2B8FA

Solution structure of bacillus subtilis blap apo form (energy minimized mean structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin/Lipoyl Attachment Protein
publication title solution structure of Bacillus subtilis BLAP Apo form (energy minimized mean structure)
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b8fA00
5K36G 1GUTA 2A6EC 2BA0A 2BDOA 2A68D 3M4YA 1GUSA 4XTCS 1EWHA 4XIGS 3KLRA 3LNNA 4DNRB 1Y8PB 1H9MA 5KNCA 2BE5C 3OPOA 4JBWA 2B8FA 2NN6H 4HR7B 2A6HD 1PMRA 4DK1A 1G291 1SMYC 3D31A 3VR5A 1ONLA 5C0XH 1VF5C 1H9SA 1VF7A 3ND9A 5BN3A 2QF7A 3I73A 4G7OC 1CFMA 1B9MA 3ND8A 1H9KA 1OXXK 2JE6I 2AWOA 2K32A 2L5TA 4IQZA 3T51B 4H0LC 1Q1BA 2ZT9C 3IFTA 3QIAA 3SE0A 4BA1I 4L8JA 4G7HC 3CRLC 4I7ZC 4KN7C 3GD7A 2A6HC 3TZUA 4DK0A 1OXVA 3N6RA 4H13C 4OO1H 3PV0A 3WDNA 3QJYA 3H94A 3MFYA 3VA7A 1GHKA 4KN4C 1I6VC 3PUZA 3T56B 2EDGA 3W3AA 1OXTA 5A35A 3IKJA 2CW0C 4LJZC 2Q8IB 4IFDG 1LABA 2AUKA 3MXUA 1VDZA 3GQBA 1Z7TA 1TU2B 3PUXA 2F1MA 2YYZA 5KNBA 1T5EA 3M85A 1QJOA 1E2WA 3VR2A 1E2VA 3VR3A 3VR6A 4GZYC 4TQUS 1HCZA 3I4LA 2A68C 1ZYRC 3FMCA 1Y69U 2PNRC 1CI3M 3OOCA 1IYUA 2B8GA 4JK1C 2NN6I 3DXJC 1GJXA 4KKSA 2DNEA 3AB9A 4KKTA 1K8MA 4RCNA 2D5DA 3RLFA 2A69D 2EJGC 1HPCA 2K33A 5JEAH 1GUNA 1YNNC 4LK1C 5K36H 1A6XA 1K8OA 4DNTB 3EQLC 4KMUC 3T53B 1IYVA 1FR3A 1TKWB 2E75C 2NN6G 4TKOB 3D4RA 2DN8A 5C0XG 1Q12A 2EVBA 2AUJD 2E74C 3A7LA 1IW7D 1DCZA 5BN5A 1OXUA 2A69C 1Y8OB 2K7VA 2O5IC 1ZKOA 2JXMB 4H44C 1O78A 5BN4A 4KKUA 4BA2I 3PUVA 3U9SA 1GUOA 2KCCA 1FYCA 3A8KE 3A8JE 4G7ZC 1H9SB 4OO1G 2JEAI 1V8QA 1DD2A 1IW7C 1VCIA 2IT1A 3QG1A 4KHZA 3LWUA 2BA1A 1HTPA 3PUWA 3PUYA 5KNDA 4KI0A 3CRKC 1Q1EA 2R6GA 3FPPA 3A8IE 1B9NA 1Z6HA 1BDOA 3A7AB 3L7ZC 1Q90A 1GHJA 2EJMA 2V4DA 4IFDH 1GUGA 3VR4A 1H9RA 1LACA 2EJFC 4PV1C 3BG3A 4OGQC 2DNCA 1YNJC 2PCFB 1H9JA 3SDZA 2LMCB 2D62A 3NE5B 1DXMA 2KA7A 2A6ED 3HGBA 2O5JC 1OXSC 2D2CC 3OW7A 2JEBI 2BE5D 3BDOA 1CTMA 3M7NA 2PPBC 3I72A 1HQMC 1E2ZA 2E76C 3P20A 5JEAG 1V43A 1O7LA 1Y8NB
chains in the Genus database with same CATH superfamily
4KHPL 5ELNA 3BS1A 4YIJA 3S16B 2WP8J 3NP8A 1J9OA 1IL8A 4RH6A 4ABNA 4DK1A 4X62Q 4DV0Q 2OCEA 2F0KA 2WKCA 2MHVA 3I4NB 1LT3D 2CQOA 3HOUG 3NBIA 1T9HA 4XXEA 5EAYA 3M3YH 1SSOA 3RR5A 2RCFA 5CBAE 3CRLC 4DXFA 1AP0A 3KF6B 1UNSA 3F1ZA 4PZ7A 5M5WH 1WTVA 4OO1H 1VQFA 2JA6G 3VA7A 1EY8A 2Z9HA 4TRDA 4IPGA 5GQOA 4LW1A 5IYBH 4ZLTF 1SNOA 4IO9A 4K0KL 4L5RC 1CI3M 5C44G 3CCSA 1KD1C 3S14B 3TP8A 3K7AH 2EYMA 4GKJQ 2NTSA 4DR1L 3E6ZX 4KKTA 2VUMB 1O80A 1HR0L 3KJOA 2OTLA 4IUPA 5HURA 1DM0B 2FMMA 4LF9L 3G6EA 2A19A 3S1RH 4XT3B 3J80L 4PMBA 2EVBA 2Q2IA 4CDDC 4OO1I 3KLWA 3OTOQ 2B2VC 2E2IB 1STBA 1SROA 1RL2A 3PUVA 4A3CH 1IBLL 4FXGC 1CHQD 3GTMH 2ICIA 1TWHB 1X9NA 2HIVA 2RQXA 3MVVA 4HMIA 4ULLA 1TWFB 1I3QB 1B3QA 4OEMB 4IN3A 1V1QA 2EIFA 2CVRA 4YWLA 5IT9E 4RG1A 1Q90A 2EJMA 1IL2A 2V4DA 4MTKA 3K58A 1NNXA 2HD3A 4QMGA 4ZQ3A 2PCFB 1VQMA 1H9JA 2KA7A 4V0BA 3CPWA 4RKLA 1JOKA 1K3BC 1UE5A 4YWKA 4L63B 1HJPA 2K52A 2E5LL 5JJLA 1E1OA 3T1YQ 1SYFA 2H4OA 5IGCA 1HNZQ 1XYIA 1U4RA 1FGBD 4P73A 4GS3A 3UDIA 2I07B 3DWAA 1Q81C 4DR4L 1D1KA 3K8AA 3AEVA 1SYEA 1R9TB 2F0MA 5D65A 1U0LA 3VYRA 4G7OC 1BCPB 2QF7A 1G2SA 1S40A 3STBC 1II3A 3G4SA 1H9KA 4K0KQ 3SE0A 4CDCC 3M4OB 2NVYB 1SXTA 2K6AA 3IRBA 1TXYA 3H94A 3HOYG 3UE0A 1PH7A 1HHVA 3W3AA 3V96A 1YIJA 4LF9Q 1EQRA 1HNWQ 2F0HA 5JVG3 4K2LA 3C2PA 2QEJC 1Z7TA 4N9TA 2R92B 1TU2B 2F4VQ 3PUXA 5I2YA 1PH2A 2PW7A 3CCLA 4DV7L 1HA6A 3V2TA 4C3JH 1VQBA 1LT5D 1A0IA 3I4LA 4L5QA 1RCVD 1WJJA 2G9DA 4IPHA 4EQ5A 3KDFB 1MJCA 2HDLA 3S24A 4F87A 4HIMA 4LNQA 1YJ9A 3PO2G 2D0OA 2ZM6L 4LF5Q 3GTQH 1IXRA 3J80i 5IY0A 2EZVA 3PIOA 1SYGA 5JJIA 5JPMC 1CT1D 3T1HL 3HOUH 4DAMA 1JORA 2ZTEA 1QVGA 2AKWB 5CMDA 2F0DA 1MSGA 1HZBA 3K5LA 3S1MH 1QNUA 2JEAI 1EZ8A 1KAAA 2JA6H 1JQYD 1K9MC 1VQ4A 1G6PA 3F8TA 1XMOL 5FO7B 4POFA 4X65L 1QVCA 2JA8G 2KHSA 3S2HB 1CKMA 4A3IB 5IIFA 4IUNA 1D7QA 4DN4M 4A3BG 5FLMG 2FINB 3A55A 4JI5L 3BDOA 1EY0A 3KLSX 3TDQA 3I72A 1RF2D 1XMQQ 1V43A 3NQIA 3A56A 3MWYW 3PIPA 3DLLA 2Z8LA 3L2PA 4DNRB 3NELA 2A74C 1SNPA 5M3MB 4BY1B 3NK9A 4LF6Q 2IX3A 3I56A 4B3SQ 2EE1A 2EPBA 4OWWB 1G51A 4IPDA 3ND8A 2RBMA 1NTGA 2YU9H 2RDHA 5DAUA 4IQZA 4BA1I 2WAQE 1VQKA 1A8VA 3TP5A 4GLVB 3RNUA 1SEBD 4NKLA 2E2HB 4YCVA 1S5ED 1RDPD 1I6VC 3TEHB 4RKBA 4A3EH 1Y14B 4ID6A 2JK8A 1PFBA 3OMCA 4LF7Q 2Z6KA 4HJ5A 5KNBA 4GNXA 2LXJA 1E2WA 2A1AA 4FDBA 2N78A 5DM63 2KHIA 4GN5A 3K81C 4JK1C 1IKMA 2FFKB 3DXJC 3K59A 5M5XB 2DNEA 1YNJD 1R4QB 2WINB 5T1IA 3HP3A 2H1EA 2WACA 1XMOQ 1SE8A 2PW5A 3JAMc 1QNKA 3QR8A 2UXDL 4C3IB 5GADC 1AZQA 1EY6A 1OXUA 5IWAL 1EY5A 1PYBA 3SK5A 4CKBA 2N88A 4U68A 2K7VA 1L0XB 1V1OA 1O78A 4JI2Q 1HTLD 3SR1A 3LX0A 1O7IA 4JI5Q 1B7YB 3BZKA 5JOBA 3SEBA 1MD2D 3R3OA 4XT1B 4IOAA 5I9PA 3HOYH 2R6GA 2JA7B 4XYQA 3FPUB 1FJGQ 1I6HH 4DR2L 5KGUA 3PMFA 3DEPA 5C3XA 5C4JH 3NBHB 2EJFC 4QL5A 3HOXG 2MQHA 3ER0A 4APVA 2R7ZB 2FXQA 2K03A 2UUCQ 1D2BA 3HGBA 2CHBD 1YJWA 3OWFA 3E5SA 2NVTH 4BY7B 3P20A 5JEAG 4EQPA 2KQ3A 4K5WA 3WWVA 2SNMA 3KOJA 3PO2H 3M4YA 4EQOA 2JA5B 3HOWB 1F2MA 3AYHB 2O4XA 1H9MA 1LTBD 2EXDA 2V1CC 3OPOA 4P2CB 1PYSB 2B8FA 3ONAB 5BR8Q 1IKLA 4C3HB 1VF7A 1H9SA 2CKZB 1Y1VG 2M2LA 3R2TA 3QB3A 5C5MA 1DOLA 1H95A 3MFGA 5ELEA 2K50A 4PNYA 1EIGA 3PGZA 2A5HA 1C8CA 1F77A 2XWBB 4BBRB 4HSVA 3DWQA 1VQOA 4JI1L 1N9WA 1ESRA 2DUDA 3R2IA 2QDBA 5G3LD 3ERQA 4CGYB 4WJ3M 2F0UA 2JA8H 3RZDB 4LFBL 2F1MA 5IWAQ 3HKZE 3QOJA 5D3IB 1PYWD 1STYA 3NWSA 1B8AA 2SOBA 4IZ8A 5E4WC 2BDNA 2CCZA 4QCLA 2MJ8A 4A3BH 3J81L 5FLMH 3S15B 2VY3A 1MGSA 3TZDA 2VQEQ 2A69D 1HPCA 1PTOF 2DGYA 4KTAA 1EOTA 4ZKCB 1LTSD 2L9HA 1SDFA 2IPKD 2EYPA 5JJKA 4DUZQ 2YTYA 4QB4A 5LL6X 1WD0A 2IY5B 1SRUA 2WKDA 1SE4A 3HOVG 2I5MX 4L5TA 1G6ZA 1R4PB 1Z47A 5ELOA 1QILA 2ZXPA 2KCCA 1LTRD 3A8JE 2NZOA 4DFAA 5EPLA 3MTSA 3QG1A 3EVQA 4HCSA 1IBKQ 2OT2A 3DUZA 4RMFA 4N9PA 1BO0A 3OHXC 1N36Q 3KBXA 1YNJC 2N3SA 1FNWA 3X3NA 3ULPA 3ICEA 1BF4A 4A93G 5M3FB 1HZCA 1PZKD 4GNXB 1E2ZA 2B2WA 1NMFA 2BOSA 3TS2A 2VW9A 4K14A 1D5MC 1I4QA 2WAQB 1Y8PB 2BE5C 4HR7B 3OSOA 1V9PA 1GO3E 2ZTCA 5FLXL 2GVAA 5C3WA 1LTLA 5LMUL 1RODA 4JBKA 3I4NG 4H0LC 1K83H 1GOZA 4A3JB 4RHSA 4LUOA 4IUUA 4UY8C 2PZTA 3TZUA 1WTXA 1GXDC 5I4DA 1M1KC 4FVMA 2IJ0A 3NXWA 1IYJB 2ZXRA 1K0RA 2KCMA 4GOPC 4XDXA 1Q8KA 3PCOB 1STNA 1XNQL 1BKBA 3RZOH 4DAYA 3S2DB 1AE3A 2L12A 3JC66 4DV2Q 2VL6A 4DK3C 2PZWA 4DV1Q 5LMNQ 4B3RL 3J81i 3LWEA 2E2JB 3CW2C 5EKIA 4TVAB 2LFNA 3GTJH 4OONA 3CF5A 1WTPA 5JEAH 1STAA 1KRTA 1O7ZA 3CMEA 1TT2A 1EQVA 2VUMG 2L1BA 3TREA 4WJWA 1EY9A 4X62L 1X54A 4Y7NB 1TWGH 5EBDA 2O5IC 1N8RC 3A54A 1VQLA 3CCEA 1F9QA 1S4ZA 5JAVA 1TY2A 1H9SB 2HCIA 1VQPA 3OYYA 1IW7C 1BBWA 3M4PA 1CQFA 3LWUA 5I2XA 4JI0Q 1VQNA 2F0TA 1BDOA 3L7ZC 3MXPA 1WTWA 4R9WA 1NCVA 4PV1C 4RWSC 3G6JB 1PRTF 2K5HA 3NE5B 1LO5D 4DKAC 2XVSA 5CV5A 2JEBI 3MHBA 5KRUA 1IBML 2PPBC 2L4NA 5IYCG 3DHQA 1ENCA 3K0XA 4QUFA 3STBD 1EFWA 1YITA 2A6EC 4KLKA 4XTCS 1EWHA 1TS3A 4ZRZA 4KJOA 4B3TQ 4A3DB 1W2BA 3AQQA 2K5QA 4MN3A 3HOVH 4EX5A 3L0OA 1D5ZC 1SBBB 1S3OA 3QIAA 2F0WA 1WD1A 4L8JA 3GTGB 1PA6A 1SYDA 1F2ZA 2IL8A 3T56B 3ULLA 4QJFA 4R4IA 2ZXOA 1J5EQ 5K5PA 2AQ2B 3P75A 2OQKA 1BOSA 1TWAB 1TQOA 2DJFC 4Y52H 1CZGA 2O2LD 3PO3B 2R92G 3C3LA 1HCZA 1PDQA 1ZYRC 3U50C 2XRQD 4HJ7A 1B2TA 1ZEQX 3VYUA 3CHBD 2ENBA 4GN4B 2KBNA 3T1YL 1AEXA 1HNZL 3RLFA 3OIQA 1KXLA 3EQLC 5FO8B 4PQXA 2KCTA 4DV4Q 4LF4Q 4GKKQ 1SN8A 4O1NA 3IL8A 1PZJD 2KEEA 3A7LA 4ALPA 1UUPA 4JCVE 4HN7A 3VDYA 3K7AB 2F0NA 4H7BA 5BN4A 3I4NH 1I50B 3BVZA 2UU9Q 1IBMQ 2E8GA 1FNVA 4PZ6A 3S1RB 2IT1A 3O13A 4ILWA 3TS0A 1B9NA 2F3IA 5FK9C 1YVCA 4HMJA 3QOLA 3RUZA 5LMNW 1HNWL 4Q0FA 1UEBA 1B44D 4O2DA 1H9RA 2F4VL 3T13A 5COYA 1DXMA 4PG3A 3A0JA 2IX0A 3SK6A 3RN2A 3I8ZA 4A3IG 3HOZB 4DAYB 1KDAA 5FJ8G 4B9WA 1CKNA 2OF1A 3GTLH 3TN2A 2VQFL 1D5XC 2R93B 4R8IA 5C3EB 3S14H 2WB1E 1Y8NB 2JYOA 2FHTA 2YTXA 3EFXD 4S3SA 1QE6A 4LF5L 2VUMH 4BBSH 3PF4A 2Z0SA 2ATWA 4A3KB 1A3VA 1W3SA 1QG7A 1S72A 4JG2A 5CBEE 5M3MG 4HEDA 3CQZB 1MBYA 3I73A 4BY1G 1JB3A 2B2VA 2UXBQ 5C0XJ 2AWOA 4A3FB 1B1ZA 2B2YA 4V190 1IZ6A 1UAPA 3J7ZC 1B53A 3CMAA 1LTTD 2E2IH 2I46A 4CJ2C 4DK0A 1L1OC 4H13C 4PMCA 1NJIC 3D4DA 1UE7A 3DWPA 4POGA 1M8AA 4DR3L 4R4CA 1TWHH 3MA2B 4DR7Q 1TWFH 1K28A 3GQBA 2K14A 3QO2A 3SK4A 2JQOA 2ALYB 3CCQA 2F0EA 4JV5Q 4KV6A 1SNCA 4QUCA 3EROA 5GAGC 2I5HA 3Q23A 3S1NB 4JW0A 4KKSA 4RCNA 5FO9B 1XMQL 4X3TA 1OO9B 2K33A 1VQ8A 3DMUA 2RDFA 4MHEA 2KUMA 3BDLA 2Q2HA 3NHHA 4C3JB 1PLFA 2PI2E 4JYAQ 3HFZB 4LF6L 5BN5A 4BS9A 5IOCA 3MC0B 4B3SL 4C3IG 4NB3A 3AMUA 2NVQB 1ILPA 4O42A 