2B8FA

Solution structure of bacillus subtilis blap apo form (energy minimized mean structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of Bacillus subtilis BLAP Apo form (energy minimized mean structure)
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Biotin/Lipoyl Attachment Protein
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b8fA00
4TQUS 1Y8OB 3DXJC 3OPOA 1HTPA 1DXMA 4JK1C 4KI0A 2DNEA 4DNRB 1YNNC 2R6GA 4H0LC 2A68D 2O5JC 1B9MA 1I6VC 1OXTA 2D5DA 1IW7D 3EQLC 3GQBA 1GHKA 5KNDA 2PCFB 3FMCA 1Q12A 5A35A 3M85A 1E2WA 1GUGA 2KA7A 4KKUA 1CFMA 1BDOA 3TZUA 2B8GA 1SMYC 1H9RA 2AUKA 2EJFC 3U9SA 3VR3A 1LACA 4RCNA 3P20A 2A6HC 2PPBC 3LNNA 3M4YA 5C0XH 3HGBA 4KHZA 3ND9A 3VA7A 4IFDH 1GUNA 1Z7TA 2D2CC 1LABA 4KN7C 1O78A 1V8QA 2EJMA 3W3AA 1H9SA 4DNTB 3T56B 5BN4A 2DNCA 5KNBA 3KLRA 1E2VA 3PUVA 4H44C 4IQZA 4XTCS 1K8MA 3PUZA 1VDZA 3FPPA 1YNJC 3I72A 3L7ZC 2D62A 2DN8A 2EVBA 3A8JE 1GHJA 2PNRC 1O7LA 4HR7B 3M7NA 1A6XA 1Y69U 2E74C 3QJYA 4JBWA 3WDNA 1Z6HA 3SE0A 4GZYC 3GD7A 3OOCA 4I7ZC 1IW7C 1GUOA 1Y8PB 5BN5A 4KKTA 1HQMC 1V43A 4KKSA 3VR6A 5K36H 3LWUA 3I4LA 3A8IE 4DK1A 3ND8A 4BA2I 2BE5C 4BA1I 1OXSC 1Q1BA 2E76C 4TKOB 4XIGS 3H94A 5C0XG 3QG1A 3VR2A 1GUSA 2A6ED 2LMCB 2EDGA 1T5EA 2A69C 5K36G 3MFYA 2K33A 2AWOA 2IT1A 2V4DA 4G7HC 2B8FA 2A6HD 2QF7A 4OO1H 2NN6G 2JXMB 2E75C 1OXVA 1ONLA 2AUJD 1VF5C 3IFTA 2BA1A 1EWHA 2F1MA 3D31A 2JE6I 1H9MA 2YYZA 4G7ZC 5JEAG 3RLFA 3A8KE 4KMUC 3T51B 3AB9A 4DK0A 1Q1EA 1DCZA 2BDOA 5KNCA 4OGQC 1CI3M 2NN6H 2K7VA 4IFDG 3D4RA 1H9JA 3PUXA 1IYUA 1CTMA 3PV0A 4LJZC 4OO1G 3PUWA 3MXUA 2A68C 1GUTA 1TU2B 3N6RA 4H13C 1IYVA 1ZKOA 1G291 1HPCA 2KCCA 4G7OC 4L8JA 3NE5B 1Y8NB 1ZYRC 2A69D 4LK1C 3VR5A 1H9SB 2EJGC 2K32A 5JEAH 3A7LA 3QIAA 3A7AB 3CRKC 2JEAI 2BE5D 2ZT9C 3OW7A 3IKJA 2CW0C 3BDOA 1HCZA 1H9KA 2A6EC 1B9NA 2BA0A 1FR3A 1Q90A 3CRLC 1QJOA 1OXUA 2L5TA 4PV1C 1FYCA 1K8OA 3SDZA 3BG3A 2JEBI 1TKWB 2O5IC 3PUYA 3T53B 1GJXA 4KN4C 3I73A 1PMRA 5BN3A 1OXXK 2Q8IB 1VF7A 1E2ZA 3VR4A 2NN6I 1VCIA 1DD2A
chains in the Genus database with same CATH superfamily
2R7DA 1PH3A 2L9HA 1B53A 1EFWA 3A5ZB 3CD6A 3S17B 3NTIA 4CJ2C 3I4NG 2IHFA 1IKLA 1TWHB 2O5JC 1LTSD 3HOXB 3GTLB 4V0BA 4L5QA 1IW7D 3UDFA 2E2HH 2UUBL 1A2TA 3DMUA 3H3VC 4M8AA 1SEBD 1EY7A 4LUOA 2JA5G 1SJHD 3NK9A 4A3FG 3T1YL 5C0XH 1GUNA 3HOYB 4TSSA 4JBMA 1V8QA 1HZAA 1JJGA 2B2UA 4CHTB 5DNFA 1LTAD 4XTCS 2EY2A 3L7ZC 4WJ3M 2EVBA 3A8JE 4FXGC 3G48A 1P16A 1PZID 1A6XA 1UUPA 4IUNA 4RKBA 4A3EH 2Z9HA 4GN5A 5IWAQ 1VQDA 3HOVH 1U4RA 2YU9B 1L0YB 5CV4A 4DU9A 1KNAA 1FL0A 4A3JH 3GTOH 3TEHB 3TN2A 5M3FG 1SYEA 2N8NA 2R3ZA 1DOLA 3K59A 3HOVG 3HOUB 1PH9A 2ZTCA 5CORA 5FJ8G 4AH6A 1CKNA 3G7LA 2V4DA 2ZM6Q 1LLRD 4IZ8A 5IGCA 4B9XA 3GO5A 1XJVA 5I2XA 3HOUH 1H9MA 4ZUIA 1BCPD 1Q1EA 3NP8A 5GROA 5IYBH 4DPGA 3D4RA 4DR4L 2A68C 1TU2B 3EA6A 1KIXA 1JWMD 4A3BH 2GA4B 4LK1C 2Z6KC 3A5UA 4G57A 4DAVA 4A3MB 4CBVA 1QVFA 4UP7A 3VYTA 3RNUA 3DWAA 4KY5A 3FRPB 2PQEA 3J7AV 4DV6L 3I4MB 3BG3A 2B2UC 3D6CA 2JA5H 2VW9A 2NVYB 5IT9c 2WV6D 2F0JA 3HOXG 4MN3A 1VCIA 4B08A 1TVXA 2BH2A 4A3GG 3M3YH 1DXMA 3UI2A 3NPPA 4R4IA 1M4VA 3EBEA 3HG9A 1BR9A 2GVAA 1PH8A 1FJGQ 2KEDA 3E0JA 4A3EG 4FNFA 1LTGD 4DR1L 5EKIA 1GUGA 1IKMA 4K6DA 1VQEA 3EVQA 2WINB 4C2MB 4IFDH 2F0WA 4IUTA 4X3TA 4YHHL 4CDCC 5KIXA 1O78A 2R92G 2Z4IA 2H1EA 1N34Q 1AW7A 4JI5L 5D3DA 1K8MA 3RZOH 5FO7B 3WWVA 2CWAA 4DV6Q 1EIHA 2QILA 5CC4A 2KECA 1JOQA 2PO4A 2NUCA 5GADC 3ULPA 2WKDA 4KTAA 4ZQ3A 1BCPC 1UAPA 4QGUA 3KJPA 4NMZA 3ND8A 4K0KQ 3PF4A 1RD9D 5E3FA 3DLLA 3CCSA 2IX1A 4Z9CB 2A6ED 3K80C 4RWSC 5G3LD 3H3VI 5K36G 1X3PA 3ZYYX 2NBFA 4DR2Q 2ZTDA 2K5NA 5EKLA 1LTLA 1QUQA 2E75C 3GTPH 1HUMA 1G91A 1AZPA 3D31A 5I2YA 2VQEQ 4GNXC 1WTXA 2MFIA 1HA6A 2KUMA 3K7AH 4F7XA 3PF5A 2F3IA 1AH9A 4N9TA 1ZYRC 1MHWC 2TMPA 5IP7G 3A7LA 2L0CA 3ERSX 2MJ8A 2K1BA 2N78A 2A6EC 2BOSA 3CCMA 3CRLC 2B2TC 3K5MA 5IGFA 3CC2A 4QB4A 1SE4A 3KYHC 4XQJA 1YI2A 1E2ZA 1EOTA 1F9RA 4DK6C 3KF6B 4HCSA 4JI2L 1D7QA 3HOZH 3FKIH 5C5LA 4TQUS 2Q2IA 3U9OA 4DAMA 4XQQA 4LMQD 2L1BA 4JK1C 2PZWA 5M5WB 3SXHA 4AYBE 3J7AF 2R6GA 4A3CG 2Z1CA 3J81E 1B9MA 2R92B 3EQLC 2YV5A 3GQBA 1GHKA 4X66L 4DK3C 3PMFA 4UP8A 3TP6A 1BDOA 1JWUD 1WTOA 1H9RA 3IRBA 2JQOA 2RBMA 3BDLA 3NQIA 5F2DA 3JAMc 4IURA 1G51A 2EJMA 4JV5L 1J5EQ 2DNCA 1EQTA 1EY6A 3KLRA 4NXNQ 3WOEA 3FPPA 1AE2A 1GOZA 1CA5A 3R3OA 4HSVA 2VS1A 2KOLA 1IBKL 2UUAQ 1PTOB 3VYRA 4GZYC 1K83B 4LW1A 1XMOQ 4C3HH 4IALA 1FGBD 1IHZA 1I4QA 1WTPA 1C4QA 2RF4A 1G8ZD 1SMYD 3HOWG 3KBGA 5IWAL 3VYUA 4KJNA 5C0XG 4LNQA 2QKIC 4N8X1 1GUSA 2NVXH 3TREA 3HOZG 1TY2A 5C4ZA 2Z6BA 3I8ZA 3ITPA 4KHPL 4B3ML 5FOBB 4HIOA 1PDQA 1IL8A 1PYBA 4NKLA 1OXVA 1VF5C 1S5FD 1STNA 3ZJYC 4A3BB 1MJEA 4QUFA 2YYZA 1PTOF 2LKVA 4FP5D 3T51B 4MIUA 4DV3L 4ODGA 1BVSA 1J5EL 5IP9H 4QUCA 1HPCA 2UXDL 5I6YA 1K8AC 5LMNW 2RHQB 3J80c 4MTNA 3QIAA 1CT1D 2PMZE 1WTWA 3OW7A 3Q0AA 2K14A 1AFPA 1LYLA 1PH1A 3K57A 2F0LA 2K5VA 1OTCA 2R61A 4R8NA 4JI0Q 5EBCA 4X64L 3TS2A 1HNWL 4GOPA 3I73A 1XNRQ 2EYHA 1RL2A 2F0SA 1NR2A 3DM1A 4B3SL 1NMFA 2B63G 4IOCA 2C5CA 2KVMA 1E22A 4A3IB 3FPUB 3CC4A 4JI6Q 3EJIA 1TWCH 2A68D 3HZXA 1C9OA 1NNXA 4FF4A 1HFGA 5IT9E 1JR0D 1X54A 2EYLA 2E2JB 1EU4A 1MSHA 3S24A 4JI8L 4NW2A 2HQEA 1Q82C 2PW7A 2F0EA 2NVYH 1IZ6A 1L1OC 1TR5A 1TWAH 2PPBC 2Q2HA 1XWEA 1NMGA 5EPKA 3HOXH 3SR1A 2R92H 1N34L 1F9PA 3I4MG 3TP5A 3D4WA 3S16B 4JYAL 5KRUA 1PH2A 3C46A 3M7NA 2E74C 4DUYL 4HJ9A 1X6OA 1PZKD 3L3OC 5FJ8H 3DWQA 3VR6A 1SXTA 2NVTB 2VQFL 1CHQD 1VQ4A 3KLSX 2SNSA 4UHVA 2PW5A 1KAWA 1NAPA 2LFNA 4BY7G 1K0RA 5JPNC 5H1SE 4A3EB 3DEOA 4JVZA 4DFAA 3PIP3 5I6WA 1ZXTA 2B8FA 5IYBG 1STHA 1RTOA 4A93H 2B2VC 5C3EH 4DR6L 3FP9A 1ICFB 4BBRG 2FHTA 3IFTA 1FVIA 1K9MC 1KABA 5I4DA 4UP9A 3EN2A 2NVXB 4JI8Q 1DCZA 4DV7L 2K03A 2RQXA 1PTOD 1F2YA 3F2CA 4GKJL 4G7OC 2GVBA 3KLWA 4RGOS 5EKKA 2KHIA 1RF2D 4BWGB 5FLXc 1WJJA 4A75A 4A3IH 4TRDA 1PRTB 2D0OA 4XT1B 2BDNA 1IL2A 1G6ZA 1HTLD 1F2LA 1UE6A 1TWCB 3GTGH 4PNYA 4K2LA 4JI6L 3DEPA 2MO0A 1KL9A 2E2JH 4CKBA 1CSPA 4KY7A 1TWGB 5E4WC 2B39A 4JI0L 3TQYA 3CCUA 4QCLA 1L0WA 3K5NA 1I4GA 4M1UB 4HTHA 1RCVD 2SEBD 2ZJQA 2X6GA 2Y0SE 2K5QA 1PFSA 5LL6S 3D6WA 1HHVA 1X3QA 5JVH3 3S16H 3S2HB 1JC7A 4A3KB 1SYCA 5ELFA 1S72A 3K0XA 3ULJA 2RCFA 1K83H 2D5DA 2ICIA 3U50C 2K6AA 3VA5A 1QNUA 4PZ7A 3NUCA 4J15A 5CGKA 1W6KA 4DNIA 3U9SA 5IT9L 4WRDA 1QZGA 1SNQA 2FJ2A 1MSGA 1RJTA 1KC8C 1H9SA 3T56B 3BS1A 4H44C 4EVOA 3PUZA 2DN8A 2KHJA 1LUZA 2AQ3B 1ASYA 4UY8C 5C3EG 4JBWA 2F3VA 2HHHQ 2R93B 1EQRA 1SLJA 3H15A 1HQMC 1V43A 5CV9A 5A2QL 1PH5A 3CCJA 4R4QA 1EZ6A 1LTBD 1X55A 1OXSC 1QE6A 4DV2L 3FDTA 4OWWB 2K01A 1SNOA 3MVVA 4HAEA 4K5WA 2M2LA 1Q3LA 4ZKCB 2F0QA 4DUZL 3Q6SA 5D14A 4NXNL 4ZLTF 2NVTH 4A3MH 2QF7A 4OO1H 2NN6G 1YITA 4B3TL 1EZ8A 3RN2A 1BXTA 1HA5A 5EPJA 3E6ZX 1SE8A 3NXWA 4C3IG 1Q8IA 2Q2UA 1Q81C 3CP0A 3G6EA 3GP7A 3VYSA 5JJIA 2HCCA 1C48A 1DONA 3J7YW 4X65Q 4DV4L 4A93B 5L37A 3GTJB 3MTSA 1WD0A 4GKJQ 1EUJA 4KLKA 1KLGD 2SNMA 1EYDA 3BDOA 2VXWA 1V9PA 3SK5A 4K6LA 4LUZA 5FO8B 4LF9L 2F4VL 2YTYA 2HIVA 5J22A 4JI3L 2IL8A 1A62A 1PHJA 2G5DA 1MBYA 4K14A 3HKZE 3TMEA 5IOCA 1SE3A 5ELOA 1BBXC 3HRZC 1AEXA 1YJ9A 3BJUA 2LY7A 5J1ZA 2F03A 2RKSA 3EFXD 3K81C 1HTPA 5JJKA 4H7BA 4Q5VA 1NJIC 1S40A 4UPAA 4X3KA 3MFGA 3T4AC 1Q12A 5FLXL 5JVG3 1XMQQ 3KFUA 1E3PA 1LTRD 3M4QA 1B8AA 4DA2A 1Z9FA 3G6JB 4BBSB 1X3FA 1JJCB 1SYFA 5CV6A 1X32A 3G4SA 4OEMB 4A4IA 2H4OA 4PZ8A 1CQVA 4O1NA 4IFDJ 1DGSA 2GN5A 1DZ1A 1YNND 2XIWA 1ET9A 2AKWB 1Q8KA 3WDNA 4YCWA 3PO3H 5C3WA 4JC0A 4CKCA 4I7ZC 1EEFD 4LF5Q 1NE3A 3I3CA 5E1FA 2K50A 3NBHB 4BA1I 3DWPA 3K5LA 1GKHA 3CKIB 4TKOB 3Q22A 4DR5Q 5C4XH 3S1MH 3K7UC 4IJHA 2F0FA 1SE2A 2B2YC 1BBWA 3SEBA 3F8TA 4MHEA 1JB7A 1XNRL 3ICEA 4ZKBB 1HNWQ 2WAQG 2KCNA 1EU3A 1EWHA 4G7ZC 5CBAE 4H02A 1N33Q 1HRJA 5C44B 1F77A 2VQFQ 3UE0A 1JJ2A 2N88A 1Y1VH 3M4PA 1O7ZA 3HKZB 1ZEQX 1STGA 5IYDH 1U4PA 4YWKA 4DR3Q 4ME3A 2EXDA 2K75A 5C0XJ 2ZT9C 1SN8A 4OXPA 4P72A 3TP8A 1PRTD 2HD3A 4BY7B 4DUZQ 2M9VA 4HN7A 2QW7A 5GAHC 1YHQA 4QMGA 1OO9B 4NP5A 3S2HH 3L9AX 4GOPB 2XWBB 1KRSA 5CMDA 4DR3L 4DV0Q 3GV6A 1CZWA 5T1GA 3DXJC 3BZKA 2NWGA 2IPKD 5BR8L 3LWEA 2I0QA 2JA6H 2B2VA 3RZOB 1VQPA 5IIFA 3HOYH 4BBSG 1N32L 5GAEC 1D1KA 1A63A 1E1TA 2A73B 3I4MH 2X6LA 1O80A 1PFNA 1YIJA 4JBKA 3X3MA 3CQZB 2TSSA 4X3SA 1VQ5A 4LF5L 1SRUA 5KGUA 4KHZA 1XPOA 2ICEC 2D0PA 3OWEB 3W3AA 1I6HB 1B50A 4JV5Q 3CW2C 4DR5L 1IYJB 3B6YA 2IX3A 1STYA 3CQZH 4XYQA 3UDGA 1A2UA 3I7FA 3S1RH 2LXJA 4YY3L 3GD7A 1HR0L 1R4PB 1ET6A 4DR7L 4RGNA 1WTVA 2E2IB 1EIYB 1VQIA 3CPFA 3KF8A 3STBD 2Y0SB 4KK7A 3J80i 5IYCH 