2B8JA

Crystal structure of apha class b acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
211
Chain Sequence
SPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords class B acid phosphatase
publication title A structure-based proposal for the catalytic mechanism of the bacterial acid phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 78
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2b8jA00
3QYPA 4BKMA 5AKIA 3I76A 1U02A 1WVIA 3AR3A 2JARA 3ZI4A 5JJBA 1NNLA 3ED5A 5ALPA 3KZXA 1CQZA 2OM6A 3N07A 4HGNA 2IOFK 5AI4A 2G09A 4J03A 2Q4TA 3OCWA 2RB5A 5ALEA 5AM0A 2O2XA 5ALGA 2EARA 2CN1A 1X42A 4UM7A 1CR6A 3R4CA 1RDFA 3ZX4A 1VJRA 1U7PA 1F5SA 2P9JA 4Y3UA 5AIAA 2OBBA 3RF6A 4BNDA 2MSNA 1Z4PX 4C4TA 4XE5A 5ALIA 1T5TA 4HGOA 5ALQA 4UARA 2FEAA 1Z4NA 1ZRMA 3L5KA 1RLMA 4Y2RA 4BYGA 4Y2TA 2YY6A 1ZD4A 1VJ5A 1Q91A 3WKEA 5AK5A 4ZEXA 2FPXA 2JGAA 2YJ3A 5A3RA 4HGPA 3SKXA 4GXTA 3SD7A 2BDUA 1RKVA 1RLOA 2HF2A 3NAMA 3MC1A 3A3YA 3EPRA 3QNMA 4UAUA 4YCNA 5AVRA 3WKAA 3ZVLA 1RMQA 5AVTA 4CF3A 3L0CA 3SKYA 2ZBDA 3QU7A 4Y2UA 1AQ6A 3TLMA 5AM2A 5IS2A 2NYVA 4G9BA 4EX7A 2I54A 2YN4A 2R8ZA 4XQ0A 5AVZA 3ZX5A 1Y8AA 4XPZA 2PKEA 1Z5GA 2EATA 3WK5A 5AW6A 3OCXA 2G80A 5T41A 2HO4A 1RRCA 3WK4A 4RESA 3QUBA 4JB3A 1J8DA 2R8EA 5AW0A 3PGVA 2HSZA 3M9LA 2AMYA 2BDEA 2ZBEA 5AK6A 2YMQA 5AW9A 4EX6A 3BWVA 4RETA 1O03A 2JAWA 2OA0A 2WF5A 3PGLA 4BBJA 3L0YA 5AW2A 4Y2PA 5AM4A 3EF1A 3U7HB 1SU4A 1RLTA 2HHLA 3K1ZA 3KOOA 2AH5A 3ZU6A 5AKZA 3NALA 4YGYA 3AR9A 4YCLA 3W5DA 5AM1A 5FP0A 2Q4RA 4B6JA 4UMFA 5AI0A 4UU1A 3WGVA 1QQ7A 5AW1A 4GIBA 4BEWA 4YCMA 2P11A 1L6RA 4L6CA 1YDFA 2G07A 2B8EA 3ESQA 1Z4MA 5AKEA 2I34A 2QYHA 2C9MA 5AKHA 4Y2XA 1XP5A 5AW3A 2YFYA 2WM8A 1N8NA 3AR6A 3EWIA 3UM9A 3ET4A 1WPGA 3U7EB 3WK6A 2WF9A 1YNSA 3GYGA 4KYTA 1LTQA 3NASA 3ZVMA 5ALHA 5ALDA 2G1AA 2ZG6A 3UMCA 5AW7A 1T5SA 4YIHA 5ALZA 4Y2JA 