2B8FA

Solution structure of bacillus subtilis blap apo form (energy minimized mean structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin/Lipoyl Attachment Protein
publication title solution structure of Bacillus subtilis BLAP Apo form (energy minimized mean structure)
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b8fA00
4KN7C 5JEAH 1GHJA 4LJZC 2ZT9C 1EWHA 2NN6I 3M4YA 1IW7D 3MXUA 3N6RA 4KHZA 3SDZA 3TZUA 3OOCA 1YNJC 1H9SA 2A6HC 2A6ED 1DXMA 1K8OA 4LK1C 2DNCA 3IFTA 1E2WA 3NE5B 5K36G 1IYVA 1DD2A 3OW7A 1ZKOA 2BA0A 2R6GA 3I73A 4DNRB 5KNBA 1Z7TA 2NN6G 3A8IE 2EVBA 2O5IC 1Q1EA 1IYUA 1V43A 3WDNA 1OXTA 5C0XH 1FYCA 2JEBI 4GZYC 1E2VA 1GUNA 4H13C 3A7AB 1T5EA 3VA7A 1Q1BA 3KLRA 3HGBA 1BDOA 3A7LA 1H9SB 2D2CC 1Y69U 3QG1A 3VR6A 3VR5A 4KKUA 2BA1A 2DN8A 3PV0A 4XIGS 4G7ZC 3VR4A 4H44C 3LWUA 1VF5C 1VDZA 2KCCA 4BA1I 1IW7C 2DNEA 1CFMA 4PV1C 1V8QA 2A6EC 1Z6HA 2F1MA 3A8JE 1GUTA 4KMUC 1OXSC 4DK1A 1VCIA 4IFDG 1ONLA 3T51B 3M7NA 4IQZA 1OXUA 5JEAG 1TU2B 3IKJA 1CI3M 4JBWA 1E2ZA 4OO1H 3D4RA 2CW0C 3EQLC 2A69D 3BDOA 2BE5D 4JK1C 4H0LC 2LMCB 2JE6I 1GUGA 2PNRC 4G7OC 1Y8OB 4TQUS 1LABA 2YYZA 4XTCS 2D5DA 2QF7A 2E75C 4TKOB 1HCZA 1GUSA 2PCFB 3ND9A 1I6VC 3T53B 1GJXA 1B9NA 3BG3A 3FMCA 3PUYA 1FR3A 4BA2I 1G291 3PUXA 4DK0A 4KKSA 5BN3A 4OGQC 5C0XG 3M85A 2K7VA 4I7ZC 1K8MA 1LACA 3I72A 3VR2A 3PUZA 3OPOA 1GUOA 1Q90A 3PUWA 3D31A 1PMRA 3P20A 2K33A 1H9MA 5BN5A 1B9MA 1ZYRC 5KNDA 5K36H 2V4DA 2K32A 3GD7A 3GQBA 3VR3A 2JEAI 4IFDH 1H9KA 1TKWB 3DXJC 2IT1A 2A68D 1H9JA 2NN6H 2BE5C 1DCZA 1OXXK 2JXMB 3CRKC 2E76C 3H94A 2AUKA 4L8JA 4KN4C 4DNTB 1VF7A 1O78A 1Q12A 2A6HD 4HR7B 5BN4A 1YNNC 3W3AA 4KI0A 2EJGC 1Y8PB 3ND8A 3QIAA 3I4LA 3L7ZC 2AUJD 4G7HC 3AB9A 5A35A 4RCNA 5KNCA 4KKTA 4OO1G 3MFYA 1A6XA 3A8KE 3QJYA 1HPCA 2BDOA 3RLFA 2O5JC 1SMYC 1QJOA 1HTPA 1CTMA 2EJFC 2B8GA 2B8FA 2EJMA 2KA7A 3PUVA 2AWOA 1OXVA 3LNNA 2Q8IB 1H9RA 2E74C 3U9SA 3T56B 1O7LA 3CRLC 2EDGA 2L5TA 3FPPA 1GHKA 2PPBC 2A69C 1HQMC 2D62A 3SE0A 1Y8NB 2A68C
chains in the Genus database with same CATH superfamily
1SJED 4PZ7A 2K5VA 4KHZA 3JAMi 5CBEE 1BCPB 5C4XB 1NSNS 1VQMA 3OTOL 4LF4Q 1STBA 1IBKL 3MVVA 1CQVA 1FNWA 2PI2A 3J81j 1IL2A 2RDFA 3DWQA 2C5CA 3I3CA 3TS2A 4J1MA 1VQLA 2CW0D 2R93H 2K04A 3T1HL 3CCEA 2WV6D 5IYCG 1M8AA 1TT2A 4DR5Q 3PO2B 2UUCQ 4C3JB 1D5ZC 1WTRA 3S1NH 4G7ZC 3KLSX 3U4VA 2K01A 1GO3E 4DU9A 3TEHB 3L2PA 1X3PA 2KCCA 1SNOA 4DV1Q 1EQRA 4PV1C 3ICEA 3Q22A 4ZQ3A 5IGBA 4A3FH 2K50A 4X64L 2VQFL 1G6PA 3J81c 1JJGA 3BDCA 4HCEA 2E2HH 3K80C 2ZM6L 4NXNQ 3KF6B 3F2CA 4JK1C 4H0LC 1X9NA 1MSHA 1STHA 1ESFA 1LABA 2YYZA 4A3EB 3G4SA 1SFOB 1F9PA 1GJXA 3Q0AA 1D8LA 3KLWA 2PZUA 5C3WA 1XPUA 5IP7G 1NCVA 2R92G 4LF5Q 3P1HA 4DGZA 4QIWB 3CQZB 4MN3A 2JA5H 1BUVT 3RR5A 4AIMA 3S1RB 1B9MA 3E9HA 3GQBA 3HKSA 2Z1CA 1L1OC 1OXXK 4LFAL 1HRJA 5ELNA 1O78A 4LAAA 3TP8A 2BOSA 4IUPA 3PF5A 4HJ8A 1TQOA 4LW1A 5CGKA 3HS0C 2IW3A 1MD2D 2LXJA 2F0QA 1TWCB 4DR1L 2RF4A 5F2DA 4FF1A 2OQKA 1EIYB 4Z9CB 1H9RA 1STAA 5FK9C 3AYHB 3HP3A 3T1YQ 3K6OA 2RSNA 4YY3L 4BBSH 1S5ED 1UE5A 2A69C 5JJKA 2MJ8A 4IFDI 1LTAD 2ZTCA 5JEAH 3G6EA 3F2BA 3MC0B 3SDZA 4RKBA 1RKNA 3OOCA 2OF1A 2NB0A 4LF6L 4YCWA 4KK7A 2B63B 1IYVA 1Y1VH 4JI6L 1VQ7A 3N52A 4JCVE 3A56A 2HIXA 4A3GH 3CD6A 3S17H 1I6HB 1E2VA 5C0XI 4H13C 1EY7A 4F8MA 2RDHA 3VR6A 4A4IA 1TWGB 4DR3L 2DGYA 3FHWA 1VQPA 4DV3L 3K7AB 4GKKQ 4GOPC 1PDQA 1QUQA 2EY2A 5DAUA 1EL0A 3Q24A 1EU4A 1I4RA 1OXSC 2WKCA 4OELB 3BZKA 2KCNA 2R3ZA 5M5WB 4K5WA 2MO0A 1LM0A 3CMEA 3F1ZA 3CCQA 3CCUA 2I0QA 1VQGA 3D6CA 1PZKD 2A8VA 2BCOA 5M3MB 3BZDB 3PMFA 2NVTH 4C3IG 3CCLA 2R7ZG 1B9NA 4QIWE 4R4QA 5FLXc 5CV9A 1B53A 5E3FA 4ZRZA 2B2UA 3CU7A 4JC0A 3H0GB 3PO3G 1SNPA 1SSOA 1VQCA 5C44B 1LT5D 3I70A 4ILWA 3IFDA 4LMQD 3QWNA 4POGA 3GTQH 5KNDA 1O7ZA 4UP9A 3DXJC 2PQAA 1KTKA 2JXMB 4L8JA 1UE1A 4DV6Q 1C9OA 2WACA 3TBIB 2E5LQ 1HUMA 1L2FA 4DV7Q 1DGSA 4KY7A 3W1GA 2HHHL 4G7HC 4OO1G 2JA9A 1C8CA 4KHPQ 1JE4A 3DMUA 1HTPA 5BR8Q 1YJNA 5D14A 4DK3C 1QVFA 2C9OA 3OYYA 1QOHA 3OTOQ 4BBRH 1O7IA 1IBKQ 1KC8C 3P7JA 2EIFA 2KBNA 1GXDC 1E1TA 3CCJA 2PO4A 1E2WA 1EIGA 3T1HQ 5T1IA 1O80A 4A3BH 1Z7TA 4TRDA 1EZ8A 2NVYH 3HOXB 4DV0L 4R8IA 3MZ5A 2RDGA 4UDUC 4YWKA 4QY7A 1Y69U 3HRZC 4X64Q 1DONA 1VQ9A 2VQFQ 4IALA 5M3FB 2DNEA 2ZM6Q 3NHHA 3E0JA 3NWSA 2F3IA 4KTAA 3KF8A 4FVMA 2L11A 4MNOA 1IL8A 3K7UC 2UXCL 1JWMD 1XXGA 3H3VI 3S14B 2PW5A 2AKWB 4PG3A 4L5QA 3RZDH 2VNUD 5JPNC 2JE6I 1WOCA 1SXTA 4RFBA 1TWHH 1HCZA 2ZJQA 4O42A 3PUYA 4ODGA 2K14A 3C46A 3MXNA 1GD7A 3A5ZB 2FXQA 3PUXA 3HOYH 1S4ZA 2RHSB 5J1ZA 1QNKA 3E9IA 4FF2A 1JR0D 5EGTA 2Q8TA 1OTCA 4A3LH 3VYRA 1C4QA 3PUZA 4RAUC 1A3UA 2JA8G 4LFAQ 3C1EA 3K5OA 4KJOA 1A2TA 4A3MH 2F0IA 2MNAA 5NUCA 3ERQA 4IPCA 2Z9HA 3GV3A 5FO9B 3NTKA 2JEAI 2IT1A 2HQEA 1GM5A 4QB4A 4AYBE 3TP5A 1WCMH 1VQIA 3CRKC 3VYUA 3EROA 4ME3A 1NE3A 3QR8A 2ZXRA 3K5MA 4A3IG 4DR1Q 3K0XA 3HOUH 5E4XA 2H1EA 3MFYA 3BVZA 1B3QA 4L5TA 3HOZB 4YY3Q 1EIHA 4WFN3 2B29A 4ZAIA 2K5QA 2IHEA 2QGQA 3J80c 1VQJA 2NZ1D 3D0FA 4IPGA 1K73C 2PPBC 1GHJA 1CHPD 1NR4A 4LF6Q 4DR2L 2MGSA 5IWAL 4JI6Q 2NZHA 4IN3A 5J3BA 3FKIB 1TWFH 2CFMA 5G3LF 2GVAA 4K0KL 3NELA 4FF3A 1EEFD 5IGGA 4F87A 4JI1L 1SE8A 3HOWH 2EXZA 2ICIA 1LLRD 2L55A 4QUCA 1PVOA 2BDNA 2NN6G 1SJHD 1IYUA 2VUMH 1W2BA 5C4ZA 2L12A 5KIXA 5FLMH 4DR3Q 4DV3Q 1NMFA 2Z6BA 3M4OH 1IXRA 1I94L 2ZXPA 3B6YA 3HGBA 3I2ZA 3S2HH 3GTKH 1CZGA 4F88A 2WB1E 1CHQD 2DJFC 1SYFA 1ILPA 5IYBG 1IW7C 4ZLTF 4BY1B 1SR3A 2HT1A 1II3A 5ISRA 3JAME 4ZUJA 1PTOF 1GUTA 4HIKA 1EOTA 4HJ9A 1Q46A 2B2UC 1ONLA 4DR4L 4A3CH 1WCMG 4X3SA 3PO2G 4HJ5A 3NEMA 1I5FA 4C3JG 1XPOA 3GTOB 1PH9A 3I4NB 5KYIA 3T53B 1HTLD 5D3DA 1KHIA 2M2LA 1F9SA 2VQEL 4B3TL 4TSSA 2A74C 4B3ML 4I7ZC 2IWHA 5EPJA 4Y52H 1C48A 2HIVA 1X55A 4FXGC 3EFXD 2VS1A 1SAPA 5JOBA 4GOPB 5K36H 4A3EG 2GA4B 2F3WA 4K8JA 3OMCA 4FF4A 5ELEA 3H94A 4CJ0B 2HHHQ 1SMXA 3KBGA 1U4RA 2L9HA 3EIVA 3NBHA 5AFWA 1ILQA 2JYOA 4TVAB 4CDDC 2WAQE 2VUMG 2MUYA 1J5EL 4LFBL 3I7FA 2CH4A 2QW7A 2AWOA 2KHSA 3EVQA 1OXVA 1V1PB 1K3BC 2H5XA 1K0SA 3M4PA 5CV4A 3U9SA 3Q23A 4J15A 4NXML 2OXPA 3MHBA 1CKMA 2WIIB 1J9OA 1NMGA 1KDCA 4DXFA 1YBYA 3S1QH 5M5YB 2NN6I 1IW7D 2SNMA 4EGVA 4NKLA 4DV0Q 1ENFA 5KYLA 3Q8DA 2O5IC 1RD9D 1X3EA 2ZTDA 1GUNA 1HQRD 2WFWA 3K0YA 1FGBD 4N8FA 4X65L 1Q1BA 3GTLH 2G5DA 4BS9A 5GQOA 2D2CC 5GAGC 3K5LA 2B63G 2HDMA 5IE8A 1ZXTA 4J8QA 2UXCQ 5JVG3 1VQ8A 2QEJC 4A3JB 3KOJA 2DJGC 2CHBD 5EJWA 1HJPA 1JJ2A 3T51B 1FGUA 1VQNA 1S5CD 1WTVA 4C2MH 3D4RA 2OQ0A 3GV6A 3H91A 1WTXA 3FVQA 4MTNA 1VQOA 2E2DC 2E75C 5ELOA 1GUSA 1W6JA 5I4DA 3S1MH 1T9HA 3NSWA 1BCPF 1U0LA 2NYZD 4EX5A 1G291 2D9UA 1E3PA 4L5RC 4V0BA 4K2KA 1AZQA 3I55A 1SROA 2D0PA 4XQNA 2F0LA 1XTCD 5M3MG 5IT9E 2L4NA 1E22A 1I4XA 1ZYRC 4KJNA 4X3KA 4LFCL 5CMDA 4IFDH 4C56C 3HKZE 2E2JH 2RCFA 3TMEA 3GDEA 1H95A 3H0GG 5C44G 3W3AA 2AWNA 1UUPA 5IYCH 3ND8A 4C1NI 1KDAA 4K5VA 1K83H 2R61A 4OL7A 2UXBL 4BY7B 1HHVA 1STEA 4RHRA 4IZ8A 2O5JC 3FPUB 5I6WA 3PQIA 1LUZA 2NVQB 1KXLA 4L6TB 4KY5A 4DR2Q 4IOAA 5IWAQ 1VQBA 2Z6KA 4DXGA 2OWOA 1EWIA 4DUZL 4A93B 3OWEB 4YWMA 4K0KQ 3E0EA 1XMOL 1Y1WB 2B2TC 1JE5A 4KN7C 4JI1Q 3J7A5 4A3KB 4YCUA 2GN5A 1QVGA 5FOBB 1PH5A 3MEFA 4FNFA 4UAIA 4HIDA 1DD2A 4HAEA 1MJCA 2NVYB 3DM3A 4A3DB 1RTOA 2E8GA 1I94Q 1TXYA 4BXXG 4K8IA 1OXTA 1X3QA 4DPGA 1O7YA 3OIQA 1I3QH 1UEAB 2PYKA 5IP7H 3CKIB 2R92H 5CR3A 2F0HA 2PI2E 3I8ZA 1U9RA 3FDTA 4R4IA 3KDFB 5IGFA 4XIGS 1VS0A 3VR4A 3H6MA 4QF4A 3JAML 3GTMH 4DR4Q 1CT1D 2F0EA 3AFPA 1V8QA 3CC7A 3CPFA 2HDLA 3SGIA 3HOXG 4IFDG 4KHVA 3PIOA 2XGTA 1ZYRD 1TU2B 5CYUA 5C3EB 2K75A 3C2PA 3CCSA 2ES2A 4IUUA 3WWVA 4DV2L 1EYGA 2JA7B 4JG2A 2VQEQ 5M3FG 4JPBW 4B3TQ 1QUQB 4B3MQ 3G6JB 3RD4A 4P75A 3NWTA 3QO2A 1Q7YC 3PIPA 1BOSA 2FMCA 4KKSA 5C0XG 2F4VL 2Z0SA 1PH1A 1HH2P 2NZOA 2A19A 2FJ2A 3D31A 1ASZA 3S15H 5IODA 1N33L 2F0NA 4XT1B 2E76C 1JOOA 1G8ZD 4OWTB 3CC4A 2A73B 3DUZA 1EU3A 1J5EQ 4GLAC 4LFBQ 4HN7A 1B7YB 2KECA 5COYA 1MHWC 3UDIA 3I4MB 2FFKB 5KNCA 1BBUA 1K9MC 2BDOA 2EY5A 5IGEA 4RGTA 1ZEQX 4NXMQ 1QZHA 4RGMA 4DAYA 1EFID 2TSSA 2PQAB 4DA2A 4QL5A 1FVIA 2RSOA 5J39A 2OT2A 1S40A 2KHJA 2HD3A 4C3HH 3MXUA 3TZUA 1VQHA 2NTSA 1QZGA 2EYLA 1STNA 3HOZG 1FL0A 1VQAA 2IHFA 4R4CA 4UY8C 5GAEC 1ZKOA 3TN2A 4C3IH 2R7ZH 2KQ3A 1I4HA 4X65Q 4JI4L 4H7BA 2F0SA 1FNUA 4N8X1 2HCIA 3H3VH 1QWYA 3SXHA 3GTPH 5IYDH 3PO3H 2JEBI 3FKIG 3M3YB 3NK9A 3BYYB 4IPHA 3VR5A 1VF5C 2F03A 3M9BA 1JWSD 4IJHA 1R9TH 1Z6HA 2X6GA 3RZOB 1VCIA 3JAMc 1X65A 3I4OA 1D6EC 3NXWA 1NJIC 1UWVA 3GTGH 4JI7L 4HIOA 2BH2A 4J6HA 3AQQA 4LF9L 2VY3A 2JQOA 1EY4A 1E2ZA 4OO1H 1WYDA 2F0GA 1T5XD 5M5XB 