A 3D7LA 5KKCA 1WLYA 1FXSA 4FPXA 4YJHB 2E48A 1ZVMA 1E7WA 2ZJ0A 3AJRA 3NUGA 2R6JA 4JBHA 3GNQA 4K26A 4BO8A 5TQVA 2GF2A 4HUJA 4WOJA 2PKRA 3TRIA 4J90A 4WLUA 2CF6A 1CDOA 1JWAB 2HMWA 4Q3NA 1YS4A 3CKYA 4D45A 1ARZA 3ZWXA 2YHUA 4QUKA 1KEWA 2ZQYA 3HFSA 4GWGA 2HRBA 3OETA 4DIBA 1ISIA 3AM4A 1MFZA 3TF5A 3OECA 5T67A 2DQ4A 4BB5A 3C1AA 1XG5A 3ZWPA 1QLJA 2QG4A 4NI5A 4BNMA 2Q4BA 3KRTA 1YH3A 5DP2A 2HLPA 4BIIA 3F3SA 4BNYA 1GPDG 1GD1O 5IAAA 2AHRA 3EDMA 2YQ5A 3ASUA 3I9LA 3O4RA 1LLUA 4R51A 2QW8A 1O5IA 4PLFA 3NJ4A 1HE4A 1B8PA 1VKNA 2G82A 3JYQA 4I5FA 5JDCC 4IDCA 3I9KA 1H9BA 3WTBA 3GDFA 1W73A 5I7FA 2J5RA 4TMFA 2FN7A 1UXKA 4GBJA 5KJEA 3WLEA 1YDEA 1RYDA 2Y05A 4ITUA 2ZB3A 3DTYA 3DBLB 4Z3KA 4WNCA 1AXGA 2YJZA 1GY8A 3IMFA 3OP4A 3C7CB 4WCFB 3LLSA 2FPPA 3KEOA 4MPDA 2Z95A 2RBEA 4D44A 1J0XO 4PLGA 3C8MA 1KOLA 4D7AA 2JHGA 4ROSA 1U1IA 4WOKA 4DLLA 1EK5A 3RROA 4P38A 4N5NA 1UXGA 1PR9A 1M67A 2VOJA 3WJAA 3OSUA 2JCXA 4RDIA 1FDSA 1P9LA 3NYWA 3ZH2A 4GVXA 3VPHA 5CDYA 2VT3A 2PNFA 4XYEA 3ETDA 5IJZA 4FB5A 1YDWA 4MP8A 1LU9A 3QVTA 5HS4A 1P1FA 2Q49A 3GR6A 4J1QA 2DPHA 4JIGA 1N1GA 4HXYA 1OOEA 5BSGA 5BQFA 4U5QA 4M89A 5JY1A 4FFOA 4MVJP 1ISHA 2G76A 4A73A 4RVUA 4PCVA 3SJ7A 5ICMA 3W8DA 4HV4A 3JYNA 3ZU2A 3RFVA 3V2GA 4BGVA 2DPGA 3S2GA 3ZW8A 3OMLA 1N7GA 3RQSA 5HM8A 1KC1A 4AJIA 1UDBA 1IZ0A 3KETA 2UUPA 1WNTA 4AFNA 4IXTA 3WGQA 1RPNA 3A9WA 1HWYA 3TOZA 4WJZA 1ONNA 4WK6A 5I7EA 5IDWA 4TRRA 4YJDA 3TZ6A 2C20A 4PZEA 4DLBA 5TIIA 1Y8QB 1GUZA 1QSGA 3QA9A 1GFSA 4BNKA 3X2FA 1HLPA 1CRWG 2ILTA 5CP8A 1ONOA 4XCVA 3BTUA 4WE3A 3RJ9A 3T4EA 3PGXA 2DBRA 2JL1A 5AXAA 3DOCA 1D1SA 2VN8A 3WICA 5T5QA 3DZGA 3ZV6A 1J4AA 4BNZA 4D42A 1IL0A 4L75A 4L4RA 5A4DA 4EZBA 4A7PA 1ZEJA 2ZB4A 1X1EA 4G5HA 1UZNA 4MVJM 1Q7CA 2Q1UA 4J0FA 1T2DA 3GOHA 4HY3A 1YB1A 4OAQA 4YBZA 3ZWOA 4TWRA 1PTJA 1EFLA 1QYCA 1SBYA 3ULKA 2C0CA 3EVTA 1VI2A 3F1LA 4FFLA 1U8FO 4KMSA 3TL3A 4BMSA 2BGKA 4CM6A 2WYVA 3CTMA 2VZ9A 2RH8A 3I6IA 4MVJI 1XCBA 1XU9A 3JD4A 3JQ8B 3KSUA 4EYEA 1MG0A 1K3TA 1LDBA 1O9BA 2HK7A 2YW9A 3L9WA 5JO9A 4DQUA 2NSDA 1GTMA 1PL6A 2VTDA 5T64A 3KYDB 4AJOA 2CZCA 5A5EA 3LZ6A 4UUPA 1PU2A 1T1SA 5A02A 3ASVA 4FDAA 2Q2WA 4Q3AA 1B7GO 3E48A 2C29D 2O3TA 3D3WA 2NLOA 3QW2A 1DB3A 1JKIA 1RKXA 2CVZA 1Y8RA 2DAPA 3ITDA 3L77A 4UUNA 5CEEA 1XSEA 1PEDA 1C0IA 3UAGA 3U4HA 3MTGA 1U28A 2EV9A 1YXMA 3I52A 2Z1MA 2CSUA 2AQHA 3HHPA 4XQ9A 5HS6A 1F8GA 4CPDA 4KTTE 1T2AA 2GN6A 4U6QA 2BKAA 5KJFA 5IZCC 4PN3A 1V35A 1PJ4A 1E3IA 3H7AA 4WASA 1YL6A 3ABIA 1H6BA 3ICCA 5JY6A 1YWGO 1OI7A 3C7AA 4F6LA 3ZHZA 5T8KA 2VYVD 4TRMA 1E1KA 1EQ2A 1LC0A 4JNKA 4XB2A 3CMCO 2O3UA 1HDYA 4GL4A 3N7UA 4EJMA 1CF2O 3W1VA 4QO8A 1BVUA 3GMSA 3JQFA 4LW8A 1HDZA 1ISGA 2J3IA 4QXMA 5JMWA 4D43A 1LDYA 1P44A 1YONA 5DCWA 1T4BA 1EZ4A 5ILOA 2TMGA 3HE3A 3GA0A 4XQGA 2Y67A 1DC5A 3NKLA 4CL3A 1G6KA 4FBGA 3E9MA 3L07A 1WZIA 1NPYA 1A4UA 4CLOB 4D46A 5AQ1A 1LI4A 1MA0A 2BD0A 3ZDFA 2PR2A 1R0KA 2D2IA 3BMQA 3NT4A 2CD9A 2Q45A 4WEQA 1X0XA 2C5EA 3L4BA 4U0JA 1PJSA 4IJWA 1KEPA 2DM6A 3MOIA 2ZB7A 1BG6A 3R0IA 4EW6A 2IXAA 1YOVB 3BMCB 3WWZA 4R01A 4R16A 1LRKA 3OHSX 3LC1O 4GGOA 4RF2A 4IMRA 5IN5A 3KYBA 3JQAD 1QYWA 5EQFA 2E37A 2EJWA 4L4XA 3R3JA 5TJ9A 4GH5A 4O59O 3PK0A 2GZ3A 1ADCA 1JQBA 3V8BA 4CMJA 3H8VA 1TB4A 5MGBA 5DOZA 4IXWA 2AXQA 4XJTA 2WD8A 4NPCA 3P2OA 5ER6A 2O4UX 3ZWYA 4E5MA 3JD3A 3H6KA 5I9LA 4RJTA 1JKJA 1C0PA 3GC6A 4QQRA 4BKPA 2AQIA 4RCVA 3TOXA 4ZQHA 3U4CA 1NXQA 1EVJA 3F4BA 2P5UA 1D8AA 3C85A 1KVQA 3PYLA 1RM3A 2D4AA 1KVTA 3DOJA 4Z0TA 2O4CA 4RLSA 1EDZA 3VAZA 2GUGA 5ENVA 9LDBA 1KY5A 1LDMA 1LUAA 1SMKA 