5AVWA 3I6BA 3AR5A 3E58A 1Z4JA 2G06A 1U2SA 2GFHA 2CFTA 1JUDA 2B1QA 3WKCA 2HI0A 3DNPA 2FPUA 2IOFA 3BA6A 5ALYA 2GO7A 3WK7A 2B82A 4KX5A 1QQ5A 2C88A 2RAVA 4I9FA 5AKGA 5AI8A 2R8XA 3QXGA 3FPBA 3WK8A 1RQLA 3R9KA 4HAIA 4UMVA 5AICA 4F71A 3L1VA 4NAVA 4BX2A 1L8LA 3L1UA 1ZD2P 3ZWKA 3KC2A 3D6JA 2IOHA 1QQ6A 4O8CA 1J97A 1VFPA 3OCZA 3OTQA 5AVUA 5AKYA 2C8LA 4QJBA 1YS9A 2HX1A 3J7TA 3E81A 2HCFA 5AI6A 3A1CA 1QYIA 5AVSA 1SWWA 3IJ5A 2GHTA 3L8HA 4HGQA 2OYCA 2YJ5A 3PCTA 4L57A 5ALRA 3KD3A 2CFRA 2I6XA 2JAUA 3N5KA 5AM5A 3SMVA 1TA0A 3E84A 3ET5A 2YMLA 4CNQA 1Z4QA 3B9RA 3A1DA 4CF4A 1KYTA 4UMEA 1U7OA 4FE3A 4NFLA 4PNHA 2ZOSA 1WR8A 4UU0A 4F72A 1YV9A 3HYCA 4Y2VA 3U7FB 1MH9A 3MMZA 2B0CA 5AK4A 3ZUPA 1Z4OA 5E0OA 3CZ4A 3RFUA 1XPJA 1Z4LA 3R09A 2QLTA 2HEGA 4BX3A 3SF0A 1NRWA 3IRUA 2C4NA 4I9GA 2FUEA 4EELA 4Y2QA 3AR2A 2R8YA 3CNHA 3IB6A 3FZQA 2B8JA 4MUMA 3NANA 3E8MA 2WHEA 2Q5EA 2G0AA 3U13A 1TE2A 1XVIA 2AUTA 3W5CA 1SWVA 3NIWA 3UMGA 2IYEA 2D2VA 1ZRNA 2W11A 2NO4A 2O9JA 5AIBA 5AVYA 3N8GA 1QH9A 5ALNA 3L8GA 1T9ZA 3QU5A 1EK1A 3ZVNA 4XOUA 3F9RA 3OCUA 2AGVA 1RKUA 5AW5A 3SLRA 1N9KA 3L0BA 3ZTYA 1L7PA 1IWOA 2ZBGA 4DWOA 2MU1A 2GHQA 3QUQA 3N1UA 4NABA 1NF2A 5AHXA 1LVHA 2DQSA 1ZD3A 4OHFA 1EK2A 5AK3A 5ALMA 2YJ6A 4EEKA 2FPRA 4UAVA 3WGUA 2B30A 3DV9A 4CE6A 2FUCA 3QUCA 3OPXA 5ALLA 3QU9A 1TJ4A 1L7MA 5AKKA 3AR7A 3ESRA 2FPWA 4KNWA 5ALSA 4FYPA 2I7DA 3N28A 4KNVA 4OD0A 4BNDB 3DDHA 5ALUA 1RKQA 1U2TA 2WFAA 1Z4KA 1YMQA 5IT0A 3I1YA 4EENA 3B9BA 2JAOA 3FM9A 3AR4A 4L6AA 4ZEWA 3QLEA 2FI1A 1ZD5A 1Z88A 4YH1A 2C8KA 2G08A 3SHQA 1ZJJA 2ZBFA 2W4MA 3ZWDA 4DFDA 3UMBA 4UATA 4AP9A 4G63A 4NWIA 3L7YA 2P27A 1S8OA 3QUTA 2EAUA 3OCVA 3NRJA 3P96A 3M1YA 4H1WA 1Q92A 2HOQA 4Y2SA 2FPSA 3QU4A 3S6JA 3I28A 2YMPA 5IT4A 1FEZA 2X4DA 3KDPA 1O08A 1L8OA 4UM5A 4E88A 2P69A 3MN1A 1S2OA 1YJ5A 3B8EA 3VAYA 4CF5A 4DW8A 5AVVA 2WF8A 4UW9A 1RC8A 5ALOA 