1NNXA 1HNWL 3X3MA 2QCPX 3CCMA 1JMCA 5CV8A 4BY1G 2FMMA 2I5LX 1I6VC 2NUCA 3SVMA 2HUGA 1GUWA 4BA2I 4YCVA 3EBEA 1PRTC 4CDCC 1N32L 2XSCA 4LFCQ 4AQYL 1BR9A 3RLNA 5A2QE 5IT9L 1TY2A 1MI2A 1PTOH 4ULLA 3S16H 1R4QB 1YITA 3I4NG 4C3HG 4DAMA 1TWAB 2V4DA 5JEAJ 1HZAA 1GKHA 4ID6A 2Q2IA 3MXNB 2UXBQ 2Z6KC 4GNXA 2E2IH 5FJ8G 4XQJA 3CMAA 1MKHA 2J7ZA 1V1OA 1JOQA 4JI3L 4YWLA 3PCOB 1Q81C 3QIAA 3L7ZC 2AUJD 2NVXH 1I4QA 3AB9A 5IYDG 1WVLA 1X3GA 1HPCA 4RWSC 1SMYC 3G48A 3HOVB 2EE1A 4DUZQ 1CSQA 1IBML 1XMOQ 2PNHA 5D65A 1VQDA 4CKBA 1PZJD 3OHXC 5EBCA 2DY7A 1D5XC 2EDGA 2WP8J 1KRSA 5C4JB 3KF6A 3S2DH 5KEEA 3M4YA 1HUNA 1VQ5A 3ZJYC 5EKLA 2OTLA 4AYBB 4RHSA 2F4IA 3NE5B 4QQBX 4CHTB 4QUFA 1DOLA 1G6ZA 1S3OA 2N78A 2I07B 3WDNA 3SK6A 1EIFA 4OIJA 3AU7A 1AZPA 3O13A 4HJ7A 1LTLA 3V2TA 2NTTA 5IP9G 4NMZA 2RCNA 1I50H 2G9DA 2JA8H 1F2LA 2EZVA 2CCZA 4XT3B 1TR5A 5HGQA 1IYJB 1PRTD 4BA1I 3SHLA 2XN9C 2F1MA 1CM9A 1WTPA 3CP0A 4O2DA 3TP6A 4QCLA 2JA6B 4A3IH 4DV2Q 2Y0SG 4KLKA 3BZCA 2AQ1B 2VXWA 4CGYB 5JJZA 3S9WA 3W1BA 2PNRC 5I9PA 2KUMA 2F4VQ 4A3JG 3VYTA 3LWEA 2ENBA 1F2YA 1SYEA 4OGQC 1IKMA 1SMYD 2KEEA 4EQPA 2WB1B 1N33Q 2PQEA 1B50A 3I72A 4WJ4A 1ET6A 1E1OA 4N9TA 1EYCA 2AQ2B 3ZYYX 2K5WA 3P20A 4CKEA 5K5PA 4Y7NB 5BN5A 1HNXL 5GADC 3R2TA 5IT9c 1H9JA 2YU9H 2NN6H 2F0UA 2KJXA 5AJ3L 4Q5VA 3L3OC 1YNNC 1LT3D 4IO9A 3F2UA 4HEDA 5A35A 1CKOA 1P16A 3A8KE 5C4XH 1IBLL 1K8AC 5IYBH 2EJFC 2B8GA 1KL9A 2EJMA 1SEBD 1TS2A 4R9WA 1PTOD 3QOLA 3NBHB 3MA2B 1E0BA 1B3AA 3MFGA 1PYSB 3OW2A 3PO2H 4BY7G 4C3JH 3T4AC 4JI4Q 1EY5A 3GTJB 1AE3A 1VQEA 5KGUA 4HJAA 2CQOA 3S24A 1BKBA 1V43A 2WAQB 3T16A 4A93G 2EQSA 1FYCA 2JJQA 3FEWX 1Y1WG 3AEVA 4K5XA 4A3KG 3KLRA 2EYOA 2AQ3B 2F52A 5LHY1 2V1CC 3PV0A 4A3EH 1SFOH 5C5LA 4JI7Q 4BWGB 4LF9Q 4A3DG 2K1BA 1A8VA 1QB5D 1L1OB 3AMUA 2I5MX 1KQSA 4JBKA 3MTSA 5M9OA 1HNWQ 1YEZA 2R93B 1PH4A 1RJTA 3CQZH 1ASYA 4JBWA 4P2CB 1XJVA 3J7AF 3SK8A 3S1RH 3MWYW 2F0FA 1D1KA 4OXPA 4WORA 1JT8A 2QKIC 3S1NB 1SRUA 2D5DA 1N32Q 5IOCA 4Q0FA 1YNND 1STGA 4AQYQ 5C4XG 4I7AA 2LY7A 2JSOA 1HFGA 4A3FB 4GNXC 5A2QL 1EQVA 4M8AA 3NTIA 3STBC 1XYIA 4APVA 2E2HB 4XYQA 3S15B 3ITPA 1LO5D 1PLFA 1LT4D 2SDFA 1TWCH 5I2YA 1MIUA 1R4PB 2JA7G 1SE4A 3RN2A 1S5DD 4JI3Q 5JAVA 4DUYQ 4RG1A 1ESRA 4CJ2C 3R3OA 1KRTA 1HZBA 2EJGC 1SDFA 2EPBA 4GN5A 1IBMQ 3L9AX 4EQ5A 3FRPB 4RCNA 2EXDA 2LS01 4KKTA 4JYAL 1N36L 1PFSA 2JA5B 3KFUA 3WOEA 2B63H 5EAYA 3QB3A 1RTNA 1QJOA 2F0VA 2K05A 2KENA 2KA7A 1NY4A 3ONAB 4DR6L 2IY5B 3I91A 2Q8IB 1L0XB 1PHJA 1I6HH 1JJCB 1RL2A 3FPPA 5C3XA 4DF7A 1YI2A 4G57A 1F2ZA 2RKSA 1EOVA 4R4TA 1EQQA 4JI0Q 2B2VA 4OX9L 3I4MG 1XTDA 1H9SA 1TWGH 3JC66 2VZAA 3K7AH 3HKZB 5EKIA 1QE6A 2PMZE 1D7QA 4I65A 3CAMA 5JJLA 5CORA 1WI5A 1BCPD 1Q1EA 1ICWA 4XDXA 1D1IA 5CV6A 5M5WH 2A5HA 4BBSB 2DUDA 1WD0A 5LMUL 2JP1A 1BDOA 3A7LA 3C3LA 4GKJL 5FLXE 5M3MH 1RCVD 2K5NA 4L5SA 4H44C 2ZJPA 1G51A 1VDZA 1AFPA 1Y1VB 3STBD 4G4KA 3PIO3 2HCCA 4ZCKA 2A1AA 4DK1A 1HR0L 4A3GB 3NUCA 3H0GH 4B3SL 3PF4A 1ICFB 1SE2A 5C44H 4PMWA 4IQZA 3S17B 1CI3M 4PMBA 1STYA 1DZ1A 2G9HD 1B2TA 1VMCA 4YHHL 1MGSA 2IL8A 3BJUA 1YZ6A 1GVPA 2PCFB 3OIPA 3RLOA 3CXCA 3PIP3 1F2MA 3NP8A 1LTRD 1SNCA 3DLLA 5JJIA 1PFNA 1FR3A 4NDXA 1VQ6A 3H15A 4QGUA 1HNXQ 1XNRL 1SNMA 3IL8A 4F7XA 1K8MA 5FO7B 5EQ0A 3VR2A 2B2WA 3NTHA 4GLXA 2CVRA 3OPOA 5AJ3Q 4LWCA 3EJIA 1H9KA 1TKWB 3I56A 2NVTB 5HURA 4KD3A 2X69A 5E7NA 4BXXH 4RGOS 1X6OA 1IHZA 1PZID 1AP0A 3K58A 3F2DA 2I46A 1Q12A 1IBLQ 5JVH3 1SYGA 1W3SA 2KOLA 3K8AA 4POFA 4GS3A 3QJYA 2XWBB 3A5UA 1HA6A 3RLFA 2ATWA 2IJ0A 2MFIA 3DM1A 1RODA 3RMHA 3U4ZA 1WTOA 4JOIA 3GTQB 1JORA 2OCEA 2E74C 3D4WA 3HOXH 3CPWA 5IIFA 4KY6A 5EPLA 4GLVB 2B2YA 4LJZC 2ZT9C 1EWHA 4CKCA 3Q6SA 4ZKCB 2EYMA 1PYBA 4LF7L 3V96A 3HOVG 4LK1C 2XWJB 4RGNA 5M3FH 4DAYB 1EZ6A 4HCSA 3E3XA 2K5HA 5KNBA 5LMNL 1PXUA 1TIID 1JC7A 3QOJA 5C0XH 1BO0A 4GZYC 1HZ9A 3S14H 2OEOA 3I90A 4BBRB 1JB7A 5ELFA 4OHJA 3W2DA 4AYBG 3DEPA 2GVBA 1SE3A 2TMPA 3TZDA 3LWUA 1YHAA 2Z4HA 3EN2A 4A3BB 2ASBA 4JI5L 4MHEA 1EY9A 4DAPA 3T13A 1PH7A 1PH8A 4PZ8A 4A76A 2LMCB 1V1PA 1GUGA 1WTHA 5E4WC 2Z8LA 4K14A 1YNJD 5FKAC 1RDPD 1QILA 2JA6G 2XRSD 2K7VA 2SOBA 1KDBA 3DHQA 1EY8A 1PV4A 1PMRA 3HOZH 3RZDB 1G2TA 1A15A 2SEBD 2K32A 5EPKA 2KCTA 3SEBA 1TWHB 2L1BA 4AH6A 4JBMA 4DNTB 4M1UB 4JYAQ 3AFQA 1KNAA 1N36Q 3HOYB 4HR7B 2SNSA 2WB1G 4FXKC 2F0KA 2L0CA 4EVOA 4P74A 1LTTD 1U4PA 3FKIH 4DR6Q 1BBWA 1F77A 2B2VC 5DLQE 1AW7A 2D0OA 2EY6A 5HGTA 3MAQA 2XIWA 4JI8L 4A3MB 1JOKA 1CK1A 5CV5A 5LL6S 1Q86C 1KLUD 3LNNA 4IUQA 3D3RA 4OX9Q 1KAWA 2F0OA 3ER0A 1WCMB 5DM73 4GNXB 4JI2L 1AE2A 2QDLA 2WINB 4FP5D 4RKLA 5H1SE 3V05A 5D3IB 3UE1A 3R8BA 5E1FA 3HOUB 2ZXOA 2LKVA 3DEOA 3NBIA 1K8OA 2DNCA 5KRUA 4U68A 1SYCA 2LSSA 4BY1H 3E5SA 3I73A 3RNUA 3K5NA 5LMUQ 4JV5L 3A8IE 2EVBA 3URYA 1F9RA 3HG9A 4GKJQ 4LF8L 2K6AA 2YV5A 1HA5A 4XQQA 2AHOB 4B08A 3VA7A 2OTJA 5FLXL 1PYWD 4RA8A 2UUBL 1EEID 4QJFA 3GTOH 1XWEA 1TWFB 1HR0Q 3I4NH 1K3RA 4B3SQ 2F0TA 3HOWB 1K8GA 3A8JE 2WAQG 3NENA 2KCMA 1X32A 5FJ8H 2VUMB 3GP7A 1KABA 2UXDL 1Q82C 1I4PA 1OXUA 4ME5A 5ELDA 4YHHQ 2MPMA 2KVMA 3M7GA 1CKNA 2PW7A 3M4OB 2Q8RE 2MO1A 1NR2A 2ID0A 3S2HB 2B2WC 3GO5A 1SNQA 1HNZL 3GTKB 1I4GA 4XTCS 1L0YB 1M90C 4TKOB 1XNRQ 2ZTEA 3HFZB 4OWXB 4P72A 3BG3A 4DFAA 1G91A 4PNYA 4DK0A 1VQ4A 1CUKA 2R93G 2IX3A 3FP9A 1EY6A 4P71A 1UE7A 4NB3A 3M85A 3OSOA 1HZCA 1LACA 1NAPA 2MHVA 1BF4A 4IPDA 4GN3B 1U4LA 5HY6A 4NPSA 1C0AA 3VYSA 4JOIC 1S5FD 1DCZA 3R2IA 1Q8IA 1SYBA 2IPKD 4A3FG 2Q2UA 3KK7A 4OWWB 1A3VA 1CQFA 2R7FA 5BN4A 2J0TD 3BVGA 4HMJA 4X62L 5IP9H 5M5YH 1E24A 3KDFA 4KD4A 2B2YC 2AMCB 4RMFA 2CQAA 3KF8B 3LX0A 1A6XA 1X54A 1WTQA 1RIPA 2B8FA 2M00A 5DEHA 2K5DA 1HR0W 3WOFA 4DAVA 1O7LA 3H3VC 4ZKBB 2XRQD 5T1GA 4LF7Q 1K28A 3A54A 1FNVA 3CHBD 2A68C 2F0WA 1N34L 1PH3A 3U58A 2XTIA 4HIMA 2EYPA 2JA5G 1LTSD 3RN5A 2A6HC 5LMNQ 1DXMA 4DUYL 2RA4A 1A0IA 3OW7A 4LNQA 3BU2A 4DNRB 4A3JH 3LGJA 4DR7L 5JPMC 5I2XA 3TS0A 2LXKA 4MZ9A 5EBDA 1YHBA 2N55A 3S1QB 2KEDA 4K6LA 4JI5Q 2VB3X 1XNQL 4KKUA 3CC2A 2DN8A 2R7DA 3HKZG 2EYJA 1CZWA 5L37A 1YIJA 2BH8A 2YTVA 3HZXA 1YNXA 1CFMA 3TQYA 1IZ6A 3UDXA 1PH6A 4JI0L 4CDEC 4V190 2Z4IA 3BS1A 5I6YA 4BBSG 3BVMA 3M7NA 2B3GA 3C1FA 2UUAL 2VL6A 1W6KA 5JEAG 4H02A 2QDBA 2CWPA 3GTLB 1NUCA 1JWUD 2A69D 2N49A 1UEBA 4PZ6A 2JK8A 1J8IA 4G7OC 4K2LA 1IKLA 1PTOC 4IUVA 4HSVA 3UI2A 1Y1VG 3MEHA 4C1NK 3ULPA 1FJGL 1TS4A 4L63B 1XMQL 3FMCA 1BNZA 4A3GG 4DV4L 2J4XA 4DN4M 1FD7D 4OONA 5LL6X 2N88A 5GROA 1X56A 4FDBA 4BY7H 3J80i 3J80L 4C2MB 1CA6A 2HQLA 1GUOA 4OEMB 1XPRA 2NBFA 2K33A 4DV5L 1N9WA 3J7ZC 4B3RL 5IGDA 2NVQH 3PGZA 1QCBD 1DM0B 1BQQT 1ML0D 2A68D 3S1MB 5LMNW 3W5OA 3MXPA 4A93H 1AN8A 2A6HD 1TS3A 1Y1WH 4DNIA 3NQTA 4KI0A 4JI8Q 1DOKA 4A3KH 1EWCA 4X6AH 3RUZA 1KLGD 3IAYA 4JI2Q 4PQXA 2RHQB 1BXTA 1CTMA 4A3DH 5G3LD 4HSPA 1SBBB 2E2JB 4HTHA 3D4DA 4QMGA 2L5TA 3U9OA 3SK4A 4IUNA 4JV5Q 1K83B 1WD1A 1EUJA 1Q8KA 1D2BA 1C7YA 4RH6A 2QEXA 5IGCA 5EKKA 4LF8Q 2B39A 1VQFA 1EYAA 2BA0A 1UE6A 3F8TA 1ET9A 4X3TA 3CCVA 1CSPA 2UUBQ 2H4OA 2YTYA 5I9OA 2Q2HA 2X6LA 2RQXA 5C3EH 4UPAA 1QVCA 1VMPA 4ZK9B 3SK5A 4R8NA 1H9SB 3EA6A 1P8LA 4OIKA 3A55A 1MJEA 3M4QA 2JA7H 3NPPA 2VW9A 2UXDQ 4GN4B 5TSSA 1J6QA 2WKDA 1AEXA 2XVSA 3VDYA 2A6EC 2EYFA 3J81E 1X3FA 1HNZQ 4FYDA 1I3QB 2R92B 1B44D 3G7LA 3IKJA 4BBRG 2C35B 4NW2A 1PRTF 2PMZB 4U673 4EQNA 3PSIA 4OO1I 1YHQA 1A62A 2QF7A 3ND9A 1Z9FA 4R1JA 4A3BG 3GTMB 2P5ZX 2FINB 4KV6A 3TRZA 2L15A 5BN3A 2F0JA 1RF2D 2CH4W 2F0DA 3IRBA 1KIXA 3I4MH 4IOCA 4ABNA 1UNSA 2UU9L 1BCPC 2NWGA 1EQTA 4X62Q 4RCOA 4UHVA 4X66L 3BDLA 2AUKA 1SLJA 3CCRA 1WFQA 2PZTA 1E7ZA 4MIUA 1A3TA 2F0PA 1JICA 2CKZB 4WJ3M 1B1ZA 1ENAA 3KLSA 5C5MA 2QA4A 5C3EG 1YJ9A 3J7AV 1V1QA 3A0JA 2MP1A 1QG7A 2B2TA 1N34Q 3KYHC 1SN8A 1N8RC 3HOYG 1VQKA 4K6DA 3K81C 3T56B 4UP7A 1GHKA 1HQMC 2QILA 1B8AA 3SE0A 1Y8NB 4A3LG 4LUOA 4UP8A 3M3YH 3P75A 3N6RA 4DR7Q 1GOZA 2A6ED 1V9PA 2VB2X 4A3MG 1G2SA 2EOTA 2R6GA 3K59A 3RZOH 3MXGA 2XNAC 5IY0A 5GAHC 1Y14B 2DY8A 2ICEC 1XNQQ 2Q2TA 5DM63 1A2UA 4LF4L 3A7AB 1T5EA 1PRTB 1WJJA 4C3HB 3HOUG 5M5XH 3QG1A 4IURA 4ZYSA 2FHTA 2ALYB 1RHPA 4ALPA 1PFMA 4DR5L 2UUAQ 5ELCA 4B9XA 4C3IB 2UUCL 2R7ZB 2F0MA 4S3SA 1SYDA 4WJWA 3GTPB 3PO3B 5C6AA 4DV1L 1DJRD 1FJGQ 3EQLC 5CV7A 3BDOA 1XMQQ 2LFNA 1BBXC 4O1NA 4CDFC 1TWAH 1QNUA 4CBVA 4DV4Q 5J22A 1Y8OB 4TQUS 3U50C 3HOWG 1LTID 4NXNL 3BYTB 1LTBD 1U4MA 1CA5A 3CW2C 1R9TB 1MBYA 4DV5Q 5FLMG 4B3RQ 3GTGB 2IX1A 3K57A 2ZJRA 2EYHA 3HOVH 2K28A 2K4KA 4LF5L 5DNFA 2YTXA 1XX8A 2BE5C 4KN4C 2EY1A 3SR1A 1NTGA 1PH2A 4R4OA 1HXYD 5C4JH 5CBAE 1TY0A 2RVLA 4A3CG 1Y8PB 3OWFA 1KNEA 1LT6D 1L0WA 4JBJA 3S16B 1PTOB 3ERSX 3VA5A 3KJPA 2K52A 3X3NA 1L1OA 4XYOA 1JQYD 3TSSA 1Z47A 3NQIA 2K03A 3D8GA 3DWAA 3J7YW 2Y0SB 3G71A 4CJ1B 4JVZA 3KBXA 3CRLC 2E2IB 4LUZA 1PFBA 4B9WA 4IUTA 1EYDA 1UAPA 1MSGA 4HMIA 4DKAC 1S5BD 4JW0A 2MQHA 3T1YL 2NVXB 1YNJC 3ULJA 5FO8B 1DOMA 3R93A 3TDQA 3IFTA 2I5HA 5K36G 3E6ZX 1Q3LA 1YVCA 1F9QA 1A63A 2JN4A 2KHIA 2JA6H 2PZWA 4WRDA 3S2DB 4YIJA 3D6WA 5ELBA 1YJWA 2BA1A 1M4VA 2IX0A 5CC4A 4DK6C 3KJOA 1PA6A 4N9PA 4ZUIA 3J81L 3J81i 2M9VA 4KMUC 4X3UA 2N3SA 1U5KA 4GKKL 4MTKA 1ENCA 1KAAA 3TP7A 2CW0C 2F3VA 4Y7NH 3ULLA 2BE5D 1LV9A 1I50B 2JA8B 1B70B 2RBMA 1B4OA 4GOPA 4LUVA 3UDGA 1K0RA 2UU9Q 4A3IB 1CKNB 4XXEA 5C4HA 1TS5A 2N8NA 2O2LD 3OMGA 4X66Q 3CF5A 3L0OA 4A75A 1S72A 3PUWA 1Q90A 4E6IA 3A74A 3UE0A 3KUPA 4IFDJ 1DYQA 1H9MA 4FO2A 3GD7A 3DWPA 3VR3A 1EFWA 1HFNA 4NP5A 1BVSA 1JCKB 4PMCA 3TREA 1NBWA 1VF7A 1JB3A 1D5MC 4O0AA 3UDFA 1EY0A 3I4LA 4IJLA 3H09A 1M1KC 3GTJH 4DV6L 1OO9B 3HEJA 5C0XJ 2Y0SE 4FXDA 4EQOA 2E5LL 1WTWA 1LTGD 1LYLA 4DV7L 1AH9A 2O4XA 4P73A 1TVXA 1SNDA 3J80E 1KD1C 2YU9B 4KHPL 5BR8L 2CWAA 3PUVA 2D62A