4ZRNA 2ZTLA 4RVFA 3LVFO 3D4NA 1EE9A 3U5TA 1E7YA 1E3EA 4IMPA 4JK3A 1KVRA 4YWJA 2O7QA 4E2WA 3ZV4A 3I23A 3EW7A 3KLMX 3JYPA 1L7EA 3GEGA 2GZ1A 4GSKA 1WWKA 2LDBA 1PS9A 4FGSA 3CPSA 1DIGA 3FWNA 2C7GA 2J5QA 2PY6A 2QRLA 4JN6B 4YT8A 4A5OA 4IZIA 4M55A 2D3TA 1WXDA 3BMNB 3PDJA 1ML3A 3INRA 1WZEA 4HFJA 1XLTA 3GUYA 4JJIA 4RDHA 2O48X 1HTBA 3DR3A 4ZA2A 3MCVA 3DFZA 2YV3A 1NAIA 3FNHA 4MDHA 1PWXA 3VH3A 3TFQA 4J7CA 5G0TA 4CR6A 3KSZO 3AM3A 4FQ8A 2PV7A 4R1NA 2NUAA 4XZ3A 3PHGA 4ND2A 3ZU3A 1Y7TA 1GEEA 1Y1PA 4UVEA 5C7OO 1YRLA 3A06A 2IEDA 3KOUA 2V6FA 5KOIA 1U2DA 3F4LA 2HMSA 4QTZA 1GAEO 2IODA 1ZIDA 2I67A 4NIMA 4WLOA 1L7DA 3CMMA 3DZIA 5KCZA 4FFRA 4XGKA 1PQUA 1ZH8A 4LISA 4QFCA 1FDWA 4CUZA 4M49A 4AJ1A 2IXBA 2HMVA 1JW9B 1I5RA 2XAAA 5A3VA 1PWZA 3ZWMA 1EE2A 4M1QA 2VZ0A 3JQ8A 3KBOA 4NH4A 4GX0A 5JAQA 4EEZA 5J23A 1MV8A 1SPXA 3PVZA 4BNLA 4EUEA 3ONDA 1E92A 3VZQA 2CF5A 1LRJA 4OMUA 3VZSA 4PG7A 1V9LA 3GHYA 3O03A 3QWBA 5DCYA 1PJ2A 4BNVA 3O26A 3W4KA 1TA4A 2VOEA 3AFNA 5T8KC 3NEPX 3WFIA 2DTDA 1Q0QA 1SOVA 3ZHXA 5B4UA 2Z1NA 5I7VA 2C2XA 1YJQA 3ZWBA 1XA0A 2DFDA 1N2SA 1UZMA 3FF4A 1DRVA 2PGLA 5IN4A 3QVSA 5JBIA 2Y1GA 1HDXA 1B16A 1UDAA 4JLWA 3IJRA 1W0CA 1IB6A 4IS3A 5TS3A 5B4TA 3M1LA 2I5PO 2EIHA 4B4UA 1ZKMA 4J1TA 1DAPA 4QT0A 3B1KA 2Y66A 3NV9A 1HETA 2XXJA 3RASA 4P22A 1LDEA 3I5MA 4RF4A 1Y9AA 1V3VA 4BKRA 5KVCA 4GKVA 3ENKA 1QV6A 2DTEA 4I9HA 1R4MA 4DBZA 2TMDA 3DAFA 1YO6A 4DPMA 4P4GA 4J4BA 3GT0A 4UEKA 4Z6KA 3E03A 2Q50A 3C3XA 4LCJA 2WM3A 1WP4A 4BNHA 3IIEA 1DIAA 2E49A 4CR8A 4OXYA 3WWYA 5HTOA 3INGA 4RVHA 1IE3A 3I4CA 3L0DA 4OXKA 4II3A 4TKMA 3RD5A 1ONPA 1PZEA 2VYND 1P77A 4F46A 1VPDA 3FHLA 4ND3A 4J2OA 3E6AA 1BXGA 3H65A 3K96A 4DA9A 2NACA 5CDTA 3OFSA 1BDBA 2B0JA 4BO7A 2VTEA 3I1JA 3OA2A 3JQFC 1E6EA 5H81A 3BMOB 3GH3A 3RUIA 5JSFA 4MVJH 3H4VA 2DLDA 4ALKA 1PSDA 3TQHA 1E3LA 4ESOA 1NHGA 3GFBA 1ZXLA 5FYDA 3AUAA 3STHA 5JFOA 5MDHA 2G5CA 1GZ3A 3MWDB 5JO0A 3GNTA 5ITVA 3PWKA 1KS9A 4J7UA 1XQ1A 2DFVA 2P9CA 3PHJA 2AW5A 1C1XB 1TLTA 2UV8A 1ENZA 3DL2A 4XWYA 4JQCA 4ND1A 5KJCA 2Q3EA 4ND5A 4ZQBA 2B35A 5A9SA 5JDIA 5I7SA 3NX4A 2DBQA 5F5NA 2FPGA 1P74A 1EUCA 5U4QA 4B4OA 1LSJA 2Q46A 2IZZA 4J9UE 5CG2A 2PZMA 2UUOA 2GCGA 3V5NA 1SB8A 3RUAA 1UH5A 4B8WA 4CODB 4G2NA 2CDCA 2RCYA 5F5LA 4R4JA 1EDOA 3ANMA 3U62A 4F45A 5DOVA 2B4RO 2YDYA 2OP0A 4RQUA 5TT0A 1HDGO 5L53A 1T26A 4NZ9A 2ET6A 1I32A 1GQQA 1NASA 1JA9A 2P4HX 4NBRA 1KVSA 3PP8A 2IDZA 1IUKA 4FFNA 2GN4A 3F5QA 4GMFA 2V7PA 4XQEA 2VWQA 3QWAA 4CQMB 2YFQA 4N54A 2VHZA 2ZJ1A 2JFGA 3D5QA 1E0DA 1XKQA 4FIZA 1DIBA 1RYEA 3BXXA 1XQ6A 4C7KA 1X1TA 4MKRA 3NT2A 2BF7A 3TZKA 1EMDA 1NFRA 3ROKA 3EK2A 2BMAA 4BNGA 2DU8A 1QYVA 4DL9A 1ZSVA 4GPD1 4D0RA 1H6DA 1MFPA 1ZK0A 3NGLA 3WYCA 5KJ1A 3RJ5A 4NDNE 4IIVA 3MJTA 3ZV3A 4I9UA 1YBAA 1W4ZA 3ADPA 4KZPA 3L6OO 3G79A 1I10A 3UF0A 3PWZA 1SZJG 4EJ6A 4KDFA 4Q3BA 4E32A 1H93A 2YQ4A 1FF9A 1LA2A 1EFKA 2R00A 4DREA 4RPKA 5JMPA 4LRTB 4FFMA 1IHXA 2P91A 2C5AA 3L9XA 4B7XA 3JQGA 1QR6A 5LCXA 1BXKA 3GEDA 1PZHA 2EXXA 3C24A 4E12A 2ZB8A 5GZ3A 4OYRA 4UAGA 4TSKA 4E5NA 5L7WA 3DBRB 1HSZA 5AXCA 4HWKA 3EAGA 4QFDA 3LSYA 3RFTA 3MJSA 3DOOA 1XDWA 2YV1A 3O8QB 1X15A 5AXBA 4BL5A 4K6FA 4L74A 3E5MA 1C1DA 2RHCA 5IXSA 5KJ6A 5COBA 3UKOA 2FRDA 3D4OA 3LT2A 3SBOA 3PGJA 3WR5A 2A4KA 1MB4A 1ZW1A 1AUPA 3DZFA 1Q2XA 5EJ2A 3FPCA 1UR5A 3QIVA 2Q4EA 1I3KA 1NNUA 1S6YA 5EQDA 3AU9A 4WPGA 1IY8A 1UZLA 4ONEA 4BQRA 4Q3CA 4OO3A 5A3JA 3AK4A 3B6ZA 2POQX 2FOIA 4QO7A 2X4GA 3N58A 3OJLA 2HK8A 4AJ2A 9LDTA 2YUTA 3DTTA 1UP6A 1O95A 5FFFA 4FSHA 3RUHA 4YTEA 4CLOA 2OBYA 1IHYA 5THQA 