4ZK9B 3D4WA 3PQIA 4IPCA 1EWCA 2VQFQ 3M4OH 2GN5A 1K73C 2NVYH 5CV9A 3KBGA 4J6HA 4QIWB 3FRPB 3JAME 4MZ9A 3SXHA 1DOMA 1TS4A 1KHIA 4WJ4A 1VQ5A 4K6DA 1V1PA 5CC4A 5D3DA 5L37A 3K5NA 2JA7G 3HOUB 4LF7L 3J7AV 4RGMA 1SE2A 2PI2A 5EJWA 3UDFA 3NUCA 1HXYD 4LFAQ 1ICFB 2R92H 1VQEA 2R7ZG 1EYDA 1PTOB 2ZTDA 3CC2A 2F0VA 1CKOA 3AU7A 1PH4A 1J6QA 3M4QA 2EYFA 4DAVA 4DR3Q 4BY7G 2F0IA 2F52A 3K7UC 4A3MB 1PH9A 2F4IA 2BA0A 2A68D 3I4OA 1ENFA 2D9UA 5CGKA 3CCMA 1JWSD 5A2QE 1A2UA 2JA5G 3HOWG 1GUWA 2B63B 2JJQA 2B29A 1WYDA 2F0QA 1PFMA 3M7GA 4C3HG 4C2MB 1I4PA 4FXDA 4A76A 1LV9A 2HT1A 3CXCA 3FDTA 4JI2L 1WTOA 1M4VA 2HQEA 4G7HC 4DR5Q 3RN5A 4I7ZC 4KN7C 5C44H 3V05A 5J1ZA 1UE1A 2RDGA 2HHHQ 1JB7A 1A2TA 3MFYA 5CV8A 3I3CA 4XQJA 3PUZA 1QCBD 5LHY1 1BBUA 3GV6A 4BBRG 5IGDA 1KQSA 2N55A 4B3MQ 1VQDA 1BNZA 4DUYQ 2YU9B 1FJGL 1LUZA 1WTHA 1YNXA 4ZAIA 5IT9c 3H0GB 4DK6C 1CA6A 1QJOA 3S2HH 1C4QA 1YJNA 3NENA 2UUCL 4A3IH 3U4ZA 4CKEA 5FJ8H 2XSCA 5AFWA 2J4XA 1JICA 4GN3B 3JAML 4A3EB 3H15A 4CJ1B 4OX9Q 1VQ6A 2QILA 5CV6A 4H02A 4LK1C 2QA4A 1A6XA 1O7YA 1CKNB 2ES2A 3CCVA 1WI5A 1NUCA 3BYYB 1X32A 2N8NA 5BR8L 4GNXC 1ML0D 4NXMQ 4BY1H 4KKUA 3SVMA 4BA2I 3NTKA 1RKNA 1A15A 3DEOA 1QOHA 2KCNA 4UPAA 4E6IA 2LSSA 1QZGA 4X64Q 4M1UB 4G7ZC 3Q0AA 3URYA 5M9OA 3W1GA 2BA1A 4JI4Q 1F2YA 1UWVA 5A2QL 4X3SA 2K5DA 4HIOA 3CPFA 2HUGA 1G8ZD 4NP5A 3G71A 3TSSA 1QVFA 2YV5A 1ILQA 4IFDJ 2WB1B 4LMQD 2L11A 5I6YA 1RD9D 1Y1WB 1HA5A 2BE5D 1VQHA 4F7XA 4YHHQ 5M3FG 4K8IA 5C4ZA 1EYGA 3U58A 1DJRD 3J81E 2VQEL 1GUTA 3KK7A 4AIMA 5M5XH 2UXCL 2J0TD 4DUZL 1DONA 2FMCA 1Q46A 2Z1CA 3EN2A 3ND9A 4JI8Q 2VXWA 1XXGA 1ASYA 2C35B 1HFNA 4P75A 1OXXK 2B2UC 1F9RA 2NUCA 3GTPB 1EYCA 4C3IH 2NVTB 4K8JA 1JWUD 5IGBA 3L3OC 1EL0A 4A3JG 4JPBW 1SFOB 4L5SA 3QJYA 1WCMB 3F2UA 4KD3A 4IJHA 2SNSA 1IBKL 2EY2A 4KY7A 3IKJA 1PRTB 4QQBX 4R4OA 1G91A 2X69A 2GA4B 1D6EC 5C5LA 2JA7H 1N36L 5G3LF 1I94L 4P72A 3VR2A 4UP8A 1EQTA 2XTIA 1V1PB 1CSQA 2A68C 4X3KA 1Y69U 1MJEA 2R7ZH 5J39A 3JAMi 3Q6SA 1I4XA 2D5DA 2OEOA 1KNAA 2B2TC 3I91A 5DLQE 2EY1A 2JA8B 4BY7H 1X56A 2JA5H 1PFSA 3HOWH 1IW7D 4OWXB 3KLSA 2X6GA 1Q82C 4C3HH 1BCPD 5FLXE 1TWCH 1E3PA 4FF4A 1C9OA 2K05A 3A8KE 3GTKH 1PH8A 1AW7A 1V8QA 4XQQA 4A3GB 4HCEA 1HTPA 1MI2A 5KNDA 4I7AA 5H1SE 3BYTB 4C56C 4DF7A 2UXCQ 1YBYA 4BXXG 4AYBE 3R8BA 2NWGA 4CDEC 1Q86C 3A74A 4DV2L 4ZCKA 3K80C 4JI3L 3SDZA 5T1GA 2A6ED 4DV1L 4MIUA 3RZDH 3MXGA 2IHEA 5LMNL 3E3XA 4DGZA 2HDMA 5HGTA 1CTMA 3OWEB 1KAWA 2F3WA 1RTOA 4XIGS 5KNCA 2K75A 4JBWA 3KJPA 1ET9A 3VR5A 4YWMA 1I94Q 1S5BD 4A3DG 3KF8A 2LS01 5GROA 1SE3A 2L5TA 1JOQA 1TIID 1HUMA 2AHOB 1GVPA 4NDXA 2M00A 1EY4A 2IWHA 3D0FA 3AFPA 1KTKA 2DY8A 3H91A 3GTOB 2F0FA 4ZKBB 5FKAC 2B2WC 3D3RA 2VB2X 3I2ZA 1OXTA 1A3TA 5EPKA 1ZYRD 4JI0L 2RHSB 1I4RA 2NVXH 1JT8A 2XIWA 5F2DA 2IHFA 5IE8A 3PO3G 3GDEA 2PNRC 2Y0SE 5M3FH 4R4QA 1GJXA 5EBCA 4FF3A 4FF1A 1P16A 1KLUD 1S5FD 3BU2A 4X3UA 1NR2A 1ET6A 4DNTB 1B3AA 3FKIB 4JBJA 3MXNA 1XNRQ 2DN8A 5IYBG 1QB5D 4HSPA 4TSSA 5IP9G 3GV3A 4B3TL 5IGFA 4K5VA 1DCZA 1NY4A 4UP9A 3CC4A 1YHAA 2B3GA 1VQCA 4JI3Q 2Z4IA 2VS1A 3HOXH 1CHPD 1WVLA 1ESFA 1UE6A 2F0OA 1E7ZA 2M9VA 4KY5A 1DOKA 1HZ9A 2BH8A 3ITPA 3ULJA 4A3JH 1KIXA 1CM9A 4GOPA 5E3FA 1X3QA 5CV4A 4OXPA 4RA8A 1Z6HA 2AMCB 1J5EL 4IOCA 1JE4A 2LXKA 1Z9FA 1LACA 1SYBA 4UDUC 3A5ZB 3S2DH 4OGQC 2EYHA 1XTDA 4JOIC 3HRZC 1Y1VH 1EU3A 3HOZG 1PFNA 3TMEA 1PXUA 3GO5A 4MTNA 2KECA 5C4XB 4YCUA 2R93G 1STHA 5C3EG 5DEHA 1BCPC 4MNOA 1YZ6A 4DNIA 4UP7A 4EVOA 4X66L 2ICEC 4AQYQ 4DV4L 4N8X1 2RSOA 2IW3A 4LF4L 2MFIA 1SMYC 1QUQA 4GKKL 4A3KG 1B9MA 1JOOA 5M5YB 5E7NA 3IFTA 1L2FA 1HUNA 2NYZD 4K5XA 1YEZA 1CSPA 4Y7NH 3S1QH 3P1HA 4A3FG 1EIFA 1EY7A 2A6HC 2PO4A 4RGTA 2UU9L 2AQ1B 1HQRD 1RIPA 4EGVA 4IALA 1N32Q 4KN4C 4FYDA 2OTJA 4ME3A 5A35A 2CW0C 2YTVA 3I4MB 1XX8A 2QKIC 1LTGD 2BH2A 4BXXH 4B08A 3IAYA 2UUAL 1K0SA 1K3RA 1D8LA 4TQUS 5D14A 4RCOA 3S17B 4LUVA 4FNFA 2RA4A 3G7LA 5AJ3Q 2NZ1D 1HRJA 3CCUA 2TMPA 3SGIA 1JCKB 1G2TA 1CQVA 5KEEA 2EJGC 2F0LA 4KJNA 3MZ5A 3FP9A 3HKZB 5TSSA 4WRDA 5EGTA 1SNQA 3T53B 1ENAA 1TKWB 2E75C 4TKOB 2VNUD 3C46A 1DYQA 1KC8C 2H5XA 1Q12A 1PTOC 3M3YB 1XJVA 2E74C 4C3JG 3CKIB 1F9SA 1FL0A 1RJTA 2F0PA 4A3DH 2UXBL 3WOFA 1ZKOA 4DV5Q 5M5WB 1STEA 1GM5A 1FYCA 1SR3A 4KY6A 1HH2P 1S5CD 4A93H 1KNEA 3PSIA 3M9BA 4LFCQ 2F03A 4ME5A 4AYBB 1VCIA 3PUWA 4DV3Q 3FPPA 4UHVA 3SHLA 1KL9A 4X66Q 3HEJA 4DR7L 2UUBL 4O0AA 3VR4A 3S16H 1KDCA 1I4HA 2BCOA 3BG3A 2Z6BA 5GAEC 1TWAH 2D62A 4JV5L 2O5JC 5ELDA 3BZCA 3PO3H 1TS5A 4FXKC 4IFDI 3J81j 1ZXTA 1ICWA 5K36G 3NTHA 3J7YW 4A3MG 1EEID 1N34L 1KDBA 4RGNA 5CORA 1XPOA 3N52A 5HY6A 4JYAL 5BN3A 5IP9H 1JR0D 1K8AC 2B63G 2UUAQ 2B39A 2K32A 3GTLB 1Q1BA 2PMZE 4R8NA 3MXNB 4P71A 1NSNS 1B4OA 3GTMB 1PH3A 4OIKA 4DR6Q 4LWCA 1E1TA 1CUKA 3FHWA 1I50H 3PV0A 2F0GA 1QZHA 4BBSB 3BVGA 4BWGB 1OTCA 3I90A 3ERSX 1X3PA 1HZAA 2P5ZX 4IJLA 1LABA 3MXUA 1U4PA 1VDZA 2R7DA 4RGOS 1N33L 5C6AA 5CYUA 2Y0SB 4GLXA 4GOPB 3CAMA 2LY7A 3VR3A 4JI7Q 3H0GG 4LFAL 2R3ZA 2B2YC 3OOCA 4R4TA 4R1JA 2L15A 3RLOA 1SAPA 4HTHA 3HOZH 1SYCA 4KHPQ 4A3EG 3ZJYC 1Q7YC 1YNNC 2R93H 5C3EH 1JJCB 2L0CA 2NN6G 4JVZA 3U9OA 2UUBQ 1I3QH 3DM1A 3B6YA 5JJZA 3NPPA 1PH5A 4PZ8A 3I55A 4A3KH 2E2DC 2C9OA 4C1NI 4NXNL 4H44C 1AZPA 3CQZH 5EKLA 4EQNA 1EZ6A 3U9SA 1U4MA 1NR4A 3J80c 2QGQA 3HKSA 1QUQB 1L1OA 4DR5L 4A3FH 1YI2A 5CV7A 2HHHL 1MKHA 3RLNA 1BVSA 1F2LA 5IYCH 3TP6A 1U5KA 2D0PA 2A73B 3CRKC 2PQAA 3G48A 4KI0A 3HS0C 3A8IE 3Q24A 5DM73 2C5CA 1W6JA 5FOBB 2ID0A 4B3ML 1GHJA 3IFDA 2Q2TA 1N34Q 4DUYL 2CH4W 1EOVA 2X6LA 4B9XA 1B50A 5C4HA 4NMZA 2TSSA 2Q8RE 2QW7A 5IP7G 2DNCA 3K5OA 2LMCB 2NB0A 1R9TH 2IX1A 4FP5D 2WB1G 3PIO3 1W6KA 1SNMA 4A4IA 1PRTC 4DR1Q 1EEFD 1Y1WG 2FJ2A 1HNXL 3GTQB 3NBHA 1S5DD 1HR0Q 2WFWA 3S1NH 1SMXA 3F2DA 4OX9L 1JMCA 1BUVT 2BDOA 5NUCA 2JN4A 1X3GA 1LT4D 1K8GA 2AQ3B 2K1BA 2KHJA 2XGTA 4DXGA 3T16A 1YHBA 1N33Q 3EJIA 5KYLA 3PF5A 1VF5C 1LLRD 3I70A 2RVLA 4NXML 3DM3A 4P74A 3S1MB 1IBLQ 1VMCA 2JA6B 2KOLA 2NVQH 4F88A 4X64L 4IUTA 3WDNA 5IT9L 1GHKA 4IUVA 5KYIA 1WCMG 4JI4L 2K04A 1MSHA 2KEDA 5I6WA 1JWMD 2K5NA 2ZJQA 3PIP3 2SEBD 3C1EA 3U4VA 2K01A 3F2BA 1A3UA 1E2VA 1LYLA 3VR6A 5C44B 1LT6D 4NXNQ 1IHZA 3H3VH 3TP7A 1LTAD 3FEWX 1XWEA 2E5LQ 5ISRA 2CQAA 4Z9CB 2B8GA 1U9RA 4YHHL 2HIXA 1PTOH 4K6LA 5IODA 1TVXA 3J7A5 2HQLA 2MNAA 5K36H 3UE1A 5JEAJ 4DR4Q 4ZYSA 3D6WA 1KRSA 1IYVA 4A3MH 3NWTA 1FNUA 5C0XG 1ASZA 2K4KA 3FVQA 3HZXA 1VQJA 4JI8L 2WV6D 2B63H 2JXMB 2EOTA 3BVMA 1L0WA 4C2MH 3SK8A 5GAHC 4QF4A 5EKKA 5EPJA 1HNXQ 4OL7A 4A3GG 3H3VI 1RHPA 1EUJA 3A7AB 2RHQB 4IUQA 4I65A 4OELB 3NEMA 3J7AF 4DV7Q 2Z6KC 5M3MH 1NMGA 3H0GH 1OXSC 3OW7A 2N49A 1NE3A 4KHVA 2J7ZA 3CCJA 4RHRA 4QGUA 1MHWC 4PMWA 1E0BA 1O7LA 2MO1A 1AN8A 2ZM6Q 2E2HH 2K28A 4YY3L 3KLRA 3LNNA 2PMZB 2NN6H 2G5DA 1PMRA 1EIHA 4J15A 3T1HQ 2JE6I 2I5LX 3UDXA 1PV4A 3F2CA 1NAPA 5ELCA 2G9HD 3HOYB 1CK1A 3BJUA 1JJGA 3E0JA 3A5UA 3OW2A 1WTRA 1I6HB 1X3EA 5IYDG 2RSNA 4DPGA 4X65Q 2Q8IB 1L1OB 5C4JB 3TBIB 3VA5A 3GP7A 3MEHA 4L6TB 4IURA 2WAQG 2R61A 3M85A 1XTCD 2PQAB 5IP7H 1Q3LA 5J22A 1LM0A 2PZUA 1HR0W 3ZYYX 3FMCA 3MAQA 4J8QA 1KABA 3HG9A 3Q8DA 2EY6A 2NN6I 1VQIA 4DV6L 1J8IA 3PO2B 3CP0A 1Y1WH 3NSWA 4CHTB 1K8MA 4DA2A 1GUNA 3E0EA 1VQAA 1VQ9A 1K8OA 1GD7A 3EA6A 3RD4A 1AE2A 1X6OA 1X65A 2KVMA 3FKIG 3EBEA 2B2UA 2F3VA 4ZUJA 1Y8OB 1CZWA 1WOCA 1WFQA 1EYAA 2L55A 1GUOA 1BCPF 1T5XD 3GTPH 2ZJRA 3D6CA 1BBXC 4RAUC 1SFOH 4FF2A 3NQTA 2XN9C 1FVIA 4YY3Q 1WCMH 4AH6A 3EIVA 2PNHA 3RMHA 2MUYA 1TWCB 3R93A 4LF8L 1L0YB 4A3BB 3GTKB 1VS0A 1C48A 1EQQA 1SJED 2D2CC 2EY5A 4OIJA 1E22A 2MPMA 3W1BA 2XWJB 1SMYD 1B70B 2CFMA 4CJ0B 2B2TA 1WTQA 2DJGC 4HIDA 3KUPA 2KJXA 1GUSA 3Q22A 5C4XG 4BBRH 1AH9A 1C0AA 2K5VA 2A6HD 2UXDQ 1XNRL 1PHJA 5C0XH 1ONLA 1QWYA 4HJ9A 5E1FA 5IGEA 1TS2A 1VQGA 3MEFA 4LUZA 1DZ1A 3T51B 1UEAB 3TRZA 2R7FA 2EQSA 2F0JA 4YCWA 2CW0D 2MP1A 1YHQA 3GD7A 1VQ7A 1PZID 4DV6Q 1JE5A 3W2DA 4F8MA 2EDGA 3K0YA 2RF4A 4A3GH 4HAEA 4HIKA 4LJZC 2ZJPA 4DR2Q 2EYJA 3S15H 4IFDG 1EFID 2AUKA 3QWNA 3I4MG 2OWOA 2HCCA 1SLJA 1T5EA 4A3LG 2Q8TA 2OQ0A 3VYTA 2QCPX 2NTTA 4CBVA 1E24A 1PTOD 2CWPA 2WIIB 2QEXA 1PH1A 5C0XI 4K2KA 3S9WA 3AB9A 3E9HA 2MGSA 4UAIA 4JI6L 1HFGA 1SNDA 2NVXB 2DY7A 2CH4A 3OMGA 3J81c 1FR3A 3VYSA 3BDCA 4AQYL 3D4RA 3HKZG 4LF8Q 1K83B 3KF6A 3CC7A 2A8VA 4U673 5J3BA 4ZUIA 3BZDB 2AWNA 5JVH3 3K6OA 4OO1G 2CWAA 1DD2A 4LAAA 4KHZA 1Q8IA 4JI1Q 1N32L 2JP1A 3RZOB 4AYBG 1Q1EA 3W5OA 3GTOH 3NTIA 4XYOA 5ELFA 5IYDH 5KIXA 3KYHC 1JC7A 3HOXB 4LFBQ 1X3FA 1P8LA 1AFPA 5E4XA 2VZAA 3UDGA 2MO0A 3GTJB 4FO2A 4OWTB 2EYOA 4HJAA 5AJ3L 2JA9A 1HQMC 2OXPA 3TQYA 5ELBA 3WOEA 1NBWA 1A62A 3OIPA 4NW2A 2GVBA 1XPRA 2F0SA 4N8FA 2ASBA 5LL6S 3H6MA 4KK7A 1TWGB 1BR9A 1CA5A 1G291 5DNFA 3D31A 4NPSA 3FKIH 2SDFA 1Y1VB 1VMPA 1CFMA 2RKSA 1LTID 1EU4A 2ZT9C 4A3CG 1BXTA 4G4KA 4DV5L 5FLXc 1A63A 1OXVA 3N6RA 4KD4A 4ODGA 4LFCL 2E2JH 2I0QA 4JI6Q 4BBSG 2EXZA 4DV3L 4RFBA 1X55A 5JPNC 3LGJA 2VB3X 3E9IA 3I7FA 3L9AX 5HGQA 4DV0L 3X3MA 1DGSA 4G57A 4CKCA 2KENA 2YYZA 3S1QB 2K5WA 4JOIA 2Y0SG 1YNND 5EQ0A 4GZYC 2LKVA 1KLGD 1BQQT 3D8GA 4JBMA 2EYLA 2RCNA 2NBFA 1FGUA 1TY0A 1IYUA 3H09A 2XRSD 1EWIA 1PH6A 4A75A 3K57A 4KMUC 1D1IA 5C4XH 3HOVB 4WORA 2AUJD 1GKHA 1STGA 2NZHA 4QIWE 4DAPA 5LMUQ 1EIYB 4X6AH 4GLAC 2A69C 1TR5A 4HJ8A 1C7YA 3CU7A 1M90C 4J1MA 4JC0A 1U4LA 5M5YH 3CCRA 1FD7D 3P7JA 4DR6L 2PQEA 1F9PA 4GKJL 4C1NK 1I5FA 3PUYA 3H3VC 5CR3A 2PYKA 1XNQQ 4CDFC 1XPUA 2JSOA 5IGGA 1GUGA 4IFDH 1PRTD 4OHJA 4DU9A 5I9OA 1RTNA 2Q2UA 3I4MH 2XNAC 3AFQA 3KDFA 3C1FA 2Z4HA 1PVOA 1JJ2A 3J80E 4QY7A 3T4AC 1MIUA 3OTOL 3KFUA 4A93B 4A3LH 4JI7L 4B3RQ 3K5MA 3CD6A 1SJHD 4WFN3 1I4GA 4XQNA 2QDLA 3M7NA 3S17H 3UI2A 3GTGH 3KF8B 4M8AA 4Q5VA 2E76C