chains in the Genus database with same CATH topology
1SJED 4KHZA 5CBEE 1BCPB 5C4XB 1NSNS 1STBA 3MVVA 1CQVA 1FNWA 2RDFA 3DWQA 2C5CA 3I3CA 4J1MA 2CW0D 2K04A 2WV6D 1M8AA 1TT2A 3PO2B 4C3JB 1D5ZC 1WTRA 4G7ZC 3KLSX 2K01A 4DU9A 1X3PA 2KCCA 1SNOA 4PV1C 3Q22A 4ZQ3A 5IGBA 3BDCA 4HCEA 4JK1C 4H0LC 1MSHA 1STHA 1ESFA 1LABA 2YYZA 4A3EB 1SFOB 1F9PA 1GJXA 3Q0AA 2PZUA 5C3WA 1NCVA 3P1HA 4DGZA 4QIWB 3CQZB 4MN3A 1BUVT 3S1RB 1B9MA 3GQBA 2Z1CA 1OXXK 1HRJA 1O78A 4LAAA 3TP8A 2BOSA 4IUPA 1TQOA 5CGKA 3HS0C 2IW3A 1MD2D 2F0QA 1TWCB 5F2DA 4FF1A 4Z9CB 1H9RA 1STAA 5FK9C 3HP3A 3K6OA 2RSNA 1S5ED 2A69C 2MJ8A 4IFDI 1LTAD 5JEAH 3MC0B 3SDZA 4RKBA 1RKNA 3OOCA 2OF1A 2NB0A 4KK7A 2B63B 1IYVA 3N52A 3A56A 1I6HB 1E2VA 5C0XI 4H13C 1EY7A 4F8MA 2RDHA 3VR6A 1TWGB 3K7AB 1PDQA 2EY2A 5DAUA 1EL0A 3Q24A 1EU4A 1I4RA 1OXSC 2WKCA 2KCNA 2R3ZA 5M5WB 4K5WA 1PZKD 3D6CA 2BCOA 5M3MB 3BZDB 3PMFA 4C3IG 1B9NA 5CV9A 1B53A 5E3FA 4ZRZA 2B2UA 3CU7A 3H0GB 1SNPA 1SSOA 5C44B 1LT5D 3I70A 4ILWA 3IFDA 4LMQD 3QWNA 5KNDA 1O7ZA 3DXJC 1KTKA 2JXMB 4L8JA 2WACA 3TBIB 1HUMA 4KY7A 4G7HC 4OO1G 1C8CA 1JE4A 3DMUA 1HTPA 5D14A 2C9OA 1QOHA 3P7JA 1GXDC 2PO4A 1E2WA 1EIGA 5T1IA 1O80A 1Z7TA 4TRDA 1EZ8A 3HOXB 4R8IA 3MZ5A 2RDGA 4UDUC 1Y69U 3HRZC 1DONA 4IALA 5M3FB 2DNEA 3NHHA 3E0JA 3NWSA 4KTAA 3KF8A 4FVMA 2L11A 1IL8A 1JWMD 1XXGA 3S14B 2PW5A 2VNUD 5JPNC 2JE6I 1SXTA 4RFBA 1HCZA 4O42A 3PUYA 4ODGA 3C46A 3MXNA 3PUXA 1S4ZA 5J1ZA 1QNKA 4FF2A 1JR0D 5EGTA 2Q8TA 3VYRA 1C4QA 3PUZA 4RAUC 1A3UA 3C1EA 3K5OA 4KJOA 1A2TA 2F0IA 5NUCA 3ERQA 3GV3A 5FO9B 2JEAI 3NTKA 2IT1A 2HQEA 4QB4A 3TP5A 3CRKC 3VYUA 3EROA 2ZXRA 3K5MA 5E4XA 2H1EA 3MFYA 3BVZA 3HOZB 1EIHA 4WFN3 4ZAIA 2K5QA 2NZ1D 2PPBC 1GHJA 1CHPD 1NR4A 2MGSA 4IN3A 3FKIB 5G3LF 4FF3A 1EEFD 5IGGA 4F87A 2EXZA 2ICIA 1LLRD 2L55A 4QUCA 2BDNA 2NN6G 1SJHD 1IYUA 5C4ZA 2L12A 5KIXA 2ZXPA 3HGBA 1CZGA 4F88A 1CHQD 1SYFA 1ILPA 1IW7C 4ZLTF 4BY1B 1II3A 5ISRA 3JAME 4ZUJA 1PTOF 1GUTA 1EOTA 2B2UC 1ONLA 4X3SA 4C3JG 3GTOB 3I4NB 5KYIA 3T53B 1HTLD 5D3DA 2M2LA 1F9SA 4TSSA 2A74C 4I7ZC 2IWHA 5EPJA 1C48A 4FXGC 3EFXD 1SAPA 5JOBA 5K36H 2GA4B 2F3WA 4K8JA 3OMCA 4FF4A 5ELEA 3H94A 4CJ0B 1U4RA 2L9HA 3KBGA 3NBHA 5AFWA 1ILQA 2JYOA 2MUYA 2AWOA 2KHSA 3EVQA 1OXVA 1V1PB 5CV4A 3U9SA 3Q23A 2OXPA 3MHBA 2WIIB 1J9OA 1KDCA 4DXFA 5M5YB 2NN6I 1IW7D 2SNMA 4EGVA 4NKLA 1ENFA 5KYLA 2O5IC 1RD9D 1GUNA 1HQRD 3K0YA 1FGBD 1Q1BA 4BS9A 2D2CC 3K5LA 2HDMA 1ZXTA 4J8QA 5JVG3 2QEJC 4A3JB 2CHBD 5EJWA 3T51B 1S5CD 1WTVA 3D4RA 3GV6A 3H91A 1WTXA 3FVQA 2E2DC 2E75C 1GUSA 1W6JA 5I4DA 3NSWA 1BCPF 2NYZD 1G291 2D9UA 4V0BA 4K2KA 1AZQA 4XQNA 2F0LA 1XTCD 5IT9E 2L4NA 1I4XA 1ZYRC 4KJNA 4X3KA 5CMDA 4IFDH 4C56C 3TMEA 3W3AA 2AWNA 1UUPA 3ND8A 4C1NI 1KDAA 4K5VA 4OL7A 2R61A 4BY7B 1HHVA 1STEA 4RHRA 4IZ8A 2O5JC 3FPUB 5I6WA 2NVQB 4L6TB 4KY5A 4DXGA 4A93B 3OWEB 1Y1WB 2B2TC 4KN7C 4A3KB 5FOBB 4FNFA 4UAIA 1DD2A 4HAEA 2NVYB 4A3DB 1RTOA 4K8IA 1OXTA 1X3QA 1O7YA 3OIQA 2PYKA 1UEAB 3CKIB 5CR3A 2F0HA 3I8ZA 1U9RA 3FDTA 5IGFA 4XIGS 3VR4A 3H6MA 4QF4A 3JAML 1CT1D 2F0EA 1V8QA 2HDLA 4IFDG 4KHVA 1ZYRD 1TU2B 5CYUA 5C3EB 3C2PA 4IUUA 2JA7B 3G6JB 3RD4A 3NWTA 3QO2A 1BOSA 2FMCA 4KKSA 5C0XG 2FJ2A 3D31A 5IODA 2F0NA 4XT1B 2E76C 1JOOA 1G8ZD 2A73B 3DUZA 1EU3A 4HN7A 2KECA 5COYA 3I4MB 2FFKB 5KNCA 2BDOA 2EY5A 5IGEA 4RGTA 1ZEQX 4RGMA 4DAYA 1EFID 2TSSA 4DA2A 2RSOA 5J39A 2OT2A 3MXUA 3TZUA 2NTSA 2EYLA 1STNA 1ZKOA 3TN2A 2KQ3A 1I4HA 4H7BA 2F0SA 1FNUA 2HCIA 1QWYA 3SXHA 2JEBI 3M3YB 3NK9A 3BYYB 3VR5A 1VF5C 2F03A 1JWSD 1Z6HA 2X6GA 3RZOB 1VCIA 3NXWA 1D6EC 4J6HA 1EY4A 1E2ZA 4OO1H 2F0GA 1T5XD 5M5XB 3X3MA 2QCPX 5CV8A 2FMMA 2NUCA 1I6VC 3SVMA 2HUGA 1GUWA 4BA2I 1PRTC 2XSCA 1BR9A 5A2QE 5IT9L 1TY2A 1MI2A 1PTOH 4ULLA 1R4QB 4C3HG 1TWAB 2V4DA 5JEAJ 4ID6A 4XQJA 2J7ZA 1V1OA 1JOQA 3QIAA 3L7ZC 2AUJD 1I4QA 3AB9A 1WVLA 1HPCA 4RWSC 1SMYC 3HOVB 2EE1A 5D65A 4CKBA 1PZJD 3OHXC 5EBCA 2DY7A 1D5XC 2EDGA 2WP8J 5C4JB 5KEEA 3M4YA 1HUNA 5EKLA 4AYBB 4RHSA 2F4IA 3NE5B 4CHTB 4QUFA 1DOLA 1G6ZA 2I07B 3WDNA 3SK6A 4OIJA 3AU7A 1AZPA 3O13A 3V2TA 2NTTA 4NMZA 2G9DA 1F2LA 2EZVA 4XT3B 1TR5A 1PRTD 4BA1I 3SHLA 2XN9C 2F1MA 1CM9A 1WTPA 3TP6A 4QCLA 2JA6B 2AQ1B 2VXWA 4CGYB 5JJZA 3S9WA 2PNRC 5I9PA 2KUMA 3VYTA 3LWEA 2ENBA 1F2YA 1SYEA 4OGQC 1IKMA 1SMYD 2KEEA 4EQPA 2WB1B 1B50A 2PQEA 3I72A 1ET6A 5K5PA 3ZYYX 4CKEA 1EYCA 2AQ2B 4N9TA 2K5WA 3P20A 4Y7NB 5BN5A 3R2TA 1H9JA 2NN6H 2F0UA 2KJXA 4Q5VA 3L3OC 1YNNC 1LT3D 3F2UA 4HEDA 5A35A 3A8KE 2EJFC 2B8GA 2EJMA 1SEBD 1TS2A 4R9WA 1PTOD 3QOLA 1E0BA 3MA2B 1B3AA 3MFGA 3T4AC 1EY5A 3GTJB 5KGUA 1V43A 2WAQB 3T16A 1FYCA 3FEWX 4K5XA 3KLRA 2EYOA 2AQ3B 5LHY1 3PV0A 5C5LA 4BWGB 2K1BA 1QB5D 3AMUA 3MTSA 5M9OA 2R93B 1RJTA 4JBWA 4P2CB 3J7AF 3SK8A 3MWYW 2F0FA 1D1KA 4WORA 2QKIC 3S1NB 2D5DA 5IOCA 4Q0FA 1YNND 1STGA 2LY7A 2JSOA 1HFGA 4A3FB 5A2QL 1EQVA 4M8AA 3NTIA 1XYIA 2E2HB 4XYQA 3S15B 3ITPA 1LO5D 1PLFA 1LT4D 2SDFA 5I2YA 1R4PB 1SE4A 1S5DD 5JAVA 1ESRA 4CJ2C 3R3OA 2EJGC 1SDFA 2EPBA 3L9AX 3FRPB 4RCNA 2LS01 4KKTA 2JA5B 3WOEA 3QB3A 1RTNA 1QJOA 2F0VA 2K05A 2KA7A 3ONAB 3I91A 2Q8IB 1L0XB 3FPPA 5C3XA 4DF7A 4G57A 1F2ZA 2RKSA 2B2VA 1H9SA 3HKZB 5EKIA 1QE6A 4I65A 5CORA 1BCPD 1Q1EA 1ICWA 4XDXA 1D1IA 5CV6A 2A5HA 4BBSB 1WD0A 2JP1A 1BDOA 3A7LA 3C3LA 5FLXE 1RCVD 4H44C 1VDZA 1AFPA 1Y1VB 4G4KA 3PIO3 2HCCA 4DK1A 4A3GB 3NUCA 1SE2A 4PMWA 4IQZA 3S17B 1CI3M 4PMBA 1STYA 1DZ1A 2G9HD 1B2TA 1VMCA 1MGSA 2IL8A 3OIPA 2PCFB 3PIP3 1F2MA 3NP8A 1LTRD 1SNCA 1PFNA 1FR3A 4NDXA 1SNMA 3IL8A 4F7XA 1K8MA 5FO7B 5EQ0A 3VR2A 2B2WA 3NTHA 2CVRA 3OPOA 3EJIA 1H9KA 1TKWB 2NVTB 5HURA 4KD3A 2X69A 4RGOS 1IHZA 1PZID 1AP0A 3K58A 2I46A 1Q12A 5JVH3 1SYGA 2KOLA 3QJYA 2XWBB 1HA6A 3RLFA 2IJ0A 3DM1A 1RODA 3RMHA 1WTOA 3GTQB 1JORA 2E74C 3D4WA 5IIFA 4KY6A 5EPLA 2B2YA 4LJZC 2ZT9C 1EWHA 4CKCA 3Q6SA 4ZKCB 2EYMA 3V96A 4LK1C 2XWJB 4RGNA 1EZ6A 4HCSA 5KNBA 1TIID 1PXUA 1JC7A 3QOJA 5C0XH 1BO0A 4GZYC 2OEOA 3I90A 4BBRB 5ELFA 4OHJA 3W2DA 3DEPA 1SE3A 2TMPA 3TZDA 3LWUA 2Z4HA 4A3BB 4MHEA 1EY9A 4DAPA 3T13A 2LMCB 1V1PA 1GUGA 5E4WC 2Z8LA 4K14A 1YNJD 5FKAC 1RDPD 1QILA 2XRSD 2K7VA 2SOBA 1KDBA 3DHQA 1EY8A 1PMRA 3RZDB 1G2TA 1A15A 2SEBD 2K32A 5EPKA 3SEBA 1TWHB 2L1BA 4DNTB 4M1UB 1KNAA 3HOYB 4HR7B 2SNSA 4FXKC 4EVOA 2F0KA 2L0CA 1LTTD 1U4PA 1F77A 2B2VC 1AW7A 2EY6A 5HGTA 3MAQA 2XIWA 4A3MB 1JOKA 1CK1A 5CV5A 5LL6S 1KLUD 3LNNA 4IUQA 3D3RA 2F0OA 1WCMB 5DM73 2WINB 4FP5D 4RKLA 3V05A 5D3IB 3R8BA 5E1FA 3HOUB 2ZXOA 2LKVA 3DEOA 3NBIA 1K8OA 2DNCA 5KRUA 4U68A 1SYCA 3E5SA 3I73A 3K5NA 3A8IE 2EVBA 3URYA 1F9RA 3HG9A 2K6AA 1HA5A 4XQQA 4B08A 3VA7A 5FLXL 1PYWD 4RA8A 1EEID 1XWEA 1TWFB 2F0TA 3HOWB 3A8JE 1X32A 2VUMB 3GP7A 1KABA 1I4PA 1OXUA 4ME5A 5ELDA 2MPMA 2KVMA 3M7GA 2PW7A 3M4OB 2Q8RE 1NR2A 2ID0A 3S2HB 2B2WC 3GO5A 1SNQA 3GTKB 1I4GA 4XTCS 1L0YB 4TKOB 3BG3A 4DFAA 1G91A 4PNYA 4DK0A 2IX3A 1EY6A 3M85A 3OSOA 1LACA 1NAPA 2MHVA 1BF4A 1U4LA 3VYSA 1S5FD 1DCZA 3R2IA 1Q8IA 1SYBA 2IPKD 3KK7A 1A3VA 1CQFA 5BN4A 2J0TD 3BVGA 4HMJA 4KD4A 2B2YC 2CQAA 3LX0A 1A6XA 1WTQA 2B8FA 2M00A 5DEHA 2K5DA 3WOFA 4DAVA 1O7LA 3H3VC 4ZKBB 2XRQD 5T1GA 3A54A 1FNVA 3CHBD 2A68C 2F0WA 2EYPA 1LTSD 2A6HC 1DXMA 2RA4A 3OW7A 4DNRB 5JPMC 5I2XA 5EBDA 2N55A 3S1QB 2KEDA 4K6LA 2VB3X 4KKUA 2DN8A 2EYJA 1CZWA 3HZXA 1CFMA 4V190 2Z4IA 3BS1A 5I6YA 3BVMA 3M7NA 3C1FA 5JEAG 1W6KA 2QDBA 3GTLB 1NUCA 1JWUD 2A69D 1J8IA 4G7OC 4K2LA 1IKLA 1PTOC 4IUVA 4HSVA 3UI2A 4C1NK 3MEHA 1TS4A 4L63B 1BNZA 3FMCA 2J4XA 4DN4M 1FD7D 5LL6X 2N88A 3J80L 