2YFHA 3RI3A 4PIVA 2EKPA 4BVAA 5DBFA 4YJFB 5KTKA 4KUGA 4LCEA 4BOYA 3W6UA 1P31A 1P1JA 2NWQA 1E7MA 2PH5A 4D41A 3FBGA 1AXEA 4JX8A 4R69A 3HADA 4IY1A 1PQWA 5L3ZA 3WBBA 3ZU4A 1V8BA 3JQ9C 2OFPA 4HNGA 4W9NA 4BNJA 4CV2A 2VHXA 3QVXA 4R9SA 3S55A 2EP7A 1NM5A 3VKVA 3DMYA 4ZD6A 1LXCA 2AQKA 4PLCA 3GZ4A 1GU7A 4BUCA 5TNXA 3M2PA 5FWNA 3LQFA 2AE2A 3JQCA 3GEMA 5KVSA 3LK7A 1DJNA 3ZNNA 3ZV5A 5EPOA 4ZRMA 3Q9NA 2X5OA 4B8ZA 3DQPA 3PIDA 2XPCA 3JCZA 3OIFA 1HF3A 3FNGA 1RWBA 2FZWA 4WEOA 1B3BA 5CDSA 2BLLA 4YCAA 2JAPA 4D79A 5KNLA 1U5AA 2PGDA 2BRUA 1PJTA 2LDXA 2VUUA 1D7OA 3EUWA 3LLVA 4N5MA 3FWZA 5G4KA 1NP3A 1XGKA 3AUSA 1GYQA 1DFGA 2VT2A 1NR1A 1XR3A 5DDIP 3KYCA 4XQCA 1Q7GA 2XXBA 4J4TA 4NBVA 3WDSA 4MVJD 4NBUA 3ZWAA 2Q1TA 2BFMA 4RORA 2EW2A 4CJXA 1G0OA 4UEJA 4GLLA 4GX1A 2H6EA 1HLDA 3R3SA 4J4HA 3UCXA 3FR7A 1IZ9A 2OZPA 3PFWO 2EGGA 1ISFA 1PGPA 1YBVA 3AOEA 1K5HA 3ZNOA 2PD4A 4RPJA 3NT5A 2JD0A 2Y68A 2J5KA 1JKFA 4OSOA 5CPFA 3QE3A 3IOYA 3L4BC 4HX5A 3PFFA 2CNBA 1CEQA 1EVIA 4E3ZA 1YKFA 2O3JA 4LN1A 5G0VA 2I65A 5JDIC 4AL4A 3QWIA 1UXJA 3PDUA 4IBOA 3CSDA 2X0JA 1YL7A 1NQAO 4ALNA 4J16A 4CLEA 1DFHA 1E3JA 3FSRA 2FR8A 3LT4A 4IDEA 4N7RA 5K9ZA 5GMOA 3WGOA 4W82A 3RC9A 1ZZEA 2JD1A 3DFUA 3AY7A 2HJRA 4I8XA 2D8AA 1J6UA 3MOGA 5F1KA 1GYRA 1HE2A 3VH1A 1XHLA 3CIFA 1DRUA 4XYLA 3GVCA 2P9GA 5JDCA 1CWUA 4RQTA 1LDGA 3K31A 1V3TA 3WGGA 4CLXA 4HFNA 2QHXA 2ZCUA 3AUTA 2WEKA 3GUCA 1ZEMA 3KLPX 4IJVA 4QEDA 3IQDB 2YYYA 4BB6A 4BQPA 3ZI0A 2QQ5A 2YHIA 1HE5A 2VQ3A 4CMGA 3WGZA 2YDXA 3Q6IA 3NDRA 1ZO8A 3P5SA 4D0SA 1BSVA 4IIUA 1M6WA 6LDHA 2PZKA 3K2BA 4R5HA 2X9VA 1TT7A 1TI7A 2UDPA 3K6JA 4CM8B 3UFXA 5C5IA 2NTJA 2PLAA 1I01A 4UVGA 4A10A 4LK3A 1A27A 4YRDA 2HUNA 3GVHA 1ZK4A 4NBTA 5G0WA 4C4OA 1YE3A 3I3OA 1WMBA 4TZKA 1I24A 2X7HA 1U3TA 3EHEA 4R1TA 5KVQA 1O89A 3MZ0A 4PRLA 3DBVO 3NTRA 1PGQA 3F46A 3DDNA 3ZHYA 3DBHA 1GYPA 4OGWA
chains in the Genus database with same CATH superfamily
5K1ZA 3FHOA 2PGXA 3OTWA 4YB8A 3MT9A 2OV1A 3NXKA 4IIYA 4D8WA 2FNAA 1TVEA 1AM4D 3GLIE 2RHOA 5AOVA 1YZHA 3PUHA 2RK6A 3QVVA 1SOWA 1U9IA 3OZWA 1EIZA 4Q7EA 1IUNA 1PZXA 2CGEA 1T6XA 2NADA 2YC4C 4QRDA 4CMHA 2OV3A 3LL7A 1FS5A 3R3YA 4LVCA 4QWWA 2Y1OA 3KKLA 1KU6A 2ATEA 4MUGA 1P4JA 2AA3A 1ND6A 1HT2E 2J0UA 1XEAA 4WBXC 3ET5A 4WK4B 2WWRA 3WLJA 2WB2A 3GG2A 3EVGA 1JEQA 4GF5A 3JQ9A 3PZBA 4AURA 2F2TA 4FR5A 3G17A 4BV9A 5D3QA 4HAXA 4U63A 5EWMA 3CLKA 2DR2A 1GTG1 2PUCA 3T9AA 3K1AB 4BYGA 3HN6A 4CQMA 3DL0A 4C76A 4CKWB 3TM4A 2O7NA 1T6NA 1DXQA 4BN5A 2HEIA 2OGZA 2VNAA 2I6TA 1JIQA 4KFRA 1SCUA 5IJ9A 4IS2A 3UXYA 2BFPA 1M8KA 4N0DA 2GK6A 4P3XA 1YZ3A 2AF3C 2CXPA 4IJQA 5LWHA 1KIMA 3U7FB 1P0MA 1BNCA 2FN9A 1IPHA 4OIMA 3AJEA 2W6IA 3DM9B 1JI0A 3DVAA 2QZZA 3ABRB 4F2HA 4YR7A 1PUXA 1F2VA 3I1YA 3GPCA 1OF1A 2WIFA 3N86A 3RVRA 2ZBVA 3UO8B 4P4NA 1Y3IA 3HJUA 4LY0A 5AJHA 3EXIB 1X87A 2I7XA 3OCZA 4M88A 2Z6AA 4GS5A 1OXSC 2DLCX 3FOEC 5LZ5A 4FCCA 3HZZA 3OPYA 1U3CA 3BMOA 4AY6A 4PYOA 1E4EB 2I2BA 2DLNA 2Q99A 3PUXA 4JROA 3PPWA 2ECQA 1I8TA 3IQFA 4XLZA 1EK2A 3HC7A 3D1VA 4MWSA 4X94A 2R6R1 3E9DA 1NQXA 2CFTA 3W3ZB 4GWKA 1IWOA 3BAFA 1O6BA 5D00A 3HWSA 1J97A 3QBJA 2ZUCA 3MRSA 5AVXA 1MT3A 1VPVA 3AHGA 3ZY2A 2FOLA 3M2TA 2RFLA 2VZ8A 3KB8A 2KB0A 2NXCA 3HJRA 2W8BB 4NR0A 1ZVVA 5E6RA 4H77A 1Q12A 3RUCA 2QLNA 2M98A 4F2PA 4LXIA 1YRYE 1A7AA 1JUDA 5HIJA 4GNRA 2VSQA 1XLTC 3NDJA 3UGTA 3GELA 1T9AA 2RHDA 3K0FB 3VMFA 1E5DA 1PUIA 2JZCA 5IC5A 4TVBA 3N0VA 2XQGA 1K9VF 3LT1A 1AKTA 5JE8A 1KWGA 4OI1A 1O0SA 1LQTA 2A5FA 2QRVA 3U4GA 3VAAA 4DWVA 2GEUA 3WFZA 2ZJ2A 3LUGA 4H7PA 1LW6E 4CIVA 