2E8GA 1VQ7A 4BBRH 3V96A 1A3UA 2E76C 4WJ4A 3PSIA 3H0GH 1EFID 2VY3A 4L5TA 1JOOA 2K33A 4QIWE 2XTIA 1EYGA 1N33L 1MGSA 3KUPA 5C44G 4X62L 1EY4A 2QDLA 2ZM6L 2VB3X 5IY0A 4B3MQ 2JXMB 1WTRA 3OMCA 2PMZB 1KDBA 2BA1A 1XX8A 1P8LA 1UE5A 3OYYA 4RKLA 2F0GA 3AB9A 1PZJD 1EL0A 1SROA 1XTCD 3K6OA 4BXXG 1XTDA 5C5MA 3NBIA 4O42A 3G71A 4L5SA 3AYHB 3X3NA 1S5DD 1X56A 3NEMA 4NXMQ 3GTGB 2F0MA 2XN9C 4JCVE 4NB3A 3L2PA 3MAQA 4K0KL 1YHAA 4RHSA 3K8AA 1E24A 2BE5D 1XYIA 1S3OA 4EQNA 3WOFA 3CCVA 1Q90A 1X9NA 1TQOA 4RH6A 2QEXA 5E7NA 1LT3D 5LL6X 4A3DG 1VMPA 2JEBI 3JC66 1QCBD 3PUYA 4JI4Q 1PMRA 2F0UA 3K0YA 2Q8IB 3NELA 3UDXA 2JA7B 3FEWX 1I94L 4XXEA 4J8QA 1PFMA 2XWJB 1JORA 5LMUL 2WFWA 4C3IB 2O4XA 4KHPQ 2M00A 2OCEA 5DM63 3NBHA 4KD3A 2OWOA 1L2FA 4A93G 2I5LX 5ELNA 1SFOB 3S2DB 5IODA 1SMXA 1GM5A 3IAYA 5DAUA 4WJWA 4P73A 4C3HB 4LFAL 4GN4B 1C8CA 4G4KA 1CFMA 1B2TA 1AE3A 4ULLA 3SK6A 1HNXQ 2JA6B 3HGBA 3VA7A 1Q86C 3S15B 4R4CA 3U4VA 3TS0A 3PUVA 2KHSA 3K5OA 3HS0C 2A74C 1G2SA 5I9PA 4IUQA 2HIXA 2IHEA 4QY7A 2WKCA 3NSWA 3S15H 1HFNA 1RDPD 5BN5A 2B29A 1O7IA 3MXPA 3PGZA 5M3MH 3CC7A 3OIPA 2CWPA 1I3QB 4IUPA 1RHPA 5FLXE 4XDXA 2VL6A 1VQKA 4A3BG 3S1QH 1I5FA 1T5EA 4YCUA 3AQQA 1FNUA 5EJWA 3C2PA 4HMIA 1XPUA 4BY1G 2UU9Q 2QGQA 1RIPA 2JA8G 1VQBA 2B2WA 4EQOA 2ZJRA 5IP7H 4PMBA 2MUYA 5ELDA 4OGQC 3W5OA 4BY1H 4LF7Q 1VQMA 5IGGA 3PV0A 1CTMA 4IOAA 1D5ZC 1YNXA 2CH4A 1QVGA 1Z47A 4CKEA 4GS3A 1WCMG 5M3FH 1SSOA 2R7ZB 3BYYB 4RG1A 3W1GA 1GXDC 2CW0C 3QO2A 1SFOH 3FKIB 2XNAC 2BA0A 4IJLA 3KJOA 5AFWA 4GLXA 4LF7L 2B63B 4GNXB 3M9BA 4IPHA 3MEFA 3U4ZA 1PH7A 1GJXA 1QVCA 5FKAC 1HQRD 1JE4A 3PCOB 4S3SA 5IP9G 3I91A 4C2MH 3RZDB 1Y1VG 1CSQA 3A54A 2UU9L 1D1IA 2X69A 5CV8A 1IBKQ 2F0VA 4F87A 2MHVA 2A19A 1YJNA 1CHPD 4FF2A 2AQ2B 1I4RA 3HKZG 2J7ZA 1STEA 3BU2A 4EQ5A 4POGA 4A3JB 4HSPA 3M3YB 3GDEA 3VR3A 1SMYC 2AUKA 2WIIB 1KHIA 5J3BA 4RCNA 2NVQH 2DGYA 2VUMH 3LNNA 1YJWA 4ZYSA 1BCPF 2WAQE 1JE5A 3PO2H 2ZTEA 2A8VA 1PH6A 2SOBA 4HJ7A 4QIWB 1YNJC 4DV3Q 3SHLA 2PNRC 3MHBA 1Y69U 3SE0A 1VQ9A 4KHVA 2NZHA 3L0OA 1KD1C 3DUZA 1IXRA 1XNQL 4KKSA 4LWCA 1W6JA 4DAPA 3LWUA 4DKAC 3CCQA 1CZGA 2F0HA 4UAIA 2QCPX 2NTTA 2EDGA 4K5XA 2ZXPA 4APVA 3BZDB 1X3GA 1YNJD 1KTKA 4CDFC 1GD7A 3STBC 1EIFA 2OEOA 4A3CH 1KDCA 4Y7NH 1UWVA 3S1MB 1JMCA 3Q8DA 3AFQA 1WCMB 3H3VH 4JI7L 4ILWA 2R7ZG 3PUXA 2JA7H 4K5VA 1K3BC 3GTPB 3IFDA 4OONA 2VQEL 2HHHL 1Y8NB 2A69D 1A0IA 1VS0A 4C3IH 2RSNA 2SDFA 4K8JA 1A3VA 1ILQA 3HOWB 1U4LA 4A3KH 1SAPA 1HCZA 4IPCA 1Y1VB 3PIO3 2QDBA 1CKNB 1MI2A 4JG2A 3T1YQ 1EY0A 3SK8A 3MC0B 1ENCA 4CDDC 3JAMi 4JI2Q 3OSOA 1DD2A 2UUBQ 3BVMA 3OHXC 2UUCQ 2PZUA 1U9RA 4A3JG 1AZQA 3U58A 5C0XI 3BVGA 1WOCA 1V1OA 2CW0D 2NZOA 1OXTA 3PO3B 3RZDH 1B3AA 4DXFA 5A35A 3J80L 5D3IB 4AQYL 4KKUA 5M3MB 1KRTA 1W3SA 2K52A 1CKOA 3P20A 1HNXL 3S1RB 2A6HC 4ZUJA 2CCZA 5M5XH 3GTMH 3OIQA 2OTJA 1WFQA 2B2YA 5KNBA 5C4XB 1SR3A 1BUVT 4IQZA 3S1NB 1K28A 4OO1I 1VDZA 3S14B 1D5XC 4C3JG 4NDXA 4B9WA 1EEID 5EPLA 5CR3A 1O7LA 2FINB 4FO2A 4N8FA 1QILA 1WVLA 3I4NH 3RD4A 3I56A 1D5MC 1YVCA 3H0GG 2L11A 2HUGA 2F0OA 4C1NK 3I4LA 2L55A 4LF8Q 2N3SA 1M8AA 1II3A 3CCEA 5HY6A 1BNZA 4JI4L 1PTOC 4XIGS 3DHQA 2LMCB 1EQVA 2RHSB 1PYSB 2B2WC 1EWIA 1UE1A 3NWTA 4C3HG 1S5ED 1ZYRD 5JJZA 4FF1A 4L6TB 1R4QB 2A1AA 4R9WA 4WORA 2JA6G 4O2DA 4CDEC 5M5YB 3MZ5A 2YU9H 2R93H 1GUWA 2ES2A 2XGTA 1KNEA 4X66Q 1JT8A 4IO9A 3RLFA 1I3QH 1TY0A 1G6PA 1KQSA 3QB3A 1IYUA 4JI1L 1MIUA 2FXQA 4ZK9B 4DV5Q 1QWYA 1V1QA 3C3LA 2KCCA 4R4OA 3A0JA 1T9HA 5JEAH 2JA5B 2JEAI 3GV3A 1ENFA 3MXGA 2EYFA 4A3FB 2UUCL 1HUNA 1F2ZA 1HXYD 3D0FA 1FR3A 5NUCA 3NTKA 4EX5A 2JK8A 1FYCA 1CKMA 1KDAA 2XSCA 4RA8A 5FK9C 1K8OA 5C4HA 2O5IC 3KK7A 1A8VA 4ID6A 3E9HA 3T16A 3I90A 2JA8B 2AMCB 2NN6I 4HJ5A 3KDFB 2JN4A 1O7YA 3CPWA 1EY5A 2N55A 4DR2L 5M3MG 1NBWA 2R7FA 5CV7A 1UE7A 3QOLA 2EY1A 1BOSA 3KF6A 1CK1A 4IFDI 1ICWA 2K04A 4KI0A 1Y1WH 1AP0A 4FF3A 4DAYB 1L1OB 1X65A 4B3SQ 5KNDA 3HKSA 1R9TB 4LFCL 4LF4L 2I07B 1ASZA 2E2IH 2B8GA 1SNMA 4OHJA 1EY9A 4U68A 4OIKA 3CHBD 1ENAA 3M4YA 4OIJA 4YCVA 2D2CC 3RLOA 2C35B 3FKIG 1TWHH 4KN7C 3RN5A 1VQGA 1SJED 3H0GB 3J81j 1NTGA 1EQQA 1SNDA 1VQLA 4K2KA 1SNCA 4LF6L 2IJ0A 1XXGA 4IN3A 4IUUA 1BCPB 2DJGC 4FXKC 3S1NH 1NY4A 4ZCKA 2NVQB 2HDLA 4A3KG 3MEHA 1XMQL 2ASBA 5T1IA 4KD4A 2JJQA 3T1HQ 4XQNA 2KJXA 3GTOB 4BS9A 2F0IA 3HFZB 4OELB 1D6EC 2HQLA 3NQTA 5G3LF 4G7HC 3M4OB 4X3UA 2DY7A 4L63B 4FXDA 4EQPA 2CFMA 4BY7H 4FVMA 2F1MA 4RAUC 1B3QA 2VB2X 4A3GB 3A8KE 1Y14B 3HOWH 1SDFA 3R93A 3MXNA 4IFDG 1IBML 1H9JA 3D3RA 4YWLA 5C3EB 4LJZC 5FO9B 1IYVA 3GTKH 1NR4A 2F0PA 1VMCA 2F4IA 3AU7A 4HIMA 1H9SB 4RGTA 1FNVA 2YTXA 2UUAL 4JI1Q 3CRKC 4LUVA 5IGBA 3S17H 3EIVA 3SVMA 4X6AH 1QJOA 3O13A 4LF9Q 1WCMH 2Q2TA 2OQKA 2MQHA 4P71A 1NUCA 5DLQE 5ELCA 5C4JB 2AWNA 4XYOA 4U673 3GTMB 2ENBA 1RKNA 2YTVA 2PI2A 2FFKB 2B63H 1MKHA 1Y1WG 1M1KC 2F52A 2EYOA 3TBIB 1QOHA 5C6AA 2QEJC 4DGZA 4JBJA 4QJFA 5M5XB 2VUMG 3VDYA 1LT4D 5CYUA 1EIGA 3FMCA 1C7YA 4JPBW 1JOKA 3LGJA 2KA7A 2UXBQ 2RDGA 1LACA 3Q24A 1UNSA 1PTOH 1YHBA 5LMUQ 4GKKL 3RMHA 4PMWA 1K8GA 3S2DH 1VQFA 4C56C 2RSOA 4PQXA 1E2VA 3BYTB 1MJCA 2EPBA 1PLFA 5HURA 4Y52H 5M5WH 4POFA 1TT2A 3F1ZA 3QJYA 4HMJA 4AQYQ 1Y8PB 1KLUD 1SYBA 1LT5D 2Z0SA 4ZRZA 1B44D 2J0TD 1U0LA 1JWSD 3H94A 2KCTA 3JAML 1QUQB 4YIJA 3MFYA 1K0SA 2P5ZX 3H09A 5I9OA 5M3FB 1N9WA 2J4XA 3D8GA 4OL7A 3ER0A 3KOJA 1WD1A 1ONLA 3I55A 5EGTA 4GOPC 3HOUG 1D8LA 1HNZQ 3P1HA 5COYA 2WB1G 2WACA 2I5MX 1WTHA 3QOJA 4DN4M 3ONAB 4C3JB 4DR1Q 3GTQH 3PUWA 2K5HA 4O0AA 5FLMG 3OWFA 3NHHA 1DM0B 2MGSA 4ABNA 3QWNA 2O2LD 1KAAA 1PFBA 2KENA 2EXZA 2LS01 2RDFA 4I65A 5ISRA 4LAAA 3K7AB 1H9KA 2DY8A 3F2DA 4HJ8A 3I4OA 1IBLQ 4J6HA 5LHY1 3R8BA 4A3MG 1QB5D 3CU7A 2PI2E 4RFBA 2NYZD 3UE1A 4ALPA 4RCOA 2VUMB 2PZTA 2I46A 2MNAA 1EWCA 3A55A 4BBSH 1WTQA 2KQ3A 4CJ1B 2ATWA 1HH2P 1Y8OB 2K05A 1N8RC 4R1JA 4DNRB 3FVQA 4DV7Q 1F9QA 4H0LC 4QF4A 1PV4A 4V190 3HOZB 2PCFB 3F2BA 1E0BA 1HR0Q 1JCKB 4DNTB 2K28A 4A3LG 4DAYA 2EJFC 5KEEA 1D2BA 3AMUA 1E7ZA 1ESRA 4Q0FA 4QQBX 4DUYQ 1TS3A 4PZ6A 5E4XA 1BQQT 5IYDG 3W1BA 1HJPA 1EOVA 2F3WA 2OF1A 2UXCQ 2EZVA 3A74A 3J81c 3BVZA 4MTKA 1L0XB 4DV1Q 4N9PA 4F88A 4A3GH 3F2UA 5D65A 3PIPA 2F0NA 4BA2I 4BY1B 3GTQB 2A5HA 4P75A 3J7ZC 2Z6KA 3DM3A 5J39A 1VQOA 4X62Q 2EQSA 4KV6A 1XNQQ 1I50B 1LTTD 4BXXH 2AUJD 2L4NA 4FDBA 1HNZL 1VQ8A 2KEEA 2ZXOA 3PO2G 1VQAA 2Q8RE 4MNOA 1JQYD 4A3IG 5C3XA 4ME5A 3UDIA 1EY8A 2EY6A 5M5YH 1GUTA 4H13C 5ELBA 1CA6A 1PXUA 1I4XA 1PRTF 2K32A 5IGDA 2Y0SG 2KBNA 4EGVA 3P75A 4KY6A 1K73C 4LF4Q 4LFCQ 1SBBB 1HZCA 2L5TA 3TZDA 1V1PB 3HP3A 3RUZA 1K3RA 4KN4C 2WP8J 4A3LH 5JEAJ 1B1ZA 3GTKB 1STAA 4IPDA 4OWTB 2IY5B 3OPOA 1NSNS 2UXDQ 3BZCA 2JA9A 4JOIA 3E0EA 4L5RC 2EYPA 1J9OA 2NTSA 1QG7A 1TXYA 4K8IA 3D4DA 4NPSA 5IE8A 2DNEA 2EE1A 4JI7Q 1L1OA 1YZ6A 1BO0A 2E2DC 1I6VC 5CBEE 1FJGL 3I70A 4J1MA 1PVOA 1E2WA 3MA2B 3URYA 3J81L 2Z4HA 2NZ1D 4KJOA 4BBRB 1Z7TA 4DV5L 5JAVA 5BN4A 3PQIA 4DR6Q 3P7JA 2IX0A 4LFBL 2ALYB 4A3DB 1RODA 3I72A 2PQAB 2D62A 1CM9A 2AQ1B 4HR7B 1J8IA 4FYDA 2JA7G 5JOBA 3EROA 3SK4A 4GNXA 1NCVA 4R4TA 4OX9Q 1GUOA 5AJ3L 4KKTA 1LT6D 3NWSA 3M4OH 2RCNA 1PH4A 2RDHA 5DEHA 1Q1BA 2B3GA 1TWFH 1Q7YC 2DJFC 3K58A 5A2QE 4HEDA 3QG1A 1TS2A 3VR2A 4X64Q 3W2DA 2A69C 1IBMQ 4B3RQ 1G2TA 1WYDA 2OTLA 2AWOA 5LMNQ 4MZ9A 1F9SA 4F8MA 4GLAC 1JICA 3H6MA 4PG3A 3N52A 1CUKA 3C1EA 4B3TQ 1QZHA 4NXML 2MP1A 3AEVA 4KMUC 1ESFA 2ZJPA 1VQHA 1CQFA 2BDOA 1ILPA 3FHWA 5KNCA 4XT3B 1CI3M 4LFBQ 5HGTA 3MXNB 2EY5A 2HDMA 2JYOA 3MXUA 4P2CB 5FLMH 1X3EA 2AHOB 2CKZB 2OT2A 1S5BD 1YBYA 4X65L 4DR4Q 4Y7NB 1VQJA 1VQCA 4LFAQ 3IKJA 2FMCA 4GN3B 3IL8A 1B9NA 4LF6Q 1OXUA 2G9HD 4R8IA 3GTLH 1B4OA 1LV9A 1UEAB 1YEZA 1STBA 1V1PA 2XVSA 1TKWB 1FNWA 3T53B 3TRZA 2CQOA 2WB1E 1WI5A 4IUVA 1U4MA 3AFPA 1T5XD 4AIMA 2UXBL 1W2BA 3BDCA 4HIDA 1MD2D 2R93G 2WB1B 3CAMA 2ID0A 5LMNL 2V1CC 3V2TA 1TWGH 2K5WA 3J80E 3M7GA 3TSSA 3J7A5 3LX0A 5DM73 4DV4Q 2JA8H 5C4JH 5C4XG 3I2ZA 3M85A 4RGMA 1U5KA 2BH8A 3NENA 2B2TA 1N36L 1HR0W 2Z8LA 2ZXRA 4RHRA 4GLVB 2KCMA 5AJ3Q 1A15A 1TWFB 3ND9A 4JI3Q 1HZBA 2H5XA 1LABA 5GQOA 4RMFA 2E2HB 1N32Q 1I4HA 1E1OA 1GHJA 1I50H 2RA4A 5HGQA 4PMCA 2IWHA 4HCEA 1SYGA 4DV0L 4OX9L 5K36H 4E6IA 3ULLA 4DK1A 2LSSA 2BE5C 4DXGA 3J81i 1XMOL 2C9OA 3CMEA 3OTOQ 3KLSA 1IBLL 1S4ZA 5TSSA 5JPMC 2VZAA 4YHHQ 5C44H 2OQ0A 1JB3A 3JAME 2R7ZH 4WFN3 4DV1L 5IGEA 1BKBA 2K4KA 1FGUA 3HEJA 2JE6I 2F0KA 4ZAIA 2F0DA 4DK0A 2MPMA 1N36Q 2UXCL 4DV2Q 1J6QA 4OWXB 2NN6H 1LO5D 4I7AA 2PNHA 4OO1G 3Q23A 5M9OA 3N6RA 1G291 1ZKOA 2EYJA 1F2MA 2E5LQ 3NE5B 3VR5A 5GAGC 4UDUC 2EJGC 1KXLA 3A7AB 4A76A 1LTID 1DJRD 4AYBG 1XPRA 4CGYB 3OW2A 1LM0A 5EQ0A 5KYIA 3OMGA 4HJAA 4JYAQ 2PYKA 1B7YB 3MWYW 2XRQD 5BN3A 3NTHA 1SNPA 1Q46A 2JSOA 1TS5A 3VR4A 1I4PA 3PO2B 1H95A 3S9WA 1DOKA 1M90C 1PYWD 1EYAA 5EAYA 2DUDA 1TWAB 2CQAA 3ERQA 1YNNC 2G9DA 4LF8L 2I5HA 3A56A 3KBXA 4HIKA 4A3DH 2EIFA 3S14H 1BF4A 2RVLA 1SYDA 4GKKQ 3TZUA 2N49A 5CV5A 4DR7Q 2LXKA 1BBUA 1TIID 4P74A 3I4NB 2PQAA 2K5DA 2WAQB 4YY3Q 3T13A 2F0TA 1PA6A 1ML0D 3S1QB 5IYCG 4QL5A 3R2IA 1Z6HA 3HOYG 1DOMA 2OXPA 3OOCA 2VNUD 1R9TH 1IW7C 2HT1A 3A8IE 1VQNA 5KYLA 3KF8B 2L15A 3H91A 3RLNA 1HZ9A 3CCRA 2BCOA 1TS4A 4CJ0B 1I6HH 5ELEA 1C0AA 3PO3G 3GTJH 2F4VQ 1DYQA 1GVPA 4JOIC 3E9IA 4DF7A 2IT1A 3TDQA 2CH4W 4JW0A 2A6HD 2EOTA 4JI5Q 3SGIA 2CVRA 3OTOL 3V05A 3CCLA 2QA4A 3HOVB 5JJLA 4B3RL 2NB0A 1VQ6A 1QNKA 5JEAG 2HCIA 3E5SA 1A3TA 4A3FH 4AYBB 2K7VA 5EBDA 1FD7D 1EYCA 3CXCA 2CHBD 3C1FA 3QR8A 5BR8Q 1GO3E 2D9UA 2MO1A 2E5LL 4L8JA 1RTNA 2JP1A 2XRSD 1B70B 4C3JH 5K5PA 1UEBA 2FMMA 2L12A 4IPGA 1I94Q 4TVAB 3CF5A 3TP7A 3T1HL 3CMAA 4PV1C 4YWMA 3SDZA 3KDFA 1Y1WB 2EYMA 3R2TA 2Q8TA 3RR5A 1OXXK 4C1NI 3E3XA 1VF7A 1AN8A 1PRTC 3PIOA 2IW3A 1S5CD