4C2MB 1CA6A 1GUOA 2NBFA 2K33A 5IGDA 1QCBD 1DM0B 1BQQT 1ML0D 2A68D 3S1MB 3MXPA 1AN8A 2A6HD 1TS3A 3NQTA 4KI0A 1DOKA 1EWCA 3RUZA 1KLGD 3IAYA 4PQXA 1BXTA 1CTMA 5G3LD 4HSPA 1SBBB 2E2JB 4HTHA 3D4DA 4QMGA 2L5TA 3U9OA 3SK4A 4IUNA 1K83B 1WD1A 1D2BA 4RH6A 5IGCA 5EKKA 2B39A 1EYAA 2BA0A 1ET9A 4X3TA 2H4OA 5I9OA 2X6LA 2RQXA 1VMPA 4ZK9B 3SK5A 4R8NA 1H9SB 3EA6A 4OIKA 3A55A 3NPPA 5TSSA 2WKDA 1AEXA 2XVSA 2A6EC 2EYFA 3J81E 4FYDA 1I3QB 2R92B 1B44D 3G7LA 3IKJA 4NW2A 1PRTF 2PMZB 4U673 4EQNA 4OO1I 2QF7A 3ND9A 3GTMB 2FINB 4KV6A 5BN3A 2F0JA 1RF2D 2F0DA 4ABNA 1UNSA 1BCPC 2NWGA 1EQTA 4RCOA 3BDLA 2AUKA 2PZTA 4MIUA 1A3TA 2F0PA 1JICA 1B1ZA 1ENAA 3KLSA 5C5MA 3J7AV 2MP1A 1QG7A 2B2TA 4K6DA 3T56B 1GHKA 1HQMC 2QILA 3SE0A 1Y8NB 3P75A 3N6RA 1GOZA 2A6ED 2VB2X 1G2SA 2EOTA 2R6GA 3K59A 3MXGA 2XNAC 2DY8A 2ICEC 5DM63 1A2UA 3A7AB 1T5EA 1PRTB 4C3HB 3QG1A 4IURA 4ZYSA 2FHTA 1RHPA 1PFMA 5ELCA 4B9XA 4C3IB 2R7ZB 2F0MA 4S3SA 1SYDA 4WJWA 3GTPB 3PO3B 5C6AA 1DJRD 3EQLC 5CV7A 3BDOA 2LFNA 1BBXC 4O1NA 4CBVA 1QNUA 5J22A 1Y8OB 4TQUS 1LTID 3BYTB 1LTBD 1U4MA 1CA5A 1R9TB 1MBYA 3GTGB 2IX1A 3K57A 2EYHA 2K28A 5DNFA 1XX8A 2BE5C 4KN4C 2EY1A 3SR1A 1HXYD 5CBAE 1TY0A 2RVLA 1Y8PB 3OWFA 1KNEA 1LT6D 3S16B 1PTOB 3VA5A 3X3NA 4XYOA 1JQYD 3TSSA 1Z47A 3NQIA 2K03A 3D8GA 3DWAA 3J7YW 2Y0SB 4CJ1B 3KBXA 3CRLC 2E2IB 1PFBA 4B9WA 4IUTA 1EYDA 1UAPA 1MSGA 4HMIA 1S5BD 2NVXB 1YNJC 5FO8B 1DOMA 3TDQA 3R93A 3IFTA 5K36G 3E6ZX 1Q3LA 1F9QA 2PZWA 4WRDA 3S2DB 4YIJA 3D6WA 5ELBA 2BA1A 1M4VA 2IX0A 5CC4A 4N9PA 4ZUIA 3J81L 2M9VA 4KMUC 4X3UA 1ENCA 1KAAA 3TP7A 2CW0C 2F3VA 2BE5D 1LV9A 1I50B 2JA8B 2RBMA 1B4OA 4A3IB 4XXEA 5C4HA 1TS5A 2O2LD 3OMGA 4E6IA 3PUWA 1Q90A 4IFDJ 3KUPA 1DYQA 1H9MA 4FO2A 3GD7A 3DWPA 3VR3A 1HFNA 4NP5A 1JCKB 4PMCA 1VF7A 1JB3A 1D5MC 1EY0A 3I4LA 3H09A 1OO9B 3HEJA 5C0XJ 4FXDA 4EQOA 1WTWA 1LTGD 2O4XA 1TVXA 1SNDA 3J80E 2YU9B 3PUVA 2D62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 C;  5JEA H;  1GHJ A;  4LJZ C;  2ZT9 C;  1EWH A;  2NN6 I;  3M4Y A;  1IW7 D;  3MXU A;  3N6R A;  4KHZ A;  3SDZ A;  3TZU A;  3OOC A;  1YNJ C;  1H9S A;  2A6H C;  2A6E D;  1DXM A;  1K8O A;  4LK1 C;  2DNC A;  3IFT A;  1E2W A;  3NE5 B;  5K36 G;  1IYV A;  1DD2 A;  3OW7 A;  1ZKO A;  2BA0 A;  2R6G A;  3I73 A;  4DNR B;  5KNB A;  1Z7T A;  2NN6 G;  3A8I E;  2EVB A;  2O5I C;  1Q1E A;  1IYU A;  1V43 A;  3WDN A;  1OXT A;  5C0X H;  1FYC A;  2JEB I;  4GZY C;  1E2V A;  1GUN A;  4H13 C;  3A7A B;  1T5E A;  3VA7 A;  1Q1B A;  3KLR A;  3HGB A;  1BDO A;  3A7L A;  1H9S B;  2D2C C;  1Y69 U;  3QG1 A;  3VR6 A;  3VR5 A;  4KKU A;  2BA1 A;  2DN8 A;  3PV0 A;  4XIG S;  4G7Z C;  3VR4 A;  4H44 C;  3LWU A;  1VF5 C;  1VDZ A;  2KCC A;  4BA1 I;  1IW7 C;  2DNE A;  1CFM A;  4PV1 C;  1V8Q A;  2A6E C;  1Z6H A;  2F1M A;  3A8J E;  1GUT A;  4KMU C;  1OXS C;  4DK1 A;  1VCI A;  4IFD G;  1ONL A;  3T51 B;  3M7N A;  4IQZ A;  1OXU A;  5JEA G;  1TU2 B;  3IKJ A;  1CI3 M;  4JBW A;  1E2Z A;  4OO1 H;  3D4R A;  2CW0 C;  3EQL C;  2A69 D;  3BDO A;  2BE5 D;  4JK1 C;  4H0L C;  2LMC B;  2JE6 I;  1GUG A;  2PNR C;  4G7O C;  1Y8O B;  4TQU S;  1LAB A;  2YYZ A;  4XTC S;  2D5D A;  2QF7 A;  2E75 C;  4TKO B;  1HCZ A;  1GUS A;  2PCF B;  3ND9 A;  1I6V C;  3T53 B;  1GJX A;  1B9N A;  3BG3 A;  3FMC A;  3PUY A;  1FR3 A;  4BA2 I;  1G29 1;  3PUX A;  4DK0 A;  4KKS A;  5BN3 A;  4OGQ C;  5C0X G;  3M85 A;  2K7V A;  4I7Z C;  1K8M A;  1LAC A;  3I72 A;  3VR2 A;  3PUZ A;  3OPO A;  1GUO A;  1Q90 A;  3PUW A;  3D31 A;  1PMR A;  3P20 A;  2K33 A;  1H9M A;  5BN5 A;  1B9M A;  1ZYR C;  5KND A;  5K36 H;  2V4D A;  2K32 A;  3GD7 A;  3GQB A;  3VR3 A;  2JEA I;  4IFD H;  1H9K A;  1TKW B;  3DXJ C;  2IT1 A;  2A68 D;  1H9J A;  2NN6 H;  2BE5 C;  1DCZ A;  1OXX K;  2JXM B;  3CRK C;  2E76 C;  3H94 A;  2AUK A;  4L8J A;  4KN4 C;  4DNT B;  1VF7 A;  1O78 A;  1Q12 A;  2A6H D;  4HR7 B;  5BN4 A;  1YNN C;  3W3A A;  4KI0 A;  2EJG C;  1Y8P B;  3ND8 A;  3QIA A;  3I4L A;  3L7Z C;  2AUJ D;  4G7H C;  3AB9 A;  5A35 A;  4RCN A;  5KNC A;  4KKT A;  4OO1 G;  3MFY A;  1A6X A;  3A8K E;  3QJY A;  1HPC A;  2BDO A;  3RLF A;  2O5J C;  1SMY C;  1QJO A;  1HTP A;  1CTM A;  2EJF C;  2B8G A;  2B8F A;  2EJM A;  2KA7 A;  3PUV A;  2AWO A;  1OXV A;  3LNN A;  2Q8I B;  1H9R A;  2E74 C;  3U9S A;  3T56 B;  1O7L A;  3CRL C;  2EDG A;  2L5T A;  3FPP A;  1GHK A;  2PPB C;  2A69 C;  1HQM C;  2D62 A;  3SE0 A;  1Y8N B;  2A68 C; 
#chains in the Genus database with same CATH topology
 1SJE D;  4PZ7 A;  2K5V A;  4KHZ A;  3JAM i;  5CBE E;  1BCP B;  5C4X B;  1NSN S;  1VQM A;  3OTO L;  4LF4 Q;  1STB A;  1IBK L;  3MVV A;  1CQV A;  1FNW A;  2PI2 A;  3J81 j;  1IL2 A;  2RDF A;  3DWQ A;  2C5C A;  3I3C A;  3TS2 A;  4J1M A;  1VQL A;  2CW0 D;  2R93 H;  2K04 A;  3T1H L;  3CCE A;  2WV6 D;  5IYC G;  1M8A A;  1TT2 A;  4DR5 Q;  3PO2 B;  2UUC Q;  4C3J B;  1D5Z C;  1WTR A;  3S1N H;  4G7Z C;  3KLS X;  3U4V A;  2K01 A;  1GO3 E;  4DU9 A;  3TEH B;  3L2P A;  1X3P A;  2KCC A;  1SNO A;  4DV1 Q;  1EQR A;  4PV1 C;  3ICE A;  3Q22 A;  4ZQ3 A;  5IGB A;  4A3F H;  2K50 A;  4X64 L;  2VQF L;  1G6P A;  3J81 c;  1JJG A;  3BDC A;  4HCE A;  2E2H H;  3K80 C;  2ZM6 L;  4NXN Q;  3KF6 B;  3F2C A;  4JK1 C;  4H0L C;  1X9N A;  1MSH A;  1STH A;  1ESF A;  1LAB A;  2YYZ A;  4A3E B;  3G4S A;  1SFO B;  1F9P A;  1GJX A;  3Q0A A;  1D8L A;  3KLW A;  2PZU A;  5C3W A;  1XPU A;  5IP7 G;  1NCV A;  2R92 G;  4LF5 Q;  3P1H A;  4DGZ A;  4QIW B;  3CQZ B;  4MN3 A;  2JA5 H;  1BUV T;  3RR5 A;  4AIM A;  3S1R B;  1B9M A;  3E9H A;  3GQB A;  3HKS A;  2Z1C A;  1L1O C;  1OXX K;  4LFA L;  1HRJ A;  5ELN A;  1O78 A;  4LAA A;  3TP8 A;  2BOS A;  4IUP A;  3PF5 A;  4HJ8 A;  1TQO A;  4LW1 A;  5CGK A;  3HS0 C;  2IW3 A;  1MD2 D;  2LXJ A;  2F0Q A;  1TWC B;  4DR1 L;  2RF4 A;  5F2D A;  4FF1 A;  2OQK A;  1EIY B;  4Z9C B;  1H9R A;  1STA A;  5FK9 C;  3AYH B;  3HP3 A;  3T1Y Q;  3K6O A;  2RSN A;  4YY3 L;  4BBS H;  1S5E D;  1UE5 A;  2A69 C;  5JJK A;  2MJ8 A;  4IFD I;  1LTA D;  2ZTC A;  5JEA H;  3G6E A;  3F2B A;  3MC0 B;  3SDZ A;  4RKB A;  1RKN A;  3OOC A;  2OF1 A;  2NB0 A;  4LF6 L;  4YCW A;  4KK7 A;  2B63 B;  1IYV A;  1Y1V H;  4JI6 L;  1VQ7 A;  3N52 A;  4JCV E;  3A56 A;  2HIX A;  4A3G H;  3CD6 A;  3S17 H;  1I6H B;  1E2V A;  5C0X I;  4H13 C;  1EY7 A;  4F8M A;  2RDH A;  3VR6 A;  4A4I A;  1TWG B;  4DR3 L;  2DGY A;  3FHW A;  1VQP A;  4DV3 L;  3K7A B;  4GKK Q;  4GOP C;  1PDQ A;  1QUQ A;  2EY2 A;  5DAU A;  1EL0 A;  3Q24 A;  1EU4 A;  1I4R A;  1OXS C;  2WKC A;  4OEL B;  3BZK A;  2KCN A;  2R3Z A;  5M5W B;  4K5W A;  2MO0 A;  1LM0 A;  3CME A;  3F1Z A;  3CCQ A;  3CCU A;  2I0Q A;  1VQG A;  3D6C A;  1PZK D;  2A8V A;  2BCO A;  5M3M B;  3BZD B;  3PMF A;  2NVT H;  4C3I G;  3CCL A;  2R7Z G;  1B9N A;  4QIW E;  4R4Q A;  5FLX c;  5CV9 A;  1B53 A;  5E3F A;  4ZRZ A;  2B2U A;  3CU7 A;  4JC0 A;  3H0G B;  3PO3 G;  1SNP A;  1SSO A;  1VQC A;  5C44 B;  1LT5 D;  3I70 A;  4ILW A;  3IFD A;  4LMQ D;  3QWN A;  4POG A;  3GTQ H;  5KND A;  1O7Z A;  4UP9 A;  3DXJ C;  2PQA A;  1KTK A;  2JXM B;  4L8J A;  1UE1 A;  4DV6 Q;  1C9O A;  2WAC A;  3TBI B;  2E5L Q;  1HUM A;  1L2F A;  4DV7 Q;  1DGS A;  4KY7 A;  3W1G A;  2HHH L;  4G7H C;  4OO1 G;  2JA9 A;  1C8C A;  4KHP Q;  1JE4 A;  3DMU A;  1HTP A;  5BR8 Q;  1YJN A;  5D14 A;  4DK3 C;  1QVF A;  2C9O A;  3OYY A;  1QOH A;  3OTO Q;  4BBR H;  1O7I A;  1IBK Q;  1KC8 C;  3P7J A;  2EIF A;  2KBN A;  1GXD C;  1E1T A;  3CCJ A;  2PO4 A;  1E2W A;  1EIG A;  3T1H Q;  5T1I A;  1O80 A;  4A3B H;  1Z7T A;  4TRD A;  1EZ8 A;  2NVY H;  3HOX B;  4DV0 L;  4R8I A;  3MZ5 A;  2RDG A;  4UDU C;  4YWK A;  4QY7 A;  1Y69 U;  3HRZ C;  4X64 Q;  1DON A;  1VQ9 A;  2VQF Q;  4IAL A;  5M3F B;  2DNE A;  2ZM6 Q;  3NHH A;  3E0J A;  3NWS A;  2F3I A;  4KTA A;  3KF8 A;  4FVM A;  2L11 A;  4MNO A;  1IL8 A;  3K7U C;  2UXC L;  1JWM D;  1XXG A;  3H3V I;  3S14 B;  2PW5 A;  2AKW B;  4PG3 A;  4L5Q A;  3RZD H;  2VNU D;  5JPN C;  2JE6 I;  1WOC A;  1SXT A;  4RFB A;  1TWH H;  1HCZ A;  2ZJQ A;  4O42 A;  3PUY A;  4ODG A;  2K14 A;  3C46 A;  3MXN A;  1GD7 A;  3A5Z B;  2FXQ A;  3PUX A;  3HOY H;  1S4Z A;  2RHS B;  5J1Z A;  1QNK A;  3E9I A;  4FF2 A;  1JR0 D;  5EGT A;  2Q8T A;  1OTC A;  4A3L H;  3VYR A;  1C4Q A;  3PUZ A;  4RAU C;  1A3U A;  2JA8 G;  4LFA Q;  3C1E A;  3K5O A;  4KJO A;  1A2T A;  4A3M H;  2F0I A;  2MNA A;  5NUC A;  3ERQ A;  4IPC A;  2Z9H A;  3GV3 A;  5FO9 B;  3NTK A;  2JEA I;  2IT1 A;  2HQE A;  1GM5 A;  4QB4 A;  