3K32A 4MUHA 2FEKA 3P97A 1OI4A 3Q9LA 3O8BA 4E21A 5JNLA 4LXYA 1QYRA 2BC9A 4R05A 2H63A 3A1VA 1W4LA 3ESAA 3RC1A 3V6LA 1W5AA 1ZSYA 3D3JA 1ISSA 3JPWA 4BLSA 3C3JA 2OORA 2AFIE 3MJ4A 5AUOB 1XZQA 3FHCB 4RPGA 3SEZA 4NPHA 1ESEA 4P3KA 3B6KA 3C3EA 4ZI7F 1E3QA 1ZL2A 3EARA 4MQMA 4OB6A 3H5IA 3IULA 5LKAA 1U1GA 1MX3A 1Z6TA 3NVMB 5ALYA 4HADA 3TNLA 2HRDA 1KQNA 1NTOA 4MQLA 1QRSA 2FMFA 4X62B 4AN0A 1YT5A 2CXOA 4N49A 4ZAWA 4RACA 3DAPA 1H0KA 3SYTA 3R8FA 1I2AA 2WOOA 2X8AA 4DCVA 4TKUA 4DMLA 3IIMA 5JTTA 4WH0A 1B6SA 1NZFA 1XVVA 1KZ9A 4MW6A 1U7TA 3IGFA 4LOKA 3B85A 4N3CA 3Q7RA 1OLSA 2NW6A 2YTZA 3AEKB 1ORRA 3OO1A 4U2KA 3RBXA 3I53A 5HTKA 3EMKA 4DR3B 2J3MA 3CJQA 3EXEB 5ISMA 3WL4A 1Q3KA 1DO2A 1I9CA 2PZFA 2PWZA 3CLTD 2Z9CA 5AH0A 3DLHA 1QF6A 3C48A 2PWPA 4EHAA 1XAJA 3OMXA 1EH5A 1PT8A 2DHCA 2JIRA 5AUQA 2H1OA 2J0UB 2ZWVA 3AIOA 3AV0B 4ZVMA 1GTRA 3WZ2A 1KOGA 2Q3BA 1WVMA 1TAUA 3HJNA 5BV8A 3LKDA 1LJUA 1O08A 1Y37A 2PUVA 3JD2A 2WAOA 2P9HA 2PXAA 1W34A 3FHJA 4XDGA 2F59A 3MAJA 1MMFB 4UOEA 3W1EA 2HREA 3HB7A 1V71A 3KELA 3E27A 3C3WA 2HMTA 1WE2A 2BF4A 3WL6A 2BEJA 1DO8A 4BV8A 2VF7A 4P6VF 2CBZA 2WF8A 5KTSA 3HXMA 3FPBA 1FQKA 2EF0A 1IU9A 1P3JA 2YV2A 3EC7A 5LQSA 4L15A 4RULA 1PFKA 2J5BA 3BA6A 1C30A 3NEAA 2H0AA 4NJMB 4TMVA 3U3XA 4F21A 5C5DA 3WB1A 5HQTA 1E7SA 3DVAB 4JJGA 2LXNA 1KGSA 4DSTA 5JU6A 1JQJC 4NV3A 1EVYA 4HLUC 4XJSA 4MUEA 1QYXA 4BGDA 1BIFA 4JB8A 3MWDA 4HR7A 2PUBA 2NTYC 1N6OA 2Q4OA 3GGSA 4V2UA 1D8TA 3OCCA 4R2IA 5IMSA 1WHTB 1NPTO 3TXXA 4AG3A 4CKBB 3TNDA 3VPFA 2JLSA 5DIFA 4Z0PA 1NQUA 3EEFA 1R8JA 2QW0X 5FBRB 4DMFA 3HSKA 3HG7A 1L1EA 3OQVA 4KV7A 4AUKA 2VPPA 4ASUD 1W36B 3FTQA 1MKYA 4URUR 5ARBA 2E4YA 3TECE 1RM0A 2DHQA 2OCBA 4C4RA 5JZ9A 1GG2A 4DIFA 1HC7A 3OIUA 1MP0A 2W6QA 3KOXA 2OKCA 2ZI5A 3TZCA 1QHYA 2FZLA 4ZI7B 1OYWA 2I1WA 1PNVA 2OK8A 4ENSA 1V9CA 2IK8A 3FCAA 5D6OA 7ADHA 3MCAA 3SXPA 4G65A 4D9MA 4YS6A 4ZVKA 4R1MA 1WBJB 3U7QA 2DJ5A 1Q0LA 2WWHA 1MJGA 3PJRA 1J7JA 4KZKA 4MYUA 1W30A 1GEGA 2P27A 2C42A 1T36B 1NVWQ 2OCLA 5FHRA 3E9QA 1D9XA 4U00A 2OGUA 3B51X 3GEHA 4FYIA 1Q0ZA 1Z34A 4RD3A 6NULA 5EZ6B 1EDEA 4DR7B 5ENDA 1E1CA 4ND7A 1QKIA 2X0RA 4Q4LA 4PFJA 1UOQA 4RIGA 2X0IA 3VVCA 3WGHA 1Y3FE 4DQXA 5IG2A 2I6XA 1Z0FA 1KFKB 2W2LA 4JKIA 4BRUA 4D96A 2PUGA 4X8OA 1ODIA 1BJRE 5JV5A 2ZSIA 2B94A 4EH1A 1UXIA 2JS7A 1EUYA 1T5TA 1F3OA 5LC1A 3DUFA 1QQAA 1T2FA 4TYPA 5F2EA 1KC3A 2DCUA 4HAWA 1UKYA 2R68A 1WXFA 4OHOA 4FTWA 4GX2A 1XRJA 3RSZA 3ER8A 1F9EA 3NATA 4ILKA 5E4JA 2Y0DA 1XNGA 3FA2A 1F4VA 2OBFA 1NI4A 1XP8A 3HA7A 3I72A 3IIKA 2DERA 5DNVA 4HAVA 3IA7A 3N2KA 3OT4A 2SCUA 3PHLA 5EKUA 3O75A 3RT7A 3Q3VA 3NNSA 1TOAA 4LSWA 4MP6A 3WYFA 2Y0CA 3M6MD 3MNFA 1NBOA 2J87A 3FIUA 5I7UA 2R5WA 4H0FA 4RLHA 3VUFA 1BGVA 1YACA 1CNEA 2W2NA 3SFTA 3IHLA 4BTEA 4TVKA 2R79A 1DJMA 2G5PA 3KAKA 1VRCA 3WK7A 1W9HA 1OA1A 4V0LA 4LVUA 1F3LA 2HIMA 3RVSA 7YASA 2H8KA 2JGRA 3KKNA 1AH2A 4YRBA 1GSAA 1PWEA 3STXA 2RGRA 1RWOA 1RQGA 1OU4A 2QMUA 4BE7B 1SKQA 2AG0A 4DR2B 2J0SA 2I4RA 1Z74A 3D5TA 5TPWA 3ELUA 1YASA 1K8XB 4GICA 4ZQIA 1X86B 3M4YA 2UAGA 4KO2S 4Z3DA 3UN1A 4DABA 2AH5A 4ECEA 1GLGA 3HXTA 1JHUA 1ZM7A 2R8ZA 2O7SA 3E8MA 1KYWA 4M53A 4PXSA 3UH1A 2W11A 4B40A 1W7AA 5K8TA 4F4UA 1AKQA 2NO1A 2NAFA 4HGOA 3IJPA 2PLNA 1COZA 1NN5A 4J0QA 3QLTA 1NOJA 3M6VA 1AK9A 2PMDA 4P5PA 2MSLA 4FKBA 5ARCA 4BO5A 4L5JA 1AA6A 3NDBB 3TE7A 1NW3A 4MLCA 1I0ZA 1DSSG 1KETA 3DC2A 4MW1A 4BNXA 5KSWB 1NLFA 2Y4OA 3CZQA 1ODJA 4OQEA 1MC4A 2F8SA 3LTNC 5JS1A 2OHXA 1T8SA 1DIOB 1TYCA 4TMWA 5EZSA 5KIAA 1CUZA 3ZW9A 3F5MA 4L5IA 2QZSA 3L6CA 4L07A 4KXQA 4L76A 1XNRB 