chains in the Genus database with same CATH topology
2L9HA 1B53A 3S17B 3NTIA 4CJ2C 1IKLA 1TWHB 2O5JC 1LTSD 3HOXB 3GTLB 4V0BA 1IW7D 1A2TA 3DMUA 3H3VC 4M8AA 1SEBD 1EY7A 1SJHD 3NK9A 5C0XH 1GUNA 3HOYB 4TSSA 1V8QA 2B2UA 4CHTB 5DNFA 1LTAD 4XTCS 2EY2A 3L7ZC 2EVBA 3A8JE 4FXGC 1PZID 1A6XA 1UUPA 4IUNA 4RKBA 1U4RA 2YU9B 1L0YB 5CV4A 4DU9A 1KNAA 3TN2A 1SYEA 2R3ZA 1DOLA 3K59A 3HOUB 5CORA 3G7LA 2V4DA 1LLRD 4IZ8A 5IGCA 4B9XA 3GO5A 5I2XA 1H9MA 4ZUIA 1BCPD 1Q1EA 3NP8A 3D4RA 2A68C 1TU2B 3EA6A 1JWMD 2GA4B 4LK1C 4G57A 4DAVA 4A3MB 4CBVA 3VYTA 3DWAA 4KY5A 3FRPB 2PQEA 3J7AV 3I4MB 3BG3A 2B2UC 3D6CA 2NVYB 2WV6D 2F0JA 4MN3A 1VCIA 4B08A 1TVXA 1DXMA 3UI2A 3NPPA 1M4VA 3HG9A 1BR9A 2KEDA 3E0JA 4FNFA 1LTGD 5EKIA 1GUGA 1IKMA 4K6DA 3EVQA 2WINB 4C2MB 4IFDH 2F0WA 4IUTA 4X3TA 5KIXA 1O78A 2Z4IA 2H1EA 1AW7A 5D3DA 1K8MA 5FO7B 1EIHA 2QILA 5CC4A 2KECA 1JOQA 2PO4A 2NUCA 2WKDA 4KTAA 4ZQ3A 1BCPC 1UAPA 4NMZA 3ND8A 1RD9D 5E3FA 2IX1A 4Z9CB 2A6ED 4RWSC 5G3LD 5K36G 1X3PA 3ZYYX 2NBFA 5EKLA 2E75C 1HUMA 1G91A 1AZPA 3D31A 5I2YA 1WTXA 1HA6A 2KUMA 4F7XA 4N9TA 1ZYRC 2TMPA 3A7LA 2L0CA 2MJ8A 2K1BA 2A6EC 2BOSA 3CRLC 2B2TC 3K5MA 5IGFA 4QB4A 1SE4A 4XQJA 1E2ZA 1EOTA 1F9RA 4HCSA 5C5LA 4TQUS 3U9OA 4XQQA 4LMQD 2L1BA 4JK1C 2PZWA 5M5WB 3SXHA 3J7AF 2R6GA 2Z1CA 3J81E 1B9MA 2R92B 3EQLC 3GQBA 1GHKA 3PMFA 3TP6A 1BDOA 1JWUD 1WTOA 1H9RA 2RBMA 3BDLA 3NQIA 5F2DA 4IURA 2EJMA 2DNCA 1EQTA 1EY6A 3KLRA 3WOEA 3FPPA 1GOZA 1CA5A 3R3OA 4HSVA 2KOLA 1PTOB 3VYRA 4GZYC 1K83B 4IALA 1FGBD 1IHZA 1I4QA 1WTPA 1C4QA 1G8ZD 1SMYD 3KBGA 3VYUA 4KJNA 5C0XG 2QKIC 1GUSA 1TY2A 5C4ZA 3I8ZA 3ITPA 5FOBB 1PDQA 1IL8A 4NKLA 1OXVA 1VF5C 1S5FD 1STNA 4A3BB 4QUFA 2YYZA 1PTOF 2LKVA 4FP5D 3T51B 4MIUA 4ODGA 4QUCA 1HPCA 5I6YA 3QIAA 1CT1D 1WTWA 3OW7A 3Q0AA 1AFPA 3K57A 2F0LA 2R61A 4R8NA 5EBCA 3I73A 2EYHA 2F0SA 1NR2A 3DM1A 2C5CA 2KVMA 4A3IB 3FPUB 3EJIA 2A68D 3HZXA 4FF4A 1HFGA 5IT9E 1JR0D 2EYLA 2E2JB 1EU4A 1MSHA 4NW2A 2HQEA 2PW7A 2F0EA 1TR5A 2PPBC 1XWEA 5EPKA 3SR1A 1F9PA 3TP5A 3D4WA 3S16B 5KRUA 3C46A 3M7NA 2E74C 1PZKD 3L3OC 3DWQA 3VR6A 1SXTA 2NVTB 1CHQD 3KLSX 2SNSA 2PW5A 1NAPA 2LFNA 5JPNC 4A3EB 3DEOA 4DFAA 3PIP3 5I6WA 1ZXTA 2B8FA 1STHA 1RTOA 2B2VC 2FHTA 3IFTA 1KABA 5I4DA 2NVXB 1DCZA 2K03A 2RQXA 1PTOD 1F2YA 4G7OC 5EKKA 4RGOS 4BWGB 1RF2D 4TRDA 1PRTB 4XT1B 2BDNA 1G6ZA 1HTLD 1F2LA 1TWCB 4PNYA 4K2LA 3DEPA 4CKBA 4KY7A 1TWGB 5E4WC 2B39A 4QCLA 3K5NA 1I4GA 4M1UB 4HTHA 1RCVD 2SEBD 2X6GA 2K5QA 5LL6S 3D6WA 1HHVA 1X3QA 5JVH3 3S2HB 1JC7A 4A3KB 1SYCA 5ELFA 2D5DA 2ICIA 2K6AA 3VA5A 1QNUA 3NUCA 5CGKA 1W6KA 3U9SA 5IT9L 4WRDA 1SNQA 2FJ2A 1MSGA 1RJTA 1H9SA 3T56B 3BS1A 4H44C 4EVOA 3PUZA 2DN8A 2AQ3B 4JBWA 2F3VA 2R93B 1HQMC 1V43A 5CV9A 5A2QL 1EZ6A 1LTBD 1OXSC 1QE6A 3FDTA 2K01A 1SNOA 3MVVA 4HAEA 4K5WA 2M2LA 1Q3LA 4ZKCB 2F0QA 3Q6SA 5D14A 4ZLTF 2QF7A 4OO1H 2NN6G 1EZ8A 1BXTA 1HA5A 5EPJA 3E6ZX 3NXWA 4C3IG 1Q8IA 3GP7A 3VYSA 2HCCA 1C48A 1DONA 3J7YW 4A93B 3GTJB 3MTSA 1WD0A 1KLGD 2SNMA 1EYDA 3BDOA 2VXWA 5FO8B 3SK5A 4K6LA 5J22A 2IL8A 1MBYA 4K14A 3TMEA 5IOCA 1SE3A 1BBXC 3HRZC 1AEXA 2LY7A 5J1ZA 2F03A 2RKSA 3EFXD 1HTPA 4H7BA 4Q5VA 4X3KA 3T4AC 3MFGA 5FLXL 1Q12A 5JVG3 1LTRD 4DA2A 3G6JB 4BBSB 1SYFA 5CV6A 1X32A 2H4OA 1CQVA 4O1NA 4IFDJ 1DZ1A 1YNND 2XIWA 1ET9A 3WDNA 5C3WA 4CKCA 4I7ZC 1EEFD 3I3CA 5E1FA 4BA1I 3DWPA 3K5LA 3CKIB 4TKOB 3Q22A 2F0FA 1SE2A 2B2YC 3SEBA 4MHEA 4ZKBB 2KCNA 1EU3A 1EWHA 4G7ZC 5CBAE 1HRJA 5C44B 1F77A 2N88A 1O7ZA 3HKZB 1ZEQX 1STGA 1U4PA 5C0XJ 2ZT9C 3TP8A 1PRTD 4BY7B 2M9VA 4HN7A 4QMGA 1OO9B 4NP5A 3L9AX 2XWBB 5CMDA 3GV6A 1CZWA 5T1GA 3DXJC 2NWGA 2IPKD 3LWEA 2B2VA 3RZOB 5IIFA 1D1KA 2A73B 2X6LA 1O80A 1PFNA 3X3MA 3CQZB 2TSSA 4X3SA 5KGUA 4KHZA 2ICEC 3OWEB 3W3AA 1I6HB 1B50A 2IX3A 1STYA 4XYQA 1A2UA 3GD7A 1R4PB 1ET6A 4RGNA 1WTVA 2E2IB 3KF8A 2Y0SB 4KK7A 3V96A 1A3UA 2E76C 1EFID 1JOOA 2K33A 1MGSA 3KUPA 1EY4A 2VB3X 2JXMB 1WTRA 3OMCA 2PMZB 1KDBA 2BA1A 1XX8A 4RKLA 2F0GA 3AB9A 1PZJD 1EL0A 1XTCD 3K6OA 5C5MA 3NBIA 4O42A 3X3NA 1S5DD 3GTGB 2F0MA 2XN9C 3MAQA 4RHSA 2BE5D 1XYIA 4EQNA 3WOFA 1Q90A 1TQOA 4RH6A 1LT3D 5LL6X 1VMPA 2JEBI 1QCBD 3PUYA 1PMRA 2F0UA 3K0YA 2Q8IB 2JA7B 3FEWX 4XXEA 4J8QA 1PFMA 2XWJB 1JORA 4C3IB 2O4XA 2M00A 5DM63 3NBHA 4KD3A 1SFOB 3S2DB 5IODA 3IAYA 5DAUA 4WJWA 4C3HB 1C8CA 4G4KA 1CFMA 1B2TA 4ULLA 3SK6A 2JA6B 3HGBA 3VA7A 3S15B 3PUVA 2KHSA 3K5OA 3HS0C 2A74C 1G2SA 5I9PA 4IUQA 2WKCA 3NSWA 1HFNA 1RDPD 5BN5A 3MXPA 3OIPA 1I3QB 4IUPA 1RHPA 5FLXE 4XDXA 1T5EA 1FNUA 5EJWA 3C2PA 4HMIA 2B2WA 4EQOA 4PMBA 2MUYA 5ELDA 4OGQC 5IGGA 3PV0A 1CTMA 1D5ZC 1Z47A 4CKEA 1SSOA 2R7ZB 3BYYB 1GXDC 2CW0C 3QO2A 3FKIB 2XNAC 2BA0A 5AFWA 2B63B 1GJXA 5FKAC 1HQRD 1JE4A 4S3SA 3I91A 3RZDB 3A54A 1D1IA 2X69A 5CV8A 2F0VA 4F87A 2MHVA 1CHPD 4FF2A 2AQ2B 1I4RA 2J7ZA 1STEA 4A3JB 4HSPA 3M3YB 3VR3A 1SMYC 2AUKA 2WIIB 4RCNA 3LNNA 4ZYSA 1BCPF 2SOBA 4QIWB 1YNJC 3SHLA 2PNRC 3MHBA 1Y69U 3SE0A 4KHVA 3DUZA 4KKSA 1W6JA 4DAPA 3LWUA 1CZGA 2F0HA 4UAIA 2QCPX 2NTTA 2EDGA 4K5XA 2ZXPA 3BZDB 1YNJD 1KTKA 2OEOA 1KDCA 3S1MB 1WCMB 4ILWA 3PUXA 4K5VA 3GTPB 3IFDA 1Y8NB 2A69D 2RSNA 2SDFA 4K8JA 1A3VA 1ILQA 3HOWB 1U4LA 1SAPA 1HCZA 1Y1VB 3PIO3 2QDBA 1MI2A 1EY0A 3SK8A 3MC0B 1ENCA 3OSOA 1DD2A 3BVMA 3OHXC 2PZUA 1U9RA 1AZQA 5C0XI 3BVGA 1V1OA 2CW0D 1OXTA 3PO3B 1B3AA 4DXFA 5A35A 3J80L 5D3IB 4KKUA 5M3MB 3P20A 3S1RB 2A6HC 4ZUJA 3OIQA 2B2YA 5KNBA 5C4XB 1BUVT 4IQZA 3S1NB 4OO1I 1VDZA 3S14B 1D5XC 4C3JG 4NDXA 4B9WA 1EEID 5EPLA 5CR3A 1O7LA 2FINB 4FO2A 1WVLA 1QILA 3RD4A 1D5MC 2L11A 2HUGA 2F0OA 4C1NK 3I4LA 2L55A 1M8AA 1II3A 1BNZA 1PTOC 4XIGS 3DHQA 2LMCB 1EQVA 2B2WC 3NWTA 4C3HG 1S5ED 1ZYRD 5JJZA 4FF1A 4L6TB 1R4QB 4R9WA 4WORA 5M5YB 3MZ5A 1GUWA 1KNEA 3RLFA 1TY0A 3QB3A 1IYUA 4ZK9B 3C3LA 1QWYA 2KCCA 5JEAH 2JA5B 2JEAI 3GV3A 1ENFA 3MXGA 2EYFA 4A3FB 1HUNA 1F2ZA 1HXYD 1FR3A 5NUCA 3NTKA 1FYCA 2XSCA 1KDAA 4RA8A 5FK9C 1K8OA 5C4HA 2O5IC 3KK7A 4ID6A 3T16A 3I90A 2JA8B 2NN6I 1O7YA 1EY5A 2N55A 5CV7A 2EY1A 3QOLA 1BOSA 4IFDI 1CK1A 1AP0A 1ICWA 2K04A 4KI0A 4FF3A 5KNDA 1R9TB 2I07B 2B8GA 1SNMA 4OHJA 1EY9A 4U68A 4OIKA 3CHBD 1ENAA 3M4YA 4OIJA 2D2CC 4KN7C 1SJED 3H0GB 1SNDA 4K2KA 1SNCA 2IJ0A 1XXGA 4IN3A 4IUUA 1BCPB 4FXKC 2NVQB 2HDLA 3MEHA 5T1IA 4KD4A 4XQNA 2KJXA 3GTOB 4BS9A 2F0IA 1D6EC 3NQTA 4G7HC 5G3LF 3M4OB 4X3UA 2DY7A 4L63B 4FXDA 4EQPA 4FVMA 2F1MA 4RAUC 2VB2X 4A3GB 3A8KE 1SDFA 3R93A 3MXNA 4IFDG 1H9JA 3D3RA 5C3EB 4LJZC 5FO9B 1IYVA 1NR4A 2F0PA 1VMCA 2F4IA 3AU7A 1H9SB 4RGTA 1FNVA 3CRKC 5IGBA 3SVMA 1QJOA 3O13A 1NUCA 5ELCA 5C4JB 2AWNA 4XYOA 4U673 3GTMB 2ENBA 1RKNA 2FFKB 2EYOA 3TBIB 1QOHA 5C6AA 2QEJC 4DGZA 5M5XB 1LT4D 5CYUA 1EIGA 3FMCA 1JOKA 2KA7A 2RDGA 1LACA 3Q24A 1UNSA 1PTOH 3RMHA 4PMWA 4C56C 2RSOA 4PQXA 1E2VA 3BYTB 2EPBA 1PLFA 5HURA 1TT2A 3QJYA 4HMJA 1Y8PB 1KLUD 1SYBA 1LT5D 4ZRZA 1B44D 2J0TD 1JWSD 3H94A 3JAML 4YIJA 3MFYA 3H09A 5I9OA 5M3FB 2J4XA 3D8GA 4OL7A 1WD1A 1ONLA 5EGTA 3P1HA 5COYA 2WACA 3QOJA 4DN4M 3ONAB 4C3JB 3PUWA 3OWFA 3NHHA 1DM0B 2MGSA 4ABNA 3QWNA 2O2LD 1KAAA 1PFBA 2EXZA 2LS01 2RDFA 4I65A 5ISRA 4LAAA 3K7AB 1H9KA 2DY8A 4J6HA 5LHY1 3R8BA 1QB5D 3CU7A 4RFBA 2NYZD 4RCOA 2VUMB 2PZTA 2I46A 1EWCA 3A55A 1WTQA 2KQ3A 4CJ1B 1Y8OB 2K05A 4DNRB 3FVQA 1F9QA 4H0LC 4QF4A 4V190 3HOZB 2PCFB 1E0BA 1JCKB 4DNTB 2K28A 4DAYA 2EJFC 5KEEA 1D2BA 3AMUA 1ESRA 4Q0FA 1TS3A 5E4XA 1BQQT 2OF1A 2F3WA 2EZVA 3BVZA 1L0XB 4N9PA 4F88A 3F2UA 5D65A 2F0NA 4BA2I 4BY1B 3GTQB 2A5HA 5J39A 4KV6A 1I50B 1LTTD 2AUJD 2L4NA 