2B8FA

Solution structure of bacillus subtilis blap apo form (energy minimized mean structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of Bacillus subtilis BLAP Apo form (energy minimized mean structure)
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Biotin/Lipoyl Attachment Protein
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b8fA00
2JE6I 4KI0A 2PCFB 3BDOA 1H9SB 3QIAA 3A7AB 1I6VC 1OXXK 3DXJC 2Q8IB 2PPBC 2AUJD 4IFDG 4KMUC 2DN8A 1GHKA 2JEAI 3AB9A 3U9SA 4H13C 2D62A 1E2ZA 1OXUA 2B8FA 1LABA 2A6ED 4XTCS 3CRLC 2BDOA 3FPPA 5KNDA 3RLFA 3ND8A 5C0XG 2AWOA 2EDGA 2IT1A 1GUTA 1LACA 3QG1A 4JBWA 3P20A 1HQMC 2JXMB 1IYUA 3T53B 2PNRC 2V4DA 1BDOA 1SMYC 2A6EC 1OXTA 1E2VA 4BA1I 3MXUA 3OPOA 1GUNA 3I72A 2B8GA 4DK0A 2K33A 3M85A 3I73A 1GUGA 5K36H 1VF7A 3L7ZC 3CRKC 3PUXA 1YNNC 4JK1C 2BE5D 3EQLC 1Z6HA 3FMCA 1Q1BA 4KKSA 2A68C 1GUSA 1VCIA 1V8QA 3IKJA 3VR4A 1DXMA 3HGBA 3TZUA 1CI3M 4IFDH 5KNCA 4I7ZC 2E75C 1IYVA 1T5EA 4KN4C 1V43A 4G7ZC 1H9RA 2CW0C 1GHJA 2K7VA 3GQBA 4TKOB 2D5DA 5JEAG 3M4YA 5KNBA 2BE5C 3BG3A 3ND9A 3OW7A 3VR3A 2EJGC 3D4RA 1K8OA 1HCZA 1Y69U 2A69D 1Q1EA 4HR7B 4L8JA 2R6GA 1HTPA 2EJFC 3VA7A 2DNCA 1O7LA 2D2CC 3LWUA 1Z7TA 5K36G 1YNJC 3PUVA 2EJMA 1B9NA 1K8MA 2A6HC 3GD7A 4KHZA 3VR5A 3PUZA 1FR3A 1B9MA 1H9MA 3T51B 3A8KE 3NE5B 5BN4A 1Q90A 4DNTB 5BN3A 2JEBI 4OO1H 3QJYA 4PV1C 4RCNA 1VF5C 3VR2A 4G7OC 1OXVA 1IW7C 1ZYRC 2A6HD 2EVBA 1HPCA 2BA0A 1DCZA 2K32A 4OO1G 4G7HC 1CTMA 1H9KA 4GZYC 2YYZA 3D31A 3A7LA 1GJXA 1ZKOA 2NN6H 3SE0A 4DK1A 2A69C 5JEAH 4KKUA 1IW7D 2E74C 2NN6I 4KKTA 4LJZC 3N6RA 1CFMA 2LMCB 4LK1C 4DNRB 1Q12A 2O5IC 1DD2A 1QJOA 1TKWB 3I4LA 4H44C 5A35A 1FYCA 3PV0A 1Y8OB 1H9JA 1GUOA 1O78A 2AUKA 2A68D 2BA1A 3H94A 3KLRA 3MFYA 4H0LC 3M7NA 1PMRA 1H9SA 5C0XH 2QF7A 2E76C 1Y8PB 4OGQC 2DNEA 3OOCA 3T56B 2KA7A 1Y8NB 3IFTA 3W3AA 1ONLA 1EWHA 1OXSC 3PUWA 1TU2B 3SDZA 3PUYA 1VDZA 2F1MA 3WDNA 2O5JC 2NN6G 3LNNA 5BN5A 3A8JE 2ZT9C 3VR6A 1E2WA 3A8IE 4TQUS 2KCCA 1G291 4XIGS 2L5TA 4KN7C 4BA2I 4IQZA 1A6XA
chains in the Genus database with same CATH superfamily
2J0TD 4GLVB 5COYA 4I65A 1Q7YC 3Q22A 5J39A 1FL0A 3AB9A 4QIWB 1A3UA 2JJQA 3RLOA 2K5WA 2JA5H 1BBWA 3DEPA 4RGTA 1EY6A 1L0WA 4R8NA 1VS0A 3H3VI 3NHHA 4FF4A 4BY7H 5CC4A 3RN5A 1P8LA 4X3SA 1EL0A 2AMCB 2XVSA 2JA9A 3WOFA 4LF6Q 1X65A 5M5XB 4GLXA 1LT5D 3DWAA 3HFZB 3TP5A 1HR0Q 1G8ZD 4BY7B 1E24A 4OIKA 3CU7A 2PMZB 1C7YA 4GKJQ 1QOHA 3V05A 2L11A 4DV7L 4EQ5A 4A3GG 3ND9A 2NVXH 1HNZQ 4YIJA 4X62Q 3M9BA 1Y69U 4DR2L 5EPKA 1DONA 3NPPA 1WTRA 4JI6Q 1YNJC 2EJMA 3A5ZB 3BJUA 4YY3Q 1TY2A 1JCKB 4GLAC 3PUZA 4OX9L 4BXXG 3R93A 4PNYA 4ABNA 2PO4A 4AYBE 5GADC 1Y1VG 1EFWA 1ASZA 4PV1C 5KGUA 3S2HH 3E5SA 4WJWA 4A4IA 2RKSA 1K9MC 2R92H 2YYZA 4ILWA 4JI7Q 1YBYA 1D2BA 1AW7A 2F0QA 3GTGH 3GTJB 3TRZA 1W3SA 4C3HG 3DM1A 3PIOA 4LK1C 1KABA 5ELCA 1L2FA 2JA6G 4A93G 1FYCA 2OTLA 1SNDA 2AUKA 3CXCA 1B50A 2VY3A 2Q2IA 3T56B 4L6TB 3S16H 3SK8A 3PUYA 4DN4M 1B3QA 2KCNA 1U4MA 3C3LA 4ME5A 2ZT9C 1TWCH 4A3MH 5IP9G 2BCOA 2LXJA 2K01A 1NJIC 2LY7A 4LF8L 4P73A 1BUVT 2WAQE 1LV9A 2Y0SE 4KI0A 4C3JB 1J6QA 1X3QA 4LF7L 4WJ4A 4A3FG 2KHIA 5C44H 1DYQA 5JVG3 5LL6X 3RZDH 1SNCA 2IW3A 3PO3H 2OTJA 2CHBD 4DA2A 1LABA 1O7IA 3K80C 4QIWE 1LT3D 4APVA 4HJAA 4UP7A 2B2TA 1PTOC 5EAYA 4POFA 1SE8A 2DJGC 4QCLA 4LFAL 1IL8A 1LTGD 1SMYC 1LT4D 2B2VA 5K36H 2X6LA 4RHRA 2JA7B 1GXDC 1L0YB 4C56C 1CM9A 3K5NA 1SNPA 1MI2A 2J4XA 3PF5A 1D5ZC 3F2BA 1WYDA 1SYBA 3BDCA 4J15A 1LTAD 4TKOB 3PQIA 2BH8A 5J22A 1TIID 4A3GB 4KJNA 1YHBA 4L5SA 1PH2A 3BYTB 1D1KA 4PZ8A 4JI8Q 4JCVE 4R1JA 1EYGA 1WFQA 2A6HC 3GD7A 2K05A 3QO2A 3VR5A 3NBIA 2MHVA 3K5OA 2F0PA 5T1IA 1IBLQ 5IODA 2OT2A 2FXQA 2RVLA 1VF5C 2MNAA 3A54A 3K0XA 2F4VQ 1VQIA 3PF4A 2NN6H 2PYKA 2K1BA 1GD7A 2A69C 1IW7D 1I6HH 2K50A 3EN2A 1CK1A 1DZ1A 1AE3A 1QJOA 4G4KA 3NBHA 5CV9A 3Q8DA 4DAMA 5FKAC 1A2UA 4C3JH 2E2HH 1SYEA 3S1QH 1GUWA 1W6JA 3UE0A 1JWUD 3IFTA 1I6HB 3CHBD 3JAML 3U9OA 1CT1D 2GN5A 1I3QH 2PQAB 4Y7NH 4A3EG 5C3XA 4I7AA 3OYYA 1NCVA 3A8JE 3VR6A 5FJ8H 1PYBA 4TQUS 5ELOA 2H5XA 2L5TA 1VMCA 3I4NB 3GDEA 3JAME 1WJJA 4JV5Q 2F0GA 2AQ3B 4B3TQ 1XNQL 1KRSA 3H3VH 2F0DA 5KNDA 1G2SA 1A3VA 4HIKA 3T1YL 2SDFA 1K73C 1PFNA 1QE6A 2MPMA 3E9IA 4A3IB 3T53B 3AMUA 1CHPD 2V4DA 3KBGA 1NAPA 1F2YA 4A3MG 3C2PA 5C4XB 1Q1BA 1HTLD 5C6AA 4DR5Q 4UDUC 1Q81C 2Y0SG 1IYVA 3TP8A 3LWEA 4LF8Q 1XWEA 2UUBQ 3STBC 2AHOB 1QVGA 2KCMA 5IGBA 3M4YA 1UUPA 5AJ3L 2XRQD 1BKBA 4XYOA 5CYUA 2ZXOA 2QKIC 2B2UC 3LX0A 4HR7B 1FJGL 1C4QA 4MIUA 3HOXB 4NP5A 2H1EA 1PTOB 1HRJA 1FR3A 3TZDA 4GOPA 1PV4A 3CCVA 5C3WA 2R92G 1SXTA 2SNSA 1S5DD 3GTKH 2G5DA 2FFKB 1F9QA 1VQHA 1S5BD 2EOTA 1PFMA 2F0OA 3FKIB 4A93H 1F2LA 1CFMA 3OHXC 2Z6KC 3CCSA 1JR0D 1TKWB 4XQJA 3I4MG 4AYBG 4F87A 2RQXA 3ZYYX 4EVOA 2EY6A 1SE3A 4GOPC 2F3VA 4EQNA 3M7NA 2BA1A 3G6JB 3HOUB 1M90C 3M3YH 4DV0L 2PZWA 3WDNA 1W2BA 4KY5A 3ULLA 3C1FA 5IP9H 4DUZL 3SK5A 4FDBA 2AQ1B 1SE2A 4IALA 1STNA 2IX3A 2EZVA 2R92B 4WJ3M 4X6AH 2QEXA 1AZQA 1TS5A 1UWVA 2VQFQ 2XN9C 1VQOA 2E2HB 3BDOA 3QIAA 4IFDG 1EYCA 1I6VC 3NTKA 2JN4A 3QB3A 4PQXA 4LW1A 3KF6B 1JICA 2A74C 2IPKD 1FGUA 4BBSH 4LFCL 1HQRD 3M4OH 1S4ZA 1B53A 1MHWC 3E3XA 5JPMC 1PA6A 2IX0A 3U4VA 2OXPA 1Q46A 1Y1WH 1SYDA 2NVTB 5IT9L 4A3EH 2KHJA 1HNWL 2N8NA 1GUNA 2WB1G 2B8GA 3UE1A 3NQIA 1ASYA 2A19A 2K6AA 2HHHQ 1TS2A 1F9RA 2L55A 4RGMA 1Z6HA 1N36Q 1Z9FA 4FXGC 1VQ9A 1MSGA 4HTHA 3D4DA 3NSWA 4JBJA 3NUCA 1CHQD 4HJ5A 4DAYB 2CW0C 3X3NA 1E1TA 1SYGA 3RD4A 2ZTEA 3BG3A 3OW7A 4DV4Q 1HZCA 1K8OA 5LMUQ 4F7XA 4IUUA 2R6GA 5HURA 2EY1A 3HOZG 4LFBL 2E5LQ 1N9WA 1ZYRD 4K6LA 3FEWX 3MXNB 5CGKA 1X3FA 1A8VA 5C4XG 5LMUL 2UU9L 2KEEA 4XQQA 5IYDG 2XRSD 4GKJL 3GV3A 5IYCH 4X64Q 5BR8L 5G3LF 4OO1G 4K0KL 4LFBQ 1H9KA 1M1KC 2ATWA 1PHJA 4K5VA 3J80E 2I07B 1EOTA 3F2CA 2Z6BA 3GTOB 2NN6I 2YTXA 3H0GB 4LJZC 4L63B 1XTCD 1K0RA 2NTTA 4DNRB 4QQBX 4GKKL 4DV2L 4LF6L 5L37A 3KLWA 5IP7H 3VYTA 1YHQA 4R4OA 1PRTC 3H94A 4J1MA 4P72A 4YHHL 1YVCA 1QB5D 1H9SA 4DV3Q 3TREA 4NKLA 3KLSA 1EWHA 4A3JG 1OXSC 1CKOA 1S40A 3S9WA 1LTSD 2F0HA 4RH6A 5A2QE 1FNUA 4ID6A 4F8MA 3I4NG 3L0OA 4GNXC 1SRUA 5CV4A 1L1OA 5IE8A 1S5FD 2EY2A 2L12A 5M3FB 4IZ8A 4OX9Q 2F0LA 2D62A 5C3EH 5F2DA 3FPPA 1PDQA 1TS4A 1GO3E 4AYBB 4MZ9A 1S5CD 1WI5A 1YHAA 1I4RA 3HOWG 4EQPA 2HT1A 3ICEA 4PG3A 3J81E 4X66L 4DK0A 4LUOA 3VDYA 5IYBH 1EUJA 3I73A 1RJTA 1EU3A 2VQEL 4DV0Q 1SNQA 1YNNC 2HD3A 1EQTA 3FMCA 3EFXD 1QVCA 3E9HA 3IKJA 4X65Q 1E3PA 4TVAB 1PH3A 1NTGA 4IOCA 5M9OA 3BVMA 3IAYA 2VUMB 2QILA 3PIP3 3MZ5A 3S17B 2B63G 5LMNW 5D65A 4LF5Q 3HOXG 1UEAB 2OQKA 2WKDA 3TBIB 3HEJA 1V9PA 3F2UA 2D9UA 4O1NA 2O4XA 2MP1A 2RA4A 4BBRB 3A8KE 3NE5B 2NVTH 1ZEQX 4DNTB 3BYYB 2NWGA 3QJYA 4G7OC 3OSOA 1N34L 3EA6A 4JPBW 2LSSA 1CTMA 1E7ZA 1LTLA 2K5QA 3BU2A 1RD9D 4NXMQ 3RLNA 3CCQA 4DR5L 3SHLA 4N9PA 3ITPA 2EYHA 3TN2A 3MVVA 4KKTA 1K3BC 1N36L 2K5VA 4HJ8A 2Q8TA 2E2DC 5A2QL 1S5ED 1EY4A 2I5MX 1DD2A 5JVH3 1QWYA 3C46A 1MIUA 4K5XA 1VQMA 4P75A 4DU9A 3GTPH 2MGSA 5CR3A 1J5EL 4ZKCB 2E76C 2VZAA 4B3SL 4OGQC 5JEAJ 1XMOQ 1JB3A 1IBKQ 3PO2H 5CV7A 1KNAA 4C2MH 3LNNA 4LUZA 2N78A 3T4AC 3I7FA 2HHHL 4JI2Q 2B39A 4BA2I 5DLQE 2F3WA 1EY8A 1YIJA 3FKIH 4A93B 2EYMA 5C4ZA 1EYDA 1WD1A 1BBUA 3AYHB 1KDCA 3H09A 1E2ZA 4AIMA 2ENBA 1YJNA 2A6ED 5C0XI 4FO2A 3QG1A 1G91A 4HAEA 4GN3B 5I4DA 4U673 2TSSA 4DV5Q 2BH2A 2F0IA 1Y1VB 4A3CG 3P75A 3M85A 1QZGA 1A63A 3OTOQ 3PUXA 4JK1C 1J5EQ 5FOBB 2ZM6L 5M3FG 3DUZA 4DR3Q 3GV6A 4ZQ3A 2K75A 3HG9A 1KQSA 1KXLA 5H1SE 5JJZA 3OW2A 5M5XH 3MAQA 1N34Q 1XPOA 2HCIA 2PW7A 4LF9Q 1U4LA 5C5MA 3OMGA 2LXKA 3HOZH 3RUZA 2SNMA 1F9SA 3S1MH 3VA7A 5GAHC 1I4QA 5JPNC 4BY1B 2JA5B 4UAIA 1AN8A 1IXRA 5DM73 2R93G 1GKHA 2F3IA 3KJPA 2HDMA 1WD0A 5C44G 4PMWA 1X3GA 5FO9B 2UXDL 4RCNA 3HOUG 2A6HD 1IW7C 1DGSA 4R4QA 2BA0A 5IT9c 1BCPD 2J7ZA 2UUBL 3K81C 4QJFA 2K28A 4GZYC 1N8RC 1GJXA 3A7LA 2NTSA 2Y0SB 4DR7Q 3CQZB 4O2DA 1STAA 3DWQA 3K7AH 2B2WC 4IPCA 4RKLA 1HA6A 2XNAC 1JOOA 4X3UA 1F2ZA 5KIXA 1PH9A 4JI2L 1EYAA 3H91A 4YCUA 2K5HA 1ILPA 4ZUJA 2Z0SA 4Y7NB 2MQHA 3DLLA 2KA7A 4OIJA 3I55A 4HCSA 3D6WA 1U4RA 2ID0A 2N3SA 1XMOL 1UE7A 1PZJD 1N32Q 1I4XA 1X54A 3I70A 5JJLA 4UPAA 4DR4Q 1VQPA 2F0KA 1LTTD 1VQEA 3TS0A 1PRTF 2VW9A 1IBLL 5AFWA 3H0GH 3PMFA 1DOMA 4L5TA 1PH6A 3KF6A 2ZM6Q 4A76A 2EXDA 4FXDA 4LF7Q 4FXKC 5I6WA 4IFDJ 4HCEA 2B2VC 1ICWA 4DV3L 4GNXB 1GUTA 3HRZC 4DK6C 1HQMC 4HIOA 2R7ZG 1IYUA 1BDOA 4JOIA 3NELA 1RDPD 5C4XH 1VQ8A 4HN7A 4C3IH 1R9TH 2L4NA 4JBKA 1PH4A 2HIVA 2F0VA 4JI4L 4QY7A 3PCOB 3STBD 2C35B 3MA2B 2RSOA 3TZUA 2JQOA 4QUCA 2E75C 2R7FA 3Q6SA 3BZKA 4ME3A 4KN4C 4C3HB 4XXEA 2K7VA 