4AYB E;  3TP5 A;  1WCM H;  1VQI A;  3CRK C;  3VYU A;  3ERO A;  4ME3 A;  1NE3 A;  3QR8 A;  2ZXR A;  3K5M A;  4A3I G;  4DR1 Q;  3K0X A;  3HOU H;  5E4X A;  2H1E A;  3MFY A;  3BVZ A;  1B3Q A;  4L5T A;  3HOZ B;  4YY3 Q;  1EIH A;  4WFN 3;  2B29 A;  4ZAI A;  2K5Q A;  2IHE A;  2QGQ A;  3J80 c;  1VQJ A;  2NZ1 D;  3D0F A;  4IPG A;  1K73 C;  2PPB C;  1GHJ A;  1CHP D;  1NR4 A;  4LF6 Q;  4DR2 L;  2MGS A;  5IWA L;  4JI6 Q;  2NZH A;  4IN3 A;  5J3B A;  3FKI B;  1TWF H;  2CFM A;  5G3L F;  2GVA A;  4K0K L;  3NEL A;  4FF3 A;  1EEF D;  5IGG A;  4F87 A;  4JI1 L;  1SE8 A;  3HOW H;  2EXZ A;  2ICI A;  1LLR D;  2L55 A;  4QUC A;  1PVO A;  2BDN A;  2NN6 G;  1SJH D;  1IYU A;  2VUM H;  1W2B A;  5C4Z A;  2L12 A;  5KIX A;  5FLM H;  4DR3 Q;  4DV3 Q;  1NMF A;  2Z6B A;  3M4O H;  1IXR A;  1I94 L;  2ZXP A;  3B6Y A;  3HGB A;  3I2Z A;  3S2H H;  3GTK H;  1CZG A;  4F88 A;  2WB1 E;  1CHQ D;  2DJF C;  1SYF A;  1ILP A;  5IYB G;  1IW7 C;  4ZLT F;  4BY1 B;  1SR3 A;  2HT1 A;  1II3 A;  5ISR A;  3JAM E;  4ZUJ A;  1PTO F;  1GUT A;  4HIK A;  1EOT A;  4HJ9 A;  1Q46 A;  2B2U C;  1ONL A;  4DR4 L;  4A3C H;  1WCM G;  4X3S A;  3PO2 G;  4HJ5 A;  3NEM A;  1I5F A;  4C3J G;  1XPO A;  3GTO B;  1PH9 A;  3I4N B;  5KYI A;  3T53 B;  1HTL D;  5D3D A;  1KHI A;  2M2L A;  1F9S A;  2VQE L;  4B3T L;  4TSS A;  2A74 C;  4B3M L;  4I7Z C;  2IWH A;  5EPJ A;  4Y52 H;  1C48 A;  2HIV A;  1X55 A;  4FXG C;  3EFX D;  2VS1 A;  1SAP A;  5JOB A;  4GOP B;  5K36 H;  4A3E G;  2GA4 B;  2F3W A;  4K8J A;  3OMC A;  4FF4 A;  5ELE A;  3H94 A;  4CJ0 B;  2HHH Q;  1SMX A;  3KBG A;  1U4R A;  2L9H A;  3EIV A;  3NBH A;  5AFW A;  1ILQ A;  2JYO A;  4TVA B;  4CDD C;  2WAQ E;  2VUM G;  2MUY A;  1J5E L;  4LFB L;  3I7F A;  2CH4 A;  2QW7 A;  2AWO A;  2KHS A;  3EVQ A;  1OXV A;  1V1P B;  1K3B C;  2H5X A;  1K0S A;  3M4P A;  5CV4 A;  3U9S A;  3Q23 A;  4J15 A;  4NXM L;  2OXP A;  3MHB A;  1CKM A;  2WII B;  1J9O A;  1NMG A;  1KDC A;  4DXF A;  1YBY A;  3S1Q H;  5M5Y B;  2NN6 I;  1IW7 D;  2SNM A;  4EGV A;  4NKL A;  4DV0 Q;  1ENF A;  5KYL A;  3Q8D A;  2O5I C;  1RD9 D;  1X3E A;  2ZTD A;  1GUN A;  1HQR D;  2WFW A;  3K0Y A;  1FGB D;  4N8F A;  4X65 L;  1Q1B A;  3GTL H;  2G5D A;  4BS9 A;  5GQO A;  2D2C C;  5GAG C;  3K5L A;  2B63 G;  2HDM A;  5IE8 A;  1ZXT A;  4J8Q A;  2UXC Q;  5JVG 3;  1VQ8 A;  2QEJ C;  4A3J B;  3KOJ A;  2DJG C;  2CHB D;  5EJW A;  1HJP A;  1JJ2 A;  3T51 B;  1FGU A;  1VQN A;  1S5C D;  1WTV A;  4C2M H;  3D4R A;  2OQ0 A;  3GV6 A;  3H91 A;  1WTX A;  3FVQ A;  4MTN A;  1VQO A;  2E2D C;  2E75 C;  5ELO A;  1GUS A;  1W6J A;  5I4D A;  3S1M H;  1T9H A;  3NSW A;  1BCP F;  1U0L A;  2NYZ D;  4EX5 A;  1G29 1;  2D9U A;  1E3P A;  4L5R C;  4V0B A;  4K2K A;  1AZQ A;  3I55 A;  1SRO A;  2D0P A;  4XQN A;  2F0L A;  1XTC D;  5M3M G;  5IT9 E;  2L4N A;  1E22 A;  1I4X A;  1ZYR C;  4KJN A;  4X3K A;  4LFC L;  5CMD A;  4IFD H;  4C56 C;  3HKZ E;  2E2J H;  2RCF A;  3TME A;  3GDE A;  1H95 A;  3H0G G;  5C44 G;  3W3A A;  2AWN A;  1UUP A;  5IYC H;  3ND8 A;  4C1N I;  1KDA A;  4K5V A;  1K83 H;  2R61 A;  4OL7 A;  2UXB L;  4BY7 B;  1HHV A;  1STE A;  4RHR A;  4IZ8 A;  2O5J C;  3FPU B;  5I6W A;  3PQI A;  1LUZ A;  2NVQ B;  1KXL A;  4L6T B;  4KY5 A;  4DR2 Q;  4IOA A;  5IWA Q;  1VQB A;  2Z6K A;  4DXG A;  2OWO A;  1EWI A;  4DUZ L;  4A93 B;  3OWE B;  4YWM A;  4K0K Q;  3E0E A;  1XMO L;  1Y1W B;  2B2T C;  1JE5 A;  4KN7 C;  4JI1 Q;  3J7A 5;  4A3K B;  4YCU A;  2GN5 A;  1QVG A;  5FOB B;  1PH5 A;  3MEF A;  4FNF A;  4UAI A;  4HID A;  1DD2 A;  4HAE A;  1MJC A;  2NVY B;  3DM3 A;  4A3D B;  1RTO A;  2E8G A;  1I94 Q;  1TXY A;  4BXX G;  4K8I A;  1OXT A;  1X3Q A;  4DPG A;  1O7Y A;  3OIQ A;  1I3Q H;  1UEA B;  2PYK A;  5IP7 H;  3CKI B;  2R92 H;  5CR3 A;  2F0H A;  2PI2 E;  3I8Z A;  1U9R A;  3FDT A;  4R4I A;  3KDF B;  5IGF A;  4XIG S;  1VS0 A;  3VR4 A;  3H6M A;  4QF4 A;  3JAM L;  3GTM H;  4DR4 Q;  1CT1 D;  2F0E A;  3AFP A;  1V8Q A;  3CC7 A;  3CPF A;  2HDL A;  3SGI A;  3HOX G;  4IFD G;  4KHV A;  3PIO A;  2XGT A;  1ZYR D;  1TU2 B;  5CYU A;  5C3E B;  2K75 A;  3C2P A;  3CCS A;  2ES2 A;  4IUU A;  3WWV A;  4DV2 L;  1EYG A;  2JA7 B;  4JG2 A;  2VQE Q;  5M3F G;  4JPB W;  4B3T Q;  1QUQ B;  4B3M Q;  3G6J B;  3RD4 A;  4P75 A;  3NWT A;  3QO2 A;  1Q7Y C;  3PIP A;  1BOS A;  2FMC A;  4KKS A;  5C0X G;  2F4V L;  2Z0S A;  1PH1 A;  1HH2 P;  2NZO A;  2A19 A;  2FJ2 A;  3D31 A;  1ASZ A;  3S15 H;  5IOD A;  1N33 L;  2F0N A;  4XT1 B;  2E76 C;  1JOO A;  1G8Z D;  4OWT B;  3CC4 A;  2A73 B;  3DUZ A;  1EU3 A;  1J5E Q;  4GLA C;  4LFB Q;  4HN7 A;  1B7Y B;  2KEC A;  5COY A;  1MHW C;  3UDI A;  3I4M B;  2FFK B;  5KNC A;  1BBU A;  1K9M C;  2BDO A;  2EY5 A;  5IGE A;  4RGT A;  1ZEQ X;  4NXM Q;  1QZH A;  4RGM A;  4DAY A;  1EFI D;  2TSS A;  2PQA B;  4DA2 A;  4QL5 A;  1FVI A;  2RSO A;  5J39 A;  2OT2 A;  1S40 A;  2KHJ A;  2HD3 A;  4C3H H;  3MXU A;  3TZU A;  1VQH A;  2NTS A;  1QZG A;  2EYL A;  1STN A;  3HOZ G;  1FL0 A;  1VQA A;  2IHF A;  4R4C A;  4UY8 C;  5GAE C;  1ZKO A;  3TN2 A;  4C3I H;  2R7Z H;  2KQ3 A;  1I4H A;  4X65 Q;  4JI4 L;  4H7B A;  2F0S A;  1FNU A;  4N8X 1;  2HCI A;  3H3V H;  1QWY A;  3SXH A;  3GTP H;  5IYD H;  3PO3 H;  2JEB I;  3FKI G;  3M3Y B;  3NK9 A;  3BYY B;  4IPH A;  3VR5 A;  1VF5 C;  2F03 A;  3M9B A;  1JWS D;  4IJH A;  1R9T H;  1Z6H A;  2X6G A;  3RZO B;  1VCI A;  3JAM c;  1X65 A;  3I4O A;  1D6E C;  3NXW A;  1NJI C;  1UWV A;  3GTG H;  4JI7 L;  4HIO A;  2BH2 A;  4J6H A;  3AQQ A;  4LF9 L;  2VY3 A;  2JQO A;  1EY4 A;  1E2Z A;  4OO1 H;  1WYD A;  2F0G A;  1T5X D;  5M5X B;  1NNX A;  1HNW L;  3X3M A;  2QCP X;  3CCM A;  1JMC A;  5CV8 A;  4BY1 G;  2FMM A;  2I5L X;  1I6V C;  2NUC A;  3SVM A;  2HUG A;  1GUW A;  4BA2 I;  4YCV A;  3EBE A;  1PRT C;  4CDC C;  1N32 L;  2XSC A;  4LFC Q;  4AQY L;  1BR9 A;  3RLN A;  5A2Q E;  5IT9 L;  1TY2 A;  1MI2 A;  1PTO H;  4ULL A;  3S16 H;  1R4Q B;  1YIT A;  3I4N G;  4C3H G;  4DAM A;  1TWA B;  2V4D A;  5JEA J;  1HZA A;  1GKH A;  4ID6 A;  2Q2I A;  3MXN B;  2UXB Q;  2Z6K C;  4GNX A;  2E2I H;  5FJ8 G;  4XQJ A;  3CMA A;  1MKH A;  2J7Z A;  1V1O A;  1JOQ A;  4JI3 L;  4YWL A;  3PCO B;  1Q81 C;  3QIA A;  3L7Z C;  2AUJ D;  2NVX H;  1I4Q A;  3AB9 A;  5IYD G;  1WVL A;  1X3G A;  1HPC A;  4RWS C;  1SMY C;  3G48 A;  3HOV B;  2EE1 A;  4DUZ Q;  1CSQ A;  1IBM L;  1XMO Q;  2PNH A;  5D65 A;  1VQD A;  4CKB A;  1PZJ D;  3OHX C;  5EBC A;  2DY7 A;  1D5X C;  2EDG A;  2WP8 J;  1KRS A;  5C4J B;  3KF6 A;  3S2D H;  5KEE A;  3M4Y A;  1HUN A;  1VQ5 A;  3ZJY C;  5EKL A;  2OTL A;  4AYB B;  4RHS A;  2F4I A;  3NE5 B;  4QQB X;  4CHT B;  4QUF A;  1DOL A;  1G6Z A;  1S3O A;  2N78 A;  2I07 B;  3WDN A;  3SK6 A;  1EIF A;  4OIJ A;  3AU7 A;  1AZP A;  3O13 A;  4HJ7 A;  1LTL A;  3V2T A;  2NTT A;  5IP9 G;  4NMZ A;  2RCN A;  1I50 H;  2G9D A;  2JA8 H;  1F2L A;  2EZV A;  2CCZ A;  4XT3 B;  1TR5 A;  5HGQ A;  1IYJ B;  1PRT D;  4BA1 I;  3SHL A;  2XN9 C;  2F1M A;  1CM9 A;  1WTP A;  3CP0 A;  4O2D A;  3TP6 A;  4QCL A;  2JA6 B;  4A3I H;  4DV2 Q;  2Y0S G;  4KLK A;  3BZC A;  2AQ1 B;  2VXW A;  4CGY B;  5JJZ A;  3S9W A;  3W1B A;  2PNR C;  5I9P A;  2KUM A;  2F4V Q;  4A3J G;  3VYT A;  3LWE A;  2ENB A;  1F2Y A;  1SYE A;  4OGQ C;  1IKM A;  1SMY D;  2KEE A;  4EQP A;  2WB1 B;  1N33 Q;  2PQE A;  1B50 A;  3I72 A;  4WJ4 A;  1ET6 A;  1E1O A;  4N9T A;  1EYC A;  2AQ2 B;  3ZYY X;  2K5W A;  3P20 A;  4CKE A;  5K5P A;  4Y7N B;  5BN5 A;  1HNX L;  5GAD C;  3R2T A;  5IT9 c;  1H9J A;  2YU9 H;  2NN6 H;  2F0U A;  2KJX A;  5AJ3 L;  4Q5V A;  3L3O C;  1YNN C;  1LT3 D;  4IO9 A;  3F2U A;  4HED A;  5A35 A;  1CKO A;  1P16 A;  3A8K E;  5C4X H;  1IBL L;  1K8A C;  5IYB H;  2EJF C;  2B8G A;  1KL9 A;  2EJM A;  1SEB D;  1TS2 A;  4R9W A;  1PTO D;  3QOL A;  3NBH B;  3MA2 B;  1E0B A;  1B3A A;  3MFG A;  1PYS B;  3OW2 A;  3PO2 H;  4BY7 G;  4C3J H;  3T4A C;  4JI4 Q;  1EY5 A;  3GTJ B;  1AE3 A;  1VQE A;  5KGU A;  4HJA A;  2CQO A;  3S24 A;  1BKB A;  1V43 A;  2WAQ B;  3T16 A;  4A93 G;  2EQS A;  1FYC A;  2JJQ A;  3FEW X;  1Y1W G;  3AEV A;  4K5X A;  4A3K G;  3KLR A;  2EYO A;  2AQ3 B;  2F52 A;  5LHY 1;  2V1C C;  3PV0 A;  4A3E H;  1SFO H;  5C5L A;  4JI7 Q;  4BWG B;  4LF9 Q;  4A3D G;  2K1B A;  1A8V A;  1QB5 D;  1L1O B;  3AMU A;  2I5M X;  1KQS A;  4JBK A;  3MTS A;  5M9O A;  1HNW Q;  1YEZ A;  2R93 B;  1PH4 A;  1RJT A;  3CQZ H;  1ASY A;  4JBW A;  4P2C B;  1XJV A;  3J7A F;  3SK8 A;  3S1R H;  3MWY W;  2F0F