2KEEA 2ZXOA 2Q8RE 1JQYD 5C3XA 4ME5A 1EY8A 2EY6A 1GUTA 4H13C 5ELBA 1CA6A 1PXUA 1I4XA 1PRTF 2K32A 5IGDA 4EGVA 3P75A 4KY6A 1SBBB 2L5TA 3TZDA 1V1PB 3HP3A 3RUZA 4KN4C 2WP8J 5JEAJ 1B1ZA 3GTKB 1STAA 3OPOA 1NSNS 2EYPA 1J9OA 2NTSA 1QG7A 4K8IA 3D4DA 2DNEA 2EE1A 1BO0A 2E2DC 1I6VC 5CBEE 3I70A 4J1MA 1E2WA 3MA2B 3URYA 3J81L 2Z4HA 2NZ1D 4KJOA 4BBRB 1Z7TA 5JAVA 5BN4A 3P7JA 2IX0A 4A3DB 1RODA 3I72A 2D62A 1CM9A 2AQ1B 4HR7B 1J8IA 4FYDA 5JOBA 3EROA 3SK4A 1NCVA 1GUOA 4KKTA 1LT6D 3NWSA 2RDHA 5DEHA 1Q1BA 3K58A 5A2QE 4HEDA 3QG1A 1TS2A 3VR2A 3W2DA 2A69C 1G2TA 2AWOA 1F9SA 4F8MA 1JICA 3H6MA 3N52A 3C1EA 2MP1A 4KMUC 1ESFA 1CQFA 2BDOA 1ILPA 5KNCA 4XT3B 1CI3M 5HGTA 2EY5A 2HDMA 2JYOA 3MXUA 4P2CB 2OT2A 1S5BD 4Y7NB 3IKJA 2FMCA 3IL8A 1B9NA 1OXUA 2G9HD 4R8IA 1B4OA 1LV9A 1UEAB 1STBA 1V1PA 2XVSA 1TKWB 1FNWA 3T53B 4IUVA 1U4MA 1T5XD 3BDCA 1MD2D 2WB1B 2ID0A 3V2TA 2K5WA 3J80E 3M7GA 3TSSA 3LX0A 5DM73 3M85A 4RGMA 2B2TA 2Z8LA 2ZXRA 4RHRA 1A15A 1TWFB 3ND9A 1LABA 2E2HB 1I4HA 1GHJA 2RA4A 4PMCA 2IWHA 4HCEA 1SYGA 5K36H 4E6IA 4DK1A 2BE5C 4DXGA 2C9OA 3KLSA 1S4ZA 5TSSA 5JPMC 3JAME 1JB3A 4WFN3 5IGEA 2JE6I 3HEJA 2F0KA 4ZAIA 2F0DA 4DK0A 2MPMA 2NN6H 1LO5D 4OO1G 3Q23A 5M9OA 3N6RA 1G291 1ZKOA 2EYJA 1F2MA 3NE5B 3VR5A 4UDUC 2EJGC 3A7AB 1LTID 1DJRD 4CGYB 5EQ0A 5KYIA 3OMGA 2PYKA 3MWYW 2XRQD 5BN3A 3NTHA 1SNPA 2JSOA 1TS5A 3VR4A 1I4PA 3PO2B 3S9WA 1DOKA 1PYWD 1EYAA 1TWAB 2CQAA 3ERQA 1YNNC 2G9DA 3A56A 3KBXA 1BF4A 2RVLA 1SYDA 3TZUA 5CV5A 1TIID 3I4NB 2K5DA 2WAQB 3T13A 2F0TA 1ML0D 3S1QB 3R2IA 1Z6HA 1DOMA 2OXPA 3OOCA 2VNUD 1IW7C 3A8IE 5KYLA 3H91A 2BCOA 1TS4A 4CJ0B 5ELEA 1DYQA 4DF7A 2IT1A 3TDQA 2A6HD 2EOTA 2CVRA 3V05A 3HOVB 2NB0A 1QNKA 5JEAG 2HCIA 3E5SA 1A3TA 4AYBB 2K7VA 5EBDA 1FD7D 1EYCA 2CHBD 3C1FA 2D9UA 4L8JA 1RTNA 2JP1A 2XRSD 5K5PA 2FMMA 2L12A 3TP7A 4PV1C 3SDZA 1Y1WB 2EYMA 3R2TA 2Q8TA 4C1NI 1OXXK 1VF7A 1AN8A 1PRTC 2IW3A 1S5CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU S;  1Y8O B;  3DXJ C;  3OPO A;  1HTP A;  1DXM A;  4JK1 C;  4KI0 A;  2DNE A;  4DNR B;  1YNN C;  2R6G A;  4H0L C;  2A68 D;  2O5J C;  1B9M A;  1I6V C;  1OXT A;  2D5D A;  1IW7 D;  3EQL C;  3GQB A;  1GHK A;  5KND A;  2PCF B;  3FMC A;  1Q12 A;  5A35 A;  3M85 A;  1E2W A;  1GUG A;  2KA7 A;  4KKU A;  1CFM A;  1BDO A;  3TZU A;  2B8G A;  1SMY C;  1H9R A;  2AUK A;  2EJF C;  3U9S A;  3VR3 A;  1LAC A;  4RCN A;  3P20 A;  2A6H C;  2PPB C;  3LNN A;  3M4Y A;  5C0X H;  3HGB A;  4KHZ A;  3ND9 A;  3VA7 A;  4IFD H;  1GUN A;  1Z7T A;  2D2C C;  1LAB A;  4KN7 C;  1O78 A;  1V8Q A;  2EJM A;  3W3A A;  1H9S A;  4DNT B;  3T56 B;  5BN4 A;  2DNC A;  5KNB A;  3KLR A;  1E2V A;  3PUV A;  4H44 C;  4IQZ A;  4XTC S;  1K8M A;  3PUZ A;  1VDZ A;  3FPP A;  1YNJ C;  3I72 A;  3L7Z C;  2D62 A;  2DN8 A;  2EVB A;  3A8J E;  1GHJ A;  2PNR C;  1O7L A;  4HR7 B;  3M7N A;  1A6X A;  1Y69 U;  2E74 C;  3QJY A;  4JBW A;  3WDN A;  1Z6H A;  3SE0 A;  4GZY C;  3GD7 A;  3OOC A;  4I7Z C;  1IW7 C;  1GUO A;  1Y8P B;  5BN5 A;  4KKT A;  1HQM C;  1V43 A;  4KKS A;  3VR6 A;  5K36 H;  3LWU A;  3I4L A;  3A8I E;  4DK1 A;  3ND8 A;  4BA2 I;  2BE5 C;  4BA1 I;  1OXS C;  1Q1B A;  2E76 C;  4TKO B;  4XIG S;  3H94 A;  5C0X G;  3QG1 A;  3VR2 A;  1GUS A;  2A6E D;  2LMC B;  2EDG A;  1T5E A;  2A69 C;  5K36 G;  3MFY A;  2K33 A;  2AWO A;  2IT1 A;  2V4D A;  4G7H C;  2B8F A;  2A6H D;  2QF7 A;  4OO1 H;  2NN6 G;  2JXM B;  2E75 C;  1OXV A;  1ONL A;  2AUJ D;  1VF5 C;  3IFT A;  2BA1 A;  1EWH A;  2F1M A;  3D31 A;  2JE6 I;  1H9M A;  2YYZ A;  4G7Z C;  5JEA G;  3RLF A;  3A8K E;  4KMU C;  3T51 B;  3AB9 A;  4DK0 A;  1Q1E A;  1DCZ A;  2BDO A;  5KNC A;  4OGQ C;  1CI3 M;  2NN6 H;  2K7V A;  4IFD G;  3D4R A;  1H9J A;  3PUX A;  1IYU A;  1CTM A;  3PV0 A;  4LJZ C;  4OO1 G;  3PUW A;  3MXU A;  2A68 C;  1GUT A;  1TU2 B;  3N6R A;  4H13 C;  1IYV A;  1ZKO A;  1G29 1;  1HPC A;  2KCC A;  4G7O C;  4L8J A;  3NE5 B;  1Y8N B;  1ZYR C;  2A69 D;  4LK1 C;  3VR5 A;  1H9S B;  2EJG C;  2K32 A;  5JEA H;  3A7L A;  3QIA A;  3A7A B;  3CRK C;  2JEA I;  2BE5 D;  2ZT9 C;  3OW7 A;  3IKJ A;  2CW0 C;  3BDO A;  1HCZ A;  1H9K A;  2A6E C;  1B9N A;  2BA0 A;  1FR3 A;  1Q90 A;  3CRL C;  1QJO A;  1OXU A;  2L5T A;  4PV1 C;  1FYC A;  1K8O A;  3SDZ A;  3BG3 A;  2JEB I;  1TKW B;  2O5I C;  3PUY A;  3T53 B;  1GJX A;  4KN4 C;  3I73 A;  1PMR A;  5BN3 A;  1OXX K;  2Q8I B;  1VF7 A;  1E2Z A;  3VR4 A;  2NN6 I;  1VCI A;  1DD2 A; 
#chains in the Genus database with same CATH topology
 2R7D A;  1PH3 A;  2L9H A;  1B53 A;  1EFW A;  3A5Z B;  3CD6 A;  3S17 B;  3NTI A;  4CJ2 C;  3I4N G;  2IHF A;  1IKL A;  1TWH B;  2O5J C;  1LTS D;  3HOX B;  3GTL B;  4V0B A;  4L5Q A;  1IW7 D;  3UDF A;  2E2H H;  2UUB L;  1A2T A;  3DMU A;  3H3V C;  4M8A A;  1SEB D;  1EY7 A;  4LUO A;  2JA5 G;  1SJH D;  3NK9 A;  4A3F G;  3T1Y L;  5C0X H;  1GUN A;  3HOY B;  4TSS A;  4JBM A;  1V8Q A;  1HZA A;  1JJG A;  2B2U A;  4CHT B;  5DNF A;  1LTA D;  4XTC S;  2EY2 A;  3L7Z C;  4WJ3 M;  2EVB A;  3A8J E;  4FXG C;  3G48 A;  1P16 A;  1PZI D;  1A6X A;  1UUP A;  4IUN A;  4RKB A;  4A3E H;  2Z9H A;  4GN5 A;  5IWA Q;  1VQD A;  3HOV H;  1U4R A;  2YU9 B;  1L0Y B;  5CV4 A;  4DU9 A;  1KNA A;  1FL0 A;  4A3J H;  3GTO H;  3TEH B;  3TN2 A;  5M3F G;  1SYE A;  2N8N A;  2R3Z A;  1DOL A;  3K59 A;  3HOV G;  3HOU B;  1PH9 A;  2ZTC A;  5COR A;  5FJ8 G;  4AH6 A;  1CKN A;  3G7L A;  2V4D A;  2ZM6 Q;  1LLR D;  4IZ8 A;  5IGC A;  4B9X A;  3GO5 A;  1XJV A;  5I2X A;  3HOU H;  1H9M A;  4ZUI A;  1BCP D;  1Q1E A;  3NP8 A;  5GRO A;  5IYB H;  4DPG A;  3D4R A;  4DR4 L;  2A68 C;  1TU2 B;  3EA6 A;  1KIX A;  1JWM D;  4A3B H;  2GA4 B;  4LK1 C;  2Z6K C;  3A5U A;  4G57 A;  4DAV A;  4A3M B;  4CBV A;  1QVF A;  4UP7 A;  3VYT A;  3RNU A;  3DWA A;  4KY5 A;  3FRP B;  2PQE A;  3J7A V;  4DV6 L;  3I4M B;  3BG3 A;  2B2U C;  3D6C A;  2JA5 H;  2VW9 A;  2NVY B;  5IT9 c;  2WV6 D;  2F0J A;  3HOX G;  4MN3 A;  1VCI A;  4B08 A;  1TVX A;  2BH2 A;  4A3G G;  3M3Y H;  1DXM A;  3UI2 A;  3NPP A;  4R4I A;  1M4V A;  3EBE A;  3HG9 A;  1BR9 A;  2GVA A;  1PH8 A;  1FJG Q;  2KED A;  3E0J A;  4A3E G;  4FNF A;  1LTG D;  4DR1 L;  5EKI A;  1GUG A;  1IKM A;  4K6D A;  1VQE A;  3EVQ A;  2WIN B;  4C2M B;  4IFD H;  2F0W A;  4IUT A;  4X3T A;  4YHH L;  4CDC C;  5KIX A;  1O78 A;  2R92 G;  2Z4I A;  2H1E A;  1N34 Q;  1AW7 A;  4JI5 L;  5D3D A;  1K8M A;  3RZO H;  5FO7 B;  3WWV A;  2CWA A;  4DV6 Q;  1EIH A;  2QIL A;  5CC4 A;  2KEC A;  1JOQ A;  2PO4 A;  2NUC A;  5GAD C;  3ULP A;  2WKD A;  4KTA A;  4ZQ3 A;  1BCP C;  1UAP A;  4QGU A;  3KJP A;  4NMZ A;  3ND8 A;  4K0K Q;  3PF4 A;  1RD9 D;  5E3F A;  3DLL A;  3CCS A;  2IX1 A;  4Z9C B;  2A6E D;  3K80 C;  4RWS C;  5G3L D;  3H3V I;  5K36 G;  1X3P A;  3ZYY X;  2NBF A;  4DR2 Q;  2ZTD A;  2K5N A;  5EKL A;  1LTL A;  1QUQ A;  2E75 C;  3GTP H;  1HUM A;  1G91 A;  1AZP A;  3D31 A;  5I2Y A;  2VQE Q;  4GNX C;  1WTX A;  2MFI A;  1HA6 A;  2KUM A;  3K7A H;  4F7X A;  3PF5 A;  2F3I A;  1AH9 A;  4N9T A;  1ZYR C;  1MHW C;  2TMP A;  5IP7 G;  3A7L A;  2L0C A;  3ERS X;  2MJ8 A;  2K1B A;  2N78 A;  2A6E C;  2BOS A;  3CCM A;  3CRL C;  2B2T C;  3K5M A;  5IGF A;  3CC2 A;  4QB4 A;  1SE4 A;  3KYH C;  4XQJ A;  1YI2 A;  1E2Z A;  1EOT A;  1F9R A;  4DK6 C;  3KF6 B;  4HCS A;  4JI2 L;  1D7Q A;  3HOZ H;  3FKI H;  5C5L A;  4TQU S;  2Q2I A;  3U9O A;  4DAM A;  4XQQ A;  4LMQ D;  2L1B A;  4JK1 C;  2PZW A;  5M5W B;  3SXH A;  4AYB E;  3J7A F;  2R6G A;  4A3C G;  2Z1C A;  3J81 E;  1B9M A;  2R92 B;  3EQL C;  2YV5 A;  3GQB A;  1GHK A;  4X66 L;  4DK3 C;  3PMF A;  4UP8 A;  3TP6 A;  1BDO A;  1JWU D;  1WTO A;  1H9R A;  3IRB A;  2JQO A;  2RBM A;  3BDL A;  3NQI A;  5F2D A;  3JAM c;  4IUR A;  1G51 A;  2EJM A;  4JV5 L;  1J5E Q;  2DNC A;  1EQT A;  1EY6 A;  3KLR A;  4NXN Q;  3WOE A;  3FPP A;  1AE2 A;  1GOZ A;  1CA5 A;  3R3O A;  4HSV A;  2VS1 A;  2KOL A;  1IBK L;  2UUA Q;  1PTO B;  3VYR A;  4GZY C;  1K83 B;  4LW1 A;  1XMO Q;  4C3H H;  4IAL A;  1FGB D;  1IHZ A;  1I4Q A;  1WTP A;  1C4Q A;  2RF4 A;  1G8Z D;  1SMY D;  3HOW G;  3KBG A;  5IWA L;  3VYU A;  4KJN A;  5C0X G;  4LNQ A;  2QKI C;  4N8X 1;  1GUS A;  2NVX H;  3TRE A;  3HOZ G;  1TY2 A;  5C4Z A;  2Z6B A;  3I8Z A;  3ITP A;  4KHP L;  4B3M L;  5FOB B;  4HIO A;  1PDQ A;  1IL8 A;  1PYB A;  4NKL A;  1OXV A;  1VF5 C;  1S5F D;  1STN A;  3ZJY C;  4A3B B;  1MJE A;  4QUF A;  2YYZ A;  1PTO F;  2LKV A;  4FP5 D;  3T51 B;  4MIU A;  4DV3 L;  4ODG A;  1BVS A;  1J5E L;  5IP9 H;  