4DV2Q 3NEMA 3VR3A 3I56A 3NTIA 2RDFA 1H95A 4KD3A 2UUCQ 2GVAA 2L9HA 1Q1EA 3IRBA 1STGA 2DNCA 1J9OA 3PUVA 1D5XC 4OL7A 2YTVA 4FVMA 1TWAH 3NK9A 2L1BA 5J1ZA 4A3EB 1WTXA 3G6EA 2K04A 4NMZA 3I8ZA 4EGVA 1S72A 4A3KB 3HKSA 1OXVA 3CPWA 4HMIA 3W1BA 2WIIB 2I0QA 2E2IH 5EBCA 5KYIA 1KL9A 5C0XJ 4GN4B 5JOBA 1K28A 5C4JB 1SEBD 3D4WA 2Z4HA 1HNZL 2P5ZX 2JA7G 1EFID 4RMFA 4XQNA 2M2LA 3AFQA 4H44C 5A35A 4LF5L 2ICIA 4YHHQ 2G9DA 1GVPA 3CCJA 4N9TA 4OONA 3KLRA 4QGUA 3PO2G 1KAAA 1CSPA 3I3CA 3EBEA 3J81j 4OELB 4X3TA 2O5JC 2EIFA 4DXGA 5D3DA 5G3LD 1D7QA 1WVLA 2RDGA 3AFPA 1I50H 5JAVA 4K14A 1AFPA 2JA8B 2Q2HA 1YITA 3VYUA 4XT1B 3DXJC 1QUQB 3DHQA 2AUJD 3GTGB 2K4KA 2R3ZA 1EU4A 3AEVA 4A3GH 5FLXE 1ESFA 4MTNA 2WV6D 1QZHA 3CPFA 2A73B 3ULJA 2NYZD 4X66Q 4GOPB 3S2HB 2E2JB 3FHWA 4DV1Q 1JJ2A 2PNRC 3V96A 5I2XA 3RN2A 2KQ3A 3OPOA 2PQAA 2XGTA 4OWTB 1VF7A 4BS9A 1KDBA 1DM0B 2IJ0A 1CKMA 3G48A 5JJIA 4WORA 4Z9CB 4GS3A 4A3BH 3EIVA 4DAYA 3VR4A 2UXCL 4H7BA 2IHEA 4GNXA 3S14B 5LHY1 2NVQB 2RHSB 3NP8A 3OMCA 4KHPL 4ZKBB 1LTID 1NE3A 2ZTCA 1HXYD 1XPUA 4O0AA 1JB7A 2WAQB 4L8JA 2DJFC 1T5XD 4DKAC 2R93H 2QDBA 1L0XB 3HOYG 1RTOA 1TQOA 4OEMB 2OF1A 4JYAL 1BNZA 2KBNA 1CUKA 4IPDA 5FLXL 2WACA 1TS3A 1ZYRC 4OO1I 2K32A 1DCZA 1QCBD 1VQ6A 4X3KA 3G71A 2G9HD 5FLMH 1VQAA 1ZXTA 1MJCA 3HOWH 1TR5A 2F03A 4YY3L 3FKIG 1SYCA 4JI6L 5C4HA 2CW0D 1VQFA 1PLFA 3ER0A 3TP6A 1VQ5A 3KFUA 3CMEA 3F1ZA 3I4OA 3KJOA 1Y8PB 4UP9A 4HIDA 2M9VA 3HOYB 2OQ0A 3KOJA 2NVYB 3CQZH 1U4PA 4C2MB 1EWIA 4LMQD 4PZ6A 2QA4A 5GROA 1PZID 5IT9E 3QOLA 4RA8A 4LF9L 1LTRD 2KHSA 2UXBL 3SE0A 1BQQT 4IQZA 1HNWQ 5IP7G 4LF4L 4DUYL 4ULLA 3WWVA 2N55A 3NQTA 1CQVA 1D1IA 1FNVA 3S15H 4JI1L 4B3RQ 3MXNA 3CRLC 3TEHB 3O13A 2DY8A 4JI0Q 1SROA 3K5LA 1HUNA 1SJED 2VB3X 1EQVA 3I4MB 2IT1A 2UXDQ 1KNEA 3SEBA 2Z8LA 1JQYD 1WCMG 2XIWA 3HKZG 2FMCA 4FF3A 3I2ZA 4MHEA 1RODA 3DWPA 1NUCA 4HJ9A 2RHQB 2WKCA 2L15A 4M8AA 3CRKC 4DR4L 2B2WA 3U58A 4DR3L 4N8X1 2KJXA 4IOAA 2F0TA 1ICFB 4BBRH 1DXMA 2L0CA 1V1PB 3H15A 3M4PA 2NVQH 5IOCA 4IJLA 2K52A 1DJRD 3BZCA 3E0JA 4JBMA 1RTNA 1WCMH 4HJ7A 5CV6A 1ET9A 3T1YQ 1XTDA 4FP5D 3C1EA 3D8GA 3TSSA 3KK7A 3I90A 3OTOL 1KD1C 3NTHA 1LT6D 1K8MA 2ZJRA 4A3FH 4BBRG 4DAVA 4DR1Q 1VQGA 3KLSX 2NVYH 1F77A 1UE6A 4DPGA 3D6CA 2F0EA 4QL5A 1X6OA 4R4IA 3R2IA 4NB3A 3TMEA 2OEOA 1PRTB 1BBXC 1MJEA 1A62A 3CCLA 3SGIA 3N52A 1SNOA 2E74C 3N6RA 3PO2B 3GTMB 2MJ8A 2FINB 3CAMA 2CKZB 3JC66 2UXBQ 5C3EB 3G7LA 2MO0A 2XWBB 3OWFA 1FJGQ 2JA8G 1KIXA 3T16A 4JVZA 1MD2D 3S24A 4RG1A 2B2TC 3MEHA 3R2TA 3URYA 2N88A 2CQOA 2NUCA 3AU7A 3L3OC 5E4XA 1VDZA 3KBXA 3X3MA 2B63B 1KDAA 4L5RC 3EROA 2HIXA 1K83B 3QWNA 1HNXL 2C9OA 4KHPQ 1HH2P 3QR8A 4PMBA 2UXCQ 2ZJQA 4G57A 2F0SA 4LUVA 3R8BA 5EQ0A 2IHFA 2JYOA 3CC4A 3CF5A 5C0XG 4A3LH 3PSIA 1IYJB 3P20A 1VQ4A 4IPGA 2OCEA 1VQLA 1CZGA 4ZCKA 4A3KG 4P2CB 4JYAQ 3VYRA 1WTWA 1G6ZA 3L7ZC 1YEZA 3ERSX 2F0UA 4JI8L 5I9PA 2QEJC 3SK4A 1VCIA 3D0FA 5DM63 3L2PA 3CCMA 2Q8RE 2RCFA 1IZ6A 1X56A 4JI3Q 2EE1A 3A56A 4KV6A 3MWYW 2DGYA 4YWLA 1SMYD 5LMNL 4PZ7A 2D2CC 2R61A 4DXFA 3K5MA 1SN8A 2ASBA 4ZRZA 1STYA 4DR2Q 1B9MA 3VA5A 1H9MA 5M3FH 5I9OA 4OO1H 1NNXA 1C0AA 1JWMD 4JOIC 2HQEA 5FLXc 1HUMA 2PNHA 2AKWB 4ZLTF 1QNKA 1PRTD 4KKUA 1I3QB 1LTBD 4BBSB 5FLMG 4DV4L 1KHIA 3ONAB 2EYFA 5ELBA 4NW2A 1M8AA 4POGA 1X3PA 3PV0A 4JI5Q 3GTMH 4DV6L 4JG2A 1JJCB 1GUOA 1UEBA 1Y14B 3HKZE 1CKNB 2SOBA 4A3IG 3AQQA 1BVSA 4BXXH 1QVFA 4QB4A 2E5LL 5IGEA 2VL6A 1K83H 4QUFA 1Q86C 1C48A 4B3ML 4WFN3 1G2TA 3KYHC 1JC7A 2HUGA 4NXNL 3JAMi 1NSNS 5BR8Q 4X64L 4DK3C 3QOJA 2MUYA 2Q2TA 2LKVA 3UDFA 4B08A 4CKBA 1NY4A 3A7AB 3IFDA 3S1RH 1R4QB 4IFDI 2DN8A 1BCPF 1O7YA 1WCMB 1D5MC 4RKBA 3HOWB 5ISRA 2NVXB 1JE4A 1TVXA 4CDFC 3E6ZX 2WB1B 3RLFA 2XSCA 1D8LA 4DR6Q 2AWOA 2CH4W 2EDGA 3GTKB 5CORA 4ZYSA 2K14A 3KDFB 4IURA 1K8AC 1ILQA 5IY0A 5T1GA 1A15A 3U4ZA 2IWHA 1PH1A 4PMCA 1TWFH 1YJ9A 4TSSA 1EIHA 5EKKA 3GTLB 1CZWA 4KD4A 3MTSA 3J7YW 2X69A 1C9OA 2JSOA 4NXML 1XXGA 4QF4A 1HNXQ 1H9RA 3DMUA 2VS1A 2FMMA 5KNBA 3HOXH 4WRDA 3GO5A 3UDXA 2EJGC 3W2DA 4CBVA 4QMGA 1TT2A 1PYWD 1QUQA 3RZOB 2CCZA 1XPRA 3NWSA 3WOEA 5E4WC 1Z7TA 3H3VC 1ENCA 1JT8A 1LO5D 3VYSA 3K8AA 1A0IA 1Y1VH 3W1GA 1SYFA 1JE5A 2WFWA 5CV8A 3T51B 1K3RA 5M5YH 4HEDA 2DUDA 1FVIA 4K0KQ 2N49A 1L1OB 5CBEE 3S1NB 2NZOA 2BDNA 3BVGA 4A3MB 5IWAL 1N33Q 4B3MQ 2CVRA 5KYLA 1JMCA 1AZPA 5JJKA 1HJPA 3BS1A 2KEDA 4N8FA 4JI3L 1GOZA 5ELDA 3FRPB 3BDLA 5C3EG 1TWGH 1CQFA 2K5NA 3V2TA 2Z6KA 4A3BG 1RIPA 4JI5L 4S3SA 1YI2A 2WINB 4DR6L 4R8IA 2BOSA 4HSPA 2NBFA 4RFBA 2GA4B 4MN3A 1IKLA 1HR0L 1AP0A 2E8GA 3B6YA 1E2WA 3FDTA 1B44D 4KN7C 4FYDA 4FNFA 1WTHA 3U50C 5GAGC 1PH5A 3FP9A 2KUMA 1GHKA 2HQLA 4DF7A 3K6OA 1DOKA 5C4JH 4JV5L 4YWMA 4YCWA 1MGSA 4J8QA 1RL2A 5M3MG 1RF2D 2BDOA 5LMNQ 1JOKA 3J80c 3RZOH 3S14H 1LUZA 4A3BB 1FGBD 1UAPA 4UY8C 1KAWA 3KF8A 4GN5A 1AE2A 1SJHD 4BA1I 3I72A 3D3RA 4ODGA 1KTKA 3OWEB 5FJ8G 1M4VA 4OXPA 2CQAA 3K0YA 2M00A 5FO8B 4CKCA 3T1HQ 1B70B 1UNSA 1GUSA 2JP1A 2MFIA 1XNRL 1Z47A 1TWFB 1V1OA 1CI3M 4K5WA 2PZTA 3HGBA 3HKZB 4R9WA 5EKLA 1T5EA 4RGNA 2VUMH 1WOCA 1GHJA 2B2UA 2AWNA 2R93B 3MC0B 1SE4A 2K03A 4KTAA 4LAAA 2A69D 2X6GA 5EJWA 1G51A 5ELEA 3DM3A 2ZJPA 1WTQA 2JA8H 1VQJA 4DAPA 1B9NA 1I94L 4KHZA 4CJ2C 2EYOA 3F8TA 3EJIA 3T13A 1V1PA 3JAMc 5BN3A 5CBAE 2F4IA 2FJ2A 3NXWA 4P74A 2JA5G 1F9PA 1HA5A 4IUQA 3I91A 1EY9A 1ENFA 1ZKOA 5D14A 2E2JH 3J80i 2RF4A 4ZK9B 2O2LD 3FPUB 3J81L 4OHJA 3HOYH 1STHA 4XYQA 2CWPA 4DGZA 2XWJB 2KENA 5DNFA 3M4QA 1XNRQ 2I46A 1O78A 4DR1L 2I5HA 1CA5A 5GAEC 1WTOA 5C0XH 3Q0AA 5EPJA 1J8IA 2A5HA 4TRDA 4A3LG 2DNEA 4KK7A 1I5FA 2HCCA 1Y8NB 3E0EA 4M1UB 1TU2B 5D3IB 4A3KH 2OWOA 3K7UC 2B63H 2I5LX 1HR0W 1I4HA 2ZXRA 3NENA 4IJHA 2Z9HA 5DEHA 2F4VL 1L1OC 4R4TA 1TWAB 5M3MB 2RBMA 2C5CA 5IYBG 1BF4A 4K2KA 2VQFL 2PCFB 5E7NA 1YNND 2PPBC 1OXXK 2V1CC 1KLGD 3K7AB 4KMUC 4B9WA 2F52A 1E0BA 1PH8A 1NR2A 1IBMQ 1IBKL 3H0GG 4HIMA 3ZJYC 2JA6B 3H6MA 3MHBA 5EBDA 1EZ8A 1SFOB 1E22A 1LACA 4CGYB 4JBWA 1PFBA 2JXMB 4IUVA 3J7A5 2D0OA 1EQQA 1OXTA 1YNXA 2KCTA 5E3FA 1TWHB 4B3RL 1K8GA 2BE5D 3HOVB 1JJGA 3S1MB 5IWAQ 2A68C 4A3FB 2IL8A 5LL6S 1N33L 3J7AV 4IFDH 3HOZB 5KNCA 1B8AA 2B3GA 3UDIA 4IPHA 1V43A 1SFOH 3HS0C 4B3SQ 2D5DA 3CD6A 1AH9A 2YTYA 4ALPA 1OTCA 4RCOA 3A74A 3UI2A 1ML0D 1O7LA 3L9AX 1FD7D 1LLRD 2LFNA 1LM0A 4OWXB 1VQ7A 5ELNA 1A3TA 1AEXA 1KC8C 3P1HA 4IUNA 3OIPA 4NDXA 2PZUA 2EVBA 3SK6A 2VXWA 4G7HC 1R4PB 1CSQA 3D31A 5IGCA 3NWTA 3SVMA 3OIQA 2B2YA 1X3EA 2VQEQ 5M5WB 2NZ1D 5EGTA 1IL2A 5EPLA 2UUAL 1XX8A 4A3DB 1Y8OB 2AQ2B 4RGOS 1ENAA 3MEFA 4DV1L 3CC7A 4H0LC 2YU9B 1YZ6A 2QF7A 2XTIA 4CKEA 1II3A 1B1ZA 5FK9C 2PW5A 4JI0L 2QW7A 4K6DA 2F1MA 3ERQA 5IYDH 2EQSA 2R7ZB 3CW2C 4UP8A 3CCEA 2YV5A 4A3DH 2RSNA 3S2DH 3PGZA 1U0LA 2JE6I 2PI2E 4A3JB 1H9SB 5IIFA 4X65L 2JEAI 3FVQA 4DNIA 4H13C 3K59A 1HFGA 5IGFA 1XYIA 2F0MA 2KECA 3GTQH 1G6PA 4XTCS 1P16A 2B2YC 4K8JA 1IHZA 2EYLA 1UE1A 4J6HA 4YCVA 3J7AF 3J81i 4NXNQ 1X55A 4DFAA 2UU9Q 4BBSG 4DV7Q 1E2VA 2EY5A 1BXTA 1JWSD 4C3HH 2K33A 1MKHA 1RKNA 5NUCA 1HHVA 2LS01 2EPBA 4KKSA 1Y1WB 3PO3G 2QGQA 4YWKA 3HP3A 4G7ZC 4BY1H 4CJ1B 5CV5A 3K58A 4AQYQ 4R4CA 5HGTA 2VUMG 1SBBB 1X32A 4CDEC 5EKIA 3I4MH 1NMFA 4IO9A 3HOVH 1HZAA 1IKMA 3GTLH 1B2TA 1EIFA 5K36G 3MXGA 3S15B 2ZTDA 4EQOA 5KRUA 4CJ0B 1HZ9A 1PTOF 4KY7A 1GM5A 5BN4A 3LGJA 1Q90A 1C8CA 1CA6A 3RMHA 4LWCA 3PIPA 2CH4A 4BY1G 2IX1A 3A5UA 1HPCA 2K5DA 2JK8A 1YNJD 4RAUC 1SMXA 4CDCC 4IUPA 3J81c 1VQKA 2UUCL 2TMPA 1TWGB 1QILA 4C3IG 1U9RA 1K0SA 3GTQB 4RHSA 1HZBA 3M7GA 1ET6A 5HY6A 4Q0FA 1H9JA 4X62L 1PXUA 3MFYA 5IGGA 4A3JH 1CKNA 3S2DB 1B7YB 1BCPC 3W3AA 1ONLA 3SDZA 1O7ZA 2NN6G 5E1FA 2ZXPA 2F0FA 4ZAIA 3A8IE 4DV6Q 1XJVA 2IY5B 4XIGS 1G291 2NZHA 1PTOH 2VNUD 2WP8J 1BOSA 5TSSA 4MNOA 5DAUA 3K57A 2Q8IB 1NBWA 1O80A 1I4GA 3U9SA 2EYPA 4LFCQ 1OXUA 2B8FA 2ICEC 3J7ZC 4BY7G 4OWWB 4JI4Q 2CFMA 5M5WH 1STBA 2CWAA 2HDLA 1WTVA 4U68A 3CMAA 4KJOA 2E2IB 1UE5A 5KEEA 5CMDA 3IL8A 1EIGA 1Q8IA 3J80L 1PFSA 1VMPA 3EQLC 4H02A 4BWGB 1BO0A 1V8QA 3TQYA 4JI7L 4LF4Q 4A3IH 4K8IA 4I7ZC 3ULPA 4HSVA 2KVMA 3GQBA 5ELFA 5JEAG 1EIYB 2BE5C 3DEOA 2NB0A 1X9NA 3D4RA 5J3BA 1XMQQ 1HCZA 3S17H 4O42A 2A8VA 2B29A 2UUAQ 2EJFC 3CKIB 1HFNA 3S1RB 1I94Q 1F2MA 1SSOA 1VQBA 1EEFD 4ZUIA 2F0NA 1VQNA 5GQOA 4A3CH 4P71A 1MSHA 4IUTA 4C1NI 1NMGA 2WAQG 2PQEA 5AJ3Q 1TWHH 5I2YA 1I50B 3EVQA 2RDHA 2ES2A 1A2TA 1B4OA 4AH6A 4IN3A 2R7ZH 1N32L 1PVOA 3RZDB 1Y1WG 3PO3B 5C44B 1Q3LA 2A1AA 1EWCA 1PH7A 2O5IC 1EEID 1KRTA 2YU9H 4V0BA 2WB1E 1PZKD 3CCRA 3GTPB 1A6XA 2A68D 1RCVD 2PMZE 4KY6A 5M3MH 1EZ6A 4C1NK 4FF1A 3S16B 1EY0A 1XNQQ 4B9XA 4K2LA 3RNUA 3PIO3 4Y52H 3KF8B 3UDGA 1ESRA 2FHTA 1T9HA 1MBYA 2KCCA 1SLJA 2MO1A 3KDFA 1KLUD 4JI1Q 4A3DG 1EOVA 3GTJH 3F2DA 4EX5A 1I4PA 1SR3A 1V1QA 4DUZQ 3NBHB 1VQDA 2KOLA 3TP7A 5I6YA 1LYLA 1TY0A 3ND8A 4HMJA 3W5OA 3RR5A 3S1NH 4B3TL 1U5KA 3GTOH 2DY7A 3SR1A 1S3OA 4KHVA 1XMQL 2Z1CA 4E6IA 3TDQA 1JORA 2A6EC 1B3AA 3MXUA 2VB2X 2F0WA 4XT3B 2GVBA 2EXZA 1GUGA 2H4OA 1W6KA 2JA7H 3Q24A 4NPSA 1SAPA 1IBML 4V190 3GP7A 3R3OA 3MFGA 4A75A 1QNUA 4DR7L 1JOQA 4XDXA 1STEA 5HGQA 3M4OB 4Q5VA 4C3IB 1R9TB 2Z4IA 3A0JA 4L5QA 4F88A 3BVZA 2R7DA 3SXHA 2QDLA 4JC0A 1WTPA 3HZXA 3P7JA 2EYJA 1HTPA 3T1HL 2JA6H 3LWUA 4MTKA 1BCPB 3G4SA 3HOVG 4CHTB 1DOLA 1Q8KA 4LFAQ 1TWCB 4DUYQ 2JEBI 5K5PA 1D6EC 3VR2A 3Q23A 1NR4A 4GKKQ 1BR9A 2ALYB 3KUPA 3MXPA 4JW0A 3HOUH 2F0JA 4DK1A 1EQRA 1E1OA 1SNMA 5JEAH 1EY5A 1RHPA 1Q82C 5IGDA 3TS2A 1EY7A 2PI2A 2LMCB 1Q12A 4AQYL 3I4LA 2D0PA 5FO7B 3I4NH 5C5LA 2SEBD 4RWSC 4DV5L 1SDFA 4KLKA 1PMRA 4CDDC 4FF2A 4UHVA 3A55A 1YJWA 5IYCG 3OOCA 2RCNA 1FNWA 1PYSB 2Q2UA 4C3JG 1PTOD 3PUWA 3S1QB 1TXYA 3CCUA 5BN5A 5M5YB 3CC2A 2QCPX 1OO9B 3BZDB 4LNQA 3M3YB 3CP0A 1QG7A 1VQCA