1BW9B 1OCEA 1ULBA 2E4XA 2D06A 2YJ6A 3DWIA 3PXUA 1MNQA 3R9KA 2R84A 3E9NA 2FN3A 3ZE2B 5B1YA 5L4NA 1CJMA 3K71B 4W5TA 2VP3A 1G21A 1SA0B 1UK6A 3PWSA 1MNAA 3D3EA 3EWIA 4LOAA 3EVBA 2QP3A 1DC4A 1NDUA 2NGRA 4BJ5A 1Z7BA 2DPLA 3U2QA 1VECA 4OBEA 3VYTB 3GLHB 5FA5A 5I6DA 1A8PA 2A7XA 4ALMA 3ZHSA 2JLBA 3O8LA 4P81A 3DW1X 3DFKA 5FLYA 1H42A 3ZYCA 3JD0A 4HDSA 2C00A 5DYTA 5EPUA 1U4OA 4ERXA 3MWEA 3TJRA 2AYXA 3HDYA 5K7SA 1TEXA 1J1IA 4G81A 3BKWA 3I5YA 4DQDA 1GR0A 5KTTA 2YN4A 2XT6A 4LY6A 5CLLA 3U9SA 4FIDA 5A6SB 5FUBA 3LX8A 3WHIA 2ZCVA 4MPTA 2J9GA 2F1OA 1W25A 3DNPA 2APJA 5A9RA 3JAKA 4QJIA 1PF7E 4BX0A 2Y99A 5U9CA 3G49A 1F4PA 1SHZA 3GFGA 3M9XA 4JP8A 3CE6A 1RFGE 5E7JA 3IQIX 1CUHA 3TI9A 2GYYA 3T95A 4C29A 1BD3A 1NMEA 2FGKA 2NM0A 2IXDA 2R1VB 4JVOA 2AZMA 3WNCA 3TVYA 4CLHA 2GN9A 1RJDA 3GFPA 3K0EA 2FUG6 1QHXA 1LWNA 4XTCS 4MIOA 4Y2XA 4J0KA 3TQQA 4UFPA 3T34A 5JZSA 2EKBA 4RHXA 1J9ZA 1ZN9A 4KAJA 4TS3A 4XWAA 1CY1A 3BTVA 3ROGA 4A8HA 4DHEA 5C8ZA 3RYHB 5AVWA 4AXXA 3IRUA 1ZINA 1C30B 1LEHA 1ODKA 5TT1A 3W2GA 4ABYA 3D3WB 4XB6B 1QTIA 4BO4A 2FP3A 5BSUA 2FN8A 1XCJA 5ALIA 5CNIA 3SOZA 3FYUB 1AKWA 3ZWQA 5HRCA 1M66A 2GHRA 3LPMA 1B0PA 1QRTA 1RLMA 2C82A 2E1RA 2YY7A 1JG1A 4LAFA 5AVKA 1JHVA 3U0BA 3ZI4A 4XB1A 5FUMA 2E21A 4CU2A 2PX0A 2QGZA 1FC0A 2UZ1B 5E7MA 3UMBA 3BG5A 4YECA 1WHTA 4HSGA 4CKBA 3T54A 2DWOA 1NUUA 3NLLA 1RPAA 3QLVC 1E8MA 4L8LA 4MROA 4BVFA 3HFGA 1XTQA 4NL4H 2P4EA 5J2TF 2GS9A 5KQGA 2D1TA 5EHGA 5EIOA 3U61B 1GSIA 5EMHA 5HJ7A 4EF5A 1V2GA 1VYVA 3AF3A 5KYGA 4RE6A 3GPLA 2ZGVA 1FFXA 1C1YA 3T3HA 1AF4A 1G4HA 4OMFG 3CUEF 4H3KB 5JMOA 2GAOA 2V4MA 4PPFA 3AFHA 4G9EA 5ES4B 4AY2A 2R8OA 1E1NA 4MJLA 1KAOA 1A8HA 3GI1A 4REOA 5ALLA 4G3XA 1YRWA 1E1RA 3A9CA 3GDHA 3IKJA 1T36A 4JGIA 1T4CB 2BV3A 4XIJA 2NQ8A 3TLGB 4CDGA 4RSHA 3AJ8A 3WTCA 2RE8A 3GWZA 3I42A 1EXMA 5B64A 4M9XA 1A8UA 2FF7A 3OJOA 4MIYA 4DDHA 4KXXA 1A72A 2X41A 3IEVA 2WG2A 1FRZA 5KNCD 2GERA 1OROA 1DQPA 1MW9X 2QIOA 3X1DA 1H9AA 2QEQA 4Z51A 3R7FA 2XGMA 3DCNA 3TIVA 1IONA 1SJ9A 3TYXA 1J2YA 2A9VA 1YZLA 1BMTA 1OBVA 3E3MA 3QRWA 4REMA 4W9RA 3FJYA 2J8ZA 2WTUA 4FHDA 2R8EA 1XUOA 4JSRA 1QRDA 4HYYA 4P93A 1EUQA 1CJKC 2LCQA 2D6FA 4NU5A 1H65A 2WF7A 3C6QA 3H9EO 3IMKA 3KD3A 4AD8A 3WGIA 1FNSA 5JOQA 1EJ2A 1ZESA 2GJSA 2JJ1A 4MYRA 2GRUA 1AE1A 1XX6A 3MIIA 2W2VA 2QXYA 3BH7A 5JS6A 4HH3C 2VUSA 1N4DA 1NA5A 4ZI2A 1WHSA 4MI1A 4BDSA 1KH2A 4BX9A 2QBYB 3HDJA 4P3OA 4WACA 4OAPA 1NG9A 2YZ2A 2HN9A 5EP3A 4V0RA 2O07A 2VZEA 3C5HA 2ZTVA 1LC3A 1YBMA 2GZHA 3JV7A 5DCUA 1BZYA 5DV9A 3BC1A 1MDFA 1TU3A 4Z4GA 2XCUA 3H9QA 4KMRA 5CXXA 1DCFA 1NR5A 3OQ6A 1A1SA 4L4SA 1T34A 3IP7A 4R1PA 1K75A 3JATA 3DE0X 3L0PA 4PG5A 2O8VA 4MYTA 3COZA 3P94A 4Q9JA 3U4QB 1YZFA 1N2HA 4C3ZA 5KZMB 3FCEA 4R31A 3W79A 1XCLA 3YASA 5I7RA 1FX0A 1RJEA 2FGJA 1K27A 2WZBA 3KK0A 5G1OA 4PQEA 4D80A 1IH8A 4XJXA 4M0MA 4DDVA 5I9BA 3RWBA 1J70A 1WRBA 5HDQA 1R4NA 2Z6UA 3B60A 1Q22A 3MEQA 2A2ZA 3W3AD 4B7UA 5LZ2A 2NO5A 3BFPA 1D3AA 2Q4RA 2REOA 1B8OA 4M86A 1EI9A 1IB0A 4FXPA 4PLWA 4F5YA 3ZGOA 1KHHA 4I66A 4R6XA 5REQA 2EFCB 3AXSA 4JMLA 3RKSA 5A0VA 4PG8A 1NATA 1UJ2A 2V59A 3BDAA 1TYDE 3ACCA 4EX6A 3W9BA 4WD3A 4DIOA 1IIRA 2P41A 3DMRA 5JLJA 3WIUA 3ZY3A 4QATA 4F1KA 2OA0A 2I80A 3L49A 4F2GA 3CRMA 1NLMA 5GIPE 1ZRHA 1CX9B 3MGGA 3DMTA 1DT3A 2ZAYA 3L4SO 3LQYA 4D8XA 3K1ZA 2X2PA 4HVCA 4MUYA 2XOKD 1U1EA 2A94A 2RCNA 3F96A 5DNDA 2AC2A 4EI7A 4MWZA 1NJFA 3T3DA 1E1MA 3KR0A 3WJ7A 1FRFS 4LDZA 2JH9A 2WPDA 1TX4B 1MW8X 2D00A 4HXGA 3THSA 4LYEA 2Z5FA 5BWNA 4V38A 1OXXK 3KWLA 3WWEA 4JI2B 2FR0A 1JZQA 4FR0A 4ZQGA 3WGVA 