4QUC A;  1HPC A;  2UXD L;  5I6Y A;  1K8A C;  5LMN W;  2RHQ B;  3J80 c;  4MTN A;  3QIA A;  1CT1 D;  2PMZ E;  1WTW A;  3OW7 A;  3Q0A A;  2K14 A;  1AFP A;  1LYL A;  1PH1 A;  3K57 A;  2F0L A;  2K5V A;  1OTC A;  2R61 A;  4R8N A;  4JI0 Q;  5EBC A;  4X64 L;  3TS2 A;  1HNW L;  4GOP A;  3I73 A;  1XNR Q;  2EYH A;  1RL2 A;  2F0S A;  1NR2 A;  3DM1 A;  4B3S L;  1NMF A;  2B63 G;  4IOC A;  2C5C A;  2KVM A;  1E22 A;  4A3I B;  3FPU B;  3CC4 A;  4JI6 Q;  3EJI A;  1TWC H;  2A68 D;  3HZX A;  1C9O A;  1NNX A;  4FF4 A;  1HFG A;  5IT9 E;  1JR0 D;  1X54 A;  2EYL A;  2E2J B;  1EU4 A;  1MSH A;  3S24 A;  4JI8 L;  4NW2 A;  2HQE A;  1Q82 C;  2PW7 A;  2F0E A;  2NVY H;  1IZ6 A;  1L1O C;  1TR5 A;  1TWA H;  2PPB C;  2Q2H A;  1XWE A;  1NMG A;  5EPK A;  3HOX H;  3SR1 A;  2R92 H;  1N34 L;  1F9P A;  3I4M G;  3TP5 A;  3D4W A;  3S16 B;  4JYA L;  5KRU A;  1PH2 A;  3C46 A;  3M7N A;  2E74 C;  4DUY L;  4HJ9 A;  1X6O A;  1PZK D;  3L3O C;  5FJ8 H;  3DWQ A;  3VR6 A;  1SXT A;  2NVT B;  2VQF L;  1CHQ D;  1VQ4 A;  3KLS X;  2SNS A;  4UHV A;  2PW5 A;  1KAW A;  1NAP A;  2LFN A;  4BY7 G;  1K0R A;  5JPN C;  5H1S E;  4A3E B;  3DEO A;  4JVZ A;  4DFA A;  3PIP 3;  5I6W A;  1ZXT A;  2B8F A;  5IYB G;  1STH A;  1RTO A;  4A93 H;  2B2V C;  5C3E H;  4DR6 L;  3FP9 A;  1ICF B;  4BBR G;  2FHT A;  3IFT A;  1FVI A;  1K9M C;  1KAB A;  5I4D A;  4UP9 A;  3EN2 A;  2NVX B;  4JI8 Q;  1DCZ A;  4DV7 L;  2K03 A;  2RQX A;  1PTO D;  1F2Y A;  3F2C A;  4GKJ L;  4G7O C;  2GVB A;  3KLW A;  4RGO S;  5EKK A;  2KHI A;  1RF2 D;  4BWG B;  5FLX c;  1WJJ A;  4A75 A;  4A3I H;  4TRD A;  1PRT B;  2D0O A;  4XT1 B;  2BDN A;  1IL2 A;  1G6Z A;  1HTL D;  1F2L A;  1UE6 A;  1TWC B;  3GTG H;  4PNY A;  4K2L A;  4JI6 L;  3DEP A;  2MO0 A;  1KL9 A;  2E2J H;  4CKB A;  1CSP A;  4KY7 A;  1TWG B;  5E4W C;  2B39 A;  4JI0 L;  3TQY A;  3CCU A;  4QCL A;  1L0W A;  3K5N A;  1I4G A;  4M1U B;  4HTH A;  1RCV D;  2SEB D;  2ZJQ A;  2X6G A;  2Y0S E;  2K5Q A;  1PFS A;  5LL6 S;  3D6W A;  1HHV A;  1X3Q A;  5JVH 3;  3S16 H;  3S2H B;  1JC7 A;  4A3K B;  1SYC A;  5ELF A;  1S72 A;  3K0X A;  3ULJ A;  2RCF A;  1K83 H;  2D5D A;  2ICI A;  3U50 C;  2K6A A;  3VA5 A;  1QNU A;  4PZ7 A;  3NUC A;  4J15 A;  5CGK A;  1W6K A;  4DNI A;  3U9S A;  5IT9 L;  4WRD A;  1QZG A;  1SNQ A;  2FJ2 A;  1MSG A;  1RJT A;  1KC8 C;  1H9S A;  3T56 B;  3BS1 A;  4H44 C;  4EVO A;  3PUZ A;  2DN8 A;  2KHJ A;  1LUZ A;  2AQ3 B;  1ASY A;  4UY8 C;  5C3E G;  4JBW A;  2F3V A;  2HHH Q;  2R93 B;  1EQR A;  1SLJ A;  3H15 A;  1HQM C;  1V43 A;  5CV9 A;  5A2Q L;  1PH5 A;  3CCJ A;  4R4Q A;  1EZ6 A;  1LTB D;  1X55 A;  1OXS C;  1QE6 A;  4DV2 L;  3FDT A;  4OWW B;  2K01 A;  1SNO A;  3MVV A;  4HAE A;  4K5W A;  2M2L A;  1Q3L A;  4ZKC B;  2F0Q A;  4DUZ L;  3Q6S A;  5D14 A;  4NXN L;  4ZLT F;  2NVT H;  4A3M H;  2QF7 A;  4OO1 H;  2NN6 G;  1YIT A;  4B3T L;  1EZ8 A;  3RN2 A;  1BXT A;  1HA5 A;  5EPJ A;  3E6Z X;  1SE8 A;  3NXW A;  4C3I G;  1Q8I A;  2Q2U A;  1Q81 C;  3CP0 A;  3G6E A;  3GP7 A;  3VYS A;  5JJI A;  2HCC A;  1C48 A;  1DON A;  3J7Y W;  4X65 Q;  4DV4 L;  4A93 B;  5L37 A;  3GTJ B;  3MTS A;  1WD0 A;  4GKJ Q;  1EUJ A;  4KLK A;  1KLG D;  2SNM A;  1EYD A;  3BDO A;  2VXW A;  1V9P A;  3SK5 A;  4K6L A;  4LUZ A;  5FO8 B;  4LF9 L;  2F4V L;  2YTY A;  2HIV A;  5J22 A;  4JI3 L;  2IL8 A;  1A62 A;  1PHJ A;  2G5D A;  1MBY A;  4K14 A;  3HKZ E;  3TME A;  5IOC A;  1SE3 A;  5ELO A;  1BBX C;  3HRZ C;  1AEX A;  1YJ9 A;  3BJU A;  2LY7 A;  5J1Z A;  2F03 A;  2RKS A;  3EFX D;  3K81 C;  1HTP A;  5JJK A;  4H7B A;  4Q5V A;  1NJI C;  1S40 A;  4UPA A;  4X3K A;  3MFG A;  3T4A C;  1Q12 A;  5FLX L;  5JVG 3;  1XMQ Q;  3KFU A;  1E3P A;  1LTR D;  3M4Q A;  1B8A A;  4DA2 A;  1Z9F A;  3G6J B;  4BBS B;  1X3F A;  1JJC B;  1SYF A;  5CV6 A;  1X32 A;  3G4S A;  4OEM B;  4A4I A;  2H4O A;  4PZ8 A;  1CQV A;  4O1N A;  4IFD J;  1DGS A;  2GN5 A;  1DZ1 A;  1YNN D;  2XIW A;  1ET9 A;  2AKW B;  1Q8K A;  3WDN A;  4YCW A;  3PO3 H;  5C3W A;  4JC0 A;  4CKC A;  4I7Z C;  1EEF D;  4LF5 Q;  1NE3 A;  3I3C A;  5E1F A;  2K50 A;  3NBH B;  4BA1 I;  3DWP A;  3K5L A;  1GKH A;  3CKI B;  4TKO B;  3Q22 A;  4DR5 Q;  5C4X H;  3S1M H;  3K7U C;  4IJH A;  2F0F A;  1SE2 A;  2B2Y C;  1BBW A;  3SEB A;  3F8T A;  4MHE A;  1JB7 A;  1XNR L;  3ICE A;  4ZKB B;  1HNW Q;  2WAQ G;  2KCN A;  1EU3 A;  1EWH A;  4G7Z C;  5CBA E;  4H02 A;  1N33 Q;  1HRJ A;  5C44 B;  1F77 A;  2VQF Q;  3UE0 A;  1JJ2 A;  2N88 A;  1Y1V H;  3M4P A;  1O7Z A;  3HKZ B;  1ZEQ X;  1STG A;  5IYD H;  1U4P A;  4YWK A;  4DR3 Q;  4ME3 A;  2EXD A;  2K75 A;  5C0X J;  2ZT9 C;  1SN8 A;  4OXP A;  4P72 A;  3TP8 A;  1PRT D;  2HD3 A;  4BY7 B;  4DUZ Q;  2M9V A;  4HN7 A;  2QW7 A;  5GAH C;  1YHQ A;  4QMG A;  1OO9 B;  4NP5 A;  3S2H H;  3L9A X;  4GOP B;  2XWB B;  1KRS A;  5CMD A;  4DR3 L;  4DV0 Q;  3GV6 A;  1CZW A;  5T1G A;  3DXJ C;  3BZK A;  2NWG A;  2IPK D;  5BR8 L;  3LWE A;  2I0Q A;  2JA6 H;  2B2V A;  3RZO B;  1VQP A;  5IIF A;  3HOY H;  4BBS G;  1N32 L;  5GAE C;  1D1K A;  1A63 A;  1E1T A;  2A73 B;  3I4M H;  2X6L A;  1O80 A;  1PFN A;  1YIJ A;  4JBK A;  3X3M A;  3CQZ B;  2TSS A;  4X3S A;  1VQ5 A;  4LF5 L;  1SRU A;  5KGU A;  4KHZ A;  1XPO A;  2ICE C;  2D0P A;  3OWE B;  3W3A A;  1I6H B;  1B50 A;  4JV5 Q;  3CW2 C;  4DR5 L;  1IYJ B;  3B6Y A;  2IX3 A;  1STY A;  3CQZ H;  4XYQ A;  3UDG A;  1A2U A;  3I7F A;  3S1R H;  2LXJ A;  4YY3 L;  3GD7 A;  1HR0 L;  1R4P B;  1ET6 A;  4DR7 L;  4RGN A;  1WTV A;  2E2I B;  1EIY B;  1VQI A;  3CPF A;  3KF8 A;  3STB D;  2Y0S B;  4KK7 A;  3J80 i;  5IYC H;  2E8G A;  1VQ7 A;  4BBR H;  3V96 A;  1A3U A;  2E76 C;  4WJ4 A;  3PSI A;  3H0G H;  1EFI D;  2VY3 A;  4L5T A;  1JOO A;  2K33 A;  4QIW E;  2XTI A;  1EYG A;  1N33 L;  1MGS A;  3KUP A;  5C44 G;  4X62 L;  1EY4 A;  2QDL A;  2ZM6 L;  2VB3 X;  5IY0 A;  4B3M Q;  2JXM B;  1WTR A;  3OMC A;  2PMZ B;  1KDB A;  2BA1 A;  1XX8 A;  1P8L A;  1UE5 A;  3OYY A;  4RKL A;  2F0G A;  3AB9 A;  1PZJ D;  1EL0 A;  1SRO A;  1XTC D;  3K6O A;  4BXX G;  1XTD A;  5C5M A;  3NBI A;  4O42 A;  3G71 A;  4L5S A;  3AYH B;  3X3N A;  1S5D D;  1X56 A;  3NEM A;  4NXM Q;  3GTG B;  2F0M A;  2XN9 C;  4JCV E;  4NB3 A;  3L2P A;  3MAQ A;  4K0K L;  1YHA A;  4RHS A;  3K8A A;  1E24 A;  2BE5 D;  1XYI A;  1S3O A;  4EQN A;  3WOF A;  3CCV A;  1Q90 A;  1X9N A;  1TQO A;  4RH6 A;  2QEX A;  5E7N A;  1LT3 D;  5LL6 X;  4A3D G;  1VMP A;  2JEB I;  3JC6 6;  1QCB D;  3PUY A;  4JI4 Q;  1PMR A;  2F0U A;  3K0Y A;  2Q8I B;  3NEL A;  3UDX A;  2JA7 B;  3FEW X;  1I94 L;  4XXE A;  4J8Q A;  1PFM A;  2XWJ B;  1JOR A;  5LMU L;  2WFW A;  4C3I B;  2O4X A;  4KHP Q;  2M00 A;  2OCE A;  5DM6 3;  3NBH A;  4KD3 A;  2OWO A;  1L2F A;  4A93 G;  2I5L X;  5ELN A;  1SFO B;  3S2D B;  5IOD A;  1SMX A;  1GM5 A;  3IAY A;  5DAU A;  4WJW A;  4P73 A;  4C3H B;  4LFA L;  4GN4 B;  1C8C A;  4G4K A;  1CFM A;  1B2T A;  1AE3 A;  4ULL A;  3SK6 A;  1HNX Q;  2JA6 B;  3HGB A;  3VA7 A;  1Q86 C;  3S15 B;  4R4C A;  3U4V A;  3TS0 A;  3PUV A;  2KHS A;  3K5O A;  3HS0 C;  2A74 C;  1G2S A;  5I9P A;  4IUQ A;  2HIX A;  2IHE A;  4QY7 A;  2WKC A;  3NSW A;  3S15 H;  1HFN A;  1RDP D;  5BN5 A;  2B29 A;  1O7I A;  3MXP A;  3PGZ A;  5M3M H;  3CC7 A;  3OIP A;  2CWP A;  1I3Q B;  4IUP A;  1RHP A;  5FLX E;  4XDX A;  2VL6 A;  1VQK A;  4A3B G;  3S1Q H;  1I5F A;  1T5E A;  4YCU A;  3AQQ A;  1FNU A;  5EJW A;  3C2P A;  4HMI A;  1XPU A;  4BY1 G;  2UU9 Q;  2QGQ A;  1RIP A;  2JA8 G;  1VQB A;  2B2W A;  4EQO A;  2ZJR A;  5IP7 H;  4PMB A;  2MUY A;  5ELD A;  4OGQ C;  3W5O A;  4BY1 H;  4LF7 Q;  1VQM A;  5IGG A;  3PV0 A;  1CTM A;  4IOA A;  1D5Z C;  1YNX A;  2CH4 A;  1QVG A;  1Z47 A;  4CKE A;  4GS3 A;  1WCM G;  5M3F H;  1SSO A;  2R7Z B;  3BYY B;  4RG1 A;  3W1G A;  1GXD C;  2CW0 C;  3QO2 A;  1SFO H;  3FKI B;  2XNA C;  2BA0 A;  4IJL A;  3KJO A;  5AFW A;  4GLX A;  4LF7 L;  2B63 B;  4GNX B;  3M9B A;  4IPH A;  3MEF A;  3U4Z A;  1PH7 A;  1GJX A;  1QVC A;  5FKA C;  1HQR D;  1JE4 A;  3PCO B;  4S3S A;  5IP9 G;  3I91 A;  4C2M H;  3RZD B;  1Y1V G;  1CSQ A;  3A54 A;  2UU9 L;  1D1I A;  2X69 A;  5CV8 A;  1IBK Q;  2F0V A;  4F87 A;  2MHV A;  2A19 A;  1YJN A;  1CHP D;  4FF2 A;  2AQ2 B;  1I4R A;  3HKZ G;  2J7Z A;  1STE A;  3BU2 A;  4EQ5 A;  4POG A;  4A3J B;  4HSP A;  3M3Y B;  3GDE A;  3VR3 A;  1SMY C;  2AUK A;  2WII B;  1KHI A;  5J3B A;  4RCN A;  2NVQ H;  2DGY A;  2VUM H;  3LNN A;  1YJW A;  4ZYS A;  1BCP F;  2WAQ E;  1JE5 A;  3PO2 