chains in the Genus database with same CATH topology
2J0TD 5COYA 4I65A 3Q22A 5J39A 3AB9A 4QIWB 1A3UA 2K5WA 3DEPA 4RGTA 1EY6A 4R8NA 3NHHA 4FF4A 5CC4A 4X3SA 1EL0A 2XVSA 3WOFA 5M5XB 1LT5D 3DWAA 3TP5A 1G8ZD 4BY7B 4OIKA 3CU7A 2PMZB 1QOHA 3V05A 2L11A 3ND9A 4YIJA 1Y69U 5EPKA 1DONA 3NPPA 1WTRA 1YNJC 2EJMA 1TY2A 1JCKB 3PUZA 3R93A 4PNYA 4ABNA 2PO4A 4PV1C 5KGUA 3E5SA 4WJWA 2RKSA 2YYZA 4ILWA 1D2BA 1AW7A 2F0QA 3GTJB 4C3HG 3DM1A 4LK1C 1KABA 5ELCA 1FYCA 1SNDA 2AUKA 1B50A 3T56B 4L6TB 3SK8A 3PUYA 4DN4M 2KCNA 1U4MA 3C3LA 4ME5A 2ZT9C 2BCOA 2K01A 2LY7A 1BUVT 1LV9A 4KI0A 4C3JB 1X3QA 1DYQA 5JVG3 5LL6X 1SNCA 2IW3A 2CHBD 4DA2A 1LABA 1LT3D 2B2TA 1PTOC 4QCLA 1IL8A 1LTGD 1SMYC 1LT4D 2B2VA 5K36H 2X6LA 4RHRA 2JA7B 1GXDC 1L0YB 4C56C 1CM9A 3K5NA 1SNPA 1MI2A 2J4XA 1D5ZC 1SYBA 3BDCA 1LTAD 4TKOB 5J22A 1TIID 4A3GB 4KJNA 3BYTB 1D1KA 2A6HC 3GD7A 2K05A 3QO2A 3VR5A 3NBIA 2MHVA 3K5OA 2F0PA 5T1IA 5IODA 2OT2A 2RVLA 1VF5C 3A54A 2NN6H 2PYKA 2K1BA 2A69C 1IW7D 1CK1A 1DZ1A 1QJOA 4G4KA 3NBHA 5CV9A 5FKAC 1A2UA 1SYEA 1GUWA 1W6JA 1JWUD 3IFTA 1I6HB 3CHBD 3JAML 3U9OA 1CT1D 5C3XA 1NCVA 3A8JE 3VR6A 4TQUS 2L5TA 1VMCA 3I4NB 3JAME 2F0GA 2AQ3B 5KNDA 2F0DA 1G2SA 1A3VA 2SDFA 1PFNA 1QE6A 2MPMA 3AMUA 4A3IB 3T53B 1CHPD 2V4DA 3KBGA 1NAPA 1F2YA 3C2PA 5C4XB 1Q1BA 1HTLD 5C6AA 4UDUC 1IYVA 3TP8A 3LWEA 1XWEA 5IGBA 3M4YA 1UUPA 2XRQD 4XYOA 5CYUA 2ZXOA 2QKIC 2B2UC 3LX0A 4HR7B 1C4QA 4MIUA 3HOXB 4NP5A 2H1EA 1PTOB 1HRJA 1FR3A 3TZDA 5C3WA 1SXTA 2SNSA 1S5DD 2FFKB 1F9QA 1S5BD 2EOTA 1PFMA 2F0OA 3FKIB 1F2LA 1CFMA 3OHXC 1JR0D 1TKWB 4XQJA 4F87A 2RQXA 3ZYYX 4EVOA 2EY6A 1SE3A 2F3VA 4EQNA 3M7NA 2BA1A 3G6JB 3HOUB 2PZWA 3WDNA 4KY5A 3C1FA 3SK5A 2AQ1B 1SE2A 4IALA 1STNA 2IX3A 2EZVA 2R92B 1AZQA 1TS5A 2XN9C 2E2HB 3BDOA 3QIAA 4IFDG 1EYCA 1I6VC 3NTKA 3QB3A 4PQXA 1JICA 2A74C 2IPKD 1HQRD 1S4ZA 1B53A 5JPMC 2IX0A 2OXPA 1SYDA 2NVTB 5IT9L 1GUNA 2B8GA 3NQIA 2K6AA 1TS2A 1F9RA 2L55A 4RGMA 1Z6HA 4FXGC 1MSGA 4HTHA 3D4DA 3NSWA 3NUCA 1CHQD 2CW0C 3X3NA 3RD4A 1SYGA 3BG3A 3OW7A 1K8OA 4F7XA 4IUUA 2R6GA 5HURA 2EY1A 1ZYRD 4K6LA 3FEWX 5CGKA 2KEEA 4XQQA 2XRSD 3GV3A 5G3LF 4OO1G 1H9KA 4K5VA 3J80E 2I07B 1EOTA 3GTOB 2NN6I 3H0GB 4LJZC 4L63B 1XTCD 4DNRB 2NTTA 3VYTA 1PRTC 3H94A 4J1MA 1QB5D 1H9SA 3KLSA 4NKLA 1EWHA 1OXSC 3S9WA 1LTSD 2F0HA 4RH6A 5A2QE 1FNUA 4ID6A 4F8MA 5CV4A 1S5FD 2EY2A 2L12A 5M3FB 4IZ8A 2F0LA 2D62A 5F2DA 3FPPA 1PDQA 1TS4A 4AYBB 1S5CD 1I4RA 4EQPA 3J81E 4DK0A 3I73A 1RJTA 1EU3A 1SNQA 1YNNC 1EQTA 3FMCA 3EFXD 3IKJA 5M9OA 3BVMA 3IAYA 2VUMB 2QILA 3PIP3 3MZ5A 3S17B 5D65A 1UEAB 2WKDA 3TBIB 3HEJA 3F2UA 2D9UA 4O1NA 2O4XA 2MP1A 2RA4A 4BBRB 3A8KE 3NE5B 1ZEQX 4DNTB 3BYYB 2NWGA 3QJYA 4G7OC 3OSOA 3EA6A 1CTMA 2K5QA 1RD9D 3SHLA 4N9PA 3ITPA 2EYHA 3TN2A 3MVVA 4KKTA 2Q8TA 2E2DC 5A2QL 1S5ED 1EY4A 1DD2A 5JVH3 1QWYA 3C46A 4K5XA 4DU9A 2MGSA 5CR3A 4ZKCB 2E76C 4OGQC 5JEAJ 1JB3A 5CV7A 1KNAA 3LNNA 3T4AC 2B39A 4BA2I 2F3WA 1EY8A 4A93B 2EYMA 5C4ZA 1EYDA 1WD1A 1KDCA 3H09A 1E2ZA 2ENBA 2A6ED 5C0XI 4FO2A 3QG1A 1G91A 4HAEA 5I4DA 4U673 2TSSA 2F0IA 1Y1VB 3P75A 3M85A 3PUXA 4JK1C 5FOBB 3DUZA 3GV6A 4ZQ3A 3HG9A 5JJZA 3MAQA 2HCIA 2PW7A 1U4LA 5C5MA 3OMGA 3RUZA 2SNMA 1F9SA 3VA7A 1I4QA 5JPNC 4BY1B 2JA5B 4UAIA 1AN8A 5DM73 2HDMA 1WD0A 4PMWA 5FO9B 4RCNA 2A6HD 1IW7C 2BA0A 1BCPD 2J7ZA 2K28A 4GZYC 1GJXA 3A7LA 2NTSA 2Y0SB 3CQZB 1STAA 3DWQA 2B2WC 4RKLA 1HA6A 2XNAC 1JOOA 4X3UA 1F2ZA 5KIXA 1EYAA 3H91A 1ILPA 4ZUJA 4Y7NB 2KA7A 4OIJA 4HCSA 1U4RA 3D6WA 2ID0A 1PZJD 1I4XA 3I70A 2F0KA 1LTTD 1PRTF 5AFWA 3PMFA 1DOMA 4FXDA 4FXKC 5I6WA 4IFDJ 4HCEA 2B2VC 1ICWA 1GUTA 3HRZC 1HQMC 1IYUA 1BDOA 1RDPD 4HN7A 2L4NA 2F0VA 3MA2B 2RSOA 3TZUA 4QUCA 2E75C 3Q6SA 4KN4C 4C3HB 4XXEA 2K7VA 3VR3A 3NTIA 2RDFA 4KD3A 2L9HA 1Q1EA 1STGA 2DNCA 1J9OA 3PUVA 1D5XC 4OL7A 4FVMA 3NK9A 2L1BA 5J1ZA 4A3EB 1WTXA 2K04A 4NMZA 3I8ZA 4EGVA 4A3KB 1OXVA 4HMIA 2WIIB 5EBCA 5KYIA 5C0XJ 5JOBA 5C4JB 1SEBD 3D4WA 2Z4HA 1EFID 4XQNA 2M2LA 4H44C 5A35A 2ICIA 2G9DA 4N9TA 3KLRA 1KAAA 3I3CA 4X3TA 2O5JC 4DXGA 5D3DA 5G3LD 1WVLA 2RDGA 5JAVA 4K14A 1AFPA 2JA8B 3VYUA 4XT1B 3DXJC 3DHQA 2AUJD 3GTGB 2R3ZA 1EU4A 5FLXE 1ESFA 2WV6D 2A73B 2NYZD 3S2HB 2E2JB 2PNRC 3V96A 5I2XA 2KQ3A 3OPOA 4BS9A 1VF7A 1KDBA 1DM0B 2IJ0A 4WORA 4Z9CB 4DAYA 3VR4A 4H7BA 2NVQB 3S14B 5LHY1 3NP8A 3OMCA 4ZKBB 1LTID 1HXYD 2WAQB 4L8JA 1T5XD 2QDBA 1L0XB 1RTOA 1TQOA 2OF1A 1BNZA 5FLXL 2WACA 1TS3A 1ZYRC 4OO1I 2K32A 1DCZA 1QCBD 4X3KA 2G9HD 1ZXTA 1TR5A 2F03A 1SYCA 5C4HA 2CW0D 1PLFA 3TP6A 1Y8PB 3HOYB 2M9VA 2NVYB 1U4PA 4C2MB 4LMQD 1PZID 5IT9E 3QOLA 4RA8A 1LTRD 2KHSA 3SE0A 1BQQT 4IQZA 4ULLA 2N55A 3NQTA 1CQVA 1D1IA 1FNVA 3MXNA 3CRLC 3O13A 2DY8A 3K5LA 1HUNA 1SJED 2VB3X 1EQVA 3I4MB 2IT1A 1KNEA 3SEBA 2Z8LA 1JQYD 2XIWA 2FMCA 4FF3A 4MHEA 1RODA 3DWPA 1NUCA 2WKCA 4M8AA 3CRKC 2B2WA 2KJXA 2F0TA 1DXMA 2L0CA 1V1PB 5IOCA 1DJRD 3E0JA 1RTNA 5CV6A 1ET9A 4FP5D 3C1EA 3D8GA 3TSSA 3KK7A 3I90A 3NTHA 1LT6D 1K8MA 4DAVA 3KLSX 1F77A 3D6CA 2F0EA 3R2IA 3TMEA 2OEOA 1PRTB 1BBXC 3N52A 1SNOA 2E74C 3N6RA 3PO2B 3GTMB 2MJ8A 2FINB 5C3EB 3G7LA 2XWBB 3OWFA 3T16A 1MD2D 2B2TC 3MEHA 3R2TA 3URYA 2N88A 2NUCA 3AU7A 3L3OC 5E4XA 1VDZA 3KBXA 3X3MA 2B63B 1KDAA 3EROA 1K83B 3QWNA 2C9OA 4PMBA 4G57A 2F0SA 3R8BA 5EQ0A 2JYOA 5C0XG 3P20A 1CZGA 4P2CB 3VYRA 1WTWA 1G6ZA 3L7ZC 2F0UA 5I9PA 2QEJC 3SK4A 1VCIA 5DM63 2Q8RE 2EE1A 3A56A 4KV6A 3MWYW 1SMYD 2D2CC 2R61A 4DXFA 3K5MA 4ZRZA 1STYA 1B9MA 3VA5A 1H9MA 5I9OA 4OO1H 1JWMD 2HQEA 1HUMA 4ZLTF 1QNKA 1PRTD 4KKUA 1I3QB 1LTBD 4BBSB 3ONAB 2EYFA 5ELBA 4NW2A 1M8AA 1X3PA 3PV0A 1GUOA 2SOBA 4QB4A 5IGEA 4QUFA 1C48A 4WFN3 1G2TA 1JC7A 2HUGA 1NSNS 3QOJA 2MUYA 2LKVA 4B08A 4CKBA 3IFDA 3A7AB 1R4QB 4IFDI 2DN8A 1BCPF 1O7YA 1WCMB 1D5MC 4RKBA 3HOWB 5ISRA 2NVXB 1JE4A 1TVXA 3E6ZX 2WB1B 3RLFA 2XSCA 2AWOA 2EDGA 3GTKB 5CORA 4ZYSA 4IURA 1ILQA 5T1GA 1A15A 2IWHA 4PMCA 4TSSA 1EIHA 5EKKA 3GTLB 1CZWA 4KD4A 3MTSA 3J7YW 2X69A 2JSOA 1XXGA 4QF4A 1H9RA 3DMUA 2FMMA 5KNBA 4WRDA 3GO5A 3W2DA 2EJGC 4CBVA 4QMGA 1TT2A 1PYWD 3RZOB 3NWSA 3WOEA 5E4WC 1Z7TA 3H3VC 1ENCA 1LO5D 3VYSA 1SYFA 5CV8A 3T51B 4HEDA 3S1NB 5CBEE 3BVGA 2BDNA 4A3MB 2CVRA 5KYLA 1AZPA 3BS1A 2KEDA 1GOZA 5ELDA 3FRPB 3BDLA 1CQFA 3V2TA 4S3SA 2WINB 4R8IA 2BOSA 4HSPA 2NBFA 4RFBA 2GA4B 4MN3A 1IKLA 1AP0A 1E2WA 3FDTA 1B44D 4KN7C 4FYDA 4FNFA 2KUMA 1GHKA 4DF7A 3K6OA 1DOKA 1MGSA 4J8QA 1RF2D 2BDOA 1JOKA 4A3BB 1FGBD 1UAPA 3KF8A 4BA1I 1SJHD 3I72A 3D3RA 4ODGA 1KTKA 3OWEB 1M4VA 2CQAA 3K0YA 2M00A 5FO8B 4CKCA 1UNSA 1GUSA 2JP1A 5EKLA 4R9WA 1Z47A 1TWFB 1V1OA 1CI3M 2PZTA 3HGBA 3HKZB 4K5WA 1T5EA 4RGNA 1GHJA 2B2UA 2AWNA 2R93B 3MC0B 1SE4A 2K03A 4KTAA 4LAAA 2A69D 2X6GA 5EJWA 5ELEA 1WTQA 4DAPA 1B9NA 4KHZA 4CJ2C 2EYOA 3EJIA 3T13A 1V1PA 5BN3A 5CBAE 2F4IA 2FJ2A 3NXWA 1F9PA 1HA5A 4IUQA 3I91A 1EY9A 1ENFA 1ZKOA 5D14A 4ZK9B 2O2LD 3FPUB 3J81L 4OHJA 1STHA 4XYQA 4DGZA 2XWJB 5DNFA 2I46A 1O78A 1CA5A 1WTOA 5C0XH 3Q0AA 5EPJA 1J8IA 2A5HA 4TRDA 2DNEA 4KK7A 2HCCA 1Y8NB 4M1UB 1TU2B 5D3IB 1I4HA 2ZXRA 5DEHA 1TWAB 5M3MB 2RBMA 1BF4A 2C5CA 4K2KA 2PCFB 1YNND 2PPBC 1OXXK 1KLGD 3K7AB 4KMUC 4B9WA 1E0BA 1NR2A 2JA6B 3H6MA 3MHBA 5EBDA 1EZ8A 1SFOB 4CGYB 1LACA 4JBWA 1PFBA 2JXMB 4IUVA 1OXTA 5E3FA 1TWHB 2BE5D 3HOVB 3S1MB 2A68C 4A3FB 2IL8A 5LL6S 3J7AV 4IFDH 3HOZB 5KNCA 1V43A 3HS0C 2D5DA 4RCOA 3UI2A 1ML0D 1O7LA 3L9AX 1FD7D 1LLRD 2LFNA 1A3TA 1AEXA 3P1HA 4IUNA 3OIPA 4NDXA 2PZUA 2EVBA 3SK6A 2VXWA 4G7HC 1R4PB 3D31A 5IGCA 3NWTA 3SVMA 3OIQA 2B2YA 