A;  1D1K A;  4OXP A;  4WOR A;  1JT8 A;  2QKI C;  3S1N B;  1SRU A;  2D5D A;  1N32 Q;  5IOC A;  4Q0F A;  1YNN D;  1STG A;  4AQY Q;  5C4X G;  4I7A A;  2LY7 A;  2JSO A;  1HFG A;  4A3F B;  4GNX C;  5A2Q L;  1EQV A;  4M8A A;  3NTI A;  3STB C;  1XYI A;  4APV A;  2E2H B;  4XYQ A;  3S15 B;  3ITP A;  1LO5 D;  1PLF A;  1LT4 D;  2SDF A;  1TWC H;  5I2Y A;  1MIU A;  1R4P B;  2JA7 G;  1SE4 A;  3RN2 A;  1S5D D;  4JI3 Q;  5JAV A;  4DUY Q;  4RG1 A;  1ESR A;  4CJ2 C;  3R3O A;  1KRT A;  1HZB A;  2EJG C;  1SDF A;  2EPB A;  4GN5 A;  1IBM Q;  3L9A X;  4EQ5 A;  3FRP B;  4RCN A;  2EXD A;  2LS0 1;  4KKT A;  4JYA L;  1N36 L;  1PFS A;  2JA5 B;  3KFU A;  3WOE A;  2B63 H;  5EAY A;  3QB3 A;  1RTN A;  1QJO A;  2F0V A;  2K05 A;  2KEN A;  2KA7 A;  1NY4 A;  3ONA B;  4DR6 L;  2IY5 B;  3I91 A;  2Q8I B;  1L0X B;  1PHJ A;  1I6H H;  1JJC B;  1RL2 A;  3FPP A;  5C3X A;  4DF7 A;  1YI2 A;  4G57 A;  1F2Z A;  2RKS A;  1EOV A;  4R4T A;  1EQQ A;  4JI0 Q;  2B2V A;  4OX9 L;  3I4M G;  1XTD A;  1H9S A;  1TWG H;  3JC6 6;  2VZA A;  3K7A H;  3HKZ B;  5EKI A;  1QE6 A;  2PMZ E;  1D7Q A;  4I65 A;  3CAM A;  5JJL A;  5COR A;  1WI5 A;  1BCP D;  1Q1E A;  1ICW A;  4XDX A;  1D1I A;  5CV6 A;  5M5W H;  2A5H A;  4BBS B;  2DUD A;  1WD0 A;  5LMU L;  2JP1 A;  1BDO A;  3A7L A;  3C3L A;  4GKJ L;  5FLX E;  5M3M H;  1RCV D;  2K5N A;  4L5S A;  4H44 C;  2ZJP A;  1G51 A;  1VDZ A;  1AFP A;  1Y1V B;  3STB D;  4G4K A;  3PIO 3;  2HCC A;  4ZCK A;  2A1A A;  4DK1 A;  1HR0 L;  4A3G B;  3NUC A;  3H0G H;  4B3S L;  3PF4 A;  1ICF B;  1SE2 A;  5C44 H;  4PMW A;  4IQZ A;  3S17 B;  1CI3 M;  4PMB A;  1STY A;  1DZ1 A;  2G9H D;  1B2T A;  1VMC A;  4YHH L;  1MGS A;  2IL8 A;  3BJU A;  1YZ6 A;  1GVP A;  2PCF B;  3OIP A;  3RLO A;  3CXC A;  3PIP 3;  1F2M A;  3NP8 A;  1LTR D;  1SNC A;  3DLL A;  5JJI A;  1PFN A;  1FR3 A;  4NDX A;  1VQ6 A;  3H15 A;  4QGU A;  1HNX Q;  1XNR L;  1SNM A;  3IL8 A;  4F7X A;  1K8M A;  5FO7 B;  5EQ0 A;  3VR2 A;  2B2W A;  3NTH A;  4GLX A;  2CVR A;  3OPO A;  5AJ3 Q;  4LWC A;  3EJI A;  1H9K A;  1TKW B;  3I56 A;  2NVT B;  5HUR A;  4KD3 A;  2X69 A;  5E7N A;  4BXX H;  4RGO S;  1X6O A;  1IHZ A;  1PZI D;  1AP0 A;  3K58 A;  3F2D A;  2I46 A;  1Q12 A;  1IBL Q;  5JVH 3;  1SYG A;  1W3S A;  2KOL A;  3K8A A;  4POF A;  4GS3 A;  3QJY A;  2XWB B;  3A5U A;  1HA6 A;  3RLF A;  2ATW A;  2IJ0 A;  2MFI A;  3DM1 A;  1ROD A;  3RMH A;  3U4Z A;  1WTO A;  4JOI A;  3GTQ B;  1JOR A;  2OCE A;  2E74 C;  3D4W A;  3HOX H;  3CPW A;  5IIF A;  4KY6 A;  5EPL A;  4GLV B;  2B2Y A;  4LJZ C;  2ZT9 C;  1EWH A;  4CKC A;  3Q6S A;  4ZKC B;  2EYM A;  1PYB A;  4LF7 L;  3V96 A;  3HOV G;  4LK1 C;  2XWJ B;  4RGN A;  5M3F H;  4DAY B;  1EZ6 A;  4HCS A;  3E3X A;  2K5H A;  5KNB A;  5LMN L;  1PXU A;  1TII D;  1JC7 A;  3QOJ A;  5C0X H;  1BO0 A;  4GZY C;  1HZ9 A;  3S14 H;  2OEO A;  3I90 A;  4BBR B;  1JB7 A;  5ELF A;  4OHJ A;  3W2D A;  4AYB G;  3DEP A;  2GVB A;  1SE3 A;  2TMP A;  3TZD A;  3LWU A;  1YHA A;  2Z4H A;  3EN2 A;  4A3B B;  2ASB A;  4JI5 L;  4MHE A;  1EY9 A;  4DAP A;  3T13 A;  1PH7 A;  1PH8 A;  4PZ8 A;  4A76 A;  2LMC B;  1V1P A;  1GUG A;  1WTH A;  5E4W C;  2Z8L A;  4K14 A;  1YNJ D;  5FKA C;  1RDP D;  1QIL A;  2JA6 G;  2XRS D;  2K7V A;  2SOB A;  1KDB A;  3DHQ A;  1EY8 A;  1PV4 A;  1PMR A;  3HOZ H;  3RZD B;  1G2T A;  1A15 A;  2SEB D;  2K32 A;  5EPK A;  2KCT A;  3SEB A;  1TWH B;  2L1B A;  4AH6 A;  4JBM A;  4DNT B;  4M1U B;  4JYA Q;  3AFQ A;  1KNA A;  1N36 Q;  3HOY B;  4HR7 B;  2SNS A;  2WB1 G;  4FXK C;  2F0K A;  2L0C A;  4EVO A;  4P74 A;  1LTT D;  1U4P A;  3FKI H;  4DR6 Q;  1BBW A;  1F77 A;  2B2V C;  5DLQ E;  1AW7 A;  2D0O A;  2EY6 A;  5HGT A;  3MAQ A;  2XIW A;  4JI8 L;  4A3M B;  1JOK A;  1CK1 A;  5CV5 A;  5LL6 S;  1Q86 C;  1KLU D;  3LNN A;  4IUQ A;  3D3R A;  4OX9 Q;  1KAW A;  2F0O A;  3ER0 A;  1WCM B;  5DM7 3;  4GNX B;  4JI2 L;  1AE2 A;  2QDL A;  2WIN B;  4FP5 D;  4RKL A;  5H1S E;  3V05 A;  5D3I B;  3UE1 A;  3R8B A;  5E1F A;  3HOU B;  2ZXO A;  2LKV A;  3DEO A;  3NBI A;  1K8O A;  2DNC A;  5KRU A;  4U68 A;  1SYC A;  2LSS A;  4BY1 H;  3E5S A;  3I73 A;  3RNU A;  3K5N A;  5LMU Q;  4JV5 L;  3A8I E;  2EVB A;  3URY A;  1F9R A;  3HG9 A;  4GKJ Q;  4LF8 L;  2K6A A;  2YV5 A;  1HA5 A;  4XQQ A;  2AHO B;  4B08 A;  3VA7 A;  2OTJ A;  5FLX L;  1PYW D;  4RA8 A;  2UUB L;  1EEI D;  4QJF A;  3GTO H;  1XWE A;  1TWF B;  1HR0 Q;  3I4N H;  1K3R A;  4B3S Q;  2F0T A;  3HOW B;  1K8G A;  3A8J E;  2WAQ G;  3NEN A;  2KCM A;  1X32 A;  5FJ8 H;  2VUM B;  3GP7 A;  1KAB A;  2UXD L;  1Q82 C;  1I4P A;  1OXU A;  4ME5 A;  5ELD A;  4YHH Q;  2MPM A;  2KVM A;  3M7G A;  1CKN A;  2PW7 A;  3M4O B;  2Q8R E;  2MO1 A;  1NR2 A;  2ID0 A;  3S2H B;  2B2W C;  3GO5 A;  1SNQ A;  1HNZ L;  3GTK B;  1I4G A;  4XTC S;  1L0Y B;  1M90 C;  4TKO B;  1XNR Q;  2ZTE A;  3HFZ B;  4OWX B;  4P72 A;  3BG3 A;  4DFA A;  1G91 A;  4PNY A;  4DK0 A;  1VQ4 A;  1CUK A;  2R93 G;  2IX3 A;  3FP9 A;  1EY6 A;  4P71 A;  1UE7 A;  4NB3 A;  3M85 A;  3OSO A;  1HZC A;  1LAC A;  1NAP A;  2MHV A;  1BF4 A;  4IPD A;  4GN3 B;  1U4L A;  5HY6 A;  4NPS A;  1C0A A;  3VYS A;  4JOI C;  1S5F D;  1DCZ A;  3R2I A;  1Q8I A;  1SYB A;  2IPK D;  4A3F G;  2Q2U A;  3KK7 A;  4OWW B;  1A3V A;  1CQF A;  2R7F A;  5BN4 A;  2J0T D;  3BVG A;  4HMJ A;  4X62 L;  5IP9 H;  5M5Y H;  1E24 A;  3KDF A;  4KD4 A;  2B2Y C;  2AMC B;  4RMF A;  2CQA A;  3KF8 B;  3LX0 A;  1A6X A;  1X54 A;  1WTQ A;  1RIP A;  2B8F A;  2M00 A;  5DEH A;  2K5D A;  1HR0 W;  3WOF A;  4DAV A;  1O7L A;  3H3V C;  4ZKB B;  2XRQ D;  5T1G A;  4LF7 Q;  1K28 A;  3A54 A;  1FNV A;  3CHB D;  2A68 C;  2F0W A;  1N34 L;  1PH3 A;  3U58 A;  2XTI A;  4HIM A;  2EYP A;  2JA5 G;  1LTS D;  3RN5 A;  2A6H C;  5LMN Q;  1DXM A;  4DUY L;  2RA4 A;  1A0I A;  3OW7 A;  4LNQ A;  3BU2 A;  4DNR B;  4A3J H;  3LGJ A;  4DR7 L;  5JPM C;  5I2X A;  3TS0 A;  2LXK A;  4MZ9 A;  5EBD A;  1YHB A;  2N55 A;  3S1Q B;  2KED A;  4K6L A;  4JI5 Q;  2VB3 X;  1XNQ L;  4KKU A;  3CC2 A;  2DN8 A;  2R7D A;  3HKZ G;  2EYJ A;  1CZW A;  5L37 A;  1YIJ A;  2BH8 A;  2YTV A;  3HZX A;  1YNX A;  1CFM A;  3TQY A;  1IZ6 A;  3UDX A;  1PH6 A;  4JI0 L;  4CDE C;  4V19 0;  2Z4I A;  3BS1 A;  5I6Y A;  4BBS G;  3BVM A;  3M7N A;  2B3G A;  3C1F A;  2UUA L;  2VL6 A;  1W6K A;  5JEA G;  4H02 A;  2QDB A;  2CWP A;  3GTL B;  1NUC A;  1JWU D;  2A69 D;  2N49 A;  1UEB A;  4PZ6 A;  2JK8 A;  1J8I A;  4G7O C;  4K2L A;  1IKL A;  1PTO C;  4IUV A;  4HSV A;  3UI2 A;  1Y1V G;  3MEH A;  4C1N K;  3ULP A;  1FJG L;  1TS4 A;  4L63 B;  1XMQ L;  3FMC A;  1BNZ A;  4A3G G;  4DV4 L;  2J4X A;  4DN4 M;  1FD7 D;  4OON A;  5LL6 X;  2N88 A;  5GRO A;  1X56 A;  4FDB A;  4BY7 H;  3J80 i;  3J80 L;  4C2M B;  1CA6 A;  2HQL A;  1GUO A;  4OEM B;  1XPR A;  2NBF A;  2K33 A;  4DV5 L;  1N9W A;  3J7Z C;  4B3R L;  5IGD A;  2NVQ H;  3PGZ A;  1QCB D;  1DM0 B;  1BQQ T;  1ML0 D;  2A68 D;  3S1M B;  5LMN W;  3W5O A;  3MXP A;  4A93 H;  1AN8 A;  2A6H D;  1TS3 A;  1Y1W H;  4DNI A;  3NQT A;  4KI0 A;  4JI8 Q;  1DOK A;  4A3K H;  1EWC A;  4X6A H;  3RUZ A;  1KLG D;  3IAY A;  4JI2 Q;  4PQX A;  2RHQ B;  1BXT A;  1CTM A;  4A3D H;  5G3L D;  4HSP A;  1SBB B;  2E2J B;  4HTH A;  3D4D A;  4QMG A;  2L5T A;  3U9O A;  3SK4 A;  4IUN A;  4JV5 Q;  1K83 B;  1WD1 A;  1EUJ A;  1Q8K A;  1D2B A;  1C7Y A;  4RH6 A;  2QEX A;  5IGC A;  5EKK A;  4LF8 Q;  2B39 A;  1VQF A;  1EYA A;  2BA0 A;  1UE6 A;  3F8T A;  1ET9 A;  4X3T A;  3CCV A;  1CSP A;  2UUB Q;  2H4O A;  2YTY A;  5I9O A;  2Q2H A;  2X6L A;  2RQX A;  5C3E H;  4UPA A;  1QVC A;  1VMP A;  4ZK9 B;  3SK5 A;  4R8N A;  1H9S B;  3EA6 A;  1P8L A;  4OIK A;  3A55 A;  1MJE A;  3M4Q A;  2JA7 H;  3NPP A;  2VW9 A;  2UXD Q;  4GN4 B;  5TSS A;  1J6Q A;  2WKD A;  1AEX A;  2XVS A;  3VDY A;  2A6E C;  2EYF A;  3J81 E;  1X3F A;  1HNZ Q;  4FYD A;  1I3Q B;  2R92 B;  1B44 D;  3G7L A;  3IKJ A;  4BBR G;  2C35 B;  4NW2 A;  1PRT F;  2PMZ B;  4U67 3;  4EQN A;  3PSI A;  4OO1 I;  1YHQ A;  1A62 A;  2QF7 A;  3ND9 A;  1Z9F A;  4R1J A;  4A3B G;  3GTM B;  2P5Z X;  2FIN B;  4KV6 A;  3TRZ A;  2L15 A;  5BN3 A;  2F0J A;  1RF2 D;  2CH4 W;  2F0D A;  3IRB A;  1KIX A;  3I4M H;  4IOC A;  4ABN A;  1UNS A;  2UU9 L;  1BCP C;  2NWG A;  1EQT A;  4X62 Q;  4RCO A;  4UHV A;  4X66 L;  3BDL A;  2AUK A;  1SLJ A;  3CCR A;  1WFQ A;  2PZT A;  1E7Z A;  4MIU A;  1A3T A;  2F0P A;  1JIC A;  2CKZ B;  4WJ3 M;  1B1Z A;  1ENA A;  3KLS A;  5C5M A;  2QA4 A;  5C3E G;  1YJ9 