H;  2ZTE A;  2A8V A;  1PH6 A;  2SOB A;  4HJ7 A;  4QIW B;  1YNJ C;  4DV3 Q;  3SHL A;  2PNR C;  3MHB A;  1Y69 U;  3SE0 A;  1VQ9 A;  4KHV A;  2NZH A;  3L0O A;  1KD1 C;  3DUZ A;  1IXR A;  1XNQ L;  4KKS A;  4LWC A;  1W6J A;  4DAP A;  3LWU A;  4DKA C;  3CCQ A;  1CZG A;  2F0H A;  4UAI A;  2QCP X;  2NTT A;  2EDG A;  4K5X A;  2ZXP A;  4APV A;  3BZD B;  1X3G A;  1YNJ D;  1KTK A;  4CDF C;  1GD7 A;  3STB C;  1EIF A;  2OEO A;  4A3C H;  1KDC A;  4Y7N H;  1UWV A;  3S1M B;  1JMC A;  3Q8D A;  3AFQ A;  1WCM B;  3H3V H;  4JI7 L;  4ILW A;  2R7Z G;  3PUX A;  2JA7 H;  4K5V A;  1K3B C;  3GTP B;  3IFD A;  4OON A;  2VQE L;  2HHH L;  1Y8N B;  2A69 D;  1A0I A;  1VS0 A;  4C3I H;  2RSN A;  2SDF A;  4K8J A;  1A3V A;  1ILQ A;  3HOW B;  1U4L A;  4A3K H;  1SAP A;  1HCZ A;  4IPC A;  1Y1V B;  3PIO 3;  2QDB A;  1CKN B;  1MI2 A;  4JG2 A;  3T1Y Q;  1EY0 A;  3SK8 A;  3MC0 B;  1ENC A;  4CDD C;  3JAM i;  4JI2 Q;  3OSO A;  1DD2 A;  2UUB Q;  3BVM A;  3OHX C;  2UUC Q;  2PZU A;  1U9R A;  4A3J G;  1AZQ A;  3U58 A;  5C0X I;  3BVG A;  1WOC A;  1V1O A;  2CW0 D;  2NZO A;  1OXT A;  3PO3 B;  3RZD H;  1B3A A;  4DXF A;  5A35 A;  3J80 L;  5D3I B;  4AQY L;  4KKU A;  5M3M B;  1KRT A;  1W3S A;  2K52 A;  1CKO A;  3P20 A;  1HNX L;  3S1R B;  2A6H C;  4ZUJ A;  2CCZ A;  5M5X H;  3GTM H;  3OIQ A;  2OTJ A;  1WFQ A;  2B2Y A;  5KNB A;  5C4X B;  1SR3 A;  1BUV T;  4IQZ A;  3S1N B;  1K28 A;  4OO1 I;  1VDZ A;  3S14 B;  1D5X C;  4C3J G;  4NDX A;  4B9W A;  1EEI D;  5EPL A;  5CR3 A;  1O7L A;  2FIN B;  4FO2 A;  4N8F A;  1QIL A;  1WVL A;  3I4N H;  3RD4 A;  3I56 A;  1D5M C;  1YVC A;  3H0G G;  2L11 A;  2HUG A;  2F0O A;  4C1N K;  3I4L A;  2L55 A;  4LF8 Q;  2N3S A;  1M8A A;  1II3 A;  3CCE A;  5HY6 A;  1BNZ A;  4JI4 L;  1PTO C;  4XIG S;  3DHQ A;  2LMC B;  1EQV A;  2RHS B;  1PYS B;  2B2W C;  1EWI A;  1UE1 A;  3NWT A;  4C3H G;  1S5E D;  1ZYR D;  5JJZ A;  4FF1 A;  4L6T B;  1R4Q B;  2A1A A;  4R9W A;  4WOR A;  2JA6 G;  4O2D A;  4CDE C;  5M5Y B;  3MZ5 A;  2YU9 H;  2R93 H;  1GUW A;  2ES2 A;  2XGT A;  1KNE A;  4X66 Q;  1JT8 A;  4IO9 A;  3RLF A;  1I3Q H;  1TY0 A;  1G6P A;  1KQS A;  3QB3 A;  1IYU A;  4JI1 L;  1MIU A;  2FXQ A;  4ZK9 B;  4DV5 Q;  1QWY A;  1V1Q A;  3C3L A;  2KCC A;  4R4O A;  3A0J A;  1T9H A;  5JEA H;  2JA5 B;  2JEA I;  3GV3 A;  1ENF A;  3MXG A;  2EYF A;  4A3F B;  2UUC L;  1HUN A;  1F2Z A;  1HXY D;  3D0F A;  1FR3 A;  5NUC A;  3NTK A;  4EX5 A;  2JK8 A;  1FYC A;  1CKM A;  1KDA A;  2XSC A;  4RA8 A;  5FK9 C;  1K8O A;  5C4H A;  2O5I C;  3KK7 A;  1A8V A;  4ID6 A;  3E9H A;  3T16 A;  3I90 A;  2JA8 B;  2AMC B;  2NN6 I;  4HJ5 A;  3KDF B;  2JN4 A;  1O7Y A;  3CPW A;  1EY5 A;  2N55 A;  4DR2 L;  5M3M G;  1NBW A;  2R7F A;  5CV7 A;  1UE7 A;  3QOL A;  2EY1 A;  1BOS A;  3KF6 A;  1CK1 A;  4IFD I;  1ICW A;  2K04 A;  4KI0 A;  1Y1W H;  1AP0 A;  4FF3 A;  4DAY B;  1L1O B;  1X65 A;  4B3S Q;  5KND A;  3HKS A;  1R9T B;  4LFC L;  4LF4 L;  2I07 B;  1ASZ A;  2E2I H;  2B8G A;  1SNM A;  4OHJ A;  1EY9 A;  4U68 A;  4OIK A;  3CHB D;  1ENA A;  3M4Y A;  4OIJ A;  4YCV A;  2D2C C;  3RLO A;  2C35 B;  3FKI G;  1TWH H;  4KN7 C;  3RN5 A;  1VQG A;  1SJE D;  3H0G B;  3J81 j;  1NTG A;  1EQQ A;  1SND A;  1VQL A;  4K2K A;  1SNC A;  4LF6 L;  2IJ0 A;  1XXG A;  4IN3 A;  4IUU A;  1BCP B;  2DJG C;  4FXK C;  3S1N H;  1NY4 A;  4ZCK A;  2NVQ B;  2HDL A;  4A3K G;  3MEH A;  1XMQ L;  2ASB A;  5T1I A;  4KD4 A;  2JJQ A;  3T1H Q;  4XQN A;  2KJX A;  3GTO B;  4BS9 A;  2F0I A;  3HFZ B;  4OEL B;  1D6E C;  2HQL A;  3NQT A;  5G3L F;  4G7H C;  3M4O B;  4X3U A;  2DY7 A;  4L63 B;  4FXD A;  4EQP A;  2CFM A;  4BY7 H;  4FVM A;  2F1M A;  4RAU C;  1B3Q A;  2VB2 X;  4A3G B;  3A8K E;  1Y14 B;  3HOW H;  1SDF A;  3R93 A;  3MXN A;  4IFD G;  1IBM L;  1H9J A;  3D3R A;  4YWL A;  5C3E B;  4LJZ C;  5FO9 B;  1IYV A;  3GTK H;  1NR4 A;  2F0P A;  1VMC A;  2F4I A;  3AU7 A;  4HIM A;  1H9S B;  4RGT A;  1FNV A;  2YTX A;  2UUA L;  4JI1 Q;  3CRK C;  4LUV A;  5IGB A;  3S17 H;  3EIV A;  3SVM A;  4X6A H;  1QJO A;  3O13 A;  4LF9 Q;  1WCM H;  2Q2T A;  2OQK A;  2MQH A;  4P71 A;  1NUC A;  5DLQ E;  5ELC A;  5C4J B;  2AWN A;  4XYO A;  4U67 3;  3GTM B;  2ENB A;  1RKN A;  2YTV A;  2PI2 A;  2FFK B;  2B63 H;  1MKH A;  1Y1W G;  1M1K C;  2F52 A;  2EYO A;  3TBI B;  1QOH A;  5C6A A;  2QEJ C;  4DGZ A;  4JBJ A;  4QJF A;  5M5X B;  2VUM G;  3VDY A;  1LT4 D;  5CYU A;  1EIG A;  3FMC A;  1C7Y A;  4JPB W;  1JOK A;  3LGJ A;  2KA7 A;  2UXB Q;  2RDG A;  1LAC A;  3Q24 A;  1UNS A;  1PTO H;  1YHB A;  5LMU Q;  4GKK L;  3RMH A;  4PMW A;  1K8G A;  3S2D H;  1VQF A;  4C56 C;  2RSO A;  4PQX A;  1E2V A;  3BYT B;  1MJC A;  2EPB A;  1PLF A;  5HUR A;  4Y52 H;  5M5W H;  4POF A;  1TT2 A;  3F1Z A;  3QJY A;  4HMJ A;  4AQY Q;  1Y8P B;  1KLU D;  1SYB A;  1LT5 D;  2Z0S A;  4ZRZ A;  1B44 D;  2J0T D;  1U0L A;  1JWS D;  3H94 A;  2KCT A;  3JAM L;  1QUQ B;  4YIJ A;  3MFY A;  1K0S A;  2P5Z X;  3H09 A;  5I9O A;  5M3F B;  1N9W A;  2J4X A;  3D8G A;  4OL7 A;  3ER0 A;  3KOJ A;  1WD1 A;  1ONL A;  3I55 A;  5EGT A;  4GOP C;  3HOU G;  1D8L A;  1HNZ Q;  3P1H A;  5COY A;  2WB1 G;  2WAC A;  2I5M X;  1WTH A;  3QOJ A;  4DN4 M;  3ONA B;  4C3J B;  4DR1 Q;  3GTQ H;  3PUW A;  2K5H A;  4O0A A;  5FLM G;  3OWF A;  3NHH A;  1DM0 B;  2MGS A;  4ABN A;  3QWN A;  2O2L D;  1KAA A;  1PFB A;  2KEN A;  2EXZ A;  2LS0 1;  2RDF A;  4I65 A;  5ISR A;  4LAA A;  3K7A B;  1H9K A;  2DY8 A;  3F2D A;  4HJ8 A;  3I4O A;  1IBL Q;  4J6H A;  5LHY 1;  3R8B A;  4A3M G;  1QB5 D;  3CU7 A;  2PI2 E;  4RFB A;  2NYZ D;  3UE1 A;  4ALP A;  4RCO A;  2VUM B;  2PZT A;  2I46 A;  2MNA A;  1EWC A;  3A55 A;  4BBS H;  1WTQ A;  2KQ3 A;  4CJ1 B;  2ATW A;  1HH2 P;  1Y8O B;  2K05 A;  1N8R C;  4R1J A;  4DNR B;  3FVQ A;  4DV7 Q;  1F9Q A;  4H0L C;  4QF4 A;  1PV4 A;  4V19 0;  3HOZ B;  2PCF B;  3F2B A;  1E0B A;  1HR0 Q;  1JCK B;  4DNT B;  2K28 A;  4A3L G;  4DAY A;  2EJF C;  5KEE A;  1D2B A;  3AMU A;  1E7Z A;  1ESR A;  4Q0F A;  4QQB X;  4DUY Q;  1TS3 A;  4PZ6 A;  5E4X A;  1BQQ T;  5IYD G;  3W1B A;  1HJP A;  1EOV A;  2F3W A;  2OF1 A;  2UXC Q;  2EZV A;  3A74 A;  3J81 c;  3BVZ A;  4MTK A;  1L0X B;  4DV1 Q;  4N9P A;  4F88 A;  4A3G H;  3F2U A;  5D65 A;  3PIP A;  2F0N A;  4BA2 I;  4BY1 B;  3GTQ B;  2A5H A;  4P75 A;  3J7Z C;  2Z6K A;  3DM3 A;  5J39 A;  1VQO A;  4X62 Q;  2EQS A;  4KV6 A;  1XNQ Q;  1I50 B;  1LTT D;  4BXX H;  2AUJ D;  2L4N A;  4FDB A;  1HNZ L;  1VQ8 A;  2KEE A;  2ZXO A;  3PO2 G;  1VQA A;  2Q8R E;  4MNO A;  1JQY D;  4A3I G;  5C3X A;  4ME5 A;  3UDI A;  1EY8 A;  2EY6 A;  5M5Y H;  1GUT A;  4H13 C;  5ELB A;  1CA6 A;  1PXU A;  1I4X A;  1PRT F;  2K32 A;  5IGD A;  2Y0S G;  2KBN A;  4EGV A;  3P75 A;  4KY6 A;  1K73 C;  4LF4 Q;  4LFC Q;  1SBB B;  1HZC A;  2L5T A;  3TZD A;  1V1P B;  3HP3 A;  3RUZ A;  1K3R A;  4KN4 C;  2WP8 J;  4A3L H;  5JEA J;  1B1Z A;  3GTK B;  1STA A;  4IPD A;  4OWT B;  2IY5 B;  3OPO A;  1NSN S;  2UXD Q;  3BZC A;  2JA9 A;  4JOI A;  3E0E A;  4L5R C;  2EYP A;  1J9O A;  2NTS A;  1QG7 A;  1TXY A;  4K8I A;  3D4D A;  4NPS A;  5IE8 A;  2DNE A;  2EE1 A;  4JI7 Q;  1L1O A;  1YZ6 A;  1BO0 A;  2E2D C;  1I6V C;  5CBE E;  1FJG L;  3I70 A;  4J1M A;  1PVO A;  1E2W A;  3MA2 B;  3URY A;  3J81 L;  2Z4H A;  2NZ1 D;  4KJO A;  4BBR B;  1Z7T A;  4DV5 L;  5JAV A;  5BN4 A;  3PQI A;  4DR6 Q;  3P7J A;  2IX0 A;  4LFB L;  2ALY B;  4A3D B;  1ROD A;  3I72 A;  2PQA B;  2D62 A;  1CM9 A;  2AQ1 B;  4HR7 B;  1J8I A;  4FYD A;  2JA7 G;  5JOB A;  3ERO A;  3SK4 A;  4GNX A;  1NCV A;  4R4T A;  4OX9 Q;  1GUO A;  5AJ3 L;  4KKT A;  1LT6 D;  3NWS A;  3M4O H;  2RCN A;  1PH4 A;  2RDH A;  5DEH A;  1Q1B A;  2B3G A;  1TWF H;  1Q7Y C;  2DJF C;  3K58 A;  5A2Q E;  4HED A;  3QG1 A;  1TS2 A;  3VR2 A;  4X64 Q;  3W2D A;  2A69 C;  1IBM Q;  4B3R Q;  1G2T A;  1WYD A;  2OTL A;  2AWO A;  5LMN Q;  4MZ9 A;  1F9S A;  4F8M A;  4GLA C;  1JIC A;  3H6M A;  4PG3 A;  3N52 A;  1CUK A;  3C1E A;  4B3T Q;  1QZH A;  4NXM L;  2MP1 A;  3AEV A;  4KMU C;  1ESF A;  2ZJP A;  1VQH A;  1CQF A;  2BDO A;  1ILP A;  3FHW A;  5KNC A;  4XT3 B;  1CI3 M;  4LFB Q;  5HGT A;  3MXN B;  2EY5 A;  2HDM A;  2JYO A;  3MXU A;  4P2C B;  5FLM H;  1X3E A;  2AHO B;  2CKZ B;  2OT2 A;  1S5B D;  1YBY A;  4X65 L;  4DR4 Q;  4Y7N B;  1VQJ A;  1VQC A;  4LFA Q;  3IKJ A;  2FMC A;  4GN3 B;  3IL8 A;  1B9N A;  4LF6 Q;  1OXU A;  2G9H D;  4R8I A;  3GTL H;  1B4O A;  1LV9 A;  1UEA B;  1YEZ A;  1STB A;  1V1P A;  2XVS A;  