5M5WB 2NZ1D 5EGTA 5EPLA 1XX8A 4A3DB 1Y8OB 2AQ2B 4RGOS 1ENAA 4H0LC 2YU9B 2QF7A 4CKEA 1II3A 1B1ZA 5FK9C 2PW5A 4K6DA 2F1MA 3ERQA 2R7ZB 2RSNA 2JE6I 4A3JB 1H9SB 5IIFA 2JEAI 3FVQA 4H13C 3K59A 1HFGA 5IGFA 1XYIA 2F0MA 2KECA 4XTCS 2B2YC 4K8JA 1IHZA 2EYLA 4J6HA 3J7AF 4DFAA 1E2VA 2EY5A 1BXTA 1JWSD 2K33A 1RKNA 5NUCA 1HHVA 2LS01 2EPBA 4KKSA 1Y1WB 3HP3A 4G7ZC 4CJ1B 5CV5A 3K58A 5HGTA 1SBBB 1X32A 5EKIA 1IKMA 1B2TA 5K36G 3MXGA 3S15B 4EQOA 5KRUA 4CJ0B 1PTOF 4KY7A 5BN4A 1Q90A 1C8CA 1CA6A 3RMHA 2IX1A 1HPCA 2K5DA 1YNJD 4RAUC 4IUPA 2TMPA 1TWGB 4C3IG 1QILA 1U9RA 3GTQB 4RHSA 3M7GA 1ET6A 4Q0FA 1H9JA 1PXUA 3MFYA 5IGGA 3S2DB 1BCPC 3W3AA 1ONLA 3SDZA 1O7ZA 2NN6G 5E1FA 2ZXPA 2F0FA 4ZAIA 3A8IE 4XIGS 1G291 1PTOH 2VNUD 2WP8J 1BOSA 5TSSA 5DAUA 3K57A 2Q8IB 1O80A 1I4GA 3U9SA 2EYPA 1OXUA 2B8FA 2ICEC 1STBA 2HDLA 1WTVA 4U68A 4KJOA 2E2IB 5KEEA 5CMDA 3IL8A 1EIGA 1Q8IA 3J80L 1VMPA 3EQLC 4BWGB 1BO0A 1V8QA 4K8IA 4I7ZC 4HSVA 2KVMA 3GQBA 5ELFA 5JEAG 2BE5C 3DEOA 2NB0A 3D4RA 1HCZA 4O42A 1HFNA 2EJFC 3CKIB 3S1RB 1F2MA 1SSOA 1EEFD 4ZUIA 2F0NA 1MSHA 4IUTA 4C1NI 2PQEA 5I2YA 1I50B 3EVQA 2RDHA 1A2TA 1B4OA 4IN3A 3RZDB 3PO3B 5C44B 1Q3LA 1EWCA 2O5IC 1EEID 4V0BA 1PZKD 3GTPB 1A6XA 2A68D 1RCVD 4KY6A 1EZ6A 4C1NK 4FF1A 3S16B 1EY0A 4B9XA 4K2LA 3PIO3 1ESRA 2FHTA 1MBYA 2KCCA 1KLUD 1I4PA 2KOLA 3TP7A 5I6YA 1TY0A 3ND8A 4HMJA 2DY7A 3SR1A 4KHVA 2Z1CA 4E6IA 3TDQA 1JORA 2A6EC 1B3AA 2VB2X 3MXUA 2F0WA 4XT3B 2H4OA 2EXZA 1GUGA 1W6KA 3Q24A 1SAPA 4V190 3GP7A 3R3OA 3MFGA 1QNUA 1JOQA 4XDXA 1STEA 3M4OB 4Q5VA 4C3IB 1R9TB 2Z4IA 4F88A 3BVZA 3SXHA 1WTPA 3HZXA 3P7JA 2EYJA 1HTPA 3LWUA 1BCPB 4CHTB 1DOLA 1TWCB 2JEBI 5K5PA 1D6EC 3Q23A 3VR2A 1NR4A 1BR9A 3KUPA 3MXPA 2F0JA 4DK1A 1SNMA 5JEAH 1EY5A 1RHPA 5IGDA 1EY7A 2LMCB 1Q12A 3I4LA 5FO7B 5C5LA 2SEBD 4RWSC 1SDFA 1PMRA 4FF2A 3A55A 3OOCA 1FNWA 4C3JG 1PTOD 3PUWA 3S1QB 5BN5A 5M5YB 2QCPX 1OO9B 3BZDB 3M3YB 1QG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  4KI0 A;  2PCF B;  3BDO A;  1H9S B;  3QIA A;  3A7A B;  1I6V C;  1OXX K;  3DXJ C;  2Q8I B;  2PPB C;  2AUJ D;  4IFD G;  4KMU C;  2DN8 A;  1GHK A;  2JEA I;  3AB9 A;  3U9S A;  4H13 C;  2D62 A;  1E2Z A;  1OXU A;  2B8F A;  1LAB A;  2A6E D;  4XTC S;  3CRL C;  2BDO A;  3FPP A;  5KND A;  3RLF A;  3ND8 A;  5C0X G;  2AWO A;  2EDG A;  2IT1 A;  1GUT A;  1LAC A;  3QG1 A;  4JBW A;  3P20 A;  1HQM C;  2JXM B;  1IYU A;  3T53 B;  2PNR C;  2V4D A;  1BDO A;  1SMY C;  2A6E C;  1OXT A;  1E2V A;  4BA1 I;  3MXU A;  3OPO A;  1GUN A;  3I72 A;  2B8G A;  4DK0 A;  2K33 A;  3M85 A;  3I73 A;  1GUG A;  5K36 H;  1VF7 A;  3L7Z C;  3CRK C;  3PUX A;  1YNN C;  4JK1 C;  2BE5 D;  3EQL C;  1Z6H A;  3FMC A;  1Q1B A;  4KKS A;  2A68 C;  1GUS A;  1VCI A;  1V8Q A;  3IKJ A;  3VR4 A;  1DXM A;  3HGB A;  3TZU A;  1CI3 M;  4IFD H;  5KNC A;  4I7Z C;  2E75 C;  1IYV A;  1T5E A;  4KN4 C;  1V43 A;  4G7Z C;  1H9R A;  2CW0 C;  1GHJ A;  2K7V A;  3GQB A;  4TKO B;  2D5D A;  5JEA G;  3M4Y A;  5KNB A;  2BE5 C;  3BG3 A;  3ND9 A;  3OW7 A;  3VR3 A;  2EJG C;  3D4R A;  1K8O A;  1HCZ A;  1Y69 U;  2A69 D;  1Q1E A;  4HR7 B;  4L8J A;  2R6G A;  1HTP A;  2EJF C;  3VA7 A;  2DNC A;  1O7L A;  2D2C C;  3LWU A;  1Z7T A;  5K36 G;  1YNJ C;  3PUV A;  2EJM A;  1B9N A;  1K8M A;  2A6H C;  3GD7 A;  4KHZ A;  3VR5 A;  3PUZ A;  1FR3 A;  1B9M A;  1H9M A;  3T51 B;  3A8K E;  3NE5 B;  5BN4 A;  1Q90 A;  4DNT B;  5BN3 A;  2JEB I;  4OO1 H;  3QJY A;  4PV1 C;  4RCN A;  1VF5 C;  3VR2 A;  4G7O C;  1OXV A;  1IW7 C;  1ZYR C;  2A6H D;  2EVB A;  1HPC A;  2BA0 A;  1DCZ A;  2K32 A;  4OO1 G;  4G7H C;  1CTM A;  1H9K A;  4GZY C;  2YYZ A;  3D31 A;  3A7L A;  1GJX A;  1ZKO A;  2NN6 H;  3SE0 A;  4DK1 A;  2A69 C;  5JEA H;  4KKU A;  1IW7 D;  2E74 C;  2NN6 I;  4KKT A;  4LJZ C;  3N6R A;  1CFM A;  2LMC B;  4LK1 C;  4DNR B;  1Q12 A;  2O5I C;  1DD2 A;  1QJO A;  1TKW B;  3I4L A;  4H44 C;  5A35 A;  1FYC A;  3PV0 A;  1Y8O B;  1H9J A;  1GUO A;  1O78 A;  2AUK A;  2A68 D;  2BA1 A;  3H94 A;  3KLR A;  3MFY A;  4H0L C;  3M7N A;  1PMR A;  1H9S A;  5C0X H;  2QF7 A;  2E76 C;  1Y8P B;  4OGQ C;  2DNE A;  3OOC A;  3T56 B;  2KA7 A;  1Y8N B;  3IFT A;  3W3A A;  1ONL A;  1EWH A;  1OXS C;  3PUW A;  1TU2 B;  3SDZ A;  3PUY A;  1VDZ A;  2F1M A;  3WDN A;  2O5J C;  2NN6 G;  3LNN A;  5BN5 A;  3A8J E;  2ZT9 C;  3VR6 A;  1E2W A;  3A8I E;  4TQU S;  2KCC A;  1G29 1;  4XIG S;  2L5T A;  4KN7 C;  4BA2 I;  4IQZ A;  1A6X A; 
#chains in the Genus database with same CATH topology
 2J0T D;  4GLV B;  5COY A;  4I65 A;  1Q7Y C;  3Q22 A;  5J39 A;  1FL0 A;  3AB9 A;  4QIW B;  1A3U A;  2JJQ A;  3RLO A;  2K5W A;  2JA5 H;  1BBW A;  3DEP A;  4RGT A;  1EY6 A;  1L0W A;  4R8N A;  1VS0 A;  3H3V I;  3NHH A;  4FF4 A;  4BY7 H;  5CC4 A;  3RN5 A;  1P8L A;  4X3S A;  1EL0 A;  2AMC B;  2XVS A;  2JA9 A;  3WOF A;  4LF6 Q;  1X65 A;  5M5X B;  4GLX A;  1LT5 D;  3DWA A;  3HFZ B;  3TP5 A;  1HR0 Q;  1G8Z D;  4BY7 B;  1E24 A;  4OIK A;  3CU7 A;  2PMZ B;  1C7Y A;  4GKJ Q;  1QOH A;  3V05 A;  2L11 A;  4DV7 L;  4EQ5 A;  4A3G G;  3ND9 A;  2NVX H;  1HNZ Q;  4YIJ A;  4X62 Q;  3M9B A;  1Y69 U;  4DR2 L;  5EPK A;  1DON A;  3NPP A;  1WTR A;  4JI6 Q;  1YNJ C;  2EJM A;  3A5Z B;  3BJU A;  4YY3 Q;  1TY2 A;  1JCK B;  4GLA C;  3PUZ A;  4OX9 L;  4BXX G;  3R93 A;  4PNY A;  4ABN A;  2PO4 A;  4AYB E;  5GAD C;  1Y1V G;  1EFW A;  1ASZ A;  4PV1 C;  5KGU A;  3S2H H;  3E5S A;  4WJW A;  4A4I A;  2RKS A;  1K9M C;  2R92 H;  2YYZ A;  4ILW A;  4JI7 Q;  1YBY A;  1D2B A;  1AW7 A;  2F0Q A;  3GTG H;  3GTJ B;  3TRZ A;  1W3S A;  4C3H G;  3DM1 A;  3PIO A;  4LK1 C;  1KAB A;  5ELC A;  1L2F A;  2JA6 G;  4A93 G;  1FYC A;  2OTL A;  1SND A;  2AUK A;  3CXC A;  1B50 A;  2VY3 A;  2Q2I A;  3T56 B;  4L6T B;  3S16 H;  3SK8 A;  3PUY A;  4DN4 M;  1B3Q A;  2KCN A;  1U4M A;  3C3L A;  4ME5 A;  2ZT9 C;  1TWC H;  4A3M H;  5IP9 G;  2BCO A;  2LXJ A;  2K01 A;  1NJI C;  2LY7 A;  4LF8 L;  4P73 A;  1BUV T;  2WAQ E;  1LV9 A;  2Y0S E;  4KI0 A;  4C3J B;  1J6Q A;  1X3Q A;  4LF7 L;  4WJ4 A;  4A3F G;  2KHI A;  5C44 H;  1DYQ A;  5JVG 3;  5LL6 X;  3RZD H;  1SNC A;  2IW3 A;  3PO3 H;  2OTJ A;  2CHB D;  4DA2 A;  1LAB A;  1O7I A;  3K80 C;  4QIW E;  1LT3 D;  4APV A;  4HJA A;  4UP7 A;  2B2T A;  1PTO C;  5EAY A;  4POF A;  1SE8 A;  2DJG C;  4QCL A;  4LFA L;  1IL8 A;  1LTG D;  1SMY C;  1LT4 D;  2B2V A;  5K36 H;  2X6L A;  4RHR A;  2JA7 B;  1GXD C;  1L0Y B;  4C56 C;  1CM9 A;  3K5N A;  1SNP A;  1MI2 A;  2J4X A;  3PF5 A;  1D5Z C;  3F2B A;  1WYD A;  1SYB A;  3BDC A;  4J15 A;  1LTA D;  4TKO B;  3PQI A;  2BH8 A;  5J22 A;  1TII D;  4A3G B;  4KJN A;  1YHB A;  4L5S A;  1PH2 A;  3BYT B;  1D1K A;  4PZ8 A;  4JI8 Q;  4JCV E;  4R1J A;  1EYG A;  1WFQ A;  2A6H C;  3GD7 A;  2K05 A;  3QO2 A;  3VR5 A;  3NBI A;  2MHV A;  3K5O A;  2F0P A;  5T1I A;  1IBL Q;  5IOD A;  2OT2 A;  2FXQ A;  2RVL A;  1VF5 C;  2MNA A;  3A54 A;  3K0X A;  2F4V Q;  1VQI A;  3PF4 A;  2NN6 H;  2PYK A;  2K1B A;  1GD7 A;  2A69 C;  1IW7 D;  1I6H H;  2K50 A;  3EN2 A;  1CK1 A;  1DZ1 A;  1AE3 A;  1QJO A;  4G4K A;  3NBH A;  5CV9 A;  3Q8D A;  4DAM A;  5FKA C;  1A2U A;  4C3J H;  2E2H H;  1SYE A;  3S1Q H;  1GUW A;  1W6J A;  3UE0 A;  1JWU D;  3IFT A;  1I6H B;  3CHB D;  3JAM L;  3U9O A;  1CT1 D;  2GN5 A;  1I3Q H;  2PQA B;  4Y7N H;  4A3E G;  5C3X A;  4I7A A;  3OYY A;  1NCV A;  3A8J E;  3VR6 A;  5FJ8 H;  1PYB A;  4TQU S;  5ELO A;  2H5X A;  2L5T A;  1VMC A;  3I4N B;  3GDE A;  3JAM E;  1WJJ A;  4JV5 Q;  2F0G A;  2AQ3 B;  4B3T Q;  1XNQ L;  1KRS A;  3H3V H;  2F0D A;  5KND A;  1G2S A;  1A3V A;  4HIK A;  3T1Y L;  2SDF A;  1K73 C;  1PFN A;  1QE6 A;  2MPM A;  3E9I A;  4A3I B;  3T53 B;  3AMU A;  1CHP D;  2V4D A;  3KBG A;  1NAP A;  1F2Y A;  4A3M G;  3C2P A;  5C4X B;  1Q1B A;  1HTL D;  5C6A A;  4DR5 Q;  4UDU C;  1Q81 C;  2Y0S G;  1IYV A;  3TP8 A;  3LWE A;  4LF8 Q;  1XWE A;  2UUB Q;  3STB C;  2AHO B;  1QVG A;  2KCM A;  5IGB A;  3M4Y A;  1UUP A;  5AJ3 L;  2XRQ D;  1BKB A;  4XYO A;  5CYU A;  2ZXO A;  2QKI C;  2B2U C;  3LX0 A;  4HR7 B;  1FJG L;  1C4Q A;  4MIU A;  3HOX B;  4NP5 A;  2H1E A;  1PTO B;  1HRJ A;  1FR3 A;  3TZD A;  4GOP A;  1PV4 A;  3CCV A;  5C3W A;  2R92 G;  1SXT A;  2SNS A;  1S5D D;  3GTK H;  2G5D A;  2FFK B;  1F9Q A;  1VQH A;  1S5B D;  2EOT A;  1PFM A;  2F0O A;  3FKI B;  4A93 H;  1F2L A;  1CFM A;  3OHX C;  2Z6K C;  3CCS A;  1JR0 D;  1TKW B;  4XQJ A;  3I4M G;  4AYB G;  4F87 A;  2RQX A;  3ZYY X;  4EVO A;  2EY6 A;  1SE3 A;  4GOP C;  2F3V A;  