chains in the Genus database with same CATH topology
3BS1A 4YIJA 3S16B 2WP8J 3NP8A 1J9OA 1IL8A 4RH6A 4ABNA 4DK1A 2F0KA 2WKCA 2MHVA 3I4NB 1LT3D 3NBIA 4XXEA 1SSOA 5CBAE 3CRLC 4DXFA 1AP0A 1UNSA 1WTVA 4OO1H 3VA7A 1EY8A 4TRDA 4ZLTF 1SNOA 1CI3M 3S14B 3TP8A 2EYMA 2NTSA 3E6ZX 4KKTA 2VUMB 1O80A 4IUPA 5HURA 1DM0B 2FMMA 4XT3B 3J80L 4PMBA 2EVBA 4OO1I 2B2VC 2E2IB 1STBA 3PUVA 4FXGC 1CHQD 2ICIA 1TWHB 2RQXA 3MVVA 4HMIA 4ULLA 1TWFB 1I3QB 4IN3A 2CVRA 5IT9E 1Q90A 2EJMA 2V4DA 3K58A 4QMGA 4ZQ3A 2PCFB 1H9JA 2KA7A 4V0BA 4RKLA 1JOKA 4L63B 1SYFA 2H4OA 5IGCA 1XYIA 1U4RA 1FGBD 2I07B 3DWAA 1D1KA 1SYEA 1R9TB 2F0MA 5D65A 3VYRA 4G7OC 1BCPB 2QF7A 1G2SA 1II3A 1H9KA 3SE0A 3M4OB 2NVYB 1SXTA 2K6AA 3H94A 1HHVA 3W3AA 3V96A 2F0HA 5JVG3 4K2LA 3C2PA 2QEJC 1Z7TA 4N9TA 2R92B 1TU2B 3PUXA 5I2YA 2PW7A 1HA6A 3V2TA 1LT5D 3I4LA 1RCVD 2G9DA 4F87A 2HDLA 2EZVA 1SYGA 5JPMC 1CT1D 1JORA 5CMDA 2F0DA 1MSGA 3K5LA 1QNUA 2JEAI 1EZ8A 1KAAA 1JQYD 5FO7B 2KHSA 3S2HB 4A3IB 5IIFA 4IUNA 4DN4M 2FINB 3A55A 3BDOA 1EY0A 3KLSX 3TDQA 3I72A 1RF2D 1V43A 3NQIA 3A56A 3MWYW 2Z8LA 4DNRB 2A74C 1SNPA 5M3MB 4BY1B 3NK9A 2IX3A 2EE1A 2EPBA 3ND8A 2RBMA 2RDHA 5DAUA 4IQZA 4BA1I 3TP5A 1SEBD 4NKLA 2E2HB 1S5ED 1RDPD 1I6VC 4RKBA 4ID6A 1PFBA 3OMCA 5KNBA 1E2WA 5DM63 4JK1C 1IKMA 2FFKB 3DXJC 3K59A 5M5XB 2DNEA 1YNJD 1R4QB 5T1IA 2WINB 3HP3A 2H1EA 2WACA 2PW5A 1QNKA 4C3IB 1AZQA 1EY6A 1OXUA 1EY5A 3SK5A 4CKBA 2N88A 4U68A 2K7VA 1L0XB 1V1OA 1O78A 1HTLD 3SR1A 3LX0A 5JOBA 3SEBA 1MD2D 3R3OA 4XT1B 5I9PA 2R6GA 2JA7B 4XYQA 3FPUB 5KGUA 3PMFA 3DEPA 5C3XA 2EJFC 2R7ZB 2K03A 1D2BA 3HGBA 2CHBD 3OWFA 3E5SA 4BY7B 3P20A 5JEAG 4EQPA 2KQ3A 4K5WA 2SNMA 3M4YA 4EQOA 2JA5B 3HOWB 1F2MA 2O4XA 1H9MA 1LTBD 3OPOA 4P2CB 2B8FA 3ONAB 1IKLA 4C3HB 1VF7A 1H9SA 2M2LA 3R2TA 3QB3A 5C5MA 1DOLA 3MFGA 5ELEA 4PNYA 1EIGA 2A5HA 1C8CA 1F77A 2XWBB 4BBRB 4HSVA 3DWQA 1ESRA 3R2IA 2QDBA 5G3LD 3ERQA 4CGYB 2F0UA 3RZDB 2F1MA 3QOJA 5D3IB 1PYWD 1STYA 3NWSA 2SOBA 4IZ8A 5E4WC 2BDNA 4QCLA 2MJ8A 3J81L 3S15B 1MGSA 3TZDA 2A69D 1HPCA 1PTOF 4KTAA 1EOTA 4ZKCB 1LTSD 2L9HA 1SDFA 2IPKD 2EYPA 4QB4A 5LL6X 1WD0A 2WKDA 1SE4A 1G6ZA 1R4PB 1Z47A 1QILA 2ZXPA 2KCCA 1LTRD 3A8JE 4DFAA 5EPLA 3MTSA 3QG1A 3EVQA 4HCSA 2OT2A 3DUZA 4N9PA 1BO0A 3OHXC 3KBXA 1YNJC 1FNWA 3X3NA 1BF4A 5M3FB 1PZKD 1E2ZA 2B2WA 2BOSA 4K14A 1D5MC 1I4QA 2WAQB 1Y8PB 2BE5C 4HR7B 3OSOA 5FLXL 5C3WA 1RODA 4H0LC 1GOZA 4A3JB 4RHSA 4IUUA 2PZTA 3TZUA 1WTXA 1GXDC 5I4DA 4FVMA 2IJ0A 3NXWA 2ZXRA 4XDXA 1STNA 4DAYA 3S2DB 2L12A 2PZWA 3LWEA 2E2JB 5EKIA 2LFNA 1WTPA 5JEAH 1STAA 1O7ZA 1TT2A 1EQVA 2L1BA 4WJWA 1EY9A 4Y7NB 5EBDA 2O5IC 3A54A 1F9QA 1S4ZA 5JAVA 1TY2A 1H9SB 2HCIA 1IW7C 1CQFA 3LWUA 5I2XA 2F0TA 1BDOA 3L7ZC 3MXPA 1WTWA 4R9WA 1NCVA 4PV1C 4RWSC 3G6JB 1PRTF 3NE5B 1LO5D 2XVSA 5CV5A 2JEBI 3MHBA 5KRUA 2PPBC 2L4NA 3DHQA 1ENCA 4QUFA 2A6EC 4XTCS 1EWHA 1TS3A 4ZRZA 4KJOA 4A3DB 2K5QA 4MN3A 1D5ZC 1SBBB 1WD1A 3QIAA 2F0WA 4L8JA 3GTGB 1SYDA 1F2ZA 2IL8A 3T56B 2ZXOA 5K5PA 2AQ2B 3P75A 1BOSA 1TWAB 1TQOA 1CZGA 2O2LD 3PO3B 3C3LA 1HCZA 1PDQA 1ZYRC 2XRQD 1B2TA 1ZEQX 3VYUA 3CHBD 2ENBA 1AEXA 3RLFA 3OIQA 3EQLC 5FO8B 4PQXA 4O1NA 3IL8A 1PZJD 2KEEA 3A7LA 1UUPA 4HN7A 3K7AB 2F0NA 4H7BA 5BN4A 1I50B 3BVZA 1FNVA 3S1RB 2IT1A 3O13A 4ILWA 1B9NA 5FK9C 4HMJA 3QOLA 3RUZA 4Q0FA 1B44D 1H9RA 3T13A 5COYA 1DXMA 2IX0A 3SK6A 3I8ZA 3HOZB 1KDAA 4B9WA 2OF1A 3TN2A 1D5XC 2R93B 4R8IA 5C3EB 1Y8NB 2JYOA 2FHTA 3EFXD 4S3SA 1QE6A 4A3KB 1A3VA 1QG7A 5CBEE 4HEDA 3CQZB 1MBYA 3I73A 1JB3A 2B2VA 5C0XJ 2AWOA 4A3FB 1B1ZA 2B2YA 4V190 1UAPA 1B53A 1LTTD 2I46A 4CJ2C 4DK0A 4H13C 4PMCA 3D4DA 3DWPA 1M8AA 3MA2B 3GQBA 3QO2A 3SK4A 2F0EA 4KV6A 1SNCA 4QUCA 3EROA 3Q23A 3S1NB 4KKSA 4RCNA 5FO9B 4X3TA 1OO9B 2K33A 3DMUA 2RDFA 4MHEA 2KUMA 3BDLA 3NHHA 4C3JB 1PLFA 5BN5A 4BS9A 5IOCA 3MC0B 4C3IG 3AMUA 2NVQB 1ILPA 4O42A 4ZK9B 3D4WA 1EWCA 5CV9A 3KBGA 4J6HA 4QIWB 3FRPB 3JAME 3SXHA 1DOMA 1TS4A 4K6DA 1V1PA 5CC4A 5D3DA 3K5NA 3HOUB 3J7AV 4RGMA 1SE2A 5EJWA 3NUCA 1HXYD 1EYDA 1PTOB 2F0VA 3AU7A 2EYFA 4DAVA 2F0IA 4A3MB 2F4IA 2BA0A 2A68D 1ENFA 2D9UA 5CGKA 1JWSD 5A2QE 1A2UA 1GUWA 2B63B 2F0QA 3M7GA 1PFMA 4C3HG 4C2MB 1I4PA 4FXDA 1LV9A 3FDTA 1WTOA 1M4VA 2HQEA 4G7HC 4I7ZC 4KN7C 3V05A 5J1ZA 2RDGA 1A2TA 3MFYA 5CV8A 3I3CA 4XQJA 3PUZA 1QCBD 5LHY1 3GV6A 5IGDA 2N55A 1BNZA 2YU9B 4ZAIA 3H0GB 1CA6A 1QJOA 1C4QA 4CKEA 2XSCA 5AFWA 2J4XA 1JICA 3JAML 4A3EB 4CJ1B 2QILA 5CV6A 4LK1C 1A6XA 1O7YA 3BYYB 1NUCA 1X32A 1ML0D 4KKUA 3SVMA 4BA2I 3NTKA 1RKNA 1A15A 3DEOA 1QOHA 2KCNA 4E6IA 4M1UB 4G7ZC 3Q0AA 3URYA 5M9OA 2BA1A 1F2YA 5A2QL 4X3SA 2K5DA 4NP5A 2HUGA 1G8ZD 3TSSA 1ILQA 4IFDJ 2WB1B 4LMQD 2L11A 5I6YA 1RD9D 1Y1WB 1HA5A 2BE5D 4F7XA 4K8IA 5C4ZA 1DJRD 3J81E 1GUTA 3KK7A 2J0TD 1DONA 2FMCA 2Z1CA 3ND9A 2VXWA 1XXGA 1HFNA 1OXXK 2B2UC 1F9RA 2NUCA 3GTPB 1EYCA 2NVTB 4K8JA 1JWUD 5IGBA 3L3OC 1EL0A 1SFOB 3QJYA 1WCMB 3F2UA 4KD3A 2SNSA 2EY2A 4KY7A 3IKJA 1PRTB 1G91A 2X69A 2GA4B 1D6EC 5C5LA 5G3LF 3VR2A 1EQTA 1V1PB 2A68C 4X3KA 1Y69U 5J39A 3Q6SA 1I4XA 2D5DA 2OEOA 1KNAA 2B2TC 3I91A 2JA8B 2EY1A 1IW7D 3KLSA 2X6GA 1BCPD 5FLXE 4FF4A 2K05A 3A8KE 1AW7A 1V8QA 4XQQA 4A3GB 4HCEA 1HTPA 1MI2A 5KNDA 3BYTB 4C56C 4DF7A 3R8BA 2NWGA 3SDZA 5T1GA 2A6ED 4MIUA 3MXGA 4DGZA 2HDMA 5HGTA 1CTMA 3OWEB 2F3WA 1RTOA 4XIGS 5KNCA 4JBWA 1ET9A 3VR5A 1S5BD 3KF8A 2LS01 1SE3A 2L5TA 1JOQA 1TIID 1HUMA 4NDXA 2M00A 1EY4A 2IWHA 1KTKA 2DY8A 3H91A 3GTOB 2F0FA 4ZKBB 5FKAC 2B2WC 3D3RA 2VB2X 1OXTA 1A3TA 5EPKA 1ZYRD 1I4RA 2XIWA 5F2DA 2PNRC 1GJXA 5EBCA 4FF3A 4FF1A 1KLUD 1S5FD 4X3UA 1NR2A 1ET6A 4DNTB 1B3AA 3FKIB 3MXNA 2DN8A 1QB5D 4HSPA 4TSSA 3GV3A 5IGFA 4K5VA 1DCZA 2Z4IA 1CHPD 1WVLA 1ESFA 2F0OA 2M9VA 4KY5A 1DOKA 3ITPA 1CM9A 5E3FA 1X3QA 5CV4A 4RA8A 1Z6HA 1JE4A 4UDUC 1LACA 1SYBA 4OGQC 2EYHA 3HRZC 1EU3A 1PFNA 3TMEA 1PXUA 3GO5A 2KECA 5C4XB 1STHA 5DEHA 1BCPC 4EVOA 2ICEC 2RSOA 2IW3A 1SMYC 1B9MA 1JOOA 5M5YB 3IFTA 1HUNA 2NYZD 4K5XA 3P1HA 1EY7A 2A6HC 2PO4A 4RGTA 2AQ1B 1HQRD 4EGVA 4IALA 4KN4C 4FYDA 5A35A 2CW0C 3I4MB 1XX8A 2QKIC 1LTGD 4B08A 3IAYA 4TQUS 5D14A 4RCOA 3S17B 4FNFA 2RA4A 3G7LA 2NZ1D 1HRJA 2TMPA 1JCKB 1G2TA 1CQVA 5KEEA 2EJGC 2F0LA 4KJNA 3MZ5A 3HKZB 5TSSA 4WRDA 5EGTA 1SNQA 3T53B 1ENAA 1TKWB 2E75C 4TKOB 2VNUD 3C46A 1DYQA 1Q12A 1PTOC 3M3YB 2E74C 4C3JG 3CKIB 1F9SA 1RJTA 2F0PA 3WOFA 1ZKOA 5M5WB 1STEA 1FYCA 4KY6A 1S5CD 1KNEA 2F03A 4ME5A 4AYBB 1VCIA 3PUWA 3FPPA 3SHLA 3HEJA 3VR4A 1KDCA 1I4HA 2BCOA 3BG3A 2D62A 2O5JC 5ELDA 1TS5A 4FXKC 4IFDI 1ZXTA 1ICWA 5K36G 3NTHA 3J7YW 1EEID 1KDBA 4RGNA 5CORA 3N52A 5BN3A 1JR0D 2B39A 2K32A 3GTLB 1Q1BA 4R8NA 1NSNS 1B4OA 3GTMB 4OIKA 3PV0A 2F0GA 4BBSB 3BVGA 4BWGB 3I90A 1X3PA 1LABA 3MXUA 1U4PA 1VDZA 4RGOS 5C6AA 5CYUA 2Y0SB 2LY7A 3VR3A 2R3ZA 2B2YC 3OOCA 1SAPA 4HTHA 1SYCA 1YNNC 2L0CA 2NN6G 3U9OA 3DM1A 5JJZA 3NPPA 2E2DC 2C9OA 4C1NI 4H44C 1AZPA 4EQNA 5EKLA 1EZ6A 3U9SA 1U4MA 1NR4A 5CV7A 1F2LA 3TP6A 2A73B 3CRKC 4KI0A 3HS0C 3A8IE 3Q24A 5DM73 2C5CA 1W6JA 5FOBB 2ID0A 1GHJA 3IFDA 2X6LA 4B9XA 1B50A 5C4HA 4NMZA 2TSSA 2Q8RE 2DNCA 3K5OA 2LMCB 2NB0A 2IX1A 4FP5D 3PIO3 1W6KA 1SNMA 1PRTC 1EEFD 2FJ2A 3GTQB 3NBHA 1S5DD 1BUVT 2BDOA 5NUCA 1LT4D 2AQ3B 2K1BA 4DXGA 3T16A 3EJIA 5KYLA 1VF5C 1LLRD 3I70A 2RVLA 3S1MB 1VMCA 2JA6B 2KOLA 4F88A 4IUTA 3WDNA 5IT9L 1GHKA 4IUVA 5KYIA 2K04A 1MSHA 2KEDA 5I6WA 1JWMD 3PIP3 2SEBD 3C1EA 2K01A 1A3UA 1E2VA 3VR6A 5C44B 1LT6D 1IHZA 3TP7A 1LTAD 3FEWX 1XWEA 5ISRA 2CQAA 4Z9CB 2B8GA 1U9RA 1PTOH 4K6LA 5IODA 1TVXA 5K36H 5JEAJ 