1TKW B;  1FNW A;  3T53 B;  3TRZ A;  2CQO A;  2WB1 E;  1WI5 A;  4IUV A;  1U4M A;  3AFP A;  1T5X D;  4AIM A;  2UXB L;  1W2B A;  3BDC A;  4HID A;  1MD2 D;  2R93 G;  2WB1 B;  3CAM A;  2ID0 A;  5LMN L;  2V1C C;  3V2T A;  1TWG H;  2K5W A;  3J80 E;  3M7G A;  3TSS A;  3J7A 5;  3LX0 A;  5DM7 3;  4DV4 Q;  2JA8 H;  5C4J H;  5C4X G;  3I2Z A;  3M85 A;  4RGM A;  1U5K A;  2BH8 A;  3NEN A;  2B2T A;  1N36 L;  1HR0 W;  2Z8L A;  2ZXR A;  4RHR A;  4GLV B;  2KCM A;  5AJ3 Q;  1A15 A;  1TWF B;  3ND9 A;  4JI3 Q;  1HZB A;  2H5X A;  1LAB A;  5GQO A;  4RMF A;  2E2H B;  1N32 Q;  1I4H A;  1E1O A;  1GHJ A;  1I50 H;  2RA4 A;  5HGQ A;  4PMC A;  2IWH A;  4HCE A;  1SYG A;  4DV0 L;  4OX9 L;  5K36 H;  4E6I A;  3ULL A;  4DK1 A;  2LSS A;  2BE5 C;  4DXG A;  3J81 i;  1XMO L;  2C9O A;  3CME A;  3OTO Q;  3KLS A;  1IBL L;  1S4Z A;  5TSS A;  5JPM C;  2VZA A;  4YHH Q;  5C44 H;  2OQ0 A;  1JB3 A;  3JAM E;  2R7Z H;  4WFN 3;  4DV1 L;  5IGE A;  1BKB A;  2K4K A;  1FGU A;  3HEJ A;  2JE6 I;  2F0K A;  4ZAI A;  2F0D A;  4DK0 A;  2MPM A;  1N36 Q;  2UXC L;  4DV2 Q;  1J6Q A;  4OWX B;  2NN6 H;  1LO5 D;  4I7A A;  2PNH A;  4OO1 G;  3Q23 A;  5M9O A;  3N6R A;  1G29 1;  1ZKO A;  2EYJ A;  1F2M A;  2E5L Q;  3NE5 B;  3VR5 A;  5GAG C;  4UDU C;  2EJG C;  1KXL A;  3A7A B;  4A76 A;  1LTI D;  1DJR D;  4AYB G;  1XPR A;  4CGY B;  3OW2 A;  1LM0 A;  5EQ0 A;  5KYI A;  3OMG A;  4HJA A;  4JYA Q;  2PYK A;  1B7Y B;  3MWY W;  2XRQ D;  5BN3 A;  3NTH A;  1SNP A;  1Q46 A;  2JSO A;  1TS5 A;  3VR4 A;  1I4P A;  3PO2 B;  1H95 A;  3S9W A;  1DOK A;  1M90 C;  1PYW D;  1EYA A;  5EAY A;  2DUD A;  1TWA B;  2CQA A;  3ERQ A;  1YNN C;  2G9D A;  4LF8 L;  2I5H A;  3A56 A;  3KBX A;  4HIK A;  4A3D H;  2EIF A;  3S14 H;  1BF4 A;  2RVL A;  1SYD A;  4GKK Q;  3TZU A;  2N49 A;  5CV5 A;  4DR7 Q;  2LXK A;  1BBU A;  1TII D;  4P74 A;  3I4N B;  2PQA A;  2K5D A;  2WAQ B;  4YY3 Q;  3T13 A;  2F0T A;  1PA6 A;  1ML0 D;  3S1Q B;  5IYC G;  4QL5 A;  3R2I A;  1Z6H A;  3HOY G;  1DOM A;  2OXP A;  3OOC A;  2VNU D;  1R9T H;  1IW7 C;  2HT1 A;  3A8I E;  1VQN A;  5KYL A;  3KF8 B;  2L15 A;  3H91 A;  3RLN A;  1HZ9 A;  3CCR A;  2BCO A;  1TS4 A;  4CJ0 B;  1I6H H;  5ELE A;  1C0A A;  3PO3 G;  3GTJ H;  2F4V Q;  1DYQ A;  1GVP A;  4JOI C;  3E9I A;  4DF7 A;  2IT1 A;  3TDQ A;  2CH4 W;  4JW0 A;  2A6H D;  2EOT A;  4JI5 Q;  3SGI A;  2CVR A;  3OTO L;  3V05 A;  3CCL A;  2QA4 A;  3HOV B;  5JJL A;  4B3R L;  2NB0 A;  1VQ6 A;  1QNK A;  5JEA G;  2HCI A;  3E5S A;  1A3T A;  4A3F H;  4AYB B;  2K7V A;  5EBD A;  1FD7 D;  1EYC A;  3CXC A;  2CHB D;  3C1F A;  3QR8 A;  5BR8 Q;  1GO3 E;  2D9U A;  2MO1 A;  2E5L L;  4L8J A;  1RTN A;  2JP1 A;  2XRS D;  1B70 B;  4C3J H;  5K5P A;  1UEB A;  2FMM A;  2L12 A;  4IPG A;  1I94 Q;  4TVA B;  3CF5 A;  3TP7 A;  3T1H L;  3CMA A;  4PV1 C;  4YWM A;  3SDZ A;  3KDF A;  1Y1W B;  2EYM A;  3R2T A;  2Q8T A;  3RR5 A;  1OXX K;  4C1N I;  3E3X A;  1VF7 A;  1AN8 A;  1PRT C;  3PIO A;  2IW3 A;  1S5C D; 
#chains in the Genus database with same CATH homology
 2L9H A;  1B53 A;  3S17 B;  3NTI A;  4CJ2 C;  1IKL A;  1TWH B;  2O5J C;  1LTS D;  3HOX B;  3GTL B;  4V0B A;  1IW7 D;  1A2T A;  3DMU A;  3H3V C;  4M8A A;  1SEB D;  1EY7 A;  1SJH D;  3NK9 A;  5C0X H;  1GUN A;  3HOY B;  4TSS A;  1V8Q A;  2B2U A;  4CHT B;  5DNF A;  1LTA D;  4XTC S;  2EY2 A;  3L7Z C;  2EVB A;  3A8J E;  4FXG C;  1PZI D;  1A6X A;  1UUP A;  4IUN A;  4RKB A;  1U4R A;  2YU9 B;  1L0Y B;  5CV4 A;  4DU9 A;  1KNA A;  3TN2 A;  1SYE A;  2R3Z A;  1DOL A;  3K59 A;  3HOU B;  5COR A;  3G7L A;  2V4D A;  1LLR D;  4IZ8 A;  5IGC A;  4B9X A;  3GO5 A;  5I2X A;  1H9M A;  4ZUI A;  1BCP D;  1Q1E A;  3NP8 A;  3D4R A;  2A68 C;  1TU2 B;  3EA6 A;  1JWM D;  2GA4 B;  4LK1 C;  4G57 A;  4DAV A;  4A3M B;  4CBV A;  3VYT A;  3DWA A;  4KY5 A;  3FRP B;  2PQE A;  3J7A V;  3I4M B;  3BG3 A;  2B2U C;  3D6C A;  2NVY B;  2WV6 D;  2F0J A;  4MN3 A;  1VCI A;  4B08 A;  1TVX A;  1DXM A;  3UI2 A;  3NPP A;  1M4V A;  3HG9 A;  1BR9 A;  2KED A;  3E0J A;  4FNF A;  1LTG D;  5EKI A;  1GUG A;  1IKM A;  4K6D A;  3EVQ A;  2WIN B;  4C2M B;  4IFD H;  2F0W A;  4IUT A;  4X3T A;  5KIX A;  1O78 A;  2Z4I A;  2H1E A;  1AW7 A;  5D3D A;  1K8M A;  5FO7 B;  1EIH A;  2QIL A;  5CC4 A;  2KEC A;  1JOQ A;  2PO4 A;  2NUC A;  2WKD A;  4KTA A;  4ZQ3 A;  1BCP C;  1UAP A;  4NMZ A;  3ND8 A;  1RD9 D;  5E3F A;  2IX1 A;  4Z9C B;  2A6E D;  4RWS C;  5G3L D;  5K36 G;  1X3P A;  3ZYY X;  2NBF A;  5EKL A;  2E75 C;  1HUM A;  1G91 A;  1AZP A;  3D31 A;  5I2Y A;  1WTX A;  1HA6 A;  2KUM A;  4F7X A;  4N9T A;  1ZYR C;  2TMP A;  3A7L A;  2L0C A;  2MJ8 A;  2K1B A;  2A6E C;  2BOS A;  3CRL C;  2B2T C;  3K5M A;  5IGF A;  4QB4 A;  1SE4 A;  4XQJ A;  1E2Z A;  1EOT A;  1F9R A;  4HCS A;  5C5L A;  4TQU S;  3U9O A;  4XQQ A;  4LMQ D;  2L1B A;  4JK1 C;  2PZW A;  5M5W B;  3SXH A;  3J7A F;  2R6G A;  2Z1C A;  3J81 E;  1B9M A;  2R92 B;  3EQL C;  3GQB A;  1GHK A;  3PMF A;  3TP6 A;  1BDO A;  1JWU D;  1WTO A;  1H9R A;  2RBM A;  3BDL A;  3NQI A;  5F2D A;  4IUR A;  2EJM A;  2DNC A;  1EQT A;  1EY6 A;  3KLR A;  3WOE A;  3FPP A;  1GOZ A;  1CA5 A;  3R3O A;  4HSV A;  2KOL A;  1PTO B;  3VYR A;  4GZY C;  1K83 B;  4IAL A;  1FGB D;  1IHZ A;  1I4Q A;  1WTP A;  1C4Q A;  1G8Z D;  1SMY D;  3KBG A;  3VYU A;  4KJN A;  5C0X G;  2QKI C;  1GUS A;  1TY2 A;  5C4Z A;  3I8Z A;  3ITP A;  5FOB B;  1PDQ A;  1IL8 A;  4NKL A;  1OXV A;  1VF5 C;  1S5F D;  1STN A;  4A3B B;  4QUF A;  2YYZ A;  1PTO F;  2LKV A;  4FP5 D;  3T51 B;  4MIU A;  4ODG A;  4QUC A;  1HPC A;  5I6Y A;  3QIA A;  1CT1 D;  1WTW A;  3OW7 A;  3Q0A A;  1AFP A;  3K57 A;  2F0L A;  2R61 A;  4R8N A;  5EBC A;  3I73 A;  2EYH A;  2F0S A;  1NR2 A;  3DM1 A;  2C5C A;  2KVM A;  4A3I B;  3FPU B;  3EJI A;  2A68 D;  3HZX A;  4FF4 A;  1HFG A;  5IT9 E;  1JR0 D;  2EYL A;  2E2J B;  1EU4 A;  1MSH A;  4NW2 A;  2HQE A;  2PW7 A;  2F0E A;  1TR5 A;  2PPB C;  1XWE A;  5EPK A;  3SR1 A;  1F9P A;  3TP5 A;  3D4W A;  3S16 B;  5KRU A;  3C46 A;  3M7N A;  2E74 C;  1PZK D;  3L3O C;  3DWQ A;  3VR6 A;  1SXT A;  2NVT B;  1CHQ D;  3KLS X;  2SNS A;  2PW5 A;  1NAP A;  2LFN A;  5JPN C;  4A3E B;  3DEO A;  4DFA A;  3PIP 3;  5I6W A;  1ZXT A;  2B8F A;  1STH A;  1RTO A;  2B2V C;  2FHT A;  3IFT A;  1KAB A;  5I4D A;  2NVX B;  1DCZ A;  2K03 A;  2RQX A;  1PTO D;  1F2Y A;  4G7O C;  5EKK A;  4RGO S;  4BWG B;  1RF2 D;  4TRD A;  1PRT B;  4XT1 B;  2BDN A;  1G6Z A;  1HTL D;  1F2L A;  1TWC B;  4PNY A;  4K2L A;  3DEP A;  4CKB A;  4KY7 A;  1TWG B;  5E4W C;  2B39 A;  4QCL A;  3K5N A;  1I4G A;  4M1U B;  4HTH A;  1RCV D;  2SEB D;  2X6G A;  2K5Q A;  5LL6 S;  3D6W A;  1HHV A;  1X3Q A;  5JVH 3;  3S2H B;  1JC7 A;  4A3K B;  1SYC A;  5ELF A;  2D5D A;  2ICI A;  2K6A A;  3VA5 A;  1QNU A;  3NUC A;  5CGK A;  1W6K A;  3U9S A;  5IT9 L;  4WRD A;  1SNQ A;  2FJ2 A;  1MSG A;  1RJT A;  1H9S A;  3T56 B;  3BS1 A;  4H44 C;  4EVO A;  3PUZ A;  2DN8 A;  2AQ3 B;  4JBW A;  2F3V A;  2R93 B;  1HQM C;  1V43 A;  5CV9 A;  5A2Q L;  1EZ6 A;  1LTB D;  1OXS C;  1QE6 A;  3FDT A;  2K01 A;  1SNO A;  3MVV A;  4HAE A;  4K5W A;  2M2L A;  1Q3L A;  4ZKC B;  2F0Q A;  3Q6S A;  5D14 A;  4ZLT F;  2QF7 A;  4OO1 H;  2NN6 G;  1EZ8 A;  1BXT A;  1HA5 A;  5EPJ A;  3E6Z X;  3NXW A;  4C3I G;  1Q8I A;  3GP7 A;  3VYS A;  2HCC A;  1C48 A;  1DON A;  3J7Y W;  4A93 B;  3GTJ B;  3MTS A;  1WD0 A;  1KLG D;  2SNM A;  1EYD A;  3BDO A;  2VXW A;  5FO8 B;  3SK5 A;  4K6L A;  5J22 A;  2IL8 A;  1MBY A;  4K14 A;  3TME A;  5IOC A;  1SE3 A;  1BBX C;  3HRZ C;  1AEX A;  2LY7 A;  5J1Z A;  2F03 A;  2RKS A;  3EFX D;  1HTP A;  4H7B A;  4Q5V A;  4X3K A;  3T4A C;  3MFG A;  5FLX L;  1Q12 A;  5JVG 3;  1LTR D;  4DA2 A;  3G6J B;  4BBS B;  1SYF A;  5CV6 A;  1X32 A;  2H4O A;  1CQV A;  4O1N A;  4IFD J;  1DZ1 A;  1YNN D;  2XIW A;  1ET9 A;  3WDN A;  5C3W A;  4CKC A;  4I7Z C;  1EEF D;  3I3C A;  5E1F A;  4BA1 I;  3DWP A;  3K5L A;  3CKI B;  4TKO B;  3Q22 A;  2F0F A;  1SE2 A;  2B2Y C;  3SEB A;  4MHE A;  4ZKB B;  2KCN A;  1EU3 A;  1EWH A;  4G7Z C;  5CBA E;  1HRJ A;  5C44 B;  1F77 A;  2N88 A;  1O7Z A;  3HKZ B;  1ZEQ X;  1STG A;  1U4P A;  5C0X J;  2ZT9 C;  3TP8 A;  1PRT D;  4BY7 B;  2M9V A;  4HN7 A;  4QMG A;  1OO9 B;  4NP5 A;  3L9A X;  2XWB B;  5CMD A;  3GV6 A;  1CZW A;  5T1G A;  3DXJ C;  2NWG A;  2IPK D;  3LWE A;  2B2V A;  3RZO B;  5IIF A;  1D1K A;  2A73 B;  2X6L A;  1O80 A;  1PFN A;  3X3M A;  3CQZ B;  2TSS A;  4X3S A;  5KGU A;  