1J1UA 1VCMA 2WYHA 1PS8A 4RIFA 5EHIA 3WGLA 1W5BA 2OOSA 5AI9A 1OC2A 4YJ3B 4RSRA 2PKWA 2I78A 1S3IA 1I3OA 1KF0A 2RGWA 3N53A 4CUKA 3RSFA 1UPXA 1X77A 2QIPA 1ZISA 1MAUA 3UBTA 4LYHA 3EPRA 5EE3A 4F0JA 1XWIA 1XJWA 3L8CA 1DBRA 1WG8A 1VE7A 1K6EA 3M9LA 2H06A 4NBWA 4WFQA 1SPBS 1U7OA 3ZQ4A 4NG5A 1HE1C 1US8B 2B30A 4LDPA 7REQA 1RJ9B 1HTWA 4CG2A 2JJ2A 1XVLA 4GIBA 1WA5A 3LC2O 4BV3A 3FCOA 4C4SA 2BBTA 3PCRB 5FI0B 4DCNA 1QGUB 1TZ2A 3TW8B 4WWHA 2O23A 5KSOA 4NEGA 1X7DA 3HA2A 1BKDR 1UAYA 1I3NA 1WP9A 3I2HA 3VNBA 4K8OA 3MG9A 1FP6A 5C8YB 3T99A 1W0JD 1E9EA 2HIHA 2EFEB 3TSOA 1ENOA 4A8JC 1G5PA 4U8HA 3DMPA 3PDIA 5LU9A 2CHQA 2JGNA 3D6HA 4GBGA 4Q1DA 1CIVA 2FP4A 4YAOA 8ATCA 4RX1A 4NDZA 2Y93A 1K7XB 5KNDD 1IOLA 4HNHA 1R12A 2OGSA 5AVQA 2NV0A 1N2XA 2HBZA 1SCAA 3BD8A 2O2HA 4G5XA 5F3DA 3T0FA 3SU8A 3WLLA 1KJJA 5CCDA 2G9NA 4KPFC 3RT1A 1RXYA 1JYEA 2ESRA 3CR3C 4LJSA 4DAOA 5CD9A 4EHDA 2COKA 1OY1A 3SIRA 1ITZA 4CETA 3M6IA 4LV6A 1T1JA 3GUUA 1E1LA 1C14A 1KPIA 3ZXYA 5DYGA 1CUDA 5JVDB 1Z5VA 1BEZA 3AU8A 3IC5A 3OCXA 1EUDA 4RTOA 5F4ZA 4KHPB 1V37A 5BR8B 2OBMA 3HPQA 4BNWA 3AOEC 3IVXA 1SUWA 3UGQA 4D1YA 3MJCA 3AETB 1Z6PA 3UYLA 2HAEA 1BEEA 1CUFA 2H7CA 2HRCA 4M76B 5AK6A 3PSAA 3U6BA 1G9XA 1ADFA 1EFVA 1V7QA 5J5CA 4IRMA 3T4XA 1Z39A 3H9GA 1GUAA 1MAVA 3WYAA 1KFEB 4PVDA 1NDHA 2QSJA 2O9JA 3OE4A 1A50B 2NU6A 3Q6NA 3BM5A 4WECA 4TZ0A 2EX1A 4TWZA 3OQBA 1WZ2A 2VJYA 4FQ7A 1QX4A 1RQ7A 2D62A 4RY0A 1WUTA 2CEAA 2HA2A 3JAWB 1OYYA 1IXZA 3FR8A 1YNSA 1KJIA 1JA0A 1UP7A 4GE3A 1N6NA 4C4XA 3Q87B 3Q2IA 3SQXA 1UM8A 3O4VA 4MR8B 3EZXA 3S2ZA 1OAOA 2RAUA 2YS7A 3KYDA 4M46A 4WSOA 3DMNA 3IKTA 1CEYA 1FMJA 1YA8A 2QR2A 3EYWA 1SQSA 3DEYX 4F96A 4P35A 2CY0A 5B3JC 2IHTA 1P1IA 2OHVA 4JXKA 1MJGM 2PWBA 2RGGA 3G8YA 3AIIA 5AM3A 3JRWA 3N2KB 4JU8A 1YFJA 2FQQA 4KGDA 1ZBQA 2JFPA 5CVVA 1KVUA 4CBVA 2XHZA 1DKOA 2QL5A 4BJ6A 2G17A 4HUTA 4Z7OB 1M83A 1ZUWA 1SCQA 1V5FA 3O0TA 1NF8A 4TYNA 2Q9UA 3HEMA 4YMIA 4Z5XA 5K3SA 2O59A 1FW8A 5H3CA 2WTBA 2GZRA 2BGNA 3PXXA 4OQMA 3RWMB 2PV0A 1XMJA 4TXJA 3RB8A 1KARA 5JAMA 3LP5A 5GPBA 3AKDA 4BPRA 1NVVQ 3GQBB 3R7SA 1Z5NA 1WCWA 3ZZ1A 1IPEA 3FRJA 4UCXA 3C87A 2FZ4A 3M70A 3WMRA 5BQOA 2IELA 4FHFA 4AWBA 1K4KA 4U5XA 4WY8A 3VVLA 4A92A 1EWTA 1GGJA 1T2UA 1VL0A 3AYZB 4QFMA 5A05A 4WLEA 5L4SA 1V0JA 5G41A 4C88A 2H29A 4OQQA 2GNAA 4CM4B 2VPWA 3OLYA 1GNPA 2C3PA 1ADGA 1XZEA 4J0HA 2GLUA 2O7VA 3FSGA 3QJ5A 4G4SO 4D8YA 2PSEA 1W76A 3PD7A 5ITWA 3AI1A 4URZR 1A7KA 1J8FA 3QLJA 4IG4A 2WW8A 1PLLA 4AZVA 4DMMA 2P9QA 3FSJX 3PGKA 1M2KA 3LWBA 3PJDA 2OWDA 4Q1VA 4QSMA 4R54A 5FEMA 3SLKA 3UAVA 5BVGB 5TC4A 3RK4A 4IWXA 3MQ2A 2DR0A 3QKRB 4KFTA 1MB9A 3HU1A 1Z45A 2IY8A 2IHKA 1NMQA 2MINA 3BICA 5K4AA 1R5JA 2DY0A 2J5XA 2VAPA 3KWJA 3PUIA 5CYFA 3ZDAA 1AKMA 4RKEA 4YRLA 3L8HA 2G4LA 3PJGA 3U3DA 4JEHA 4OKIA 1UPUA 3IUEA 3MTEA 3WWCA 4F9EA 3RS7A 3OX2A 1X7ZB 1BE1A 3CZPA 2E7ZA 1BGXT 5K4HA 4DV2B 1RRVA 4W7IA 1JFFB 2WICA 2HJGA 1CERA 5AJUA 2AJCA 5EWJA 3OG9A 3OT1B 3UOGA 2LGJA 4P0PB 1T4DA 1VM6A 5FYQA 3PFCA 2HMUA 4EL5A 2FYTA 1VDZA 2HO5A 1VIDA 2D0PB 3GRKA 1RP1A 5DF1A 3RS5A 1EFCA 4OP3A 3IHKA 5DMHA 1F5NA 4L8VA 3ROQA 3ZKWB 3GAFA 4RC9A 3U9TA 5C1OA 1R16A 1AMNA 1WIWA 4AIRA 2QI9F 2CXRA 1RWWA 3L0CA 2QD4A 5I8PA 1O9HA 2FRXA 5J2UA 5B3LA 1M7BA 4NRDA 1QYDA 3P9QA 1UJCA 4KSYA 4EBFA 3RAJA 1KI3A 3D59A 3CH4B 3TD6A 2VP4A 1ID1A 2C4KA 5TE9A 3B70A 3HJAA 4K6KA 4UAJA 1GCGA 2NV6A 3M4ZA 4E1VA 2YRWA 3T12A 3HR7A 4DNQA 1CJBA 3DAGA 3LDHA 2AUTA 3EVCA 3F9RA 2CLDX 5HMLA 3R0VA 4B79A 3ZDRA 1JSRA 2F9LA 3L7OA 4TL8A 3QEOA 3SC2A 2IH4A 2QWXA 5LMZA 3DLIA 5AYVA 