4ZYSA 3D6WA 1IYVA 3NWTA 1FNUA 5C0XG 3FVQA 3HZXA 2WV6D 2JXMB 2EOTA 3BVMA 3SK8A 4QF4A 5EKKA 5EPJA 4OL7A 1RHPA 3A7AB 4IUQA 4I65A 3J7AF 1OXSC 3OW7A 4KHVA 2J7ZA 4RHRA 4PMWA 1E0BA 1O7LA 1AN8A 2K28A 3KLRA 3LNNA 2PMZB 2NN6H 1PMRA 1EIHA 2JE6I 1NAPA 5ELCA 2G9HD 3HOYB 1CK1A 3E0JA 1WTRA 1I6HB 2RSNA 2Q8IB 5C4JB 3TBIB 3VA5A 3GP7A 3MEHA 4L6TB 4IURA 2R61A 3M85A 1XTCD 1Q3LA 5J22A 2PZUA 3ZYYX 3FMCA 3MAQA 4J8QA 1KABA 3HG9A 2EY6A 2NN6I 1J8IA 3PO2B 3NSWA 4CHTB 1K8MA 4DA2A 1GUNA 1K8OA 3EA6A 3RD4A 2KVMA 2B2UA 2F3VA 4ZUJA 1Y8OB 1CZWA 1EYAA 2L55A 1GUOA 1BCPF 1T5XD 3D6CA 1BBXC 4RAUC 4FF2A 3NQTA 2XN9C 3RMHA 2MUYA 1TWCB 3R93A 1L0YB 4A3BB 3GTKB 1C48A 1SJED 2D2CC 2EY5A 4OIJA 2MPMA 2XWJB 1SMYD 4CJ0B 2B2TA 1WTQA 3KUPA 2KJXA 1GUSA 3Q22A 2A6HD 5C0XH 1ONLA 1QWYA 5E1FA 5IGEA 1TS2A 1DZ1A 3T51B 1UEAB 2F0JA 2CW0D 2MP1A 3GD7A 1PZID 3W2DA 4F8MA 2EDGA 3K0YA 4HAEA 4LJZC 2EYJA 4IFDG 1EFID 2AUKA 3QWNA 2HCCA 1T5EA 2Q8TA 3VYTA 2QCPX 2NTTA 4CBVA 1PTOD 2WIIB 5C0XI 4K2KA 3S9WA 3AB9A 2MGSA 4UAIA 1HFGA 1SNDA 2NVXB 2DY7A 3OMGA 1FR3A 3VYSA 3BDCA 3D4RA 1K83B 4U673 4ZUIA 3BZDB 2AWNA 5JVH3 3K6OA 4OO1G 1DD2A 4LAAA 4KHZA 1Q8IA 2JP1A 3RZOB 1Q1EA 3NTIA 4XYOA 5ELFA 5KIXA 1JC7A 3HOXB 1AFPA 5E4XA 3GTJB 4FO2A 2EYOA 1HQMC 2OXPA 5ELBA 3WOEA 4NW2A 3OIPA 2F0SA 5LL6S 3H6MA 4KK7A 1TWGB 1BR9A 1CA5A 1G291 5DNFA 3D31A 2SDFA 1Y1VB 1VMPA 1CFMA 2RKSA 1LTID 1EU4A 2ZT9C 1BXTA 4G4KA 1OXVA 3N6RA 4KD4A 4ODGA 2EXZA 4RFBA 5JPNC 2VB3X 3L9AX 3X3MA 4G57A 4CKCA 2YYZA 3S1QB 2K5WA 1YNND 5EQ0A 4GZYC 2LKVA 1KLGD 1BQQT 3D8GA 2EYLA 2NBFA 1TY0A 1IYUA 3H09A 2XRSD 3K57A 4KMUC 1D1IA 3HOVB 4WORA 2AUJD 4DAPA 1STGA 2A69C 1TR5A 3CU7A 4J1MA 1U4LA 1FD7D 3P7JA 2PQEA 1F9PA 4C1NK 3PUYA 3H3VC 5CR3A 2PYKA 2JSOA 5IGGA 1GUGA 4IFDH 1PRTD 5I9OA 4OHJA 4DU9A 1RTNA 2XNAC 3C1FA 2Z4HA 3J80E 3T4AC 4A93B 3K5MA 1SJHD 1I4GA 4XQNA 3M7NA 3UI2A 4WFN3 4M8AA 4Q5VA 2E76C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  1GUT A;  2A6E C;  2BA0 A;  2BDO A;  2A68 D;  3M4Y A;  1GUS A;  4XTC S;  1EWH A;  4XIG S;  3KLR A;  3LNN A;  4DNR B;  1Y8P B;  1H9M A;  5KNC A;  2BE5 C;  3OPO A;  4JBW A;  2B8F A;  2NN6 H;  4HR7 B;  2A6H D;  1PMR A;  4DK1 A;  1G29 1;  1SMY C;  3D31 A;  3VR5 A;  1ONL A;  5C0X H;  1VF5 C;  1H9S A;  1VF7 A;  3ND9 A;  5BN3 A;  2QF7 A;  3I73 A;  4G7O C;  1CFM A;  1B9M A;  3ND8 A;  1H9K A;  1OXX K;  2JE6 I;  2AWO A;  2K32 A;  2L5T A;  4IQZ A;  3T51 B;  4H0L C;  1Q1B A;  2ZT9 C;  3IFT A;  3QIA A;  3SE0 A;  4BA1 I;  4L8J A;  4G7H C;  3CRL C;  4I7Z C;  4KN7 C;  3GD7 A;  2A6H C;  3TZU A;  4DK0 A;  1OXV A;  3N6R A;  4H13 C;  4OO1 H;  3PV0 A;  3WDN A;  3QJY A;  3H94 A;  3MFY A;  3VA7 A;  1GHK A;  4KN4 C;  1I6V C;  3PUZ A;  3T56 B;  2EDG A;  3W3A A;  1OXT A;  5A35 A;  3IKJ A;  2CW0 C;  4LJZ C;  2Q8I B;  4IFD G;  1LAB A;  2AUK A;  3MXU A;  1VDZ A;  3GQB A;  1Z7T A;  1TU2 B;  3PUX A;  2F1M A;  2YYZ A;  5KNB A;  1T5E A;  3M85 A;  1QJO A;  1E2W A;  3VR2 A;  1E2V A;  3VR3 A;  3VR6 A;  4GZY C;  4TQU S;  1HCZ A;  3I4L A;  2A68 C;  1ZYR C;  3FMC A;  1Y69 U;  2PNR C;  1CI3 M;  3OOC A;  1IYU A;  2B8G A;  4JK1 C;  2NN6 I;  3DXJ C;  1GJX A;  4KKS A;  2DNE A;  3AB9 A;  4KKT A;  1K8M A;  4RCN A;  2D5D A;  3RLF A;  2A69 D;  2EJG C;  1HPC A;  2K33 A;  5JEA H;  1GUN A;  1YNN C;  4LK1 C;  5K36 H;  1A6X A;  1K8O A;  4DNT B;  3EQL C;  4KMU C;  3T53 B;  1IYV A;  1FR3 A;  1TKW B;  2E75 C;  2NN6 G;  4TKO B;  3D4R A;  2DN8 A;  5C0X G;  1Q12 A;  2EVB A;  2AUJ D;  2E74 C;  3A7L A;  1IW7 D;  1DCZ A;  5BN5 A;  1OXU A;  2A69 C;  1Y8O B;  2K7V A;  2O5I C;  1ZKO A;  2JXM B;  4H44 C;  1O78 A;  5BN4 A;  4KKU A;  4BA2 I;  3PUV A;  3U9S A;  1GUO A;  2KCC A;  1FYC A;  3A8K E;  3A8J E;  4G7Z C;  1H9S B;  4OO1 G;  2JEA I;  1V8Q A;  1DD2 A;  1IW7 C;  1VCI A;  2IT1 A;  3QG1 A;  4KHZ A;  3LWU A;  2BA1 A;  1HTP A;  3PUW A;  3PUY A;  5KND A;  4KI0 A;  3CRK C;  1Q1E A;  2R6G A;  3FPP A;  3A8I E;  1B9N A;  1Z6H A;  1BDO A;  3A7A B;  3L7Z C;  1Q90 A;  1GHJ A;  2EJM A;  2V4D A;  4IFD H;  1GUG A;  3VR4 A;  1H9R A;  1LAC A;  2EJF C;  4PV1 C;  3BG3 A;  4OGQ C;  2DNC A;  1YNJ C;  2PCF B;  1H9J A;  3SDZ A;  2LMC B;  2D62 A;  3NE5 B;  1DXM A;  2KA7 A;  2A6E D;  3HGB A;  2O5J C;  1OXS C;  2D2C C;  3OW7 A;  2JEB I;  2BE5 D;  3BDO A;  1CTM A;  3M7N A;  2PPB C;  3I72 A;  1HQM C;  1E2Z A;  2E76 C;  3P20 A;  5JEA G;  1V43 A;  1O7L A;  1Y8N B; 
#chains in the Genus database with same CATH topology
 4KHP L;  5ELN A;  3BS1 A;  4YIJ A;  3S16 B;  2WP8 J;  3NP8 A;  1J9O A;  1IL8 A;  4RH6 A;  4ABN A;  4DK1 A;  4X62 Q;  4DV0 Q;  2OCE A;  2F0K A;  2WKC A;  2MHV A;  3I4N B;  1LT3 D;  2CQO A;  3HOU G;  3NBI A;  1T9H A;  4XXE A;  5EAY A;  3M3Y H;  1SSO A;  3RR5 A;  2RCF A;  5CBA E;  3CRL C;  4DXF A;  1AP0 A;  3KF6 B;  1UNS A;  3F1Z A;  4PZ7 A;  5M5W H;  1WTV A;  4OO1 H;  1VQF A;  2JA6 G;  3VA7 A;  1EY8 A;  2Z9H A;  4TRD A;  4IPG A;  5GQO A;  4LW1 A;  5IYB H;  4ZLT F;  1SNO A;  4IO9 A;  4K0K L;  4L5R C;  1CI3 M;  5C44 G;  3CCS A;  1KD1 C;  3S14 B;  3TP8 A;  3K7A H;  2EYM A;  4GKJ Q;  2NTS A;  4DR1 L;  3E6Z X;  4KKT A;  2VUM B;  1O80 A;  1HR0 L;  3KJO A;  2OTL A;  4IUP A;  5HUR A;  1DM0 B;  2FMM A;  4LF9 L;  3G6E A;  2A19 A;  3S1R H;  4XT3 B;  3J80 L;  4PMB A;  2EVB A;  2Q2I A;  4CDD C;  4OO1 I;  3KLW A;  3OTO Q;  2B2V C;  2E2I B;  1STB A;  1SRO A;  1RL2 A;  3PUV A;  4A3C H;  1IBL L;  4FXG C;  1CHQ D;  3GTM H;  2ICI A;  1TWH B;  1X9N A;  2HIV A;  2RQX A;  3MVV A;  4HMI A;  4ULL A;  1TWF B;  1I3Q B;  1B3Q A;  4OEM B;  4IN3 A;  1V1Q A;  2EIF A;  2CVR A;  4YWL A;  5IT9 E;  4RG1 A;  1Q90 A;  2EJM A;  1IL2 A;  2V4D A;  4MTK A;  3K58 A;  1NNX A;  2HD3 A;  4QMG A;  4ZQ3 A;  2PCF B;  1VQM A;  1H9J A;  2KA7 A;  4V0B A;  3CPW A;  4RKL A;  1JOK A;  1K3B C;  1UE5 A;  4YWK A;  4L63 B;  1HJP A;  2K52 A;  2E5L L;  5JJL A;  1E1O A;  3T1Y Q;  1SYF A;  2H4O A;  5IGC A;  1HNZ Q;  1XYI A;  1U4R A;  1FGB D;  4P73 A;  4GS3 A;  3UDI A;  2I07 B;  3DWA A;  1Q81 C;  4DR4 L;  1D1K A;  3K8A A;  3AEV A;  1SYE A;  1R9T B;  2F0M A;  5D65 A;  1U0L A;  3VYR A;  4G7O C;  1BCP B;  2QF7 A;  1G2S A;  1S40 A;  3STB C;  1II3 A;  3G4S A;  1H9K A;  4K0K Q;  3SE0 A;  4CDC C;  3M4O B;  2NVY B;  1SXT A;  2K6A A;  3IRB A;  1TXY A;  3H94 A;  3HOY G;  3UE0 A;  1PH7 A;  1HHV A;  3W3A A;  3V96 A;  1YIJ A;  4LF9 Q;  1EQR A;  1HNW Q;  2F0H A;  5JVG 3;  4K2L A;  3C2P A;  2QEJ C;  1Z7T A;  4N9T A;  2R92 B;  1TU2 B;  2F4V Q;  3PUX A;  5I2Y A;  1PH2 A;  2PW7 A;  3CCL A;  4DV7 L;  1HA6 A;  3V2T A;  4C3J H;  1VQB A;  1LT5 D;  1A0I A;  3I4L A;  4L5Q A;  1RCV D;  1WJJ A;  2G9D A;  4IPH A;  4EQ5 A;  3KDF B;  1MJC A;  2HDL A;  3S24 A;  4F87 A;  4HIM A;  4LNQ A;  1YJ9 A;  3PO2 G;  2D0O A;  2ZM6 L;  4LF5 Q;  3GTQ H;  1IXR A;  3J80 i;  5IY0 A;  2EZV A;  3PIO A;  1SYG A;  5JJI A;  5JPM C;  1CT1 D;  3T1H L;  3HOU H;  4DAM A;  1JOR A;  2ZTE A;  1QVG A;  2AKW B;  5CMD A;  2F0D A;  1MSG A;  1HZB A;  3K5L A;  3S1M H;  1QNU A;  2JEA I;  1EZ8 A;  1KAA A;  2JA6 H;  1JQY D;  1K9M C;  1VQ4 A;  1G6P A;  3F8T A;  1XMO L;  5FO7 B;  4POF A;  4X65 L;  1QVC A;  2JA8 G;  2KHS A;  3S2H B;  1CKM A;  4A3I B;  5IIF A;  4IUN A;  1D7Q A;  4DN4 M;  4A3B G;  5FLM G;  2FIN B;  3A55 A;  4JI5 L;  3BDO A;  1EY0 A;  3KLS X;  3TDQ A;  3I72 A;  1RF2 D;  1XMQ Q;  1V43 A;  3NQI A;  3A56 A;  3MWY W;  3PIP A;  3DLL A;  2Z8L A;  3L2P A;  4DNR B;  3NEL A;  2A74 C;  1SNP A;  5M3M B;  4BY1 B;  3NK9 A;  4LF6 Q;  2IX3 A;  3I56 A;  4B3S Q;  2EE1 A;  2EPB A;  4OWW B;  1G51 A;  4IPD A;  3ND8 A;  2RBM A;  1NTG A;  2YU9 H;  2RDH A;  5DAU A;  4IQZ A;  4BA1 I;  2WAQ E;  1VQK A;  1A8V A;  3TP5 A;  4GLV B;  3RNU A;  1SEB D;  4NKL A;  2E2H B;  4YCV A;  1S5E D;  1RDP D;  1I6V C;  3TEH B;  4RKB A;  4A3E H;  1Y14 B;  4ID6 A;  2JK8 A;  1PFB A;  3OMC A;  4LF7 Q;  2Z6K A;  4HJ5 A;  5KNB A;  4GNX A;  2LXJ A;  1E2W A;  2A1A A;  4FDB A;  2N78 A;  5DM6 3;  2KHI A;  4GN5 A;  3K81 C;  4JK1 C;  1IKM A;  2FFK B;  3DXJ C;  3K59 A;  5M5X B;  2DNE A;  1YNJ D;  1R4Q B;  2WIN B;  5T1I A;  3HP3 A;  2H1E A;  2WAC A;  1XMO Q;  1SE8 A;  2PW5 A;  3JAM c;  1QNK A;  3QR8 A;  2UXD L;  4C3I B;  5GAD C;  1AZQ A;  1EY6 A;  1OXU A;  5IWA L;  1EY5 A;  1PYB A;  3SK5 A;  4CKB A;  2N88 A;  4U68 A;  2K7V A;  1L0X B;  1V1O A;  1O78 A;  4JI2 Q;  1HTL D;  3SR1 A;  3LX0 A;  1O7I A;  4JI5 Q;  1B7Y B;  3BZK A;  5JOB A;  3SEB A;  1MD2 D;  3R3O A;  4XT1 B;  4IOA