1Z5UA 3OCYA 5AW4A 2ODAA 1L7NA 2HDOA 3QX7A 5ALFA 3KBBA 5AVQA 2IA5A 4JDPA 1L7OA 5ALKA 5ALTA 3AR8A 4UMDA 3U26A 1RQNA 3W5AA 5A3QA 3FVVA 2RARA 3L8FA 5AVXA 2B1RA 4HYTA 4EZEA 2WF7A 3U7GA 5AESA 4OFZA 1Z4IA 4BEVA 2VKQA 2WF6A 5AKLA 5AI5A 1WZCA 3WK9A 4C4RA 5AW8A 1ZOLA 2YBDA 3FGOA 5AKXA 3HLTA 5ALXA 1TJ5A 1TJ3A 2I33A 3WKBA 3ZW7A 2NO5A 2W43A 2YMMA 5ALVA 5ALJA 3NUQA 3L8EA 3EF0A 2BY4A 3ONNA 2GMWA 3MPOA 4AS2A 5AKJA 4C4SA 3A1EA 2PR7A 1RPZA 3W5BA 2CFSA 4YIKA 3WKDA 3FPSA 4BX0A 5AM3A 4Y2YA 4HGRA 1RMTA 3ZTWA 4KN8A 4J2TA 2RBKA 4AS3A 4IFTA 3QU2A 3U19A 4IG4A 1RMYA 5A3SA 4MWOA 2HF7A 4FFDA 4ZEVA 4NV0A 2YJ4A 3QGMA 4KX3A 1PW5A 2ZXEA 1ZS9A 4QQFA 2PQ0A 1K1EA 2FDRA 5ALWA 4DCCA 4UASA 3DAOA 2I55A 5AI9A 4OCZA 3PDWA
chains in the Genus database with same CATH superfamily
1LF0A 3QYPA 5JC8A 4BKMA 2OFWA 2AXNA 4GPAA 4UC0A 4CTJA 4H60A 3SHWA 4C0QC 1NQAO 3WL4A 4EAQA 1C9MA 1DCMA 5J4VA 2ZRMA 3IUEA 4K6KA 4TKMA 5I5GA 4QFDA 3V7WA 3LQQA 5HF8A 4U5QA 2OM6A 3RVBA 4N76A 1YJCA 2GXQA 2VSNA 4F2HA 4YS6A 1NKSA 5KVQA 3UGKA 4UFNA 2A4KA 1IL0A 1DZIA 3ELUA 3OCWA 3O92A 5T4HA 4YR9A 3COJA 1W4CA 2CUNA 4JI3B 4K3VA 2ZRCA 4CMCA 5EWJB 1KEEB 1Z0FA 3EK2A 3GEEA 3U3XA 4G5OA 3EDOA 1WY7A 2BRUC 2O6LA 3KJHA 3IUBA 3D6MA 4C0WA 1YS4A 2COUA 2IU4A 3P94A 2EARA 3DMRA 4KKVA 2LNDA 1D03A 4LE2A 2PX5A 4L72A 3UJ9A 3D9QX 2AI1A 1Z8DA 5JEEA 1RDFA 4MWTA 2POCA 4Y18A 4HDKA 2GPTA 4MCHA 5CT9A 1TK2A 2QLFA 4O4HF 5CCEA 4E6EA 3RS0A 2Y68A 1ECCA 2VQ3A 3T1OA 3NEYA 2PWYA 2OBBA 3AGPA 4JLNA 1QV6A 2PXXA 3DM5A 3NS7A 1B3RA 5CUQA 2BMWA 2FDXA 2J0UB 4QBFA 1TMGE 4RQTA 2EF0A 4RVDA 2OZKA 3G89A 1XMIA 4HGOA 4MP3A 5ADVA 4IP0A 1MG5A 4UARA 2H4JA 4J91A 1SCKA 3U3MA 1OHHA 4DMHA 5HIAA 1RQPA 1Z6GA 3CIOA 4EBFA 2BGMA 4F97A 4WFIA 1UWKA 1GV1A 4Q7JB 4TMYA 4Y2TA 2YQ5A 1VJ5A 3D3JA 4NKRA 4F4FA 3G02A 3TUIC 1IOVA 1ECFA 1E3SA 2VDQB 2YY7A 3DZHA 3ANSA 3AJ9A 4XWYA 5IMSA 