A;  3J7A V;  1V1Q A;  3A0J A;  2MP1 A;  1QG7 A;  2B2T A;  1N34 Q;  3KYH C;  1SN8 A;  1N8R C;  3HOY G;  1VQK A;  4K6D A;  3K81 C;  3T56 B;  4UP7 A;  1GHK A;  1HQM C;  2QIL A;  1B8A A;  3SE0 A;  1Y8N B;  4A3L G;  4LUO A;  4UP8 A;  3M3Y H;  3P75 A;  3N6R A;  4DR7 Q;  1GOZ A;  2A6E D;  1V9P A;  2VB2 X;  4A3M G;  1G2S A;  2EOT A;  2R6G A;  3K59 A;  3RZO H;  3MXG A;  2XNA C;  5IY0 A;  5GAH C;  1Y14 B;  2DY8 A;  2ICE C;  1XNQ Q;  2Q2T A;  5DM6 3;  1A2U A;  4LF4 L;  3A7A B;  1T5E A;  1PRT B;  1WJJ A;  4C3H B;  3HOU G;  5M5X H;  3QG1 A;  4IUR A;  4ZYS A;  2FHT A;  2ALY B;  1RHP A;  4ALP A;  1PFM A;  4DR5 L;  2UUA Q;  5ELC A;  4B9X A;  4C3I B;  2UUC L;  2R7Z B;  2F0M A;  4S3S A;  1SYD A;  4WJW A;  3GTP B;  3PO3 B;  5C6A A;  4DV1 L;  1DJR D;  1FJG Q;  3EQL C;  5CV7 A;  3BDO A;  1XMQ Q;  2LFN A;  1BBX C;  4O1N A;  4CDF C;  1TWA H;  1QNU A;  4CBV A;  4DV4 Q;  5J22 A;  1Y8O B;  4TQU S;  3U50 C;  3HOW G;  1LTI D;  4NXN L;  3BYT B;  1LTB D;  1U4M A;  1CA5 A;  3CW2 C;  1R9T B;  1MBY A;  4DV5 Q;  5FLM G;  4B3R Q;  3GTG B;  2IX1 A;  3K57 A;  2ZJR A;  2EYH A;  3HOV H;  2K28 A;  2K4K A;  4LF5 L;  5DNF A;  2YTX A;  1XX8 A;  2BE5 C;  4KN4 C;  2EY1 A;  3SR1 A;  1NTG A;  1PH2 A;  4R4O A;  1HXY D;  5C4J H;  5CBA E;  1TY0 A;  2RVL A;  4A3C G;  1Y8P B;  3OWF A;  1KNE A;  1LT6 D;  1L0W A;  4JBJ A;  3S16 B;  1PTO B;  3ERS X;  3VA5 A;  3KJP A;  2K52 A;  3X3N A;  1L1O A;  4XYO A;  1JQY D;  3TSS A;  1Z47 A;  3NQI A;  2K03 A;  3D8G A;  3DWA A;  3J7Y W;  2Y0S B;  3G71 A;  4CJ1 B;  4JVZ A;  3KBX A;  3CRL C;  2E2I B;  4LUZ A;  1PFB A;  4B9W A;  4IUT A;  1EYD A;  1UAP A;  1MSG A;  4HMI A;  4DKA C;  1S5B D;  4JW0 A;  2MQH A;  3T1Y L;  2NVX B;  1YNJ C;  3ULJ A;  5FO8 B;  1DOM A;  3R93 A;  3TDQ A;  3IFT A;  2I5H A;  5K36 G;  3E6Z X;  1Q3L A;  1YVC A;  1F9Q A;  1A63 A;  2JN4 A;  2KHI A;  2JA6 H;  2PZW A;  4WRD A;  3S2D B;  4YIJ A;  3D6W A;  5ELB A;  1YJW A;  2BA1 A;  1M4V A;  2IX0 A;  5CC4 A;  4DK6 C;  3KJO A;  1PA6 A;  4N9P A;  4ZUI A;  3J81 L;  3J81 i;  2M9V A;  4KMU C;  4X3U A;  2N3S A;  1U5K A;  4GKK L;  4MTK A;  1ENC A;  1KAA A;  3TP7 A;  2CW0 C;  2F3V A;  4Y7N H;  3ULL A;  2BE5 D;  1LV9 A;  1I50 B;  2JA8 B;  1B70 B;  2RBM A;  1B4O A;  4GOP A;  4LUV A;  3UDG A;  1K0R A;  2UU9 Q;  4A3I B;  1CKN B;  4XXE A;  5C4H A;  1TS5 A;  2N8N A;  2O2L D;  3OMG A;  4X66 Q;  3CF5 A;  3L0O A;  4A75 A;  1S72 A;  3PUW A;  1Q90 A;  4E6I A;  3A74 A;  3UE0 A;  3KUP A;  4IFD J;  1DYQ A;  1H9M A;  4FO2 A;  3GD7 A;  3DWP A;  3VR3 A;  1EFW A;  1HFN A;  4NP5 A;  1BVS A;  1JCK B;  4PMC A;  3TRE A;  1NBW A;  1VF7 A;  1JB3 A;  1D5M C;  4O0A A;  3UDF A;  1EY0 A;  3I4L A;  4IJL A;  3H09 A;  1M1K C;  3GTJ H;  4DV6 L;  1OO9 B;  3HEJ A;  5C0X J;  2Y0S E;  4FXD A;  4EQO A;  2E5L L;  1WTW A;  1LTG D;  1LYL A;  4DV7 L;  1AH9 A;  2O4X A;  4P73 A;  1TVX A;  1SND A;  3J80 E;  1KD1 C;  2YU9 B;  4KHP L;  5BR8 L;  2CWA A;  3PUV A;  2D62 A; 
#chains in the Genus database with same CATH homology
 1SJE D;  4KHZ A;  5CBE E;  1BCP B;  5C4X B;  1NSN S;  1STB A;  3MVV A;  1CQV A;  1FNW A;  2RDF A;  3DWQ A;  2C5C A;  3I3C A;  4J1M A;  2CW0 D;  2K04 A;  2WV6 D;  1M8A A;  1TT2 A;  3PO2 B;  4C3J B;  1D5Z C;  1WTR A;  4G7Z C;  3KLS X;  2K01 A;  4DU9 A;  1X3P A;  2KCC A;  1SNO A;  4PV1 C;  3Q22 A;  4ZQ3 A;  5IGB A;  3BDC A;  4HCE A;  4JK1 C;  4H0L C;  1MSH A;  1STH A;  1ESF A;  1LAB A;  2YYZ A;  4A3E B;  1SFO B;  1F9P A;  1GJX A;  3Q0A A;  2PZU A;  5C3W A;  1NCV A;  3P1H A;  4DGZ A;  4QIW B;  3CQZ B;  4MN3 A;  1BUV T;  3S1R B;  1B9M A;  3GQB A;  2Z1C A;  1OXX K;  1HRJ A;  1O78 A;  4LAA A;  3TP8 A;  2BOS A;  4IUP A;  1TQO A;  5CGK A;  3HS0 C;  2IW3 A;  1MD2 D;  2F0Q A;  1TWC B;  5F2D A;  4FF1 A;  4Z9C B;  1H9R A;  1STA A;  5FK9 C;  3HP3 A;  3K6O A;  2RSN A;  1S5E D;  2A69 C;  2MJ8 A;  4IFD I;  1LTA D;  5JEA H;  3MC0 B;  3SDZ A;  4RKB A;  1RKN A;  3OOC A;  2OF1 A;  2NB0 A;  4KK7 A;  2B63 B;  1IYV A;  3N52 A;  3A56 A;  1I6H B;  1E2V A;  5C0X I;  4H13 C;  1EY7 A;  4F8M A;  2RDH A;  3VR6 A;  1TWG B;  3K7A B;  1PDQ A;  2EY2 A;  5DAU A;  1EL0 A;  3Q24 A;  1EU4 A;  1I4R A;  1OXS C;  2WKC A;  2KCN A;  2R3Z A;  5M5W B;  4K5W A;  1PZK D;  3D6C A;  2BCO A;  5M3M B;  3BZD B;  3PMF A;  4C3I G;  1B9N A;  5CV9 A;  1B53 A;  5E3F A;  4ZRZ A;  2B2U A;  3CU7 A;  3H0G B;  1SNP A;  1SSO A;  5C44 B;  1LT5 D;  3I70 A;  4ILW A;  3IFD A;  4LMQ D;  3QWN A;  5KND A;  1O7Z A;  3DXJ C;  1KTK A;  2JXM B;  4L8J A;  2WAC A;  3TBI B;  1HUM A;  4KY7 A;  4G7H C;  4OO1 G;  1C8C A;  1JE4 A;  3DMU A;  1HTP A;  5D14 A;  2C9O A;  1QOH A;  3P7J A;  1GXD C;  2PO4 A;  1E2W A;  1EIG A;  5T1I A;  1O80 A;  1Z7T A;  4TRD A;  1EZ8 A;  3HOX B;  4R8I A;  3MZ5 A;  2RDG A;  4UDU C;  1Y69 U;  3HRZ C;  1DON A;  4IAL A;  5M3F B;  2DNE A;  3NHH A;  3E0J A;  3NWS A;  4KTA A;  3KF8 A;  4FVM A;  2L11 A;  1IL8 A;  1JWM D;  1XXG A;  3S14 B;  2PW5 A;  2VNU D;  5JPN C;  2JE6 I;  1SXT A;  4RFB A;  1HCZ A;  4O42 A;  3PUY A;  4ODG A;  3C46 A;  3MXN A;  3PUX A;  1S4Z A;  5J1Z A;  1QNK A;  4FF2 A;  1JR0 D;  5EGT A;  2Q8T A;  3VYR A;  1C4Q A;  3PUZ A;  4RAU C;  1A3U A;  3C1E A;  3K5O A;  4KJO A;  1A2T A;  2F0I A;  5NUC A;  3ERQ A;  3GV3 A;  5FO9 B;  2JEA I;  3NTK A;  2IT1 A;  2HQE A;  4QB4 A;  3TP5 A;  3CRK C;  3VYU A;  3ERO A;  2ZXR A;  3K5M A;  5E4X A;  2H1E A;  3MFY A;  3BVZ A;  3HOZ B;  1EIH A;  4WFN 3;  4ZAI A;  2K5Q A;  2NZ1 D;  2PPB C;  1GHJ A;  1CHP D;  1NR4 A;  2MGS A;  4IN3 A;  3FKI B;  5G3L F;  4FF3 A;  1EEF D;  5IGG A;  4F87 A;  2EXZ A;  2ICI A;  1LLR D;  2L55 A;  4QUC A;  2BDN A;  2NN6 G;  1SJH D;  1IYU A;  5C4Z A;  2L12 A;  5KIX A;  2ZXP A;  3HGB A;  1CZG A;  4F88 A;  1CHQ D;  1SYF A;  1ILP A;  1IW7 C;  4ZLT F;  4BY1 B;  1II3 A;  5ISR A;  3JAM E;  4ZUJ A;  1PTO F;  1GUT A;  1EOT A;  2B2U C;  1ONL A;  4X3S A;  4C3J G;  3GTO B;  3I4N B;  5KYI A;  3T53 B;  1HTL D;  5D3D A;  2M2L A;  1F9S A;  4TSS A;  2A74 C;  4I7Z C;  2IWH A;  5EPJ A;  1C48 A;  4FXG C;  3EFX D;  1SAP A;  5JOB A;  5K36 H;  2GA4 B;  2F3W A;  4K8J A;  3OMC A;  4FF4 A;  5ELE A;  3H94 A;  4CJ0 B;  1U4R A;  2L9H A;  3KBG A;  3NBH A;  5AFW A;  1ILQ A;  2JYO A;  2MUY A;  2AWO A;  2KHS A;  3EVQ A;  1OXV A;  1V1P B;  5CV4 A;  3U9S A;  3Q23 A;  2OXP A;  3MHB A;  2WII B;  1J9O A;  1KDC A;  4DXF A;  5M5Y B;  2NN6 I;  1IW7 D;  2SNM A;  4EGV A;  4NKL A;  1ENF A;  5KYL A;  2O5I C;  1RD9 D;  1GUN A;  1HQR D;  3K0Y A;  1FGB D;  1Q1B A;  4BS9 A;  2D2C C;  3K5L A;  2HDM A;  1ZXT A;  4J8Q A;  5JVG 3;  2QEJ C;  4A3J B;  2CHB D;  5EJW A;  3T51 B;  1S5C D;  1WTV A;  3D4R A;  3GV6 A;  3H91 A;  1WTX A;  3FVQ A;  2E2D C;  2E75 C;  1GUS A;  1W6J A;  5I4D A;  3NSW A;  1BCP F;  2NYZ D;  1G29 1;  2D9U A;  4V0B A;  4K2K A;  1AZQ A;  4XQN A;  2F0L A;  1XTC D;  5IT9 E;  2L4N A;  1I4X A;  1ZYR C;  4KJN A;  4X3K A;  5CMD A;  4IFD H;  4C56 C;  3TME A;  3W3A A;  2AWN A;  1UUP A;  3ND8 A;  4C1N I;  1KDA A;  4K5V A;  4OL7 A;  2R61 A;  4BY7 B;  1HHV A;  1STE A;  4RHR A;  4IZ8 A;  2O5J C;  3FPU B;  5I6W A;  2NVQ B;  4L6T B;  4KY5 A;  4DXG A;  4A93 B;  3OWE B;  1Y1W B;  2B2T C;  4KN7 C;  4A3K B;  5FOB B;  4FNF A;  4UAI A;  1DD2 A;  4HAE A;  2NVY B;  4A3D B;  1RTO A;  4K8I A;  1OXT A;  1X3Q A;  1O7Y A;  3OIQ A;  2PYK A;  1UEA B;  3CKI B;  5CR3 A;  2F0H A;  3I8Z A;  1U9R A;  3FDT A;  5IGF A;  4XIG S;  3VR4 A;  3H6M A;  4QF4 A;  3JAM L;  1CT1 D;  2F0E A;  1V8Q A;  2HDL A;  4IFD G;  4KHV A;  1ZYR D;  1TU2 B;  5CYU A;  5C3E B;  3C2P A;  4IUU A;  2JA7 B;  3G6J B;  3RD4 A;  3NWT A;  3QO2 A;  1BOS A;  2FMC A;  4KKS A;  5C0X G;  2FJ2 A;  3D31 A;  5IOD A;  2F0N A;  4XT1 B;  2E76 C;  1JOO A;  1G8Z D;  2A73 B;  3DUZ A;  1EU3 A;  4HN7 A;  2KEC A;  5COY A;  3I4M B;  2FFK B;  5KNC A;  2BDO A;  2EY5 A;  5IGE A;  4RGT A;  1ZEQ X;  4RGM A;  4DAY A;  1EFI D;  2TSS A;  4DA2 A;  2RSO A;  5J39 A;  2OT2 A;  3MXU A;  3TZU A;  2NTS A;  2EYL A;  1STN A;  1ZKO A;  3TN2 A;  2KQ3 A;  1I4H A;  4H7B A;  2F0S A;  1FNU A;  2HCI A;  1QWY A;  3SXH A;  2JEB I;  3M3Y B;  3NK9 A;  3BYY B;  3VR5 A;  1VF5 C;  2F03 A;  1JWS D;  1Z6H A;  2X6G A;  3RZO B;  1VCI A;  3NXW A;  1D6E C;  4J6H A;  1EY4 A;  1E2Z A;  4OO1 H;  2F0G A;  1T5X D;  5M5X B;  3X3M A;  2QCP X;  5CV8 A;  2FMM A;  2NUC A;  1I6V C;  3SVM A;  2HUG A;  1GUW A;  4BA2 I;  1PRT C;  2XSC A;  1BR9 A;  5A2Q E;  5IT9 L;  1TY2 