A;  5I9P A;  3HOY H;  2R6G A;  2JA7 B;  4XYQ A;  3FPU B;  1FJG Q;  1I6H H;  4DR2 L;  5KGU A;  3PMF A;  3DEP A;  5C3X A;  5C4J H;  3NBH B;  2EJF C;  4QL5 A;  3HOX G;  2MQH A;  3ER0 A;  4APV A;  2R7Z B;  2FXQ A;  2K03 A;  2UUC Q;  1D2B A;  3HGB A;  2CHB D;  1YJW A;  3OWF A;  3E5S A;  2NVT H;  4BY7 B;  3P20 A;  5JEA G;  4EQP A;  2KQ3 A;  4K5W A;  3WWV A;  2SNM A;  3KOJ A;  3PO2 H;  3M4Y A;  4EQO A;  2JA5 B;  3HOW B;  1F2M A;  3AYH B;  2O4X A;  1H9M A;  1LTB D;  2EXD A;  2V1C C;  3OPO A;  4P2C B;  1PYS B;  2B8F A;  3ONA B;  5BR8 Q;  1IKL A;  4C3H B;  1VF7 A;  1H9S A;  2CKZ B;  1Y1V G;  2M2L A;  3R2T A;  3QB3 A;  5C5M A;  1DOL A;  1H95 A;  3MFG A;  5ELE A;  2K50 A;  4PNY A;  1EIG A;  3PGZ A;  2A5H A;  1C8C A;  1F77 A;  2XWB B;  4BBR B;  4HSV A;  3DWQ A;  1VQO A;  4JI1 L;  1N9W A;  1ESR A;  2DUD A;  3R2I A;  2QDB A;  5G3L D;  3ERQ A;  4CGY B;  4WJ3 M;  2F0U A;  2JA8 H;  3RZD B;  4LFB L;  2F1M A;  5IWA Q;  3HKZ E;  3QOJ A;  5D3I B;  1PYW D;  1STY A;  3NWS A;  1B8A A;  2SOB A;  4IZ8 A;  5E4W C;  2BDN A;  2CCZ A;  4QCL A;  2MJ8 A;  4A3B H;  3J81 L;  5FLM H;  3S15 B;  2VY3 A;  1MGS A;  3TZD A;  2VQE Q;  2A69 D;  1HPC A;  1PTO F;  2DGY A;  4KTA A;  1EOT A;  4ZKC B;  1LTS D;  2L9H A;  1SDF A;  2IPK D;  2EYP A;  5JJK A;  4DUZ Q;  2YTY A;  4QB4 A;  5LL6 X;  1WD0 A;  2IY5 B;  1SRU A;  2WKD A;  1SE4 A;  3HOV G;  2I5M X;  4L5T A;  1G6Z A;  1R4P B;  1Z47 A;  5ELO A;  1QIL A;  2ZXP A;  2KCC A;  1LTR D;  3A8J E;  2NZO A;  4DFA A;  5EPL A;  3MTS A;  3QG1 A;  3EVQ A;  4HCS A;  1IBK Q;  2OT2 A;  3DUZ A;  4RMF A;  4N9P A;  1BO0 A;  3OHX C;  1N36 Q;  3KBX A;  1YNJ C;  2N3S A;  1FNW A;  3X3N A;  3ULP A;  3ICE A;  1BF4 A;  4A93 G;  5M3F B;  1HZC A;  1PZK D;  4GNX B;  1E2Z A;  2B2W A;  1NMF A;  2BOS A;  3TS2 A;  2VW9 A;  4K14 A;  1D5M C;  1I4Q A;  2WAQ B;  1Y8P B;  2BE5 C;  4HR7 B;  3OSO A;  1V9P A;  1GO3 E;  2ZTC A;  5FLX L;  2GVA A;  5C3W A;  1LTL A;  5LMU L;  1ROD A;  4JBK A;  3I4N G;  4H0L C;  1K83 H;  1GOZ A;  4A3J B;  4RHS A;  4LUO A;  4IUU A;  4UY8 C;  2PZT A;  3TZU A;  1WTX A;  1GXD C;  5I4D A;  1M1K C;  4FVM A;  2IJ0 A;  3NXW A;  1IYJ B;  2ZXR A;  1K0R A;  2KCM A;  4GOP C;  4XDX A;  1Q8K A;  3PCO B;  1STN A;  1XNQ L;  1BKB A;  3RZO H;  4DAY A;  3S2D B;  1AE3 A;  2L12 A;  3JC6 6;  4DV2 Q;  2VL6 A;  4DK3 C;  2PZW A;  4DV1 Q;  5LMN Q;  4B3R L;  3J81 i;  3LWE A;  2E2J B;  3CW2 C;  5EKI A;  4TVA B;  2LFN A;  3GTJ H;  4OON A;  3CF5 A;  1WTP A;  5JEA H;  1STA A;  1KRT A;  1O7Z A;  3CME A;  1TT2 A;  1EQV A;  2VUM G;  2L1B A;  3TRE A;  4WJW A;  1EY9 A;  4X62 L;  1X54 A;  4Y7N B;  1TWG H;  5EBD A;  2O5I C;  1N8R C;  3A54 A;  1VQL A;  3CCE A;  1F9Q A;  1S4Z A;  5JAV A;  1TY2 A;  1H9S B;  2HCI A;  1VQP A;  3OYY A;  1IW7 C;  1BBW A;  3M4P A;  1CQF A;  3LWU A;  5I2X A;  4JI0 Q;  1VQN A;  2F0T A;  1BDO A;  3L7Z C;  3MXP A;  1WTW A;  4R9W A;  1NCV A;  4PV1 C;  4RWS C;  3G6J B;  1PRT F;  2K5H A;  3NE5 B;  1LO5 D;  4DKA C;  2XVS A;  5CV5 A;  2JEB I;  3MHB A;  5KRU A;  1IBM L;  2PPB C;  2L4N A;  5IYC G;  3DHQ A;  1ENC A;  3K0X A;  4QUF A;  3STB D;  1EFW A;  1YIT A;  2A6E C;  4KLK A;  4XTC S;  1EWH A;  1TS3 A;  4ZRZ A;  4KJO A;  4B3T Q;  4A3D B;  1W2B A;  3AQQ A;  2K5Q A;  4MN3 A;  3HOV H;  4EX5 A;  3L0O A;  1D5Z C;  1SBB B;  1S3O A;  3QIA A;  2F0W A;  1WD1 A;  4L8J A;  3GTG B;  1PA6 A;  1SYD A;  1F2Z A;  2IL8 A;  3T56 B;  3ULL A;  4QJF A;  4R4I A;  2ZXO A;  1J5E Q;  5K5P A;  2AQ2 B;  3P75 A;  2OQK A;  1BOS A;  1TWA B;  1TQO A;  2DJF C;  4Y52 H;  1CZG A;  2O2L D;  3PO3 B;  2R92 G;  3C3L A;  1HCZ A;  1PDQ A;  1ZYR C;  3U50 C;  2XRQ D;  4HJ7 A;  1B2T A;  1ZEQ X;  3VYU A;  3CHB D;  2ENB A;  4GN4 B;  2KBN A;  3T1Y L;  1AEX A;  1HNZ L;  3RLF A;  3OIQ A;  1KXL A;  3EQL C;  5FO8 B;  4PQX A;  2KCT A;  4DV4 Q;  4LF4 Q;  4GKK Q;  1SN8 A;  4O1N A;  3IL8 A;  1PZJ D;  2KEE A;  3A7L A;  4ALP A;  1UUP A;  4JCV E;  4HN7 A;  3VDY A;  3K7A B;  2F0N A;  4H7B A;  5BN4 A;  3I4N H;  1I50 B;  3BVZ A;  2UU9 Q;  1IBM Q;  2E8G A;  1FNV A;  4PZ6 A;  3S1R B;  2IT1 A;  3O13 A;  4ILW A;  3TS0 A;  1B9N A;  2F3I A;  5FK9 C;  1YVC A;  4HMJ A;  3QOL A;  3RUZ A;  5LMN W;  1HNW L;  4Q0F A;  1UEB A;  1B44 D;  4O2D A;  1H9R A;  2F4V L;  3T13 A;  5COY A;  1DXM A;  4PG3 A;  3A0J A;  2IX0 A;  3SK6 A;  3RN2 A;  3I8Z A;  4A3I G;  3HOZ B;  4DAY B;  1KDA A;  5FJ8 G;  4B9W A;  1CKN A;  2OF1 A;  3GTL H;  3TN2 A;  2VQF L;  1D5X C;  2R93 B;  4R8I A;  5C3E B;  3S14 H;  2WB1 E;  1Y8N B;  2JYO A;  2FHT A;  2YTX A;  3EFX D;  4S3S A;  1QE6 A;  4LF5 L;  2VUM H;  4BBS H;  3PF4 A;  2Z0S A;  2ATW A;  4A3K B;  1A3V A;  1W3S A;  1QG7 A;  1S72 A;  4JG2 A;  5CBE E;  5M3M G;  4HED A;  3CQZ B;  1MBY A;  3I73 A;  4BY1 G;  1JB3 A;  2B2V A;  2UXB Q;  5C0X J;  2AWO A;  4A3F B;  1B1Z A;  2B2Y A;  4V19 0;  1IZ6 A;  1UAP A;  3J7Z C;  1B53 A;  3CMA A;  1LTT D;  2E2I H;  2I46 A;  4CJ2 C;  4DK0 A;  1L1O C;  4H13 C;  4PMC A;  1NJI C;  3D4D A;  1UE7 A;  3DWP A;  4POG A;  1M8A A;  4DR3 L;  4R4C A;  1TWH H;  3MA2 B;  4DR7 Q;  1TWF H;  1K28 A;  3GQB A;  2K14 A;  3QO2 A;  3SK4 A;  2JQO A;  2ALY B;  3CCQ A;  2F0E A;  4JV5 Q;  4KV6 A;  1SNC A;  4QUC A;  3ERO A;  5GAG C;  2I5H A;  3Q23 A;  3S1N B;  4JW0 A;  4KKS A;  4RCN A;  5FO9 B;  1XMQ L;  4X3T A;  1OO9 B;  2K33 A;  1VQ8 A;  3DMU A;  2RDF A;  4MHE A;  2KUM A;  3BDL A;  2Q2H A;  3NHH A;  4C3J B;  1PLF A;  2PI2 E;  4JYA Q;  3HFZ B;  4LF6 L;  5BN5 A;  4BS9 A;  5IOC A;  3MC0 B;  4B3S L;  4C3I G;  4NB3 A;  3AMU A;  2NVQ B;  1ILP A;  4O42 A;  4ZK9 B;  3D4W A;  3PQI A;  4IPC A;  1EWC A;  2VQF Q;  3M4O H;  2GN5 A;  1K73 C;  2NVY H;  5CV9 A;  3KBG A;  4J6H A;  4QIW B;  3FRP B;  3JAM E;  4MZ9 A;  3SXH A;  1DOM A;  1TS4 A;  1KHI A;  4WJ4 A;  1VQ5 A;  4K6D A;  1V1P A;  5CC4 A;  5D3D A;  5L37 A;  3K5N A;  2JA7 G;  3HOU B;  4LF7 L;  3J7A V;  4RGM A;  1SE2 A;  2PI2 A;  5EJW A;  3UDF A;  3NUC A;  1HXY D;  4LFA Q;  1ICF B;  2R92 H;  1VQE A;  2R7Z G;  1EYD A;  1PTO B;  2ZTD A;  3CC2 A;  2F0V A;  1CKO A;  3AU7 A;  1PH4 A;  1J6Q A;  3M4Q A;  2EYF A;  4DAV A;  4DR3 Q;  4BY7 G;  2F0I A;  2F52 A;  3K7U C;  4A3M B;  1PH9 A;  2F4I A;  2BA0 A;  2A68 D;  3I4O A;  1ENF A;  2D9U A;  5CGK A;  3CCM A;  1JWS D;  5A2Q E;  1A2U A;  2JA5 G;  3HOW G;  1GUW A;  2B63 B;  2JJQ A;  2B29 A;  1WYD A;  2F0Q A;  1PFM A;  3M7G A;  4C3H G;  4C2M B;  1I4P A;  4FXD A;  4A76 A;  1LV9 A;  2HT1 A;  3CXC A;  3FDT A;  4JI2 L;  1WTO A;  1M4V A;  2HQE A;  4G7H C;  4DR5 Q;  3RN5 A;  4I7Z C;  4KN7 C;  5C44 H;  3V05 A;  5J1Z A;  1UE1 A;  2RDG A;  2HHH Q;  1JB7 A;  1A2T A;  3MFY A;  5CV8 A;  3I3C A;  4XQJ A;  3PUZ A;  1QCB D;  5LHY 1;  1BBU A;  3GV6 A;  4BBR G;  5IGD A;  1KQS A;  2N55 A;  4B3M Q;  1VQD A;  1BNZ A;  4DUY Q;  2YU9 B;  1FJG L;  1LUZ A;  1WTH A;  1YNX A;  4ZAI A;  5IT9 c;  3H0G B;  4DK6 C;  1CA6 A;  1QJO A;  3S2H H;  1C4Q A;  1YJN A;  3NEN A;  2UUC L;  4A3I H;  3U4Z A;  4CKE A;  5FJ8 H;  2XSC A;  5AFW A;  2J4X A;  1JIC A;  4GN3 B;  3JAM L;  4A3E B;  3H15 A;  4CJ1 B;  4OX9 Q;  1VQ6 A;  2QIL A;  5CV6 A;  4H02 A;  4LK1 C;  2QA4 A;  1A6X A;  1O7Y A;  1CKN B;  2ES2 A;  3CCV A;  1WI5 A;  1NUC A;  3BYY B;  1X32 A;  2N8N A;  5BR8 L;  4GNX C;  1ML0 D;  4NXM Q;  4BY1 H;  4KKU A;  3SVM A;  4BA2 I;  3NTK A;  1RKN A;  1A15 A;  3DEO A;  1QOH A;  2KCN A;  4UPA A;  4E6I A;  2LSS A;  1QZG A;  4X64 Q;  4M1U B;  4G7Z C;  3Q0A A;  3URY A;  5M9O A;  3W1G A;  2BA1 A;  4JI4 Q;  1F2Y A;  1UWV A;  5A2Q L;  4X3S A;  2K5D A;  4HIO A;  3CPF A;  2HUG A;  1G8Z D;  4NP5 A;  3G71 A;  3TSS A;  1QVF A;  2YV5 A;  1ILQ A;  4IFD J;  2WB1 B;  4LMQ D;  2L11 A;  5I6Y A;  1RD9 D;  1Y1W B;  1HA5 A;  2BE5 D;  1VQH A;  4F7X A;  4YHH Q;  5M3F G;  4K8I A;  5C4Z A;  1EYG A;  3U58 A;  1DJR D;  3J81 E;  2VQE L;  1GUT A;  3KK7 A;  4AIM A;  5M5X H;  2UXC L;  2J0T D;  4DUZ L;  1DON A;  2FMC A;  1Q46 A;  2Z1C A;  3EN2 A;  3ND9 A;  4JI8 Q;  2VXW A;  1XXG A;  1ASY A;  2C35 B;  1HFN A;  4P75 A;  1OXX K;  2B2U C;  1F9R A;  2NUC A;  3GTP B;  1EYC A;  4C3I H;  2NVT B;  4K8J A;  1JWU D;  5IGB A;  3L3O C;  1EL0 A;  4A3J G;  4JPB W;  1SFO B;  4L5S A;  3QJY A;  1WCM B;  3F2U A;  4KD3 A;  4IJH A;  2SNS A;  1IBK L;  2EY2 A;  4KY7 A;  3IKJ A;  1PRT B;  4QQB X;  4R4O A;  1G91 A;  2X69 A;  2GA4 B;  1D6E C;  5C5L A;  2JA7 H;  1N36 L;  5G3L F;  1I94 L;  4P72 A;  3VR2 A;  4UP8 A;  1EQT A;  2XTI