4EQN A;  3M7N A;  2BA1 A;  3G6J B;  3HOU B;  1M90 C;  3M3Y H;  4DV0 L;  2PZW A;  3WDN A;  1W2B A;  4KY5 A;  3ULL A;  3C1F A;  5IP9 H;  4DUZ L;  3SK5 A;  4FDB A;  2AQ1 B;  1SE2 A;  4IAL A;  1STN A;  2IX3 A;  2EZV A;  2R92 B;  4WJ3 M;  4X6A H;  2QEX A;  1AZQ A;  1TS5 A;  1UWV A;  2VQF Q;  2XN9 C;  1VQO A;  2E2H B;  3BDO A;  3QIA A;  4IFD G;  1EYC A;  1I6V C;  3NTK A;  2JN4 A;  3QB3 A;  4PQX A;  4LW1 A;  3KF6 B;  1JIC A;  2A74 C;  2IPK D;  1FGU A;  4BBS H;  4LFC L;  1HQR D;  3M4O H;  1S4Z A;  1B53 A;  1MHW C;  3E3X A;  5JPM C;  1PA6 A;  2IX0 A;  3U4V A;  2OXP A;  1Q46 A;  1Y1W H;  1SYD A;  2NVT B;  5IT9 L;  4A3E H;  2KHJ A;  1HNW L;  2N8N A;  1GUN A;  2WB1 G;  2B8G A;  3UE1 A;  3NQI A;  1ASY A;  2A19 A;  2K6A A;  2HHH Q;  1TS2 A;  1F9R A;  2L55 A;  4RGM A;  1Z6H A;  1N36 Q;  1Z9F A;  4FXG C;  1VQ9 A;  1MSG A;  4HTH A;  3D4D A;  3NSW A;  4JBJ A;  3NUC A;  1CHQ D;  4HJ5 A;  4DAY B;  2CW0 C;  3X3N A;  1E1T A;  1SYG A;  3RD4 A;  2ZTE A;  3BG3 A;  3OW7 A;  4DV4 Q;  1HZC A;  1K8O A;  5LMU Q;  4F7X A;  4IUU A;  2R6G A;  5HUR A;  2EY1 A;  3HOZ G;  4LFB L;  2E5L Q;  1N9W A;  1ZYR D;  4K6L A;  3FEW X;  3MXN B;  5CGK A;  1X3F A;  1A8V A;  5C4X G;  5LMU L;  2UU9 L;  2KEE A;  4XQQ A;  5IYD G;  2XRS D;  4GKJ L;  3GV3 A;  5IYC H;  4X64 Q;  5BR8 L;  5G3L F;  4OO1 G;  4K0K L;  4LFB Q;  1H9K A;  1M1K C;  2ATW A;  1PHJ A;  4K5V A;  3J80 E;  2I07 B;  1EOT A;  3F2C A;  2Z6B A;  3GTO B;  2NN6 I;  2YTX A;  3H0G B;  4LJZ C;  4L63 B;  1XTC D;  1K0R A;  2NTT A;  4DNR B;  4QQB X;  4GKK L;  4DV2 L;  4LF6 L;  5L37 A;  3KLW A;  5IP7 H;  3VYT A;  1YHQ A;  4R4O A;  1PRT C;  3H94 A;  4J1M A;  4P72 A;  4YHH L;  1YVC A;  1QB5 D;  1H9S A;  4DV3 Q;  3TRE A;  4NKL A;  3KLS A;  1EWH A;  4A3J G;  1OXS C;  1CKO A;  1S40 A;  3S9W A;  1LTS D;  2F0H A;  4RH6 A;  5A2Q E;  1FNU A;  4ID6 A;  4F8M A;  3I4N G;  3L0O A;  4GNX C;  1SRU A;  5CV4 A;  1L1O A;  5IE8 A;  1S5F D;  2EY2 A;  2L12 A;  5M3F B;  4IZ8 A;  4OX9 Q;  2F0L A;  2D62 A;  5C3E H;  5F2D A;  3FPP A;  1PDQ A;  1TS4 A;  1GO3 E;  4AYB B;  4MZ9 A;  1S5C D;  1WI5 A;  1YHA A;  1I4R A;  3HOW G;  4EQP A;  2HT1 A;  3ICE A;  4PG3 A;  3J81 E;  4X66 L;  4DK0 A;  4LUO A;  3VDY A;  5IYB H;  1EUJ A;  3I73 A;  1RJT A;  1EU3 A;  2VQE L;  4DV0 Q;  1SNQ A;  1YNN C;  2HD3 A;  1EQT A;  3FMC A;  3EFX D;  1QVC A;  3E9H A;  3IKJ A;  4X65 Q;  1E3P A;  4TVA B;  1PH3 A;  1NTG A;  4IOC A;  5M9O A;  3BVM A;  3IAY A;  2VUM B;  2QIL A;  3PIP 3;  3MZ5 A;  3S17 B;  2B63 G;  5LMN W;  5D65 A;  4LF5 Q;  3HOX G;  1UEA B;  2OQK A;  2WKD A;  3TBI B;  3HEJ A;  1V9P A;  3F2U A;  2D9U A;  4O1N A;  2O4X A;  2MP1 A;  2RA4 A;  4BBR B;  3A8K E;  3NE5 B;  2NVT H;  1ZEQ X;  4DNT B;  3BYY B;  2NWG A;  3QJY A;  4G7O C;  3OSO A;  1N34 L;  3EA6 A;  4JPB W;  2LSS A;  1CTM A;  1E7Z A;  1LTL A;  2K5Q A;  3BU2 A;  1RD9 D;  4NXM Q;  3RLN A;  3CCQ A;  4DR5 L;  3SHL A;  4N9P A;  3ITP A;  2EYH A;  3TN2 A;  3MVV A;  4KKT A;  1K3B C;  1N36 L;  2K5V A;  4HJ8 A;  2Q8T A;  2E2D C;  5A2Q L;  1S5E D;  1EY4 A;  2I5M X;  1DD2 A;  5JVH 3;  1QWY A;  3C46 A;  1MIU A;  4K5X A;  1VQM A;  4P75 A;  4DU9 A;  3GTP H;  2MGS A;  5CR3 A;  1J5E L;  4ZKC B;  2E76 C;  2VZA A;  4B3S L;  4OGQ C;  5JEA J;  1XMO Q;  1JB3 A;  1IBK Q;  3PO2 H;  5CV7 A;  1KNA A;  4C2M H;  3LNN A;  4LUZ A;  2N78 A;  3T4A C;  3I7F A;  2HHH L;  4JI2 Q;  2B39 A;  4BA2 I;  5DLQ E;  2F3W A;  1EY8 A;  1YIJ A;  3FKI H;  4A93 B;  2EYM A;  5C4Z A;  1EYD A;  1WD1 A;  1BBU A;  3AYH B;  1KDC A;  3H09 A;  1E2Z A;  4AIM A;  2ENB A;  1YJN A;  2A6E D;  5C0X I;  4FO2 A;  3QG1 A;  1G91 A;  4HAE A;  4GN3 B;  5I4D A;  4U67 3;  2TSS A;  4DV5 Q;  2BH2 A;  2F0I A;  1Y1V B;  4A3C G;  3P75 A;  3M85 A;  1QZG A;  1A63 A;  3OTO Q;  3PUX A;  4JK1 C;  1J5E Q;  5FOB B;  2ZM6 L;  5M3F G;  3DUZ A;  4DR3 Q;  3GV6 A;  4ZQ3 A;  2K75 A;  3HG9 A;  1KQS A;  1KXL A;  5H1S E;  5JJZ A;  3OW2 A;  5M5X H;  3MAQ A;  1N34 Q;  1XPO A;  2HCI A;  2PW7 A;  4LF9 Q;  1U4L A;  5C5M A;  3OMG A;  2LXK A;  3HOZ H;  3RUZ A;  2SNM A;  1F9S A;  3S1M H;  3VA7 A;  5GAH C;  1I4Q A;  5JPN C;  4BY1 B;  2JA5 B;  4UAI A;  1AN8 A;  1IXR A;  5DM7 3;  2R93 G;  1GKH A;  2F3I A;  3KJP A;  2HDM A;  1WD0 A;  5C44 G;  4PMW A;  1X3G A;  5FO9 B;  2UXD L;  4RCN A;  3HOU G;  2A6H D;  1IW7 C;  1DGS A;  4R4Q A;  2BA0 A;  5IT9 c;  1BCP D;  2J7Z A;  2UUB L;  3K81 C;  4QJF A;  2K28 A;  4GZY C;  1N8R C;  1GJX A;  3A7L A;  2NTS A;  2Y0S B;  4DR7 Q;  3CQZ B;  4O2D A;  1STA A;  3DWQ A;  3K7A H;  2B2W C;  4IPC A;  4RKL A;  1HA6 A;  2XNA C;  1JOO A;  4X3U A;  1F2Z A;  5KIX A;  1PH9 A;  4JI2 L;  1EYA A;  3H91 A;  4YCU A;  2K5H A;  1ILP A;  4ZUJ A;  2Z0S A;  4Y7N B;  2MQH A;  3DLL A;  2KA7 A;  4OIJ A;  3I55 A;  4HCS A;  3D6W A;  1U4R A;  2ID0 A;  2N3S A;  1XMO L;  1UE7 A;  1PZJ D;  1N32 Q;  1I4X A;  1X54 A;  3I70 A;  5JJL A;  4UPA A;  4DR4 Q;  1VQP A;  2F0K A;  1LTT D;  1VQE A;  3TS0 A;  1PRT F;  2VW9 A;  1IBL L;  5AFW A;  3H0G H;  3PMF A;  1DOM A;  4L5T A;  1PH6 A;  3KF6 A;  2ZM6 Q;  4A76 A;  2EXD A;  4FXD A;  4LF7 Q;  4FXK C;  5I6W A;  4IFD J;  4HCE A;  2B2V C;  1ICW A;  4DV3 L;  4GNX B;  1GUT A;  3HRZ C;  4DK6 C;  1HQM C;  4HIO A;  2R7Z G;  1IYU A;  1BDO A;  4JOI A;  3NEL A;  1RDP D;  5C4X H;  1VQ8 A;  4HN7 A;  4C3I H;  1R9T H;  2L4N A;  4JBK A;  1PH4 A;  2HIV A;  2F0V A;  4JI4 L;  4QY7 A;  3PCO B;  3STB D;  2C35 B;  3MA2 B;  2RSO A;  3TZU A;  2JQO A;  4QUC A;  2E75 C;  2R7F A;  3Q6S A;  3BZK A;  4ME3 A;  4KN4 C;  4C3H B;  4XXE A;  2K7V A;  4DV2 Q;  3NEM A;  3VR3 A;  3I56 A;  3NTI A;  2RDF A;  1H95 A;  4KD3 A;  2UUC Q;  2GVA A;  2L9H A;  1Q1E A;  3IRB A;  1STG A;  2DNC A;  1J9O A;  3PUV A;  1D5X C;  4OL7 A;  2YTV A;  4FVM A;  1TWA H;  3NK9 A;  2L1B A;  5J1Z A;  4A3E B;  1WTX A;  3G6E A;  2K04 A;  4NMZ A;  3I8Z A;  4EGV A;  1S72 A;  4A3K B;  3HKS A;  1OXV A;  3CPW A;  4HMI A;  3W1B A;  2WII B;  2I0Q A;  2E2I H;  5EBC A;  5KYI A;  1KL9 A;  5C0X J;  4GN4 B;  5JOB A;  1K28 A;  5C4J B;  1SEB D;  3D4W A;  2Z4H A;  1HNZ L;  2P5Z X;  2JA7 G;  1EFI D;  4RMF A;  4XQN A;  2M2L A;  3AFQ A;  4H44 C;  5A35 A;  4LF5 L;  2ICI A;  4YHH Q;  2G9D A;  1GVP A;  3CCJ A;  4N9T A;  4OON A;  3KLR A;  4QGU A;  3PO2 G;  1KAA A;  1CSP A;  3I3C A;  3EBE A;  3J81 j;  4OEL B;  4X3T A;  2O5J C;  2EIF A;  4DXG A;  5D3D A;  5G3L D;  1D7Q A;  1WVL A;  2RDG A;  3AFP A;  1I50 H;  5JAV A;  4K14 A;  1AFP A;  2JA8 B;  2Q2H A;  1YIT A;  3VYU A;  4XT1 B;  3DXJ C;  1QUQ B;  3DHQ A;  2AUJ D;  3GTG B;  2K4K A;  2R3Z A;  1EU4 A;  3AEV A;  4A3G H;  5FLX E;  1ESF A;  4MTN A;  2WV6 D;  1QZH A;  3CPF A;  2A73 B;  3ULJ A;  2NYZ D;  4X66 Q;  4GOP B;  3S2H B;  2E2J B;  3FHW A;  4DV1 Q;  1JJ2 A;  2PNR C;  3V96 A;  5I2X A;  3RN2 A;  2KQ3 A;  3OPO A;  2PQA A;  2XGT A;  4OWT B;  1VF7 A;  4BS9 A;  1KDB A;  1DM0 B;  2IJ0 A;  1CKM A;  3G48 A;  5JJI A;  4WOR A;  4Z9C B;  4GS3 A;  4A3B H;  3EIV A;  4DAY A;  3VR4 A;  2UXC L;  4H7B A;  2IHE A;  4GNX A;  3S14 B;  5LHY 1;  2NVQ B;  2RHS B;  3NP8 A;  3OMC A;  4KHP L;  4ZKB B;  1LTI D;  1NE3 A;  2ZTC A;  1HXY D;  1XPU A;  4O0A A;  1JB7 A;  2WAQ B;  4L8J A;  2DJF C;  1T5X D;  4DKA C;  2R93 H;  2QDB A;  1L0X B;  3HOY G;  1RTO A;  1TQO A;  4OEM B;  2OF1 A;  4JYA L;  1BNZ A;  2KBN A;  1CUK A;  4IPD A;  5FLX L;  2WAC A;  1TS3 A;  1ZYR C;  4OO1 I;  2K32 A;  1DCZ A;  1QCB D;  1VQ6 A;  4X3K A;  3G71 A;  2G9H D;  5FLM H;  1VQA A;  1ZXT A;  1MJC A;  3HOW H;  1TR5 A;  2F03 A;  4YY3 L;  3FKI G;  1SYC A;  4JI6 L;  5C4H A;  2CW0 D;  1VQF A;  1PLF A;  3ER0 A;  3TP6 A;  1VQ5 A;  3KFU A;  3CME A;  3F1Z A;  3I4O A;  3KJO A;  1Y8P B;  4UP9 A;  4HID A;  2M9V A;  3HOY B;  2OQ0 A;  3KOJ A;  2NVY B;  3CQZ H;  1U4P A;  4C2M B;  1EWI A;  4LMQ D;  4PZ6 A;  2QA4 A;  5GRO A;  1PZI D;  5IT9 E;  3QOL A;  4RA8 A;  4LF9 L;  1LTR D;  2KHS A;  2UXB L;  3SE0 A;  1BQQ T;  4IQZ A;  1HNW Q;  5IP7 G;  4LF4 L;  4DUY L;  4ULL A;  3WWV A;  2N55 A;  3NQT A;  1CQV A;  1D1I A;  1FNV A;  3S15 H;  4JI1 L;  4B3R Q;  3MXN A;  3CRL C;  3TEH B;  3O13 A;  2DY8 A;  4JI0 Q;  1SRO A;  3K5L A;  1HUN A;  1SJE D;  2VB3 X;  1EQV A;  3I4M B;  2IT1 A;  2UXD Q;  1KNE A;  3SEB A;  2Z8L A;  1JQY D;  1WCM G;  2XIW A;  3HKZ G;  2FMC A;  4FF3 A;  3I2Z A;  4MHE A;  1ROD A;  3DWP A;  1NUC A;  4HJ9 A;  2RHQ B;  2WKC A;  2L15 A;  4M8A A;  3CRK C;  4DR4 L;  2B2W A;  3U58 A;  4DR3 L;  4N8X 