A;  1MI2 A;  1PTO H;  4ULL A;  1R4Q B;  4C3H G;  1TWA B;  2V4D A;  5JEA J;  4ID6 A;  4XQJ A;  2J7Z A;  1V1O A;  1JOQ A;  3QIA A;  3L7Z C;  2AUJ D;  1I4Q A;  3AB9 A;  1WVL A;  1HPC A;  4RWS C;  1SMY C;  3HOV B;  2EE1 A;  5D65 A;  4CKB A;  1PZJ D;  3OHX C;  5EBC A;  2DY7 A;  1D5X C;  2EDG A;  2WP8 J;  5C4J B;  5KEE A;  3M4Y A;  1HUN A;  5EKL A;  4AYB B;  4RHS A;  2F4I A;  3NE5 B;  4CHT B;  4QUF A;  1DOL A;  1G6Z A;  2I07 B;  3WDN A;  3SK6 A;  4OIJ A;  3AU7 A;  1AZP A;  3O13 A;  3V2T A;  2NTT A;  4NMZ A;  2G9D A;  1F2L A;  2EZV A;  4XT3 B;  1TR5 A;  1PRT D;  4BA1 I;  3SHL A;  2XN9 C;  2F1M A;  1CM9 A;  1WTP A;  3TP6 A;  4QCL A;  2JA6 B;  2AQ1 B;  2VXW A;  4CGY B;  5JJZ A;  3S9W A;  2PNR C;  5I9P A;  2KUM A;  3VYT A;  3LWE A;  2ENB A;  1F2Y A;  1SYE A;  4OGQ C;  1IKM A;  1SMY D;  2KEE A;  4EQP A;  2WB1 B;  1B50 A;  2PQE A;  3I72 A;  1ET6 A;  5K5P A;  3ZYY X;  4CKE A;  1EYC A;  2AQ2 B;  4N9T A;  2K5W A;  3P20 A;  4Y7N B;  5BN5 A;  3R2T A;  1H9J A;  2NN6 H;  2F0U A;  2KJX A;  4Q5V A;  3L3O C;  1YNN C;  1LT3 D;  3F2U A;  4HED A;  5A35 A;  3A8K E;  2EJF C;  2B8G A;  2EJM A;  1SEB D;  1TS2 A;  4R9W A;  1PTO D;  3QOL A;  1E0B A;  3MA2 B;  1B3A A;  3MFG A;  3T4A C;  1EY5 A;  3GTJ B;  5KGU A;  1V43 A;  2WAQ B;  3T16 A;  1FYC A;  3FEW X;  4K5X A;  3KLR A;  2EYO A;  2AQ3 B;  5LHY 1;  3PV0 A;  5C5L A;  4BWG B;  2K1B A;  1QB5 D;  3AMU A;  3MTS A;  5M9O A;  2R93 B;  1RJT A;  4JBW A;  4P2C B;  3J7A F;  3SK8 A;  3MWY W;  2F0F A;  1D1K A;  4WOR A;  2QKI C;  3S1N B;  2D5D A;  5IOC A;  4Q0F A;  1YNN D;  1STG A;  2LY7 A;  2JSO A;  1HFG A;  4A3F B;  5A2Q L;  1EQV A;  4M8A A;  3NTI A;  1XYI A;  2E2H B;  4XYQ A;  3S15 B;  3ITP A;  1LO5 D;  1PLF A;  1LT4 D;  2SDF A;  5I2Y A;  1R4P B;  1SE4 A;  1S5D D;  5JAV A;  1ESR A;  4CJ2 C;  3R3O A;  2EJG C;  1SDF A;  2EPB A;  3L9A X;  3FRP B;  4RCN A;  2LS0 1;  4KKT A;  2JA5 B;  3WOE A;  3QB3 A;  1RTN A;  1QJO A;  2F0V A;  2K05 A;  2KA7 A;  3ONA B;  3I91 A;  2Q8I B;  1L0X B;  3FPP A;  5C3X A;  4DF7 A;  4G57 A;  1F2Z A;  2RKS A;  2B2V A;  1H9S A;  3HKZ B;  5EKI A;  1QE6 A;  4I65 A;  5COR A;  1BCP D;  1Q1E A;  1ICW A;  4XDX A;  1D1I A;  5CV6 A;  2A5H A;  4BBS B;  1WD0 A;  2JP1 A;  1BDO A;  3A7L A;  3C3L A;  5FLX E;  1RCV D;  4H44 C;  1VDZ A;  1AFP A;  1Y1V B;  4G4K A;  3PIO 3;  2HCC A;  4DK1 A;  4A3G B;  3NUC A;  1SE2 A;  4PMW A;  4IQZ A;  3S17 B;  1CI3 M;  4PMB A;  1STY A;  1DZ1 A;  2G9H D;  1B2T A;  1VMC A;  1MGS A;  2IL8 A;  3OIP A;  2PCF B;  3PIP 3;  1F2M A;  3NP8 A;  1LTR D;  1SNC A;  1PFN A;  1FR3 A;  4NDX A;  1SNM A;  3IL8 A;  4F7X A;  1K8M A;  5FO7 B;  5EQ0 A;  3VR2 A;  2B2W A;  3NTH A;  2CVR A;  3OPO A;  3EJI A;  1H9K A;  1TKW B;  2NVT B;  5HUR A;  4KD3 A;  2X69 A;  4RGO S;  1IHZ A;  1PZI D;  1AP0 A;  3K58 A;  2I46 A;  1Q12 A;  5JVH 3;  1SYG A;  2KOL A;  3QJY A;  2XWB B;  1HA6 A;  3RLF A;  2IJ0 A;  3DM1 A;  1ROD A;  3RMH A;  1WTO A;  3GTQ B;  1JOR A;  2E74 C;  3D4W A;  5IIF A;  4KY6 A;  5EPL A;  2B2Y A;  4LJZ C;  2ZT9 C;  1EWH A;  4CKC A;  3Q6S A;  4ZKC B;  2EYM A;  3V96 A;  4LK1 C;  2XWJ B;  4RGN A;  1EZ6 A;  4HCS A;  5KNB A;  1TII D;  1PXU A;  1JC7 A;  3QOJ A;  5C0X H;  1BO0 A;  4GZY C;  2OEO A;  3I90 A;  4BBR B;  5ELF A;  4OHJ A;  3W2D A;  3DEP A;  1SE3 A;  2TMP A;  3TZD A;  3LWU A;  2Z4H A;  4A3B B;  4MHE A;  1EY9 A;  4DAP A;  3T13 A;  2LMC B;  1V1P A;  1GUG A;  5E4W C;  2Z8L A;  4K14 A;  1YNJ D;  5FKA C;  1RDP D;  1QIL A;  2XRS D;  2K7V A;  2SOB A;  1KDB A;  3DHQ A;  1EY8 A;  1PMR A;  3RZD B;  1G2T A;  1A15 A;  2SEB D;  2K32 A;  5EPK A;  3SEB A;  1TWH B;  2L1B A;  4DNT B;  4M1U B;  1KNA A;  3HOY B;  4HR7 B;  2SNS A;  4FXK C;  4EVO A;  2F0K A;  2L0C A;  1LTT D;  1U4P A;  1F77 A;  2B2V C;  1AW7 A;  2EY6 A;  5HGT A;  3MAQ A;  2XIW A;  4A3M B;  1JOK A;  1CK1 A;  5CV5 A;  5LL6 S;  1KLU D;  3LNN A;  4IUQ A;  3D3R A;  2F0O A;  1WCM B;  5DM7 3;  2WIN B;  4FP5 D;  4RKL A;  3V05 A;  5D3I B;  3R8B A;  5E1F A;  3HOU B;  2ZXO A;  2LKV A;  3DEO A;  3NBI A;  1K8O A;  2DNC A;  5KRU A;  4U68 A;  1SYC A;  3E5S A;  3I73 A;  3K5N A;  3A8I E;  2EVB A;  3URY A;  1F9R A;  3HG9 A;  2K6A A;  1HA5 A;  4XQQ A;  4B08 A;  3VA7 A;  5FLX L;  1PYW D;  4RA8 A;  1EEI D;  1XWE A;  1TWF B;  2F0T A;  3HOW B;  3A8J E;  1X32 A;  2VUM B;  3GP7 A;  1KAB A;  1I4P A;  1OXU A;  4ME5 A;  5ELD A;  2MPM A;  2KVM A;  3M7G A;  2PW7 A;  3M4O B;  2Q8R E;  1NR2 A;  2ID0 A;  3S2H B;  2B2W C;  3GO5 A;  1SNQ A;  3GTK B;  1I4G A;  4XTC S;  1L0Y B;  4TKO B;  3BG3 A;  4DFA A;  1G91 A;  4PNY A;  4DK0 A;  2IX3 A;  1EY6 A;  3M85 A;  3OSO A;  1LAC A;  1NAP A;  2MHV A;  1BF4 A;  1U4L A;  3VYS A;  1S5F D;  1DCZ A;  3R2I A;  1Q8I A;  1SYB A;  2IPK D;  3KK7 A;  1A3V A;  1CQF A;  5BN4 A;  2J0T D;  3BVG A;  4HMJ A;  4KD4 A;  2B2Y C;  2CQA A;  3LX0 A;  1A6X A;  1WTQ A;  2B8F A;  2M00 A;  5DEH A;  2K5D A;  3WOF A;  4DAV A;  1O7L A;  3H3V C;  4ZKB B;  2XRQ D;  5T1G A;  3A54 A;  1FNV A;  3CHB D;  2A68 C;  2F0W A;  2EYP A;  1LTS D;  2A6H C;  1DXM A;  2RA4 A;  3OW7 A;  4DNR B;  5JPM C;  5I2X A;  5EBD A;  2N55 A;  3S1Q B;  2KED A;  4K6L A;  2VB3 X;  4KKU A;  2DN8 A;  2EYJ A;  1CZW A;  3HZX A;  1CFM A;  4V19 0;  2Z4I A;  3BS1 A;  5I6Y A;  3BVM A;  3M7N A;  3C1F A;  5JEA G;  1W6K A;  2QDB A;  3GTL B;  1NUC A;  1JWU D;  2A69 D;  1J8I A;  4G7O C;  4K2L A;  1IKL A;  1PTO C;  4IUV A;  4HSV A;  3UI2 A;  4C1N K;  3MEH A;  1TS4 A;  4L63 B;  1BNZ A;  3FMC A;  2J4X A;  4DN4 M;  1FD7 D;  5LL6 X;  2N88 A;  3J80 L;  4C2M B;  1CA6 A;  1GUO A;  2NBF A;  2K33 A;  5IGD A;  1QCB D;  1DM0 B;  1BQQ T;  1ML0 D;  2A68 D;  3S1M B;  3MXP A;  1AN8 A;  2A6H D;  1TS3 A;  3NQT A;  4KI0 A;  1DOK A;  1EWC A;  3RUZ A;  1KLG D;  3IAY A;  4PQX A;  1BXT A;  1CTM A;  5G3L D;  4HSP A;  1SBB B;  2E2J B;  4HTH A;  3D4D A;  4QMG A;  2L5T A;  3U9O A;  3SK4 A;  4IUN A;  1K83 B;  1WD1 A;  1D2B A;  4RH6 A;  5IGC A;  5EKK A;  2B39 A;  1EYA A;  2BA0 A;  1ET9 A;  4X3T A;  2H4O A;  5I9O A;  2X6L A;  2RQX A;  1VMP A;  4ZK9 B;  3SK5 A;  4R8N A;  1H9S B;  3EA6 A;  4OIK A;  3A55 A;  3NPP A;  5TSS A;  2WKD A;  1AEX A;  2XVS A;  2A6E C;  2EYF A;  3J81 E;  4FYD A;  1I3Q B;  2R92 B;  1B44 D;  3G7L A;  3IKJ A;  4NW2 A;  1PRT F;  2PMZ B;  4U67 3;  4EQN A;  4OO1 I;  2QF7 A;  3ND9 A;  3GTM B;  2FIN B;  4KV6 A;  5BN3 A;  2F0J A;  1RF2 D;  2F0D A;  4ABN A;  1UNS A;  1BCP C;  2NWG A;  1EQT A;  4RCO A;  3BDL A;  2AUK A;  2PZT A;  4MIU A;  1A3T A;  2F0P A;  1JIC A;  1B1Z A;  1ENA A;  3KLS A;  5C5M A;  3J7A V;  2MP1 A;  1QG7 A;  2B2T A;  4K6D A;  3T56 B;  1GHK A;  1HQM C;  2QIL A;  3SE0 A;  1Y8N B;  3P75 A;  3N6R A;  1GOZ A;  2A6E D;  2VB2 X;  1G2S A;  2EOT A;  2R6G A;  3K59 A;  3MXG A;  2XNA C;  2DY8 A;  2ICE C;  5DM6 3;  1A2U A;  3A7A B;  1T5E A;  1PRT B;  4C3H B;  3QG1 A;  4IUR A;  4ZYS A;  2FHT A;  1RHP A;  1PFM A;  5ELC A;  4B9X A;  4C3I B;  2R7Z B;  2F0M A;  4S3S A;  1SYD A;  4WJW A;  3GTP B;  3PO3 B;  5C6A A;  1DJR D;  3EQL C;  5CV7 A;  3BDO A;  2LFN A;  1BBX C;  4O1N A;  4CBV A;  1QNU A;  5J22 A;  1Y8O B;  4TQU S;  1LTI D;  3BYT B;  1LTB D;  1U4M A;  1CA5 A;  1R9T B;  1MBY A;  3GTG B;  2IX1 A;  3K57 A;  2EYH A;  2K28 A;  5DNF A;  1XX8 A;  2BE5 C;  4KN4 C;  2EY1 A;  3SR1 A;  1HXY D;  5CBA E;  1TY0 A;  2RVL A;  1Y8P B;  3OWF A;  1KNE A;  1LT6 D;  3S16 B;  1PTO B;  3VA5 A;  3X3N A;  4XYO A;  1JQY D;  3TSS A;  1Z47 A;  3NQI A;  2K03 A;  3D8G A;  3DWA A;  3J7Y W;  2Y0S B;  4CJ1 B;  3KBX A;  3CRL C;  2E2I B;  1PFB A;  4B9W A;  4IUT A;  1EYD A;  1UAP A;  1MSG A;  4HMI A;  1S5B D;  2NVX B;  1YNJ C;  5FO8 B;  1DOM A;  3TDQ A;  3R93 A;  3IFT A;  5K36 G;  3E6Z X;  1Q3L A;  1F9Q A;  2PZW A;  4WRD A;  3S2D B;  4YIJ A;  3D6W A;  5ELB A;  2BA1 A;  1M4V A;  2IX0 A;  5CC4 A;  4N9P A;  4ZUI A;  3J81 L;  2M9V A;  4KMU C;  4X3U A;  1ENC A;  1KAA A;  3TP7 A;  2CW0 C;  2F3V A;  2BE5 D;  1LV9 A;  1I50 B;  2JA8 B;  2RBM A;  1B4O A;  4A3I B;  4XXE A;  5C4H A;  1TS5 A;  2O2L D;  3OMG A;  4E6I A;  3PUW A;  1Q90 A;  4IFD J;  3KUP A;  1DYQ A;  1H9M A;  4FO2 A;  3GD7 A;  3DWP A;  3VR3 A;  1HFN A;  4NP5 A;  1JCK B;  4PMC A;  1VF7 A;  1JB3 A;  1D5M C;  1EY0 A;  3I4L A;  3H09 A;  1OO9 B;  3HEJ A;  5C0X J;  4FXD A;  4EQO A;  1WTW A;  1LTG D;  2O4X A;  1TVX A;  1SND A;  3J80 E;  2YU9 B;  3PUV A;  2D62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...