3E0XA 1M2NA 4YCNA 4A0SA 2XQJA 2PFGA 3TGWA 2H92A 3PHHA 1PSWA 3BDIA 3KSRA 2PGAA 4COOA 2OWEA 3CCBA 1RRPA 4BQNA 4OQ4A 1VJ0A 3Q9UA 1PZGA 3BMXA 4FHEA 1O9GA 2XRFA 1AKYA 2HLNA 3EWAA 1T24A 5TDHA 2YHIB 4Z7NB 4FBMA 4RPLA 3Q8KA 4YJ2F 4AJPA 4U0KA 3BHMA 3RR2A 2QE6A 1HH4A 1ORWA 3C43A 2QD5A 2UZIR 3KDSE 3WG9A 3IP3A 4EECA 2JF0A 3ANXA 4M54A 1JU4A 1NQTA 1B0UA 4AZTA 3OM1A 3RABA 4RLFA 2VBGA 4TMZA 4Y2SA 2JIOA 5CIYA 4HDMA 4Q12A 1QNLA 5KOYA 4INZA 2PD3A 4KI7A 4EB6B 2ODNA 2YX1A 2GHTA 5FPQA 3UHAA 5LOVB 1P7ZA 5CA1A 4U7WA 4B9EA 2O8BA 1ZA1A 4A6EA 4B4VA 7MDHA 1W44A 2ZRMA 3E8SA 4TTQA 1ZONA 3JATB 4RY8A 4E4YA 2D1YA 1ZM3A 2HA4A 1ZXBA 2J6IA 3I0ZA 1UMKA 4A5SA 3N1UA 2QZJA 1A71A 1E77A 1DJPA 1LPBB 2PJRA 1K2WA 2Q5IA 2QNIA 3WISA 4FS3A 3CURA 3WAJA 2J07A 1V5GA 1UFVA 4IJMA 5G4KB 2QKYA 1MC8A 3HB4X 2W90A 2BAGA 3RADC 1RJGA 1DMRA 1T5IA 1RCUA 4X0EA 5B1SA 3MWKA 1U1FA 3B20A 3G88A 1K8QA 3OU7A 5FOTA 5H1YA 5TGDA 1ULTA 3EVNA 4TRJA 2HTFA 4ZQFA 4IIHA 1SBNE 4CM1A 1PEYA 4M0EA 4ZHQB 4UU0A 4B7ZA 1DQNA 1WX1A 5HJ2A 3U44A 1RE1A 1SZDA 3S2UA 2JJYA 1RAAA 2C5SA 2PA3A 3WBFA 5JCJD 5J5VA 1NBEA 3ZTTA 2O1XA 2XCQA 1ZUNA 4MGEA 4DMGA 4NCBA 4N01A 2O2IA 1FMTA 4OB8A 3JQAA 2VDOB 5DX1A 2DC1A 5GZ6A 1OGIA 1PYDA 2YHAA 3GPDG 4IH9A 5E9WA 3S5JA 3IBTA 1MHTA 1ORHA 4BY9E 1E3DA 4KPYA 2PZLA 1XTBA 2WILA 1ZGBA 1PZFA 3IP8A 1L1FA 1F0NA 2DFPA 1YR9A 4L2IA 1K0UA 4GMGA 5FD8A 2IKSA 4IZHA 1K8YB 1KYXA 3QVWA 2A86A 3OD1A 4RL4A 2X4LA 1XPJA 4YRJA 3EIFA 1RNLA 3FN4A 4YACA 1ZC3A 4MLZA 4FUQA 3QYFA 3SC4A 3CZRA 1Q44A 4EA7A 1HFWA 3AEUB 1JQKA 2FPIB 1G7RA 1TEHA 4IHQA 4YJGA 3M6XA 1XHEA 3A6ZA 1JHDA 3ELDA 3EQ7A 2ATVA 3Q7QA 3R0XA 5KAMA 3QPUA 4BO0A 4PLZA 5SZJA 4WQMA 4ZAXA 4C0XA 1NXOA 5CJPA 3QSYA 1BHO1 3MQFA 4PRKA 4PW0A 4TTIA 5BOVA 4KREA 1PX0A 5F1YA 4B35A 2JD2A 1FDTA 2XNDA 3FFAA 1XRQA 1G8PA 4S24A 3GGPA 2QVCA 4W1SA 2H2IA 4F9TA 2NYAA 5KOHB 5BPFA 3CG4A 1A5ZA 1KRXA 1W2HA 3TE6A 5G1PA 1LQ2A 3ETJA 4IO0A 2CNKA 3GG9A 2OCXA 1LLCA 3KUUA 1W93A 2IPNA 1NW6A 3M3DA 3OEYA 3V4LA 3ZWDA 4B6EA 1AO0A 4D4IA 3ZWKA 3C8ZA 1QO0D 1VHTA 1VQ1A 3GJSA 3WWDA 5BWCA 5EIXA 4UHFA 1X80B 5H9WA 2HW8A 4MVJE 4FK8A 2R60A 3EIXA 3R40A 1JSCA 5TF0A 2HCJB 3IT3A 1HXHA 2DR3A 3CCFA 1BCRA 2XUAA 4EKIA 4KL8S 1EYZA 2WFAA 1UT6A 1VSVA 5CA0B 4JLAA 2OFFA 4N82A 5K0ZA 3EIQA 4X7MA 5CYPA 2I87A 1OR8A 5E3HA 3DHNA 2ZZMA 2Q9BA 3LUCA 1PUJA 2V6IA 2IITA 2XB9A 2XOKA 3L6EA 1GNVA 3GT4A 1QRRA 4OSPA 4TVSA 3LQ1A 4W5OA 3VSBA 4FDUA 5CGZA 4BZQA 2WD7A 1KJQA 3MQ4A 3E5RA 2ZRAA 4I5DA 1RQXA 1CVLA 3F6SA 4QNRA 3WY9A 4O25A 2QUKA 6PFKA 1NIJA 1E79D 3KKMA 1GILA 5BUQA 3NPMA 1UBRS 3HUDA 3HU3A 5EJ7A 3HK2A 4NOJA 5EPEA 1AGXA 1KIAA 2B9EA 3A3OA 1M2WA 2HJSA 3OZDA 1G21E 2AJDA 3FLBA 2QYHA 2VXOA 3GZNB 2FZCA 1JPUA 3SVLA 2OCPA 1IOVA 1BDJA 1VCIA 4DKXA 5ADHA 2QRMA 3D8UA 4NU6A 3T7TA 3OTHA 4C89A 1ECPA 1M76A 5BUSA 1OHHD 2I3AA 2J6HA 5FV4A 4CLDA 4KQCA 2ZKLA 4MICA 1PWYE 1Z18A 3FVTA 4HGQA 5ILQA 5F3WB 2O5VA 4D5EA 2M32A 3VJLA 3IBGA 5F7JA 4DDKA 2AOXA 1B2LA 3AIMA 1D5WA 2OORC 4RWZA 4ZCPA 2VH1A 5ALPA 1G3RA 2W8ZA 5JJLA 2H2HA 1XYGA 4GMKA 3ICQB 4UE6A 1WJGA 3SYNA 2H48A 3CX6A 1CZHA 5IYZB 5EFOA 3SQOA 1LVHA 1NFFA 1QQ6A 2Q9AA 4UM7A 1JQ5A 1M6HA 1UKAA 1USGA 2FEXA 2Y92A 5COQA 4EKGA 1XAIA 2LKDA 1TPZA 3DULA 1TTHA 3EG9A 1IEWA 2A92A 2HK9A 2WNHA 1A88A 1AG9A 4X8LA 1FCJA 1UEJA 4K86A 1IEVA 3G6WA 5TGTA 2JKYA 5LIRA 3R9XB 5FOUA 2ZJ8A 4Y6PA 3AGPA 3GIDA 4OKNA 4E2ZA 4XOUA 1BQEA 1W88A 2XBUA 5LKRA 2GPJA 1KJ8A 4R41A 1U8TA 1UBOS 3ECCA 3EF0A 3M5DA 4JLNA 4JZKA 2GZDA 3DGFC 5DVZA 2JLUA 4IQ0A 3A10A 4FOOA 3GUVA 1GPWB 2C1ZA 5JWOA 3NC1C 4QLBA 5T6MA 