1;  2KJX A;  4IOA A;  2F0T A;  1ICF B;  4BBR H;  1DXM A;  2L0C A;  1V1P B;  3H15 A;  3M4P A;  2NVQ H;  5IOC A;  4IJL A;  2K52 A;  1DJR D;  3BZC A;  3E0J A;  4JBM A;  1RTN A;  1WCM H;  4HJ7 A;  5CV6 A;  1ET9 A;  3T1Y Q;  1XTD A;  4FP5 D;  3C1E A;  3D8G A;  3TSS A;  3KK7 A;  3I90 A;  3OTO L;  1KD1 C;  3NTH A;  1LT6 D;  1K8M A;  2ZJR A;  4A3F H;  4BBR G;  4DAV A;  4DR1 Q;  1VQG A;  3KLS X;  2NVY H;  1F77 A;  1UE6 A;  4DPG A;  3D6C A;  2F0E A;  4QL5 A;  1X6O A;  4R4I A;  3R2I A;  4NB3 A;  3TME A;  2OEO A;  1PRT B;  1BBX C;  1MJE A;  1A62 A;  3CCL A;  3SGI A;  3N52 A;  1SNO A;  2E74 C;  3N6R A;  3PO2 B;  3GTM B;  2MJ8 A;  2FIN B;  3CAM A;  2CKZ B;  3JC6 6;  2UXB Q;  5C3E B;  3G7L A;  2MO0 A;  2XWB B;  3OWF A;  1FJG Q;  2JA8 G;  1KIX A;  3T16 A;  4JVZ A;  1MD2 D;  3S24 A;  4RG1 A;  2B2T C;  3MEH A;  3R2T A;  3URY A;  2N88 A;  2CQO A;  2NUC A;  3AU7 A;  3L3O C;  5E4X A;  1VDZ A;  3KBX A;  3X3M A;  2B63 B;  1KDA A;  4L5R C;  3ERO A;  2HIX A;  1K83 B;  3QWN A;  1HNX L;  2C9O A;  4KHP Q;  1HH2 P;  3QR8 A;  4PMB A;  2UXC Q;  2ZJQ A;  4G57 A;  2F0S A;  4LUV A;  3R8B A;  5EQ0 A;  2IHF A;  2JYO A;  3CC4 A;  3CF5 A;  5C0X G;  4A3L H;  3PSI A;  1IYJ B;  3P20 A;  1VQ4 A;  4IPG A;  2OCE A;  1VQL A;  1CZG A;  4ZCK A;  4A3K G;  4P2C B;  4JYA Q;  3VYR A;  1WTW A;  1G6Z A;  3L7Z C;  1YEZ A;  3ERS X;  2F0U A;  4JI8 L;  5I9P A;  2QEJ C;  3SK4 A;  1VCI A;  3D0F A;  5DM6 3;  3L2P A;  3CCM A;  2Q8R E;  2RCF A;  1IZ6 A;  1X56 A;  4JI3 Q;  2EE1 A;  3A56 A;  4KV6 A;  3MWY W;  2DGY A;  4YWL A;  1SMY D;  5LMN L;  4PZ7 A;  2D2C C;  2R61 A;  4DXF A;  3K5M A;  1SN8 A;  2ASB A;  4ZRZ A;  1STY A;  4DR2 Q;  1B9M A;  3VA5 A;  1H9M A;  5M3F H;  5I9O A;  4OO1 H;  1NNX A;  1C0A A;  1JWM D;  4JOI C;  2HQE A;  5FLX c;  1HUM A;  2PNH A;  2AKW B;  4ZLT F;  1QNK A;  1PRT D;  4KKU A;  1I3Q B;  1LTB D;  4BBS B;  5FLM G;  4DV4 L;  1KHI A;  3ONA B;  2EYF A;  5ELB A;  4NW2 A;  1M8A A;  4POG A;  1X3P A;  3PV0 A;  4JI5 Q;  3GTM H;  4DV6 L;  4JG2 A;  1JJC B;  1GUO A;  1UEB A;  1Y14 B;  3HKZ E;  1CKN B;  2SOB A;  4A3I G;  3AQQ A;  1BVS A;  4BXX H;  1QVF A;  4QB4 A;  2E5L L;  5IGE A;  2VL6 A;  1K83 H;  4QUF A;  1Q86 C;  1C48 A;  4B3M L;  4WFN 3;  1G2T A;  3KYH C;  1JC7 A;  2HUG A;  4NXN L;  3JAM i;  1NSN S;  5BR8 Q;  4X64 L;  4DK3 C;  3QOJ A;  2MUY A;  2Q2T A;  2LKV A;  3UDF A;  4B08 A;  4CKB A;  1NY4 A;  3A7A B;  3IFD A;  3S1R H;  1R4Q B;  4IFD I;  2DN8 A;  1BCP F;  1O7Y A;  1WCM B;  1D5M C;  4RKB A;  3HOW B;  5ISR A;  2NVX B;  1JE4 A;  1TVX A;  4CDF C;  3E6Z X;  2WB1 B;  3RLF A;  2XSC A;  1D8L A;  4DR6 Q;  2AWO A;  2CH4 W;  2EDG A;  3GTK B;  5COR A;  4ZYS A;  2K14 A;  3KDF B;  4IUR A;  1K8A C;  1ILQ A;  5IY0 A;  5T1G A;  1A15 A;  3U4Z A;  2IWH A;  1PH1 A;  4PMC A;  1TWF H;  1YJ9 A;  4TSS A;  1EIH A;  5EKK A;  3GTL B;  1CZW A;  4KD4 A;  3MTS A;  3J7Y W;  2X69 A;  1C9O A;  2JSO A;  4NXM L;  1XXG A;  4QF4 A;  1HNX Q;  1H9R A;  3DMU A;  2VS1 A;  2FMM A;  5KNB A;  3HOX H;  4WRD A;  3GO5 A;  3UDX A;  2EJG C;  3W2D A;  4CBV A;  4QMG A;  1TT2 A;  1PYW D;  1QUQ A;  3RZO B;  2CCZ A;  1XPR A;  3NWS A;  3WOE A;  5E4W C;  1Z7T A;  3H3V C;  1ENC A;  1JT8 A;  1LO5 D;  3VYS A;  3K8A A;  1A0I A;  1Y1V H;  3W1G A;  1SYF A;  1JE5 A;  2WFW A;  5CV8 A;  3T51 B;  1K3R A;  5M5Y H;  4HED A;  2DUD A;  1FVI A;  4K0K Q;  2N49 A;  1L1O B;  5CBE E;  3S1N B;  2NZO A;  2BDN A;  3BVG A;  4A3M B;  5IWA L;  1N33 Q;  4B3M Q;  2CVR A;  5KYL A;  1JMC A;  1AZP A;  5JJK A;  1HJP A;  3BS1 A;  2KED A;  4N8F A;  4JI3 L;  1GOZ A;  5ELD A;  3FRP B;  3BDL A;  5C3E G;  1TWG H;  1CQF A;  2K5N A;  3V2T A;  2Z6K A;  4A3B G;  1RIP A;  4JI5 L;  4S3S A;  1YI2 A;  2WIN B;  4DR6 L;  4R8I A;  2BOS A;  4HSP A;  2NBF A;  4RFB A;  2GA4 B;  4MN3 A;  1IKL A;  1HR0 L;  1AP0 A;  2E8G A;  3B6Y A;  1E2W A;  3FDT A;  1B44 D;  4KN7 C;  4FYD A;  4FNF A;  1WTH A;  3U50 C;  5GAG C;  1PH5 A;  3FP9 A;  2KUM A;  1GHK A;  2HQL A;  4DF7 A;  3K6O A;  1DOK A;  5C4J H;  4JV5 L;  4YWM A;  4YCW A;  1MGS A;  4J8Q A;  1RL2 A;  5M3M G;  1RF2 D;  2BDO A;  5LMN Q;  1JOK A;  3J80 c;  3RZO H;  3S14 H;  1LUZ A;  4A3B B;  1FGB D;  1UAP A;  4UY8 C;  1KAW A;  3KF8 A;  4GN5 A;  1AE2 A;  1SJH D;  4BA1 I;  3I72 A;  3D3R A;  4ODG A;  1KTK A;  3OWE B;  5FJ8 G;  1M4V A;  4OXP A;  2CQA A;  3K0Y A;  2M00 A;  5FO8 B;  4CKC A;  3T1H Q;  1B70 B;  1UNS A;  1GUS A;  2JP1 A;  2MFI A;  1XNR L;  1Z47 A;  1TWF B;  1V1O A;  1CI3 M;  4K5W A;  2PZT A;  3HGB A;  3HKZ B;  4R9W A;  5EKL A;  1T5E A;  4RGN A;  2VUM H;  1WOC A;  1GHJ A;  2B2U A;  2AWN A;  2R93 B;  3MC0 B;  1SE4 A;  2K03 A;  4KTA A;  4LAA A;  2A69 D;  2X6G A;  5EJW A;  1G51 A;  5ELE A;  3DM3 A;  2ZJP A;  1WTQ A;  2JA8 H;  1VQJ A;  4DAP A;  1B9N A;  1I94 L;  4KHZ A;  4CJ2 C;  2EYO A;  3F8T A;  3EJI A;  3T13 A;  1V1P A;  3JAM c;  5BN3 A;  5CBA E;  2F4I A;  2FJ2 A;  3NXW A;  4P74 A;  2JA5 G;  1F9P A;  1HA5 A;  4IUQ A;  3I91 A;  1EY9 A;  1ENF A;  1ZKO A;  5D14 A;  2E2J H;  3J80 i;  2RF4 A;  4ZK9 B;  2O2L D;  3FPU B;  3J81 L;  4OHJ A;  3HOY H;  1STH A;  4XYQ A;  2CWP A;  4DGZ A;  2XWJ B;  2KEN A;  5DNF A;  3M4Q A;  1XNR Q;  2I46 A;  1O78 A;  4DR1 L;  2I5H A;  1CA5 A;  5GAE C;  1WTO A;  5C0X H;  3Q0A A;  5EPJ A;  1J8I A;  2A5H A;  4TRD A;  4A3L G;  2DNE A;  4KK7 A;  1I5F A;  2HCC A;  1Y8N B;  3E0E A;  4M1U B;  1TU2 B;  5D3I B;  4A3K H;  2OWO A;  3K7U C;  2B63 H;  2I5L X;  1HR0 W;  1I4H A;  2ZXR A;  3NEN A;  4IJH A;  2Z9H A;  5DEH A;  2F4V L;  1L1O C;  4R4T A;  1TWA B;  5M3M B;  2RBM A;  2C5C A;  5IYB G;  1BF4 A;  4K2K A;  2VQF L;  2PCF B;  5E7N A;  1YNN D;  2PPB C;  1OXX K;  2V1C C;  1KLG D;  3K7A B;  4KMU C;  4B9W A;  2F52 A;  1E0B A;  1PH8 A;  1NR2 A;  1IBM Q;  1IBK L;  3H0G G;  4HIM A;  3ZJY C;  2JA6 B;  3H6M A;  3MHB A;  5EBD A;  1EZ8 A;  1SFO B;  1E22 A;  1LAC A;  4CGY B;  4JBW A;  1PFB A;  2JXM B;  4IUV A;  3J7A 5;  2D0O A;  1EQQ A;  1OXT A;  1YNX A;  2KCT A;  5E3F A;  1TWH B;  4B3R L;  1K8G A;  2BE5 D;  3HOV B;  1JJG A;  3S1M B;  5IWA Q;  2A68 C;  4A3F B;  2IL8 A;  5LL6 S;  1N33 L;  3J7A V;  4IFD H;  3HOZ B;  5KNC A;  1B8A A;  2B3G A;  3UDI A;  4IPH A;  1V43 A;  1SFO H;  3HS0 C;  4B3S Q;  2D5D A;  3CD6 A;  1AH9 A;  2YTY A;  4ALP A;  1OTC A;  4RCO A;  3A74 A;  3UI2 A;  1ML0 D;  1O7L A;  3L9A X;  1FD7 D;  1LLR D;  2LFN A;  1LM0 A;  4OWX B;  1VQ7 A;  5ELN A;  1A3T A;  1AEX A;  1KC8 C;  3P1H A;  4IUN A;  3OIP A;  4NDX A;  2PZU A;  2EVB A;  3SK6 A;  2VXW A;  4G7H C;  1R4P B;  1CSQ A;  3D31 A;  5IGC A;  3NWT A;  3SVM A;  3OIQ A;  2B2Y A;  1X3E A;  2VQE Q;  5M5W B;  2NZ1 D;  5EGT A;  1IL2 A;  5EPL A;  2UUA L;  1XX8 A;  4A3D B;  1Y8O B;  2AQ2 B;  4RGO S;  1ENA A;  3MEF A;  4DV1 L;  3CC7 A;  4H0L C;  2YU9 B;  1YZ6 A;  2QF7 A;  2XTI A;  4CKE A;  1II3 A;  1B1Z A;  5FK9 C;  2PW5 A;  4JI0 L;  2QW7 A;  4K6D A;  2F1M A;  3ERQ A;  5IYD H;  2EQS A;  2R7Z B;  3CW2 C;  4UP8 A;  3CCE A;  2YV5 A;  4A3D H;  2RSN A;  3S2D H;  3PGZ A;  1U0L A;  2JE6 I;  2PI2 E;  4A3J B;  1H9S B;  5IIF A;  4X65 L;  2JEA I;  3FVQ A;  4DNI A;  4H13 C;  3K59 A;  1HFG A;  5IGF A;  1XYI A;  2F0M A;  2KEC A;  3GTQ H;  1G6P A;  4XTC S;  1P16 A;  2B2Y C;  4K8J A;  1IHZ A;  2EYL A;  1UE1 A;  4J6H A;  4YCV A;  3J7A F;  3J81 i;  4NXN Q;  1X55 A;  4DFA A;  2UU9 Q;  4BBS G;  4DV7 Q;  1E2V A;  2EY5 A;  1BXT A;  1JWS D;  4C3H H;  2K33 A;  1MKH A;  1RKN A;  5NUC A;  1HHV A;  2LS0 1;  2EPB A;  4KKS A;  1Y1W B;  3PO3 G;  2QGQ A;  4YWK A;  3HP3 A;  4G7Z C;  4BY1 H;  4CJ1 B;  5CV5 A;  3K58 A;  4AQY Q;  4R4C A;  5HGT A;  2VUM G;  1SBB B;  1X32 A;  4CDE C;  5EKI A;  3I4M H;  1NMF A;  4IO9 A;  3HOV H;  1HZA A;  1IKM A;  3GTL H;  1B2T A;  1EIF A;  5K36 G;  3MXG A;  3S15 B;  2ZTD A;  4EQO A;  5KRU A;  4CJ0 B;  1HZ9 A;  1PTO F;  4KY7 A;  1GM5 A;  5BN4 A;  3LGJ A;  1Q90 A;  1C8C A;  1CA6 A;  3RMH A;  4LWC A;  3PIP A;  2CH4 A;  4BY1 G;  2IX1 A;  3A5U A;  1HPC A;  2K5D A;  2JK8 A;  1YNJ D;  4RAU C;  1SMX A;  4CDC C;  4IUP A;  3J81 c;  1VQK A;  2UUC L;  2TMP A;  1TWG B;  1QIL A;  4C3I G;  1U9R A;  1K0S A;  3GTQ B;  4RHS A;  1HZB A;  3M7G A;  1ET6 A;  5HY6 A;  4Q0F A;  1H9J A;  4X62 L;  1PXU A;  3MFY A;  5IGG A;  4A3J H;  1CKN A;  3S2D B;  1B7Y B;  1BCP C;  3W3A A;  1ONL A;  3SDZ A;  1O7Z A;  2NN6 G;  5E1F A;  2ZXP A;  2F0F A;  4ZAI A;  3A8I E;  4DV6 Q;  1XJV A;  2IY5 B;  4XIG S;  1G29 1;  