A;  1V1P B;  1CSQ A;  2A68 C;  4X3K A;  1Y69 U;  1MJE A;  2R7Z H;  5J39 A;  3JAM i;  3Q6S A;  1I4X A;  2D5D A;  2OEO A;  1KNA A;  2B2T C;  3I91 A;  5DLQ E;  2EY1 A;  2JA8 B;  4BY7 H;  1X56 A;  2JA5 H;  1PFS A;  3HOW H;  1IW7 D;  4OWX B;  3KLS A;  2X6G A;  1Q82 C;  4C3H H;  1BCP D;  5FLX E;  1TWC H;  1E3P A;  4FF4 A;  1C9O A;  2K05 A;  3A8K E;  3GTK H;  1PH8 A;  1AW7 A;  1V8Q A;  4XQQ A;  4A3G B;  4HCE A;  1HTP A;  1MI2 A;  5KND A;  4I7A A;  5H1S E;  3BYT B;  4C56 C;  4DF7 A;  2UXC Q;  1YBY A;  4BXX G;  4AYB E;  3R8B A;  2NWG A;  4CDE C;  1Q86 C;  3A74 A;  4DV2 L;  4ZCK A;  3K80 C;  4JI3 L;  3SDZ A;  5T1G A;  2A6E D;  4DV1 L;  4MIU A;  3RZD H;  3MXG A;  2IHE A;  5LMN L;  3E3X A;  4DGZ A;  2HDM A;  5HGT A;  1CTM A;  3OWE B;  1KAW A;  2F3W A;  1RTO A;  4XIG S;  5KNC A;  2K75 A;  4JBW A;  3KJP A;  1ET9 A;  3VR5 A;  4YWM A;  1I94 Q;  1S5B D;  4A3D G;  3KF8 A;  2LS0 1;  5GRO A;  1SE3 A;  2L5T A;  1JOQ A;  1TII D;  1HUM A;  2AHO B;  1GVP A;  4NDX A;  2M00 A;  1EY4 A;  2IWH A;  3D0F A;  3AFP A;  1KTK A;  2DY8 A;  3H91 A;  3GTO B;  2F0F A;  4ZKB B;  5FKA C;  2B2W C;  3D3R A;  2VB2 X;  3I2Z A;  1OXT A;  1A3T A;  5EPK A;  1ZYR D;  4JI0 L;  2RHS B;  1I4R A;  2NVX H;  1JT8 A;  2XIW A;  5F2D A;  2IHF A;  5IE8 A;  3PO3 G;  3GDE A;  2PNR C;  2Y0S E;  5M3F H;  4R4Q A;  1GJX A;  5EBC A;  4FF3 A;  4FF1 A;  1P16 A;  1KLU D;  1S5F D;  3BU2 A;  4X3U A;  1NR2 A;  1ET6 A;  4DNT B;  1B3A A;  3FKI B;  4JBJ A;  3MXN A;  1XNR Q;  2DN8 A;  5IYB G;  1QB5 D;  4HSP A;  4TSS A;  5IP9 G;  3GV3 A;  4B3T L;  5IGF A;  4K5V A;  1DCZ A;  1NY4 A;  4UP9 A;  3CC4 A;  1YHA A;  2B3G A;  1VQC A;  4JI3 Q;  2Z4I A;  2VS1 A;  3HOX H;  1CHP D;  1WVL A;  1ESF A;  1UE6 A;  2F0O A;  1E7Z A;  2M9V A;  4KY5 A;  1DOK A;  1HZ9 A;  2BH8 A;  3ITP A;  3ULJ A;  4A3J H;  1KIX A;  1CM9 A;  4GOP A;  5E3F A;  1X3Q A;  5CV4 A;  4OXP A;  4RA8 A;  1Z6H A;  2AMC B;  1J5E L;  4IOC A;  1JE4 A;  2LXK A;  1Z9F A;  1LAC A;  1SYB A;  4UDU C;  3A5Z B;  3S2D H;  4OGQ C;  2EYH A;  1XTD A;  4JOI C;  3HRZ C;  1Y1V H;  1EU3 A;  3HOZ G;  1PFN A;  3TME A;  1PXU A;  3GO5 A;  4MTN A;  2KEC A;  5C4X B;  4YCU A;  2R93 G;  1STH A;  5C3E G;  5DEH A;  1BCP C;  4MNO A;  1YZ6 A;  4DNI A;  4UP7 A;  4EVO A;  4X66 L;  2ICE C;  4AQY Q;  4DV4 L;  4N8X 1;  2RSO A;  2IW3 A;  4LF4 L;  2MFI A;  1SMY C;  1QUQ A;  4GKK L;  4A3K G;  1B9M A;  1JOO A;  5M5Y B;  5E7N A;  3IFT A;  1L2F A;  1HUN A;  2NYZ D;  4K5X A;  1YEZ A;  1CSP A;  4Y7N H;  3S1Q H;  3P1H A;  4A3F G;  1EIF A;  1EY7 A;  2A6H C;  2PO4 A;  4RGT A;  2UU9 L;  2AQ1 B;  1HQR D;  1RIP A;  4EGV A;  4IAL A;  1N32 Q;  4KN4 C;  4FYD A;  2OTJ A;  4ME3 A;  5A35 A;  2CW0 C;  2YTV A;  3I4M B;  1XX8 A;  2QKI C;  1LTG D;  2BH2 A;  4BXX H;  4B08 A;  3IAY A;  2UUA L;  1K0S A;  1K3R A;  1D8L A;  4TQU S;  5D14 A;  4RCO A;  3S17 B;  4LUV A;  4FNF A;  2RA4 A;  3G7L A;  5AJ3 Q;  2NZ1 D;  1HRJ A;  3CCU A;  2TMP A;  3SGI A;  1JCK B;  1G2T A;  1CQV A;  5KEE A;  2EJG C;  2F0L A;  4KJN A;  3MZ5 A;  3FP9 A;  3HKZ B;  5TSS A;  4WRD A;  5EGT A;  1SNQ A;  3T53 B;  1ENA A;  1TKW B;  2E75 C;  4TKO B;  2VNU D;  3C46 A;  1DYQ A;  1KC8 C;  2H5X A;  1Q12 A;  1PTO C;  3M3Y B;  1XJV A;  2E74 C;  4C3J G;  3CKI B;  1F9S A;  1FL0 A;  1RJT A;  2F0P A;  4A3D H;  2UXB L;  3WOF A;  1ZKO A;  4DV5 Q;  5M5W B;  1STE A;  1GM5 A;  1FYC A;  1SR3 A;  4KY6 A;  1HH2 P;  1S5C D;  4A93 H;  1KNE A;  3PSI A;  3M9B A;  4LFC Q;  2F03 A;  4ME5 A;  4AYB B;  1VCI A;  3PUW A;  4DV3 Q;  3FPP A;  4UHV A;  3SHL A;  1KL9 A;  4X66 Q;  3HEJ A;  4DR7 L;  2UUB L;  4O0A A;  3VR4 A;  3S16 H;  1KDC A;  1I4H A;  2BCO A;  3BG3 A;  2Z6B A;  5GAE C;  1TWA H;  2D62 A;  4JV5 L;  2O5J C;  5ELD A;  3BZC A;  3PO3 H;  1TS5 A;  4FXK C;  4IFD I;  3J81 j;  1ZXT A;  1ICW A;  5K36 G;  3NTH A;  3J7Y W;  4A3M G;  1EEI D;  1N34 L;  1KDB A;  4RGN A;  5COR A;  1XPO A;  3N52 A;  5HY6 A;  4JYA L;  5BN3 A;  5IP9 H;  1JR0 D;  1K8A C;  2B63 G;  2UUA Q;  2B39 A;  2K32 A;  3GTL B;  1Q1B A;  2PMZ E;  4R8N A;  3MXN B;  4P71 A;  1NSN S;  1B4O A;  3GTM B;  1PH3 A;  4OIK A;  4DR6 Q;  4LWC A;  1E1T A;  1CUK A;  3FHW A;  1I50 H;  3PV0 A;  2F0G A;  1QZH A;  4BBS B;  3BVG A;  4BWG B;  1OTC A;  3I90 A;  3ERS X;  1X3P A;  1HZA A;  2P5Z X;  4IJL A;  1LAB A;  3MXU A;  1U4P A;  1VDZ A;  2R7D A;  4RGO S;  1N33 L;  5C6A A;  5CYU A;  2Y0S B;  4GLX A;  4GOP B;  3CAM A;  2LY7 A;  3VR3 A;  4JI7 Q;  3H0G G;  4LFA L;  2R3Z A;  2B2Y C;  3OOC A;  4R4T A;  4R1J A;  2L15 A;  3RLO A;  1SAP A;  4HTH A;  3HOZ H;  1SYC A;  4KHP Q;  4A3E G;  3ZJY C;  1Q7Y C;  1YNN C;  2R93 H;  5C3E H;  1JJC B;  2L0C A;  2NN6 G;  4JVZ A;  3U9O A;  2UUB Q;  1I3Q H;  3DM1 A;  3B6Y A;  5JJZ A;  3NPP A;  1PH5 A;  4PZ8 A;  3I55 A;  4A3K H;  2E2D C;  2C9O A;  4C1N I;  4NXN L;  4H44 C;  1AZP A;  3CQZ H;  5EKL A;  4EQN A;  1EZ6 A;  3U9S A;  1U4M A;  1NR4 A;  3J80 c;  2QGQ A;  3HKS A;  1QUQ B;  1L1O A;  4DR5 L;  4A3F H;  1YI2 A;  5CV7 A;  2HHH L;  1MKH A;  3RLN A;  1BVS A;  1F2L A;  5IYC H;  3TP6 A;  1U5K A;  2D0P A;  2A73 B;  3CRK C;  2PQA A;  3G48 A;  4KI0 A;  3HS0 C;  3A8I E;  3Q24 A;  5DM7 3;  2C5C A;  1W6J A;  5FOB B;  2ID0 A;  4B3M L;  1GHJ A;  3IFD A;  2Q2T A;  1N34 Q;  4DUY L;  2CH4 W;  1EOV A;  2X6L A;  4B9X A;  1B50 A;  5C4H A;  4NMZ A;  2TSS A;  2Q8R E;  2QW7 A;  5IP7 G;  2DNC A;  3K5O A;  2LMC B;  2NB0 A;  1R9T H;  2IX1 A;  4FP5 D;  2WB1 G;  3PIO 3;  1W6K A;  1SNM A;  4A4I A;  1PRT C;  4DR1 Q;  1EEF D;  1Y1W G;  2FJ2 A;  1HNX L;  3GTQ B;  3NBH A;  1S5D D;  1HR0 Q;  2WFW A;  3S1N H;  1SMX A;  3F2D A;  4OX9 L;  1JMC A;  1BUV T;  2BDO A;  5NUC A;  2JN4 A;  1X3G A;  1LT4 D;  1K8G A;  2AQ3 B;  2K1B A;  2KHJ A;  2XGT A;  4DXG A;  3T16 A;  1YHB A;  1N33 Q;  3EJI A;  5KYL A;  3PF5 A;  1VF5 C;  1LLR D;  3I70 A;  2RVL A;  4NXM L;  3DM3 A;  4P74 A;  3S1M B;  1IBL Q;  1VMC A;  2JA6 B;  2KOL A;  2NVQ H;  4F88 A;  4X64 L;  4IUT A;  3WDN A;  5IT9 L;  1GHK A;  4IUV A;  5KYI A;  1WCM G;  4JI4 L;  2K04 A;  1MSH A;  2KED A;  5I6W A;  1JWM D;  2K5N A;  2ZJQ A;  3PIP 3;  2SEB D;  3C1E A;  3U4V A;  2K01 A;  3F2B A;  1A3U A;  1E2V A;  1LYL A;  3VR6 A;  5C44 B;  1LT6 D;  4NXN Q;  1IHZ A;  3H3V H;  3TP7 A;  1LTA D;  3FEW X;  1XWE A;  2E5L Q;  5ISR A;  2CQA A;  4Z9C B;  2B8G A;  1U9R A;  4YHH L;  2HIX A;  1PTO H;  4K6L A;  5IOD A;  1TVX A;  3J7A 5;  2HQL A;  2MNA A;  5K36 H;  3UE1 A;  5JEA J;  4DR4 Q;  4ZYS A;  3D6W A;  1KRS A;  1IYV A;  4A3M H;  3NWT A;  1FNU A;  5C0X G;  1ASZ A;  2K4K A;  3FVQ A;  3HZX A;  1VQJ A;  4JI8 L;  2WV6 D;  2B63 H;  2JXM B;  2EOT A;  3BVM A;  1L0W A;  4C2M H;  3SK8 A;  5GAH C;  4QF4 A;  5EKK A;  5EPJ A;  1HNX Q;  4OL7 A;  4A3G G;  3H3V I;  1RHP A;  1EUJ A;  3A7A B;  2RHQ B;  4IUQ A;  4I65 A;  4OEL B;  3NEM A;  3J7A F;  4DV7 Q;  2Z6K C;  5M3M H;  1NMG A;  3H0G H;  1OXS C;  3OW7 A;  2N49 A;  1NE3 A;  4KHV A;  2J7Z A;  3CCJ A;  4RHR A;  4QGU A;  1MHW C;  4PMW A;  1E0B A;  1O7L A;  2MO1 A;  1AN8 A;  2ZM6 Q;  2E2H H;  2K28 A;  4YY3 L;  3KLR A;  3LNN A;  2PMZ B;  2NN6 H;  2G5D A;  1PMR A;  1EIH A;  4J15 A;  3T1H Q;  2JE6 I;  2I5L X;  3UDX A;  1PV4 A;  3F2C A;  1NAP A;  5ELC A;  2G9H D;  3HOY B;  1CK1 A;  3BJU A;  1JJG A;  3E0J A;  3A5U A;  3OW2 A;  1WTR A;  1I6H B;  1X3E A;  5IYD G;  2RSN A;  4DPG A;  4X65 Q;  2Q8I B;  1L1O B;  5C4J B;  3TBI B;  3VA5 A;  3GP7 A;  3MEH A;  4L6T B;  4IUR A;  2WAQ G;  2R61 A;  3M85 A;  1XTC D;  2PQA B;  5IP7 H;  1Q3L A;  5J22 A;  1LM0 A;  2PZU A;  1HR0 W;  3ZYY X;  3FMC A;  3MAQ A;  4J8Q A;  1KAB A;  3HG9 A;  3Q8D A;  2EY6 A;  2NN6 I;  1VQI A;  4DV6 L;  1J8I A;  3PO2 B;  3CP0 A;  1Y1W H;  3NSW A;  4CHT B;  1K8M A;  4DA2 A;  1GUN A;  3E0E A;  1VQA A;  1VQ9 A;  1K8O A;  1GD7 A;  3EA6 A;  3RD4 A;  1AE2 A;  1X6O A;  1X65 A;  2KVM A;  3FKI G;  3EBE A;  2B2U A;  2F3V A;  4ZUJ A;  1Y8O B;  1CZW A;  1WOC A;  1WFQ A;  1EYA A;  2L55 A;  1GUO A;  1BCP F;  1T5X D;  3GTP H;  2ZJR A;  3D6C A;  1BBX C;  4RAU C;  1SFO H;  4FF2 A;  3NQT A;  2XN9 C;  1FVI A;  4YY3 Q;  1WCM H;  4AH6 A;  3EIV A;  2PNH A;  3RMH A;  2MUY A;  1TWC B;  3R93 A;  4LF8 L;  1L0Y B;  4A3B B;  3GTK B;  1VS0 A;  1C48 A;  1EQQ A;  1SJE D;  2D2C C;  2EY5 A;  4OIJ A;  1E22 A;  2MPM A;  3W1B A;  2XWJ B;  1SMY D;  1B70 B;  2CFM A;  4CJ0 B;  2B2T A;  1WTQ A;  2DJG C;  4HID A;  3KUP A;  2KJX A;  1GUS A;  3Q22 A;  5C4X G;  4BBR