2XXAA 1ZU5A 1DBVO 1DUVG 2YY6A 3KZKA 1OGJA 1ZOSA 3PYXA 5D85A 5CPBA 3IPLA 2NVUB 5EUBA 2UUCB 4W4TA 1WB6A 1L7XA 5HYVA 1M1YE 2FPIA 4YJGB 1U0NA 3ZTWA 4TYMA 5FA6A 2V03A 3GFTA 4QNMA 1VL8A 2B7CA 5AVYA 1A8QA 1SD2A 3BBPA 1N0HA 1NQVA 2H18A 2W0MA 5GONB 2R7NA 2X8WA 4REQA 4L6IA 2JA2A 4MUKA 4BFYA 2PRIA 4XVQA 4BBZA 4BMOB 5IT9A 3RANA 2Y1WA 5EKXA 3D6FA 2JK1A 3FGZA 4MKGA 3ZU5A 5HP4A 5DTMA 1BVRA 3QXHA 5GIOE 1K8RA 1VL6A 5AD1A 1O8CA 3SSMA 4FFDA 4E14A 4DPKA 1EJ0A 4MV6A 5JSKA 3C8DA 4BS9A 5EFZA 1BXRB 1F4LA 5EIFA 2ZM5A 4CEJA 2PKEA 4D3DA 1XEXA 2O05A 3T38A 4R81A 4G4JA 4OH1A 5IAKA 1T13A 1E0SA 5TMBA 4R84A 1N2EA 2HU2A 4K3UA 3ICWA 3IT2A 4DWOA 3FTEA 1PHPA 2A35A 4GU5A 4MQUA 2XE4A 1ODTC 5GQSA 3RUPA 2VDWB 2C5BA 5FX2A 2BH9A 3TIGA 4HI0E 5B4TA 4ZVRA 1FFHA 1RMYA 1TM2A 1SVMA 1L1QA 1DKNA 1BXGB 2XVXA 3RYIB 4EJ2A 3RU9A 3NOOA 5H0IA 3ACBA 4WBNB 3EODA 4BE9A 2C88A 1P3Y1 4Y98A 1YJCA 3VR1A 3GP5A 3WHLA 3C4QA 2WIJA 4B3DA 4OJMX 3C4JA 4WNAA 4N8SA 1OLOA 1REQA 2BEWB 3G2LA 1VG9B 4B31A 2IZ0A 1FEZA 4B1FA 1C7RA 1ZVQA 1MQAA 2UZ3A 4BRSA 1WLYA 1KHTA 2ILVA 3RRZA 4S1WA 2NZUG 3VPDA 1U2TA 3NUGA 1Z8FA 1LB1B 3G8DA 2R6JA 4K26A 2ZJ6A 3GNQA 2BFFB 3ZQJA 2GF2A 1GP2A 5AOBA 2FSIA 1VG8A 4DRXB 3VR5A 1C3OB 1JG7A 1GNLA 1E9FA 2RI6A 3B2QA 4JBLA 4BLPA 821PA 5KQPA 1TECE 3QIAA 3SX0A 2AS0A 1H2WA 1JWAB 2VLIA 4CF3A 1L4HA 2JBHA 1KSHA 2CW5A 2HMWA 2VTVA 3CA8A 4Q3NA 4YFYA 3TJMA 1SA0A 1YS4A 5CHYA 3WKEA 3A31A 1ARZA 3ZWXA 1KEWA 3RTGA 1P2VA 3IT0A 3PUYA 4KITB 1U2EA 3CLVA 3GYBA 4IGKA 3OETA 3AM4A 1JBKA 1NW9B 3BGIA 4DLUA 1T3TA 3AYXB 2VAVA 2X4DA 2DQ4A 1H0SA 2KE5A 1V6CA 3BE8A 1WMDA 3AX6A 1XG5A 4G8JA 5GV8A 3RRMA 3N2GA 1P4RA 2L19A 2Q4BA 4TL6A 4RZSA 1NXTA 5DP2A 4S2EA 3F3SA 4GI1A 2C4HA 3BORA 5DH9A 2NUTA 1NZDA 5IAAA 2AHRA 3MM4A 3ASUA 3B38A 2ZYSA 3E7XA 4I81A 2JFOA 5KB3A 3O1HB 2QW8A 1EHCA 1ST2A 4EYSA 5EJ6A 3AESB 4PLFA 3R5HA 1HE4A 4B2IA 4BC1A 4ENQA 3KLOA 4YCJA 2G82A 2Q3LA 1ZR2A 3JYQA 2HWXA 4I5FA 2WTNA 2C5GA 2VNJA 4NQRA 2OFWA 3WTBA 5CX1B 2PWYA 4WI1A 4BVGA 2J5RA 2CJXA 1XHFA 3VU8A 5JYCA 4UKDA 3UC5A 1TQHA 2WLTA 3HMQA 4C2TA 3WLEA 1RYDA 1W1UA 4XLTA 1TO2E 3OZIA 2XF2A 5JNVA 2HT1A 3G9QA 1FNCA 3VR6A 2ARKA 2CV0A 3BREA 1AXGA 2YJZA 1LTKA 3FTFA 4OGLA 1ZA2A 3LLSA 3BQNB 1KI9A 1XWWA 1FFSA 2ANCA 2Z95A 3GBVA 2ZIXA 1J0XO 3IMGA 3KEOA 4V0QA 5DMXA 2JHGA 1KOLA 2CV2A 4DLLA 3RROA 3WOVA 1R74A 2CKDA 4N5NA 1UXGA 1PR9A 4HQOA 3WJAA 2H2AA 5DNYB 2D7DA 4CQJA 4RDIA 3E9CA 1J0EA 1FDSA 2WU0A 1V5WA 4C7MA 5BR1A 2VT3A 5LQDA 3VKWA 2E3JA 2BFBA 1F9AA 4W5JA 3F67A 2QORA 4C1NA 2J31A 1CUEA 5IJZA 4J7AA 1GHTA 2C7OA 3GCWA 5HUHA 5IKEA 1TCUA 1P1FA 4D9EA 2Q27A 1POXA 2Q49A 3ANSA 3E84A 4HATA 2DPHA 4JIGA 4KC0A 1N1GA 4HXYA 2YJGA 3H4TA 3DP7A 1P7VA 2AC7A 3V6MA 3KVYA 5BQFA 8ABPA 1A9XA 5JY1A 2HSZA 4I1SA 3WV5A 2XMQA 2H51A 3SJ7A 3CLSC 5ICMA 4HUQB 3Q41A 3KOYA 3S2GA 1N7GA 1S0UA 5HM8A 2RHJA 5IM4A 4X66B 3LM8A 2BEUA 1ZD3A 2PFSA 4AJIA 4M0PA 1A9RA 1RBMA 4LYAA 2Z8ZA 4MS4B 1SWVA 2CMGA 2H1CA 2UUPA 4XJVA 5ALVA 5ABPA 4XM0A 3L1UA 4IZ6A 4Q00A 4IXTA 2WV7A 1H0HA 3SKXA 4RCYA 2GJ9A 1HWYA 4PO8A 3KKKA 4FEEA 1ONNA 5DLDA 3TOZA 1JBEA 4A2PA 2Y1LA 1EWKA 1NI4B 2FPSA 1QQ7A 1M9NA 3B5IA 3ESZA 3O4GA 2OG2A 3VHXB 1XJCA 1MVOA 4DQ0A 3QA9A 4ABTA 2BDUA 4EB6A 2VTBA 2QY9A 1YQUA 2JFUA 1Z0DA 4BNKA 4CEHA 1SCNE 4GYJA 4RXTA 4XCVA 1NSFA 2GEFA 2OHOA 3QU9A 4EF6A 4WE3A 1VBKA 5AW3A 2ZRBA 4HQLA 1IJKA 1YBFA 2GEKA 1PYOA 4PNHA 4R8KA 5AXAA 1YOBA 1D1SA 1XJ5A 4YUWA 2VN8A 3PDHA 4KVFA 3DZGA 1D5CA 4MIKA 3PEYA 3F3YA 3DO8A 5JH7B 2VYQA 2Z1DA 4YO8A 3MTIA 3EVAA 2WMYA 3FZGA 4DG9A 4L75A 2XT0A 4RY2A 5FFMA