2NZH A;  1PTO H;  2VNU D;  2WP8 J;  1BOS A;  5TSS A;  4MNO A;  5DAU A;  3K57 A;  2Q8I B;  1NBW A;  1O80 A;  1I4G A;  3U9S A;  2EYP A;  4LFC Q;  1OXU A;  2B8F A;  2ICE C;  3J7Z C;  4BY7 G;  4OWW B;  4JI4 Q;  2CFM A;  5M5W H;  1STB A;  2CWA A;  2HDL A;  1WTV A;  4U68 A;  3CMA A;  4KJO A;  2E2I B;  1UE5 A;  5KEE A;  5CMD A;  3IL8 A;  1EIG A;  1Q8I A;  3J80 L;  1PFS A;  1VMP A;  3EQL C;  4H02 A;  4BWG B;  1BO0 A;  1V8Q A;  3TQY A;  4JI7 L;  4LF4 Q;  4A3I H;  4K8I A;  4I7Z C;  3ULP A;  4HSV A;  2KVM A;  3GQB A;  5ELF A;  5JEA G;  1EIY B;  2BE5 C;  3DEO A;  2NB0 A;  1X9N A;  3D4R A;  5J3B A;  1XMQ Q;  1HCZ A;  3S17 H;  4O42 A;  2A8V A;  2B29 A;  2UUA Q;  2EJF C;  3CKI B;  1HFN A;  3S1R B;  1I94 Q;  1F2M A;  1SSO A;  1VQB A;  1EEF D;  4ZUI A;  2F0N A;  1VQN A;  5GQO A;  4A3C H;  4P71 A;  1MSH A;  4IUT A;  4C1N I;  1NMG A;  2WAQ G;  2PQE A;  5AJ3 Q;  1TWH H;  5I2Y A;  1I50 B;  3EVQ A;  2RDH A;  2ES2 A;  1A2T A;  1B4O A;  4AH6 A;  4IN3 A;  2R7Z H;  1N32 L;  1PVO A;  3RZD B;  1Y1W G;  3PO3 B;  5C44 B;  1Q3L A;  2A1A A;  1EWC A;  1PH7 A;  2O5I C;  1EEI D;  1KRT A;  2YU9 H;  4V0B A;  2WB1 E;  1PZK D;  3CCR A;  3GTP B;  1A6X A;  2A68 D;  1RCV D;  2PMZ E;  4KY6 A;  5M3M H;  1EZ6 A;  4C1N K;  4FF1 A;  3S16 B;  1EY0 A;  1XNQ Q;  4B9X A;  4K2L A;  3RNU A;  3PIO 3;  4Y52 H;  3KF8 B;  3UDG A;  1ESR A;  2FHT A;  1T9H A;  1MBY A;  2KCC A;  1SLJ A;  2MO1 A;  3KDF A;  1KLU D;  4JI1 Q;  4A3D G;  1EOV A;  3GTJ H;  3F2D A;  4EX5 A;  1I4P A;  1SR3 A;  1V1Q A;  4DUZ Q;  3NBH B;  1VQD A;  2KOL A;  3TP7 A;  5I6Y A;  1LYL A;  1TY0 A;  3ND8 A;  4HMJ A;  3W5O A;  3RR5 A;  3S1N H;  4B3T L;  1U5K A;  3GTO H;  2DY7 A;  3SR1 A;  1S3O A;  4KHV A;  1XMQ L;  2Z1C A;  4E6I A;  3TDQ A;  1JOR A;  2A6E C;  1B3A A;  3MXU A;  2VB2 X;  2F0W A;  4XT3 B;  2GVB A;  2EXZ A;  1GUG A;  2H4O A;  1W6K A;  2JA7 H;  3Q24 A;  4NPS A;  1SAP A;  1IBM L;  4V19 0;  3GP7 A;  3R3O A;  3MFG A;  4A75 A;  1QNU A;  4DR7 L;  1JOQ A;  4XDX A;  1STE A;  5HGQ A;  3M4O B;  4Q5V A;  4C3I B;  1R9T B;  2Z4I A;  3A0J A;  4L5Q A;  4F88 A;  3BVZ A;  2R7D A;  3SXH A;  2QDL A;  4JC0 A;  1WTP A;  3HZX A;  3P7J A;  2EYJ A;  1HTP A;  3T1H L;  2JA6 H;  3LWU A;  4MTK A;  1BCP B;  3G4S A;  3HOV G;  4CHT B;  1DOL A;  1Q8K A;  4LFA Q;  1TWC B;  4DUY Q;  2JEB I;  5K5P A;  1D6E C;  3VR2 A;  3Q23 A;  1NR4 A;  4GKK Q;  1BR9 A;  2ALY B;  3KUP A;  3MXP A;  4JW0 A;  3HOU H;  2F0J A;  4DK1 A;  1EQR A;  1E1O A;  1SNM A;  5JEA H;  1EY5 A;  1RHP A;  1Q82 C;  5IGD A;  3TS2 A;  1EY7 A;  2PI2 A;  2LMC B;  1Q12 A;  4AQY L;  3I4L A;  2D0P A;  5FO7 B;  3I4N H;  5C5L A;  2SEB D;  4RWS C;  4DV5 L;  1SDF A;  4KLK A;  1PMR A;  4CDD C;  4FF2 A;  4UHV A;  3A55 A;  1YJW A;  5IYC G;  3OOC A;  2RCN A;  1FNW A;  1PYS B;  2Q2U A;  4C3J G;  1PTO D;  3PUW A;  3S1Q B;  1TXY A;  3CCU A;  5BN5 A;  5M5Y B;  3CC2 A;  2QCP X;  1OO9 B;  3BZD B;  4LNQ A;  3M3Y B;  3CP0 A;  1QG7 A;  1VQC A; 
#chains in the Genus database with same CATH homology
 2J0T D;  5COY A;  4I65 A;  3Q22 A;  5J39 A;  3AB9 A;  4QIW B;  1A3U A;  2K5W A;  3DEP A;  4RGT A;  1EY6 A;  4R8N A;  3NHH A;  4FF4 A;  5CC4 A;  4X3S A;  1EL0 A;  2XVS A;  3WOF A;  5M5X B;  1LT5 D;  3DWA A;  3TP5 A;  1G8Z D;  4BY7 B;  4OIK A;  3CU7 A;  2PMZ B;  1QOH A;  3V05 A;  2L11 A;  3ND9 A;  4YIJ A;  1Y69 U;  5EPK A;  1DON A;  3NPP A;  1WTR A;  1YNJ C;  2EJM A;  1TY2 A;  1JCK B;  3PUZ A;  3R93 A;  4PNY A;  4ABN A;  2PO4 A;  4PV1 C;  5KGU A;  3E5S A;  4WJW A;  2RKS A;  2YYZ A;  4ILW A;  1D2B A;  1AW7 A;  2F0Q A;  3GTJ B;  4C3H G;  3DM1 A;  4LK1 C;  1KAB A;  5ELC A;  1FYC A;  1SND A;  2AUK A;  1B50 A;  3T56 B;  4L6T B;  3SK8 A;  3PUY A;  4DN4 M;  2KCN A;  1U4M A;  3C3L A;  4ME5 A;  2ZT9 C;  2BCO A;  2K01 A;  2LY7 A;  1BUV T;  1LV9 A;  4KI0 A;  4C3J B;  1X3Q A;  1DYQ A;  5JVG 3;  5LL6 X;  1SNC A;  2IW3 A;  2CHB D;  4DA2 A;  1LAB A;  1LT3 D;  2B2T A;  1PTO C;  4QCL A;  1IL8 A;  1LTG D;  1SMY C;  1LT4 D;  2B2V A;  5K36 H;  2X6L A;  4RHR A;  2JA7 B;  1GXD C;  1L0Y B;  4C56 C;  1CM9 A;  3K5N A;  1SNP A;  1MI2 A;  2J4X A;  1D5Z C;  1SYB A;  3BDC A;  1LTA D;  4TKO B;  5J22 A;  1TII D;  4A3G B;  4KJN A;  3BYT B;  1D1K A;  2A6H C;  3GD7 A;  2K05 A;  3QO2 A;  3VR5 A;  3NBI A;  2MHV A;  3K5O A;  2F0P A;  5T1I A;  5IOD A;  2OT2 A;  2RVL A;  1VF5 C;  3A54 A;  2NN6 H;  2PYK A;  2K1B A;  2A69 C;  1IW7 D;  1CK1 A;  1DZ1 A;  1QJO A;  4G4K A;  3NBH A;  5CV9 A;  5FKA C;  1A2U A;  1SYE A;  1GUW A;  1W6J A;  1JWU D;  3IFT A;  1I6H B;  3CHB D;  3JAM L;  3U9O A;  1CT1 D;  5C3X A;  1NCV A;  3A8J E;  3VR6 A;  4TQU S;  2L5T A;  1VMC A;  3I4N B;  3JAM E;  2F0G A;  2AQ3 B;  5KND A;  2F0D A;  1G2S A;  1A3V A;  2SDF A;  1PFN A;  1QE6 A;  2MPM A;  3AMU A;  4A3I B;  3T53 B;  1CHP D;  2V4D A;  3KBG A;  1NAP A;  1F2Y A;  3C2P A;  5C4X B;  1Q1B A;  1HTL D;  5C6A A;  4UDU C;  1IYV A;  3TP8 A;  3LWE A;  1XWE A;  5IGB A;  3M4Y A;  1UUP A;  2XRQ D;  4XYO A;  5CYU A;  2ZXO A;  2QKI C;  2B2U C;  3LX0 A;  4HR7 B;  1C4Q A;  4MIU A;  3HOX B;  4NP5 A;  2H1E A;  1PTO B;  1HRJ A;  1FR3 A;  3TZD A;  5C3W A;  1SXT A;  2SNS A;  1S5D D;  2FFK B;  1F9Q A;  1S5B D;  2EOT A;  1PFM A;  2F0O A;  3FKI B;  1F2L A;  1CFM A;  3OHX C;  1JR0 D;  1TKW B;  4XQJ A;  4F87 A;  2RQX A;  3ZYY X;  4EVO A;  2EY6 A;  1SE3 A;  2F3V A;  4EQN A;  3M7N A;  2BA1 A;  3G6J B;  3HOU B;  2PZW A;  3WDN A;  4KY5 A;  3C1F A;  3SK5 A;  2AQ1 B;  1SE2 A;  4IAL A;  1STN A;  2IX3 A;  2EZV A;  2R92 B;  1AZQ A;  1TS5 A;  2XN9 C;  2E2H B;  3BDO A;  3QIA A;  4IFD G;  1EYC A;  1I6V C;  3NTK A;  3QB3 A;  4PQX A;  1JIC A;  2A74 C;  2IPK D;  1HQR D;  1S4Z A;  1B53 A;  5JPM C;  2IX0 A;  2OXP A;  1SYD A;  2NVT B;  5IT9 L;  1GUN A;  2B8G A;  3NQI A;  2K6A A;  1TS2 A;  1F9R A;  2L55 A;  4RGM A;  1Z6H A;  4FXG C;  1MSG A;  4HTH A;  3D4D A;  3NSW A;  3NUC A;  1CHQ D;  2CW0 C;  3X3N A;  3RD4 A;  1SYG A;  3BG3 A;  3OW7 A;  1K8O A;  4F7X A;  4IUU A;  2R6G A;  5HUR A;  2EY1 A;  1ZYR D;  4K6L A;  3FEW X;  5CGK A;  2KEE A;  4XQQ A;  2XRS D;  3GV3 A;  5G3L F;  4OO1 G;  1H9K A;  4K5V A;  3J80 E;  2I07 B;  1EOT A;  3GTO B;  2NN6 I;  3H0G B;  4LJZ C;  4L63 B;  1XTC D;  4DNR B;  2NTT A;  3VYT A;  1PRT C;  3H94 A;  4J1M A;  1QB5 D;  1H9S A;  3KLS A;  4NKL A;  1EWH A;  1OXS C;  3S9W A;  1LTS D;  2F0H A;  4RH6 A;  5A2Q E;  1FNU A;  4ID6 A;  4F8M A;  5CV4 A;  1S5F D;  2EY2 A;  2L12 A;  5M3F B;  4IZ8 A;  2F0L A;  2D62 A;  5F2D A;  3FPP A;  1PDQ A;  1TS4 A;  4AYB B;  1S5C D;  1I4R A;  4EQP A;  3J81 E;  4DK0 A;  3I73 A;  1RJT A;  1EU3 A;  1SNQ A;  1YNN C;  1EQT A;  3FMC A;  3EFX D;  3IKJ A;  5M9O A;  3BVM A;  3IAY A;  2VUM B;  2QIL A;  3PIP 3;  3MZ5 A;  3S17 B;  5D65 A;  1UEA B;  2WKD A;  3TBI B;  3HEJ A;  3F2U A;  2D9U A;  4O1N A;  2O4X A;  2MP1 A;  2RA4 A;  4BBR B;  3A8K E;  3NE5 B;  1ZEQ X;  4DNT B;  3BYY B;  2NWG A;  3QJY A;  4G7O C;  3OSO A;  3EA6 A;  1CTM A;  2K5Q A;  1RD9 D;  3SHL A;  4N9P A;  3ITP A;  2EYH A;  3TN2 A;  3MVV A;  4KKT A;  2Q8T A;  2E2D C;  5A2Q L;  1S5E D;  1EY4 A;  1DD2 A;  5JVH 3;  1QWY A;  3C46 A;  4K5X A;  4DU9 A;  2MGS A;  5CR3 A;  4ZKC B;  2E76 C;  4OGQ C;  5JEA J;  1JB3 A;  5CV7 A;  1KNA A;  3LNN A;  3T4A C;  2B39 A;  4BA2 I;  2F3W A;  1EY8 A;  4A93 B;  2EYM A;  5C4Z A;  1EYD A;  1WD1 A;  1KDC A;  3H09 A;  1E2Z A;  2ENB A;  2A6E D;  5C0X I;  4FO2 A;  3QG1 A;  1G91 A;  4HAE A;  5I4D A;  4U67 3;  2TSS A;  2F0I A;  1Y1V B;  3P75 A;  3M85 A;  3PUX A;  4JK1 C;  5FOB B;  3DUZ A;  3GV6 A;  4ZQ3 A;  3HG9 A;  5JJZ A;  3MAQ A;  2HCI A;  2PW7 A;  1U4L A;  5C5M A;  3OMG A;  3RUZ A;  2SNM A;  1F9S A;  3VA7 A;  1I4Q A;  5JPN C;  4BY1 B;  2JA5 B;  4UAI A;  1AN8 A;  5DM7 3;  2HDM A;  1WD0 A;  4PMW A;  5FO9 B;  4RCN A;  2A6H D;  1IW7 C;  2BA0 A;  1BCP D;  2J7Z A;  2K28 A;  4GZY C;  1GJX A;  3A7L A;  2NTS A;  2Y0S B;  3CQZ B;  1STA A;  3DWQ A;  2B2W C;  4RKL A;  1HA6 A;  2XNA C;  1JOO A;  4X3U A;  1F2Z A;  5KIX A;  1EYA A;  3H91 A;  1ILP A;  4ZUJ A;  4Y7N B;  2KA7 A;  4OIJ A;  4HCS A;  1U4R A;  3D6W A;  2ID0 A;  1PZJ D;  1I4X A;  3I70 A;  2F0K A;  1LTT D;  1PRT F;  5AFW A;  3PMF A;  1DOM A;  4FXD A;  4FXK C;  5I6W A;  4IFD J;  4HCE A;  2B2V C;  1ICW A;  1GUT A;  3HRZ C;  1HQM C;  1IYU A;  1BDO A;  1RDP D;  4HN7 A;  2L4N A;  2F0V A;  3MA2 B;  2RSO A;  3TZU A;  4QUC A;  2E75 C;  3Q6S A;  4KN4 C;  4C3H B;  