H;  1AH9 A;  1C0A A;  2K5V A;  2A6H D;  2UXD Q;  1XNR L;  1PHJ A;  5C0X H;  1ONL A;  1QWY A;  4HJ9 A;  5E1F A;  5IGE A;  1TS2 A;  1VQG A;  3MEF A;  4LUZ A;  1DZ1 A;  3T51 B;  1UEA B;  3TRZ A;  2R7F A;  2EQS A;  2F0J A;  4YCW A;  2CW0 D;  2MP1 A;  1YHQ A;  3GD7 A;  1VQ7 A;  1PZI D;  4DV6 Q;  1JE5 A;  3W2D A;  4F8M A;  2EDG A;  3K0Y A;  2RF4 A;  4A3G H;  4HAE A;  4HIK A;  4LJZ C;  2ZJP A;  4DR2 Q;  2EYJ A;  3S15 H;  4IFD G;  1EFI D;  2AUK A;  3QWN A;  3I4M G;  2OWO A;  2HCC A;  1SLJ A;  1T5E A;  4A3L G;  2Q8T A;  2OQ0 A;  3VYT A;  2QCP X;  2NTT A;  4CBV A;  1E24 A;  1PTO D;  2CWP A;  2WII B;  2QEX A;  1PH1 A;  5C0X I;  4K2K A;  3S9W A;  3AB9 A;  3E9H A;  2MGS A;  4UAI A;  4JI6 L;  1HFG A;  1SND A;  2NVX B;  2DY7 A;  2CH4 A;  3OMG A;  3J81 c;  1FR3 A;  3VYS A;  3BDC A;  4AQY L;  3D4R A;  3HKZ G;  4LF8 Q;  1K83 B;  3KF6 A;  3CC7 A;  2A8V A;  4U67 3;  5J3B A;  4ZUI A;  3BZD B;  2AWN A;  5JVH 3;  3K6O A;  4OO1 G;  2CWA A;  1DD2 A;  4LAA A;  4KHZ A;  1Q8I A;  4JI1 Q;  1N32 L;  2JP1 A;  3RZO B;  4AYB G;  1Q1E A;  3W5O A;  3GTO H;  3NTI A;  4XYO A;  5ELF A;  5IYD H;  5KIX A;  3KYH C;  1JC7 A;  3HOX B;  4LFB Q;  1X3F A;  1P8L A;  1AFP A;  5E4X A;  2VZA A;  3UDG A;  2MO0 A;  3GTJ B;  4FO2 A;  4OWT B;  2EYO A;  4HJA A;  5AJ3 L;  2JA9 A;  1HQM C;  2OXP A;  3TQY A;  5ELB A;  3WOE A;  1NBW A;  1A62 A;  3OIP A;  4NW2 A;  2GVB A;  1XPR A;  2F0S A;  4N8F A;  2ASB A;  5LL6 S;  3H6M A;  4KK7 A;  1TWG B;  1BR9 A;  1CA5 A;  1G29 1;  5DNF A;  3D31 A;  4NPS A;  3FKI H;  2SDF A;  1Y1V B;  1VMP A;  1CFM A;  2RKS A;  1LTI D;  1EU4 A;  2ZT9 C;  4A3C G;  1BXT A;  4G4K A;  4DV5 L;  5FLX c;  1A63 A;  1OXV A;  3N6R A;  4KD4 A;  4ODG A;  4LFC L;  2E2J H;  2I0Q A;  4JI6 Q;  4BBS G;  2EXZ A;  4DV3 L;  4RFB A;  1X55 A;  5JPN C;  3LGJ A;  2VB3 X;  3E9I A;  3I7F A;  3L9A X;  5HGQ A;  4DV0 L;  3X3M A;  1DGS A;  4G57 A;  4CKC A;  2KEN A;  2YYZ A;  3S1Q B;  2K5W A;  4JOI A;  2Y0S G;  1YNN D;  5EQ0 A;  4GZY C;  2LKV A;  1KLG D;  1BQQ T;  3D8G A;  4JBM A;  2EYL A;  2RCN A;  2NBF A;  1FGU A;  1TY0 A;  1IYU A;  3H09 A;  2XRS D;  1EWI A;  1PH6 A;  4A75 A;  3K57 A;  4KMU C;  1D1I A;  5C4X H;  3HOV B;  4WOR A;  2AUJ D;  1GKH A;  1STG A;  2NZH A;  4QIW E;  4DAP A;  5LMU Q;  1EIY B;  4X6A H;  4GLA C;  2A69 C;  1TR5 A;  4HJ8 A;  1C7Y A;  3CU7 A;  1M90 C;  4J1M A;  4JC0 A;  1U4L A;  5M5Y H;  3CCR A;  1FD7 D;  3P7J A;  4DR6 L;  2PQE A;  1F9P A;  4GKJ L;  4C1N K;  1I5F A;  3PUY A;  3H3V C;  5CR3 A;  2PYK A;  1XNQ Q;  4CDF C;  1XPU A;  2JSO A;  5IGG A;  1GUG A;  4IFD H;  1PRT D;  4OHJ A;  4DU9 A;  5I9O A;  1RTN A;  2Q2U A;  3I4M H;  2XNA C;  3AFQ A;  3KDF A;  3C1F A;  2Z4H A;  1PVO A;  1JJ2 A;  3J80 E;  4QY7 A;  3T4A C;  1MIU A;  3OTO L;  3KFU A;  4A93 B;  4A3L H;  4JI7 L;  4B3R Q;  3K5M A;  3CD6 A;  1SJH D;  4WFN 3;  1I4G A;  4XQN A;  2QDL A;  3M7N A;  3S17 H;  3UI2 A;  3GTG H;  3KF8 B;  4M8A A;  4Q5V A;  2E76 C; 
#chains in the Genus database with same CATH homology
 3BS1 A;  4YIJ A;  3S16 B;  2WP8 J;  3NP8 A;  1J9O A;  1IL8 A;  4RH6 A;  4ABN A;  4DK1 A;  2F0K A;  2WKC A;  2MHV A;  3I4N B;  1LT3 D;  3NBI A;  4XXE A;  1SSO A;  5CBA E;  3CRL C;  4DXF A;  1AP0 A;  1UNS A;  1WTV A;  4OO1 H;  3VA7 A;  1EY8 A;  4TRD A;  4ZLT F;  1SNO A;  1CI3 M;  3S14 B;  3TP8 A;  2EYM A;  2NTS A;  3E6Z X;  4KKT A;  2VUM B;  1O80 A;  4IUP A;  5HUR A;  1DM0 B;  2FMM A;  4XT3 B;  3J80 L;  4PMB A;  2EVB A;  4OO1 I;  2B2V C;  2E2I B;  1STB A;  3PUV A;  4FXG C;  1CHQ D;  2ICI A;  1TWH B;  2RQX A;  3MVV A;  4HMI A;  4ULL A;  1TWF B;  1I3Q B;  4IN3 A;  2CVR A;  5IT9 E;  1Q90 A;  2EJM A;  2V4D A;  3K58 A;  4QMG A;  4ZQ3 A;  2PCF B;  1H9J A;  2KA7 A;  4V0B A;  4RKL A;  1JOK A;  4L63 B;  1SYF A;  2H4O A;  5IGC A;  1XYI A;  1U4R A;  1FGB D;  2I07 B;  3DWA A;  1D1K A;  1SYE A;  1R9T B;  2F0M A;  5D65 A;  3VYR A;  4G7O C;  1BCP B;  2QF7 A;  1G2S A;  1II3 A;  1H9K A;  3SE0 A;  3M4O B;  2NVY B;  1SXT A;  2K6A A;  3H94 A;  1HHV A;  3W3A A;  3V96 A;  2F0H A;  5JVG 3;  4K2L A;  3C2P A;  2QEJ C;  1Z7T A;  4N9T A;  2R92 B;  1TU2 B;  3PUX A;  5I2Y A;  2PW7 A;  1HA6 A;  3V2T A;  1LT5 D;  3I4L A;  1RCV D;  2G9D A;  4F87 A;  2HDL A;  2EZV A;  1SYG A;  5JPM C;  1CT1 D;  1JOR A;  5CMD A;  2F0D A;  1MSG A;  3K5L A;  1QNU A;  2JEA I;  1EZ8 A;  1KAA A;  1JQY D;  5FO7 B;  2KHS A;  3S2H B;  4A3I B;  5IIF A;  4IUN A;  4DN4 M;  2FIN B;  3A55 A;  3BDO A;  1EY0 A;  3KLS X;  3TDQ A;  3I72 A;  1RF2 D;  1V43 A;  3NQI A;  3A56 A;  3MWY W;  2Z8L A;  4DNR B;  2A74 C;  1SNP A;  5M3M B;  4BY1 B;  3NK9 A;  2IX3 A;  2EE1 A;  2EPB A;  3ND8 A;  2RBM A;  2RDH A;  5DAU A;  4IQZ A;  4BA1 I;  3TP5 A;  1SEB D;  4NKL A;  2E2H B;  1S5E D;  1RDP D;  1I6V C;  4RKB A;  4ID6 A;  1PFB A;  3OMC A;  5KNB A;  1E2W A;  5DM6 3;  4JK1 C;  1IKM A;  2FFK B;  3DXJ C;  3K59 A;  5M5X B;  2DNE A;  1YNJ D;  1R4Q B;  5T1I A;  2WIN B;  3HP3 A;  2H1E A;  2WAC A;  2PW5 A;  1QNK A;  4C3I B;  1AZQ A;  1EY6 A;  1OXU A;  1EY5 A;  3SK5 A;  4CKB A;  2N88 A;  4U68 A;  2K7V A;  1L0X B;  1V1O A;  1O78 A;  1HTL D;  3SR1 A;  3LX0 A;  5JOB A;  3SEB A;  1MD2 D;  3R3O A;  4XT1 B;  5I9P A;  2R6G A;  2JA7 B;  4XYQ A;  3FPU B;  5KGU A;  3PMF A;  3DEP A;  5C3X A;  2EJF C;  2R7Z B;  2K03 A;  1D2B A;  3HGB A;  2CHB D;  3OWF A;  3E5S A;  4BY7 B;  3P20 A;  5JEA G;  4EQP A;  2KQ3 A;  4K5W A;  2SNM A;  3M4Y A;  4EQO A;  2JA5 B;  3HOW B;  1F2M A;  2O4X A;  1H9M A;  1LTB D;  3OPO A;  4P2C B;  2B8F A;  3ONA B;  1IKL A;  4C3H B;  1VF7 A;  1H9S A;  2M2L A;  3R2T A;  3QB3 A;  5C5M A;  1DOL A;  3MFG A;  5ELE A;  4PNY A;  1EIG A;  2A5H A;  1C8C A;  1F77 A;  2XWB B;  4BBR B;  4HSV A;  3DWQ A;  1ESR A;  3R2I A;  2QDB A;  5G3L D;  3ERQ A;  4CGY B;  2F0U A;  3RZD B;  2F1M A;  3QOJ A;  5D3I B;  1PYW D;  1STY A;  3NWS A;  2SOB A;  4IZ8 A;  5E4W C;  2BDN A;  4QCL A;  2MJ8 A;  3J81 L;  3S15 B;  1MGS A;  3TZD A;  2A69 D;  1HPC A;  1PTO F;  4KTA A;  1EOT A;  4ZKC B;  1LTS D;  2L9H A;  1SDF A;  2IPK D;  2EYP A;  4QB4 A;  5LL6 X;  1WD0 A;  2WKD A;  1SE4 A;  1G6Z A;  1R4P B;  1Z47 A;  1QIL A;  2ZXP A;  2KCC A;  1LTR D;  3A8J E;  4DFA A;  5EPL A;  3MTS A;  3QG1 A;  3EVQ A;  4HCS A;  2OT2 A;  3DUZ A;  4N9P A;  1BO0 A;  3OHX C;  3KBX A;  1YNJ C;  1FNW A;  3X3N A;  1BF4 A;  5M3F B;  1PZK D;  1E2Z A;  2B2W A;  2BOS A;  4K14 A;  1D5M C;  1I4Q A;  2WAQ B;  1Y8P B;  2BE5 C;  4HR7 B;  3OSO A;  5FLX L;  5C3W A;  1ROD A;  4H0L C;  1GOZ A;  4A3J B;  4RHS A;  4IUU A;  2PZT A;  3TZU A;  1WTX A;  1GXD C;  5I4D A;  4FVM A;  2IJ0 A;  3NXW A;  2ZXR A;  4XDX A;  1STN A;  4DAY A;  3S2D B;  2L12 A;  2PZW A;  3LWE A;  2E2J B;  5EKI A;  2LFN A;  1WTP A;  5JEA H;  1STA A;  1O7Z A;  1TT2 A;  1EQV A;  2L1B A;  4WJW A;  1EY9 A;  4Y7N B;  5EBD A;  2O5I C;  3A54 A;  1F9Q A;  1S4Z A;  5JAV A;  1TY2 A;  1H9S B;  2HCI A;  1IW7 C;  1CQF A;  3LWU A;  5I2X A;  2F0T A;  1BDO A;  3L7Z C;  3MXP A;  1WTW A;  4R9W A;  1NCV A;  4PV1 C;  4RWS C;  3G6J B;  1PRT F;  3NE5 B;  1LO5 D;  2XVS A;  5CV5 A;  2JEB I;  3MHB A;  5KRU A;  2PPB C;  2L4N A;  3DHQ A;  1ENC A;  4QUF A;  2A6E C;  4XTC S;  1EWH A;  1TS3 A;  4ZRZ A;  4KJO A;  4A3D B;  2K5Q A;  4MN3 A;  1D5Z C;  1SBB B;  1WD1 A;  3QIA A;  2F0W A;  4L8J A;  3GTG B;  1SYD A;  1F2Z A;  2IL8 A;  3T56 B;  2ZXO A;  5K5P A;  2AQ2 B;  3P75 A;  1BOS A;  1TWA B;  1TQO A;  1CZG A;  2O2L D;  3PO3 B;  3C3L A;  1HCZ A;  1PDQ A;  1ZYR C;  2XRQ D;  1B2T A;  1ZEQ X;  3VYU A;  3CHB D;  2ENB A;  1AEX A;  3RLF A;  3OIQ A;  3EQL C;  5FO8 B;  4PQX A;  4O1N A;  3IL8 A;  1PZJ D;  2KEE A;  3A7L A;  1UUP A;  4HN7 A;  3K7A B;  2F0N A;  4H7B A;  5BN4 A;  1I50 B;  3BVZ A;  1FNV A;  3S1R B;  2IT1 A;  3O13 A;  4ILW A;  1B9N A;  5FK9 C;  4HMJ A;  3QOL A;  3RUZ A;  4Q0F A;  1B44 D;  1H9R A;  3T13 A;  5COY A;  1DXM A;  2IX0 A;  3SK6 A;  3I8Z A;  3HOZ B;  1KDA A;  4B9W A;  2OF1 A;  3TN2 A;  1D5X C;  2R93 B;  4R8I A;  5C3E B;  1Y8N B;  2JYO A;  2FHT A;  3EFX D;  4S3S A;  1QE6 A;  4A3K B;  1A3V A;  1QG7 A;  5CBE E;  4HED A;  3CQZ B;  1MBY A;  3I73 A;  1JB3 A;  2B2V A;  5C0X J;  2AWO A;  4A3F B;  1B1Z A;  2B2Y A;  4V19 0;  1UAP A;  1B53 A;  1LTT D;  2I46 A;  4CJ2 C;  4DK0 A;  4H13 C;  4PMC A;  3D4D A;  3DWP A;  1M8A A;  3MA2 B;  3GQB A;  3QO2 A;  3SK4 A;  2F0E A;  4KV6 A;  1SNC A;  4QUC A;  3ERO A;  3Q23 A;  3S1N B;  4KKS A;  4RCN A;  5FO9 