4KHZ A;  2ICE C;  3OWE B;  3W3A A;  1I6H B;  1B50 A;  2IX3 A;  1STY A;  4XYQ A;  1A2U A;  3GD7 A;  1R4P B;  1ET6 A;  4RGN A;  1WTV A;  2E2I B;  3KF8 A;  2Y0S B;  4KK7 A;  3V96 A;  1A3U A;  2E76 C;  1EFI D;  1JOO A;  2K33 A;  1MGS A;  3KUP A;  1EY4 A;  2VB3 X;  2JXM B;  1WTR A;  3OMC A;  2PMZ B;  1KDB A;  2BA1 A;  1XX8 A;  4RKL A;  2F0G A;  3AB9 A;  1PZJ D;  1EL0 A;  1XTC D;  3K6O A;  5C5M A;  3NBI A;  4O42 A;  3X3N A;  1S5D D;  3GTG B;  2F0M A;  2XN9 C;  3MAQ A;  4RHS A;  2BE5 D;  1XYI A;  4EQN A;  3WOF A;  1Q90 A;  1TQO A;  4RH6 A;  1LT3 D;  5LL6 X;  1VMP A;  2JEB I;  1QCB D;  3PUY A;  1PMR A;  2F0U A;  3K0Y A;  2Q8I B;  2JA7 B;  3FEW X;  4XXE A;  4J8Q A;  1PFM A;  2XWJ B;  1JOR A;  4C3I B;  2O4X A;  2M00 A;  5DM6 3;  3NBH A;  4KD3 A;  1SFO B;  3S2D B;  5IOD A;  3IAY A;  5DAU A;  4WJW A;  4C3H B;  1C8C A;  4G4K A;  1CFM A;  1B2T A;  4ULL A;  3SK6 A;  2JA6 B;  3HGB A;  3VA7 A;  3S15 B;  3PUV A;  2KHS A;  3K5O A;  3HS0 C;  2A74 C;  1G2S A;  5I9P A;  4IUQ A;  2WKC A;  3NSW A;  1HFN A;  1RDP D;  5BN5 A;  3MXP A;  3OIP A;  1I3Q B;  4IUP A;  1RHP A;  5FLX E;  4XDX A;  1T5E A;  1FNU A;  5EJW A;  3C2P A;  4HMI A;  2B2W A;  4EQO A;  4PMB A;  2MUY A;  5ELD A;  4OGQ C;  5IGG A;  3PV0 A;  1CTM A;  1D5Z C;  1Z47 A;  4CKE A;  1SSO A;  2R7Z B;  3BYY B;  1GXD C;  2CW0 C;  3QO2 A;  3FKI B;  2XNA C;  2BA0 A;  5AFW A;  2B63 B;  1GJX A;  5FKA C;  1HQR D;  1JE4 A;  4S3S A;  3I91 A;  3RZD B;  3A54 A;  1D1I A;  2X69 A;  5CV8 A;  2F0V A;  4F87 A;  2MHV A;  1CHP D;  4FF2 A;  2AQ2 B;  1I4R A;  2J7Z A;  1STE A;  4A3J B;  4HSP A;  3M3Y B;  3VR3 A;  1SMY C;  2AUK A;  2WII B;  4RCN A;  3LNN A;  4ZYS A;  1BCP F;  2SOB A;  4QIW B;  1YNJ C;  3SHL A;  2PNR C;  3MHB A;  1Y69 U;  3SE0 A;  4KHV A;  3DUZ A;  4KKS A;  1W6J A;  4DAP A;  3LWU A;  1CZG A;  2F0H A;  4UAI A;  2QCP X;  2NTT A;  2EDG A;  4K5X A;  2ZXP A;  3BZD B;  1YNJ D;  1KTK A;  2OEO A;  1KDC A;  3S1M B;  1WCM B;  4ILW A;  3PUX A;  4K5V A;  3GTP B;  3IFD A;  1Y8N B;  2A69 D;  2RSN A;  2SDF A;  4K8J A;  1A3V A;  1ILQ A;  3HOW B;  1U4L A;  1SAP A;  1HCZ A;  1Y1V B;  3PIO 3;  2QDB A;  1MI2 A;  1EY0 A;  3SK8 A;  3MC0 B;  1ENC A;  3OSO A;  1DD2 A;  3BVM A;  3OHX C;  2PZU A;  1U9R A;  1AZQ A;  5C0X I;  3BVG A;  1V1O A;  2CW0 D;  1OXT A;  3PO3 B;  1B3A A;  4DXF A;  5A35 A;  3J80 L;  5D3I B;  4KKU A;  5M3M B;  3P20 A;  3S1R B;  2A6H C;  4ZUJ A;  3OIQ A;  2B2Y A;  5KNB A;  5C4X B;  1BUV T;  4IQZ A;  3S1N B;  4OO1 I;  1VDZ A;  3S14 B;  1D5X C;  4C3J G;  4NDX A;  4B9W A;  1EEI D;  5EPL A;  5CR3 A;  1O7L A;  2FIN B;  4FO2 A;  1WVL A;  1QIL A;  3RD4 A;  1D5M C;  2L11 A;  2HUG A;  2F0O A;  4C1N K;  3I4L A;  2L55 A;  1M8A A;  1II3 A;  1BNZ A;  1PTO C;  4XIG S;  3DHQ A;  2LMC B;  1EQV A;  2B2W C;  3NWT A;  4C3H G;  1S5E D;  1ZYR D;  5JJZ A;  4FF1 A;  4L6T B;  1R4Q B;  4R9W A;  4WOR A;  5M5Y B;  3MZ5 A;  1GUW A;  1KNE A;  3RLF A;  1TY0 A;  3QB3 A;  1IYU A;  4ZK9 B;  3C3L A;  1QWY A;  2KCC A;  5JEA H;  2JA5 B;  2JEA I;  3GV3 A;  1ENF A;  3MXG A;  2EYF A;  4A3F B;  1HUN A;  1F2Z A;  1HXY D;  1FR3 A;  5NUC A;  3NTK A;  1FYC A;  2XSC A;  1KDA A;  4RA8 A;  5FK9 C;  1K8O A;  5C4H A;  2O5I C;  3KK7 A;  4ID6 A;  3T16 A;  3I90 A;  2JA8 B;  2NN6 I;  1O7Y A;  1EY5 A;  2N55 A;  5CV7 A;  2EY1 A;  3QOL A;  1BOS A;  4IFD I;  1CK1 A;  1AP0 A;  1ICW A;  2K04 A;  4KI0 A;  4FF3 A;  5KND A;  1R9T B;  2I07 B;  2B8G A;  1SNM A;  4OHJ A;  1EY9 A;  4U68 A;  4OIK A;  3CHB D;  1ENA A;  3M4Y A;  4OIJ A;  2D2C C;  4KN7 C;  1SJE D;  3H0G B;  1SND A;  4K2K A;  1SNC A;  2IJ0 A;  1XXG A;  4IN3 A;  4IUU A;  1BCP B;  4FXK C;  2NVQ B;  2HDL A;  3MEH A;  5T1I A;  4KD4 A;  4XQN A;  2KJX A;  3GTO B;  4BS9 A;  2F0I A;  1D6E C;  3NQT A;  4G7H C;  5G3L F;  3M4O B;  4X3U A;  2DY7 A;  4L63 B;  4FXD A;  4EQP A;  4FVM A;  2F1M A;  4RAU C;  2VB2 X;  4A3G B;  3A8K E;  1SDF A;  3R93 A;  3MXN A;  4IFD G;  1H9J A;  3D3R A;  5C3E B;  4LJZ C;  5FO9 B;  1IYV A;  1NR4 A;  2F0P A;  1VMC A;  2F4I A;  3AU7 A;  1H9S B;  4RGT A;  1FNV A;  3CRK C;  5IGB A;  3SVM A;  1QJO A;  3O13 A;  1NUC A;  5ELC A;  5C4J B;  2AWN A;  4XYO A;  4U67 3;  3GTM B;  2ENB A;  1RKN A;  2FFK B;  2EYO A;  3TBI B;  1QOH A;  5C6A A;  2QEJ C;  4DGZ A;  5M5X B;  1LT4 D;  5CYU A;  1EIG A;  3FMC A;  1JOK A;  2KA7 A;  2RDG A;  1LAC A;  3Q24 A;  1UNS A;  1PTO H;  3RMH A;  4PMW A;  4C56 C;  2RSO A;  4PQX A;  1E2V A;  3BYT B;  2EPB A;  1PLF A;  5HUR A;  1TT2 A;  3QJY A;  4HMJ A;  1Y8P B;  1KLU D;  1SYB A;  1LT5 D;  4ZRZ A;  1B44 D;  2J0T D;  1JWS D;  3H94 A;  3JAM L;  4YIJ A;  3MFY A;  3H09 A;  5I9O A;  5M3F B;  2J4X A;  3D8G A;  4OL7 A;  1WD1 A;  1ONL A;  5EGT A;  3P1H A;  5COY A;  2WAC A;  3QOJ A;  4DN4 M;  3ONA B;  4C3J B;  3PUW A;  3OWF A;  3NHH A;  1DM0 B;  2MGS A;  4ABN A;  3QWN A;  2O2L D;  1KAA A;  1PFB A;  2EXZ A;  2LS0 1;  2RDF A;  4I65 A;  5ISR A;  4LAA A;  3K7A B;  1H9K A;  2DY8 A;  4J6H A;  5LHY 1;  3R8B A;  1QB5 D;  3CU7 A;  4RFB A;  2NYZ D;  4RCO A;  2VUM B;  2PZT A;  2I46 A;  1EWC A;  3A55 A;  1WTQ A;  2KQ3 A;  4CJ1 B;  1Y8O B;  2K05 A;  4DNR B;  3FVQ A;  1F9Q A;  4H0L C;  4QF4 A;  4V19 0;  3HOZ B;  2PCF B;  1E0B A;  1JCK B;  4DNT B;  2K28 A;  4DAY A;  2EJF C;  5KEE A;  1D2B A;  3AMU A;  1ESR A;  4Q0F A;  1TS3 A;  5E4X A;  1BQQ T;  2OF1 A;  2F3W A;  2EZV A;  3BVZ A;  1L0X B;  4N9P A;  4F88 A;  3F2U A;  5D65 A;  2F0N A;  4BA2 I;  4BY1 B;  3GTQ B;  2A5H A;  5J39 A;  4KV6 A;  1I50 B;  1LTT D;  2AUJ D;  2L4N A;  2KEE A;  2ZXO A;  2Q8R E;  1JQY D;  5C3X A;  4ME5 A;  1EY8 A;  2EY6 A;  1GUT A;  4H13 C;  5ELB A;  1CA6 A;  1PXU A;  1I4X A;  1PRT F;  2K32 A;  5IGD A;  4EGV A;  3P75 A;  4KY6 A;  1SBB B;  2L5T A;  3TZD A;  1V1P B;  3HP3 A;  3RUZ A;  4KN4 C;  2WP8 J;  5JEA J;  1B1Z A;  3GTK B;  1STA A;  3OPO A;  1NSN S;  2EYP A;  1J9O A;  2NTS A;  1QG7 A;  4K8I A;  3D4D A;  2DNE A;  2EE1 A;  1BO0 A;  2E2D C;  1I6V C;  5CBE E;  3I70 A;  4J1M A;  1E2W A;  3MA2 B;  3URY A;  3J81 L;  2Z4H A;  2NZ1 D;  4KJO A;  4BBR B;  1Z7T A;  5JAV A;  5BN4 A;  3P7J A;  2IX0 A;  4A3D B;  1ROD A;  3I72 A;  2D62 A;  1CM9 A;  2AQ1 B;  4HR7 B;  1J8I A;  4FYD A;  5JOB A;  3ERO A;  3SK4 A;  1NCV A;  1GUO A;  4KKT A;  1LT6 D;  3NWS A;  2RDH A;  5DEH A;  1Q1B A;  3K58 A;  5A2Q E;  4HED A;  3QG1 A;  1TS2 A;  3VR2 A;  3W2D A;  2A69 C;  1G2T A;  2AWO A;  1F9S A;  4F8M A;  1JIC A;  3H6M A;  3N52 A;  3C1E A;  2MP1 A;  4KMU C;  1ESF A;  1CQF A;  2BDO A;  1ILP A;  5KNC A;  4XT3 B;  1CI3 M;  5HGT A;  2EY5 A;  2HDM A;  2JYO A;  3MXU A;  4P2C B;  2OT2 A;  1S5B D;  4Y7N B;  3IKJ A;  2FMC A;  3IL8 A;  1B9N A;  1OXU A;  2G9H D;  4R8I A;  1B4O A;  1LV9 A;  1UEA B;  1STB A;  1V1P A;  2XVS A;  1TKW B;  1FNW A;  3T53 B;  4IUV A;  1U4M A;  1T5X D;  3BDC A;  1MD2 D;  2WB1 B;  2ID0 A;  3V2T A;  2K5W A;  3J80 E;  3M7G A;  3TSS A;  3LX0 A;  5DM7 3;  3M85 A;  4RGM A;  2B2T A;  2Z8L A;  2ZXR A;  4RHR A;  1A15 A;  1TWF B;  3ND9 A;  1LAB A;  2E2H B;  1I4H A;  1GHJ A;  2RA4 A;  4PMC A;  2IWH A;  4HCE A;  1SYG A;  5K36 H;  4E6I A;  4DK1 A;  2BE5 C;  4DXG A;  2C9O A;  3KLS A;  1S4Z A;  5TSS A;  5JPM C;  3JAM E;  1JB3 A;  4WFN 3;  5IGE A;  2JE6 I;  3HEJ A;  2F0K A;  4ZAI A;  2F0D A;  4DK0 A;  2MPM A;  2NN6 H;  1LO5 D;  4OO1 G;  3Q23 A;  5M9O A;  3N6R A;  1G29 1;  1ZKO A;  2EYJ A;  1F2M A;  3NE5 B;  3VR5 A;  4UDU C;  2EJG C;  3A7A B;  1LTI D;  1DJR D;  4CGY B;  5EQ0 A;  5KYI A;  3OMG A;  2PYK A;  3MWY W;  2XRQ D;  5BN3 A;  3NTH A;  1SNP A;  2JSO A;  1TS5 A;  3VR4 A;  1I4P A;  3PO2 B;  3S9W A;  1DOK A;  1PYW D;  1EYA A;  1TWA B;  2CQA A;  3ERQ A;  1YNN C;  2G9D A;  3A56 A;  3KBX A;  1BF4 A;  2RVL A;  1SYD A;  3TZU A;  5CV5 A;  1TII D;  3I4N B;  2K5D A;  2WAQ B;  3T13 A;  2F0T A;  1ML0 D;  3S1Q B;  3R2I A;  1Z6H A;  1DOM A;  2OXP A;  3OOC A;  2VNU D;  1IW7 C;  3A8I E;  5KYL A;  3H91 A;  2BCO A;  1TS4 A;  4CJ0 B;  5ELE A;  1DYQ A;  4DF7 A;  2IT1 A;  3TDQ A;  2A6H D;  2EOT A;  2CVR A;  3V05 A;  3HOV B;  2NB0 A;  1QNK A;  5JEA G;  2HCI A;  3E5S A;  1A3T A;  4AYB B;  2K7V A;  5EBD A;  1FD7 D;  1EYC A;  2CHB D;  3C1F A;  2D9U A;  4L8J A;  1RTN A;  2JP1 A;  2XRS D;  5K5P A;  2FMM A;  2L12 A;  3TP7 A;  4PV1 C;  3SDZ A;  1Y1W B;  2EYM A;  3R2T A;  2Q8T A;  4C1N I;  1OXX K;  1VF7 A;  1AN8 A;  1PRT C;  2IW3 A;  1S5C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...