4XXE A;  2K7V A;  3VR3 A;  3NTI A;  2RDF A;  4KD3 A;  2L9H A;  1Q1E A;  1STG A;  2DNC A;  1J9O A;  3PUV A;  1D5X C;  4OL7 A;  4FVM A;  3NK9 A;  2L1B A;  5J1Z A;  4A3E B;  1WTX A;  2K04 A;  4NMZ A;  3I8Z A;  4EGV A;  4A3K B;  1OXV A;  4HMI A;  2WII B;  5EBC A;  5KYI A;  5C0X J;  5JOB A;  5C4J B;  1SEB D;  3D4W A;  2Z4H A;  1EFI D;  4XQN A;  2M2L A;  4H44 C;  5A35 A;  2ICI A;  2G9D A;  4N9T A;  3KLR A;  1KAA A;  3I3C A;  4X3T A;  2O5J C;  4DXG A;  5D3D A;  5G3L D;  1WVL A;  2RDG A;  5JAV A;  4K14 A;  1AFP A;  2JA8 B;  3VYU A;  4XT1 B;  3DXJ C;  3DHQ A;  2AUJ D;  3GTG B;  2R3Z A;  1EU4 A;  5FLX E;  1ESF A;  2WV6 D;  2A73 B;  2NYZ D;  3S2H B;  2E2J B;  2PNR C;  3V96 A;  5I2X A;  2KQ3 A;  3OPO A;  4BS9 A;  1VF7 A;  1KDB A;  1DM0 B;  2IJ0 A;  4WOR A;  4Z9C B;  4DAY A;  3VR4 A;  4H7B A;  2NVQ B;  3S14 B;  5LHY 1;  3NP8 A;  3OMC A;  4ZKB B;  1LTI D;  1HXY D;  2WAQ B;  4L8J A;  1T5X D;  2QDB A;  1L0X B;  1RTO A;  1TQO A;  2OF1 A;  1BNZ A;  5FLX L;  2WAC A;  1TS3 A;  1ZYR C;  4OO1 I;  2K32 A;  1DCZ A;  1QCB D;  4X3K A;  2G9H D;  1ZXT A;  1TR5 A;  2F03 A;  1SYC A;  5C4H A;  2CW0 D;  1PLF A;  3TP6 A;  1Y8P B;  3HOY B;  2M9V A;  2NVY B;  1U4P A;  4C2M B;  4LMQ D;  1PZI D;  5IT9 E;  3QOL A;  4RA8 A;  1LTR D;  2KHS A;  3SE0 A;  1BQQ T;  4IQZ A;  4ULL A;  2N55 A;  3NQT A;  1CQV A;  1D1I A;  1FNV A;  3MXN A;  3CRL C;  3O13 A;  2DY8 A;  3K5L A;  1HUN A;  1SJE D;  2VB3 X;  1EQV A;  3I4M B;  2IT1 A;  1KNE A;  3SEB A;  2Z8L A;  1JQY D;  2XIW A;  2FMC A;  4FF3 A;  4MHE A;  1ROD A;  3DWP A;  1NUC A;  2WKC A;  4M8A A;  3CRK C;  2B2W A;  2KJX A;  2F0T A;  1DXM A;  2L0C A;  1V1P B;  5IOC A;  1DJR D;  3E0J A;  1RTN A;  5CV6 A;  1ET9 A;  4FP5 D;  3C1E A;  3D8G A;  3TSS A;  3KK7 A;  3I90 A;  3NTH A;  1LT6 D;  1K8M A;  4DAV A;  3KLS X;  1F77 A;  3D6C A;  2F0E A;  3R2I A;  3TME A;  2OEO A;  1PRT B;  1BBX C;  3N52 A;  1SNO A;  2E74 C;  3N6R A;  3PO2 B;  3GTM B;  2MJ8 A;  2FIN B;  5C3E B;  3G7L A;  2XWB B;  3OWF A;  3T16 A;  1MD2 D;  2B2T C;  3MEH A;  3R2T A;  3URY A;  2N88 A;  2NUC A;  3AU7 A;  3L3O C;  5E4X A;  1VDZ A;  3KBX A;  3X3M A;  2B63 B;  1KDA A;  3ERO A;  1K83 B;  3QWN A;  2C9O A;  4PMB A;  4G57 A;  2F0S A;  3R8B A;  5EQ0 A;  2JYO A;  5C0X G;  3P20 A;  1CZG A;  4P2C B;  3VYR A;  1WTW A;  1G6Z A;  3L7Z C;  2F0U A;  5I9P A;  2QEJ C;  3SK4 A;  1VCI A;  5DM6 3;  2Q8R E;  2EE1 A;  3A56 A;  4KV6 A;  3MWY W;  1SMY D;  2D2C C;  2R61 A;  4DXF A;  3K5M A;  4ZRZ A;  1STY A;  1B9M A;  3VA5 A;  1H9M A;  5I9O A;  4OO1 H;  1JWM D;  2HQE A;  1HUM A;  4ZLT F;  1QNK A;  1PRT D;  4KKU A;  1I3Q B;  1LTB D;  4BBS B;  3ONA B;  2EYF A;  5ELB A;  4NW2 A;  1M8A A;  1X3P A;  3PV0 A;  1GUO A;  2SOB A;  4QB4 A;  5IGE A;  4QUF A;  1C48 A;  4WFN 3;  1G2T A;  1JC7 A;  2HUG A;  1NSN S;  3QOJ A;  2MUY A;  2LKV A;  4B08 A;  4CKB A;  3IFD A;  3A7A B;  1R4Q B;  4IFD I;  2DN8 A;  1BCP F;  1O7Y A;  1WCM B;  1D5M C;  4RKB A;  3HOW B;  5ISR A;  2NVX B;  1JE4 A;  1TVX A;  3E6Z X;  2WB1 B;  3RLF A;  2XSC A;  2AWO A;  2EDG A;  3GTK B;  5COR A;  4ZYS A;  4IUR A;  1ILQ A;  5T1G A;  1A15 A;  2IWH A;  4PMC A;  4TSS A;  1EIH A;  5EKK A;  3GTL B;  1CZW A;  4KD4 A;  3MTS A;  3J7Y W;  2X69 A;  2JSO A;  1XXG A;  4QF4 A;  1H9R A;  3DMU A;  2FMM A;  5KNB A;  4WRD A;  3GO5 A;  3W2D A;  2EJG C;  4CBV A;  4QMG A;  1TT2 A;  1PYW D;  3RZO B;  3NWS A;  3WOE A;  5E4W C;  1Z7T A;  3H3V C;  1ENC A;  1LO5 D;  3VYS A;  1SYF A;  5CV8 A;  3T51 B;  4HED A;  3S1N B;  5CBE E;  3BVG A;  2BDN A;  4A3M B;  2CVR A;  5KYL A;  1AZP A;  3BS1 A;  2KED A;  1GOZ A;  5ELD A;  3FRP B;  3BDL A;  1CQF A;  3V2T A;  4S3S A;  2WIN B;  4R8I A;  2BOS A;  4HSP A;  2NBF A;  4RFB A;  2GA4 B;  4MN3 A;  1IKL A;  1AP0 A;  1E2W A;  3FDT A;  1B44 D;  4KN7 C;  4FYD A;  4FNF A;  2KUM A;  1GHK A;  4DF7 A;  3K6O A;  1DOK A;  1MGS A;  4J8Q A;  1RF2 D;  2BDO A;  1JOK A;  4A3B B;  1FGB D;  1UAP A;  3KF8 A;  4BA1 I;  1SJH D;  3I72 A;  3D3R A;  4ODG A;  1KTK A;  3OWE B;  1M4V A;  2CQA A;  3K0Y A;  2M00 A;  5FO8 B;  4CKC A;  1UNS A;  1GUS A;  2JP1 A;  5EKL A;  4R9W A;  1Z47 A;  1TWF B;  1V1O A;  1CI3 M;  2PZT A;  3HGB A;  3HKZ B;  4K5W A;  1T5E A;  4RGN A;  1GHJ A;  2B2U A;  2AWN A;  2R93 B;  3MC0 B;  1SE4 A;  2K03 A;  4KTA A;  4LAA A;  2A69 D;  2X6G A;  5EJW A;  5ELE A;  1WTQ A;  4DAP A;  1B9N A;  4KHZ A;  4CJ2 C;  2EYO A;  3EJI A;  3T13 A;  1V1P A;  5BN3 A;  5CBA E;  2F4I A;  2FJ2 A;  3NXW A;  1F9P A;  1HA5 A;  4IUQ A;  3I91 A;  1EY9 A;  1ENF A;  1ZKO A;  5D14 A;  4ZK9 B;  2O2L D;  3FPU B;  3J81 L;  4OHJ A;  1STH A;  4XYQ A;  4DGZ A;  2XWJ B;  5DNF A;  2I46 A;  1O78 A;  1CA5 A;  1WTO A;  5C0X H;  3Q0A A;  5EPJ A;  1J8I A;  2A5H A;  4TRD A;  2DNE A;  4KK7 A;  2HCC A;  1Y8N B;  4M1U B;  1TU2 B;  5D3I B;  1I4H A;  2ZXR A;  5DEH A;  1TWA B;  5M3M B;  2RBM A;  1BF4 A;  2C5C A;  4K2K A;  2PCF B;  1YNN D;  2PPB C;  1OXX K;  1KLG D;  3K7A B;  4KMU C;  4B9W A;  1E0B A;  1NR2 A;  2JA6 B;  3H6M A;  3MHB A;  5EBD A;  1EZ8 A;  1SFO B;  4CGY B;  1LAC A;  4JBW A;  1PFB A;  2JXM B;  4IUV A;  1OXT A;  5E3F A;  1TWH B;  2BE5 D;  3HOV B;  3S1M B;  2A68 C;  4A3F B;  2IL8 A;  5LL6 S;  3J7A V;  4IFD H;  3HOZ B;  5KNC A;  1V43 A;  3HS0 C;  2D5D A;  4RCO A;  3UI2 A;  1ML0 D;  1O7L A;  3L9A X;  1FD7 D;  1LLR D;  2LFN A;  1A3T A;  1AEX A;  3P1H A;  4IUN A;  3OIP A;  4NDX A;  2PZU A;  2EVB A;  3SK6 A;  2VXW A;  4G7H C;  1R4P B;  3D31 A;  5IGC A;  3NWT A;  3SVM A;  3OIQ A;  2B2Y A;  5M5W B;  2NZ1 D;  5EGT A;  5EPL A;  1XX8 A;  4A3D B;  1Y8O B;  2AQ2 B;  4RGO S;  1ENA A;  4H0L C;  2YU9 B;  2QF7 A;  4CKE A;  1II3 A;  1B1Z A;  5FK9 C;  2PW5 A;  4K6D A;  2F1M A;  3ERQ A;  2R7Z B;  2RSN A;  2JE6 I;  4A3J B;  1H9S B;  5IIF A;  2JEA I;  3FVQ A;  4H13 C;  3K59 A;  1HFG A;  5IGF A;  1XYI A;  2F0M A;  2KEC A;  4XTC S;  2B2Y C;  4K8J A;  1IHZ A;  2EYL A;  4J6H A;  3J7A F;  4DFA A;  1E2V A;  2EY5 A;  1BXT A;  1JWS D;  2K33 A;  1RKN A;  5NUC A;  1HHV A;  2LS0 1;  2EPB A;  4KKS A;  1Y1W B;  3HP3 A;  4G7Z C;  4CJ1 B;  5CV5 A;  3K58 A;  5HGT A;  1SBB B;  1X32 A;  5EKI A;  1IKM A;  1B2T A;  5K36 G;  3MXG A;  3S15 B;  4EQO A;  5KRU A;  4CJ0 B;  1PTO F;  4KY7 A;  5BN4 A;  1Q90 A;  1C8C A;  1CA6 A;  3RMH A;  2IX1 A;  1HPC A;  2K5D A;  1YNJ D;  4RAU C;  4IUP A;  2TMP A;  1TWG B;  4C3I G;  1QIL A;  1U9R A;  3GTQ B;  4RHS A;  3M7G A;  1ET6 A;  4Q0F A;  1H9J A;  1PXU A;  3MFY A;  5IGG A;  3S2D B;  1BCP C;  3W3A A;  1ONL A;  3SDZ A;  1O7Z A;  2NN6 G;  5E1F A;  2ZXP A;  2F0F A;  4ZAI A;  3A8I E;  4XIG S;  1G29 1;  1PTO H;  2VNU D;  2WP8 J;  1BOS A;  5TSS A;  5DAU A;  3K57 A;  2Q8I B;  1O80 A;  1I4G A;  3U9S A;  2EYP A;  1OXU A;  2B8F A;  2ICE C;  1STB A;  2HDL A;  1WTV A;  4U68 A;  4KJO A;  2E2I B;  5KEE A;  5CMD A;  3IL8 A;  1EIG A;  1Q8I A;  3J80 L;  1VMP A;  3EQL C;  4BWG B;  1BO0 A;  1V8Q A;  4K8I A;  4I7Z C;  4HSV A;  2KVM A;  3GQB A;  5ELF A;  5JEA G;  2BE5 C;  3DEO A;  2NB0 A;  3D4R A;  1HCZ A;  4O42 A;  1HFN A;  2EJF C;  3CKI B;  3S1R B;  1F2M A;  1SSO A;  1EEF D;  4ZUI A;  2F0N A;  1MSH A;  4IUT A;  4C1N I;  2PQE A;  5I2Y A;  1I50 B;  3EVQ A;  2RDH A;  1A2T A;  1B4O A;  4IN3 A;  3RZD B;  3PO3 B;  5C44 B;  1Q3L A;  1EWC A;  2O5I C;  1EEI D;  4V0B A;  1PZK D;  3GTP B;  1A6X A;  2A68 D;  1RCV D;  4KY6 A;  1EZ6 A;  4C1N K;  4FF1 A;  3S16 B;  1EY0 A;  4B9X A;  4K2L A;  3PIO 3;  1ESR A;  2FHT A;  1MBY A;  2KCC A;  1KLU D;  1I4P A;  2KOL A;  3TP7 A;  5I6Y A;  1TY0 A;  3ND8 A;  4HMJ A;  2DY7 A;  3SR1 A;  4KHV A;  2Z1C A;  4E6I A;  3TDQ A;  1JOR A;  2A6E C;  1B3A A;  2VB2 X;  3MXU A;  2F0W A;  4XT3 B;  2H4O A;  2EXZ A;  1GUG A;  1W6K A;  3Q24 A;  1SAP A;  4V19 0;  3GP7 A;  3R3O A;  3MFG A;  1QNU A;  1JOQ A;  4XDX A;  1STE A;  3M4O B;  4Q5V A;  4C3I B;  1R9T B;  2Z4I A;  4F88 A;  3BVZ A;  3SXH A;  1WTP A;  3HZX A;  3P7J A;  2EYJ A;  1HTP A;  3LWU A;  1BCP B;  4CHT B;  1DOL A;  1TWC B;  2JEB I;  5K5P A;  1D6E C;  3Q23 A;  3VR2 A;  1NR4 A;  1BR9 A;  3KUP A;  3MXP A;  2F0J A;  4DK1 A;  1SNM A;  5JEA H;  1EY5 A;  1RHP A;  5IGD A;  1EY7 A;  2LMC B;  1Q12 A;  3I4L A;  5FO7 B;  5C5L A;  2SEB D;  4RWS C;  1SDF A;  1PMR A;  4FF2 A;  3A55 A;  3OOC A;  1FNW A;  4C3J G;  1PTO D;  3PUW A;  3S1Q B;  5BN5 A;  5M5Y B;  2QCP X;  1OO9 B;  3BZD B;  3M3Y B;  1QG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...