B;  4X3T A;  1OO9 B;  2K33 A;  3DMU A;  2RDF A;  4MHE A;  2KUM A;  3BDL A;  3NHH A;  4C3J B;  1PLF A;  5BN5 A;  4BS9 A;  5IOC A;  3MC0 B;  4C3I G;  3AMU A;  2NVQ B;  1ILP A;  4O42 A;  4ZK9 B;  3D4W A;  1EWC A;  5CV9 A;  3KBG A;  4J6H A;  4QIW B;  3FRP B;  3JAM E;  3SXH A;  1DOM A;  1TS4 A;  4K6D A;  1V1P A;  5CC4 A;  5D3D A;  3K5N A;  3HOU B;  3J7A V;  4RGM A;  1SE2 A;  5EJW A;  3NUC A;  1HXY D;  1EYD A;  1PTO B;  2F0V A;  3AU7 A;  2EYF A;  4DAV A;  2F0I A;  4A3M B;  2F4I A;  2BA0 A;  2A68 D;  1ENF A;  2D9U A;  5CGK A;  1JWS D;  5A2Q E;  1A2U A;  1GUW A;  2B63 B;  2F0Q A;  3M7G A;  1PFM A;  4C3H G;  4C2M B;  1I4P A;  4FXD A;  1LV9 A;  3FDT A;  1WTO A;  1M4V A;  2HQE A;  4G7H C;  4I7Z C;  4KN7 C;  3V05 A;  5J1Z A;  2RDG A;  1A2T A;  3MFY A;  5CV8 A;  3I3C A;  4XQJ A;  3PUZ A;  1QCB D;  5LHY 1;  3GV6 A;  5IGD A;  2N55 A;  1BNZ A;  2YU9 B;  4ZAI A;  3H0G B;  1CA6 A;  1QJO A;  1C4Q A;  4CKE A;  2XSC A;  5AFW A;  2J4X A;  1JIC A;  3JAM L;  4A3E B;  4CJ1 B;  2QIL A;  5CV6 A;  4LK1 C;  1A6X A;  1O7Y A;  3BYY B;  1NUC A;  1X32 A;  1ML0 D;  4KKU A;  3SVM A;  4BA2 I;  3NTK A;  1RKN A;  1A15 A;  3DEO A;  1QOH A;  2KCN A;  4E6I A;  4M1U B;  4G7Z C;  3Q0A A;  3URY A;  5M9O A;  2BA1 A;  1F2Y A;  5A2Q L;  4X3S A;  2K5D A;  4NP5 A;  2HUG A;  1G8Z D;  3TSS A;  1ILQ A;  4IFD J;  2WB1 B;  4LMQ D;  2L11 A;  5I6Y A;  1RD9 D;  1Y1W B;  1HA5 A;  2BE5 D;  4F7X A;  4K8I A;  5C4Z A;  1DJR D;  3J81 E;  1GUT A;  3KK7 A;  2J0T D;  1DON A;  2FMC A;  2Z1C A;  3ND9 A;  2VXW A;  1XXG A;  1HFN A;  1OXX K;  2B2U C;  1F9R A;  2NUC A;  3GTP B;  1EYC A;  2NVT B;  4K8J A;  1JWU D;  5IGB A;  3L3O C;  1EL0 A;  1SFO B;  3QJY A;  1WCM B;  3F2U A;  4KD3 A;  2SNS A;  2EY2 A;  4KY7 A;  3IKJ A;  1PRT B;  1G91 A;  2X69 A;  2GA4 B;  1D6E C;  5C5L A;  5G3L F;  3VR2 A;  1EQT A;  1V1P B;  2A68 C;  4X3K A;  1Y69 U;  5J39 A;  3Q6S A;  1I4X A;  2D5D A;  2OEO A;  1KNA A;  2B2T C;  3I91 A;  2JA8 B;  2EY1 A;  1IW7 D;  3KLS A;  2X6G A;  1BCP D;  5FLX E;  4FF4 A;  2K05 A;  3A8K E;  1AW7 A;  1V8Q A;  4XQQ A;  4A3G B;  4HCE A;  1HTP A;  1MI2 A;  5KND A;  3BYT B;  4C56 C;  4DF7 A;  3R8B A;  2NWG A;  3SDZ A;  5T1G A;  2A6E D;  4MIU A;  3MXG A;  4DGZ A;  2HDM A;  5HGT A;  1CTM A;  3OWE B;  2F3W A;  1RTO A;  4XIG S;  5KNC A;  4JBW A;  1ET9 A;  3VR5 A;  1S5B D;  3KF8 A;  2LS0 1;  1SE3 A;  2L5T A;  1JOQ A;  1TII D;  1HUM A;  4NDX A;  2M00 A;  1EY4 A;  2IWH A;  1KTK A;  2DY8 A;  3H91 A;  3GTO B;  2F0F A;  4ZKB B;  5FKA C;  2B2W C;  3D3R A;  2VB2 X;  1OXT A;  1A3T A;  5EPK A;  1ZYR D;  1I4R A;  2XIW A;  5F2D A;  2PNR C;  1GJX A;  5EBC A;  4FF3 A;  4FF1 A;  1KLU D;  1S5F D;  4X3U A;  1NR2 A;  1ET6 A;  4DNT B;  1B3A A;  3FKI B;  3MXN A;  2DN8 A;  1QB5 D;  4HSP A;  4TSS A;  3GV3 A;  5IGF A;  4K5V A;  1DCZ A;  2Z4I A;  1CHP D;  1WVL A;  1ESF A;  2F0O A;  2M9V A;  4KY5 A;  1DOK A;  3ITP A;  1CM9 A;  5E3F A;  1X3Q A;  5CV4 A;  4RA8 A;  1Z6H A;  1JE4 A;  4UDU C;  1LAC A;  1SYB A;  4OGQ C;  2EYH A;  3HRZ C;  1EU3 A;  1PFN A;  3TME A;  1PXU A;  3GO5 A;  2KEC A;  5C4X B;  1STH A;  5DEH A;  1BCP C;  4EVO A;  2ICE C;  2RSO A;  2IW3 A;  1SMY C;  1B9M A;  1JOO A;  5M5Y B;  3IFT A;  1HUN A;  2NYZ D;  4K5X A;  3P1H A;  1EY7 A;  2A6H C;  2PO4 A;  4RGT A;  2AQ1 B;  1HQR D;  4EGV A;  4IAL A;  4KN4 C;  4FYD A;  5A35 A;  2CW0 C;  3I4M B;  1XX8 A;  2QKI C;  1LTG D;  4B08 A;  3IAY A;  4TQU S;  5D14 A;  4RCO A;  3S17 B;  4FNF A;  2RA4 A;  3G7L A;  2NZ1 D;  1HRJ A;  2TMP A;  1JCK B;  1G2T A;  1CQV A;  5KEE A;  2EJG C;  2F0L A;  4KJN A;  3MZ5 A;  3HKZ B;  5TSS A;  4WRD A;  5EGT A;  1SNQ A;  3T53 B;  1ENA A;  1TKW B;  2E75 C;  4TKO B;  2VNU D;  3C46 A;  1DYQ A;  1Q12 A;  1PTO C;  3M3Y B;  2E74 C;  4C3J G;  3CKI B;  1F9S A;  1RJT A;  2F0P A;  3WOF A;  1ZKO A;  5M5W B;  1STE A;  1FYC A;  4KY6 A;  1S5C D;  1KNE A;  2F03 A;  4ME5 A;  4AYB B;  1VCI A;  3PUW A;  3FPP A;  3SHL A;  3HEJ A;  3VR4 A;  1KDC A;  1I4H A;  2BCO A;  3BG3 A;  2D62 A;  2O5J C;  5ELD A;  1TS5 A;  4FXK C;  4IFD I;  1ZXT A;  1ICW A;  5K36 G;  3NTH A;  3J7Y W;  1EEI D;  1KDB A;  4RGN A;  5COR A;  3N52 A;  5BN3 A;  1JR0 D;  2B39 A;  2K32 A;  3GTL B;  1Q1B A;  4R8N A;  1NSN S;  1B4O A;  3GTM B;  4OIK A;  3PV0 A;  2F0G A;  4BBS B;  3BVG A;  4BWG B;  3I90 A;  1X3P A;  1LAB A;  3MXU A;  1U4P A;  1VDZ A;  4RGO S;  5C6A A;  5CYU A;  2Y0S B;  2LY7 A;  3VR3 A;  2R3Z A;  2B2Y C;  3OOC A;  1SAP A;  4HTH A;  1SYC A;  1YNN C;  2L0C A;  2NN6 G;  3U9O A;  3DM1 A;  5JJZ A;  3NPP A;  2E2D C;  2C9O A;  4C1N I;  4H44 C;  1AZP A;  4EQN A;  5EKL A;  1EZ6 A;  3U9S A;  1U4M A;  1NR4 A;  5CV7 A;  1F2L A;  3TP6 A;  2A73 B;  3CRK C;  4KI0 A;  3HS0 C;  3A8I E;  3Q24 A;  5DM7 3;  2C5C A;  1W6J A;  5FOB B;  2ID0 A;  1GHJ A;  3IFD A;  2X6L A;  4B9X A;  1B50 A;  5C4H A;  4NMZ A;  2TSS A;  2Q8R E;  2DNC A;  3K5O A;  2LMC B;  2NB0 A;  2IX1 A;  4FP5 D;  3PIO 3;  1W6K A;  1SNM A;  1PRT C;  1EEF D;  2FJ2 A;  3GTQ B;  3NBH A;  1S5D D;  1BUV T;  2BDO A;  5NUC A;  1LT4 D;  2AQ3 B;  2K1B A;  4DXG A;  3T16 A;  3EJI A;  5KYL A;  1VF5 C;  1LLR D;  3I70 A;  2RVL A;  3S1M B;  1VMC A;  2JA6 B;  2KOL A;  4F88 A;  4IUT A;  3WDN A;  5IT9 L;  1GHK A;  4IUV A;  5KYI A;  2K04 A;  1MSH A;  2KED A;  5I6W A;  1JWM D;  3PIP 3;  2SEB D;  3C1E A;  2K01 A;  1A3U A;  1E2V A;  3VR6 A;  5C44 B;  1LT6 D;  1IHZ A;  3TP7 A;  1LTA D;  3FEW X;  1XWE A;  5ISR A;  2CQA A;  4Z9C B;  2B8G A;  1U9R A;  1PTO H;  4K6L A;  5IOD A;  1TVX A;  5K36 H;  5JEA J;  4ZYS A;  3D6W A;  1IYV A;  3NWT A;  1FNU A;  5C0X G;  3FVQ A;  3HZX A;  2WV6 D;  2JXM B;  2EOT A;  3BVM A;  3SK8 A;  4QF4 A;  5EKK A;  5EPJ A;  4OL7 A;  1RHP A;  3A7A B;  4IUQ A;  4I65 A;  3J7A F;  1OXS C;  3OW7 A;  4KHV A;  2J7Z A;  4RHR A;  4PMW A;  1E0B A;  1O7L A;  1AN8 A;  2K28 A;  3KLR A;  3LNN A;  2PMZ B;  2NN6 H;  1PMR A;  1EIH A;  2JE6 I;  1NAP A;  5ELC A;  2G9H D;  3HOY B;  1CK1 A;  3E0J A;  1WTR A;  1I6H B;  2RSN A;  2Q8I B;  5C4J B;  3TBI B;  3VA5 A;  3GP7 A;  3MEH A;  4L6T B;  4IUR A;  2R61 A;  3M85 A;  1XTC D;  1Q3L A;  5J22 A;  2PZU A;  3ZYY X;  3FMC A;  3MAQ A;  4J8Q A;  1KAB A;  3HG9 A;  2EY6 A;  2NN6 I;  1J8I A;  3PO2 B;  3NSW A;  4CHT B;  1K8M A;  4DA2 A;  1GUN A;  1K8O A;  3EA6 A;  3RD4 A;  2KVM A;  2B2U A;  2F3V A;  4ZUJ A;  1Y8O B;  1CZW A;  1EYA A;  2L55 A;  1GUO A;  1BCP F;  1T5X D;  3D6C A;  1BBX C;  4RAU C;  4FF2 A;  3NQT A;  2XN9 C;  3RMH A;  2MUY A;  1TWC B;  3R93 A;  1L0Y B;  4A3B B;  3GTK B;  1C48 A;  1SJE D;  2D2C C;  2EY5 A;  4OIJ A;  2MPM A;  2XWJ B;  1SMY D;  4CJ0 B;  2B2T A;  1WTQ A;  3KUP A;  2KJX A;  1GUS A;  3Q22 A;  2A6H D;  5C0X H;  1ONL A;  1QWY A;  5E1F A;  5IGE A;  1TS2 A;  1DZ1 A;  3T51 B;  1UEA B;  2F0J A;  2CW0 D;  2MP1 A;  3GD7 A;  1PZI D;  3W2D A;  4F8M A;  2EDG A;  3K0Y A;  4HAE A;  4LJZ C;  2EYJ A;  4IFD G;  1EFI D;  2AUK A;  3QWN A;  2HCC A;  1T5E A;  2Q8T A;  3VYT A;  2QCP X;  2NTT A;  4CBV A;  1PTO D;  2WII B;  5C0X I;  4K2K A;  3S9W A;  3AB9 A;  2MGS A;  4UAI A;  1HFG A;  1SND A;  2NVX B;  2DY7 A;  3OMG A;  1FR3 A;  3VYS A;  3BDC A;  3D4R A;  1K83 B;  4U67 3;  4ZUI A;  3BZD B;  2AWN A;  5JVH 3;  3K6O A;  4OO1 G;  1DD2 A;  4LAA A;  4KHZ A;  1Q8I A;  2JP1 A;  3RZO B;  1Q1E A;  3NTI A;  4XYO A;  5ELF A;  5KIX A;  1JC7 A;  3HOX B;  1AFP A;  5E4X A;  3GTJ B;  4FO2 A;  2EYO A;  1HQM C;  2OXP A;  5ELB A;  3WOE A;  4NW2 A;  3OIP A;  2F0S A;  5LL6 S;  3H6M A;  4KK7 A;  1TWG B;  1BR9 A;  1CA5 A;  1G29 1;  5DNF A;  3D31 A;  2SDF A;  1Y1V B;  1VMP A;  1CFM A;  2RKS A;  1LTI D;  1EU4 A;  2ZT9 C;  1BXT A;  4G4K A;  1OXV A;  3N6R A;  4KD4 A;  4ODG A;  2EXZ A;  4RFB A;  5JPN C;  2VB3 X;  3L9A X;  3X3M A;  4G57 A;  4CKC A;  2YYZ A;  3S1Q B;  2K5W A;  1YNN D;  5EQ0 A;  4GZY C;  2LKV A;  1KLG D;  1BQQ T;  3D8G A;  2EYL A;  2NBF A;  1TY0 A;  1IYU A;  3H09 A;  2XRS D;  3K57 A;  4KMU C;  1D1I A;  3HOV B;  4WOR A;  2AUJ D;  4DAP A;  1STG A;  2A69 C;  1TR5 A;  3CU7 A;  4J1M A;  1U4L A;  1FD7 D;  3P7J A;  2PQE A;  1F9P A;  4C1N K;  3PUY A;  3H3V C;  5CR3 A;  2PYK A;  2JSO A;  5IGG A;  1GUG A;  4IFD H;  1PRT D;  5I9O A;  4OHJ A;  4DU9 A;  1RTN A;  2XNA C;  3C1F A;  2Z4H A;  3J80 E;  3T4A C;  4A93 B;  3K5M A;  1SJH D;  1I4G A;  4XQN A;  3M7N A;  3UI2 A;  4WFN 3;  4M8A A;  4Q5V A;  2E76 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...