2XY4A 2PTHA 2PH7A 2GFIA 3HUFA 3KJXA 3A1TA 3EMKA 4P31A 1KH1A 4B2LA 3O1JC 1DL5A 3D4BA 1B93A 1G3UA 5EKDA 4X64B 1FYXA 4DMLA 4NATA 1P6QA 1VIMA 2B98A 5KQPA 3CEHA 5E2IA 4BB6A 3ZVLA 2GNOA 4WY8A 3O4RA 3LHKA 5AJUA 4AJIA 1IY0A 3G23A 5FFFA 2INGX 3AF2A 3QXSA 4U7FA 5CVDA 4M89A 5GGYA 5DWQA 1RQRA 4MUAA 1T5OA 3GRUA 3I8XA 3NCTA 1UIMA 3LZDA 4D45A 5JNTA 4WFJA 4D4KA 1WB5A 2WI8A 5JO0A 1FDTA 2BCEA 2HU7A 4P34A 3PNBA 4C06A 1XMXA 3LKVA 3TSZA 3W6NA 4EF4A 4C0AC 2PE5A 4G0XA 3E7XA 2AJDA 5C8YA 5TQ2A 3FTFA 2Z1DA 1E0KA 3Q3VA 3E7WA 5FFMA 1JMYA 4B6GA 4ZK2A 4IDOA 1OVGA 3LECA 1CJKC 2RI0A 3A32A 3B7PA 3QMPA 3VDXA 1O77A 4F91B 4LV5B 4ND6A 3LUJA 1POWA 3NJRA 1SBQA 1Z3CA 3GAMA 2G1PA 5H68A 1SA0B 3EZ9A 4G23A 2P4QA 3WGVA 1YFKA 3M9LA 1Z45A 3TQSA 1J33A 4WKNA 3RSOA 1YR2A 2UZ1B 4HH4A 1AQNA 4IXMA 2PT6A 1JV2B 5EZ6B 4AICA 2CDRA 1VPDA 4MW5A 1FMCA 1GL7A 1LQUA 4AJHA 4BASA 1SKMA 1BGWA 3KQUA 2IYTA 3KVYA 4KREA 3RYFB 1T26A 1QX4A 1RAEA 2P0AA 3RLFA 4E15A 3G8BA 4Q15A 3DDZX 2DH6A 2A94A 1SU4A 3AFIA 1DBWA 3DZDA 4KYIB 2EFJA 4HSGA 4WXMA 4EI9A 4JWTA 3OQOA 3GY0A 1CEEA 4I1UA 1X39A 5FL3A 4HJRA 1V25A 2IEYA 3GHYA 4RE5A 1MC4A 1QQAA 4TV8B 2FQQA 1QP8A 4G9GA 4KBGA 4PFQA 4UTXA 1UWCA 3IUMA 4IKOA 4FNMA 3RFFA 4MA4A 4B6JA 5A5DA 5TQJA 1UBTS 3K2QA 3STHA 3U3KA 4MA5A 2XDQB 5FI1B 3T61A 5HUHA 1YC2A 1AH2A 2GPNA 4FLEA 1W34A 2GLUA 3X1WA 5AW1A 1BA2A 4KO4S 2WYIA 1L6RA 2PKRA 1YZLA 2OAEA 3IVXA 3UXEA 1R8QA 5KQSA 1HY3A 3D3WA 1ILEA 1XA4A 4UDXX 5ELXA 5CMLA 1N2CE 5EIWA 5F4ZA 1A4RA 3UXHA 2D1YA 3WLRA 1E9SA 3QVVA 2K5UA 2TRSB 4D4LA 4WERA 5KNCD 1WXXA 2PIDA 5F9FA 2C94A 4Q6BA 1JG6A 4MVWA 4TXHA 1X7HA 2WSLA 3JQ6A 1I13A 4BWGA 1SHKA 2PX3A 1XXHA 5DE3A 2O54A 3GJXC 3DCNA 3FUXA 2HF8A 4FKZA 1O1YA 5CX1B 5DSZA 2D74A 5L3VA 4DADA 4EY5A 1Y5IA 2GA9A 3VX4A 4H18A 2MCFA 2BHTA 5BSHA 5EQJB 4JOSA 2D0DA 4MRNA 3USCS 2DF8A 4Q9KA 1V0JA 2C4VA 4HNHA 4I4TB 4I6JA 1TMKA 4CIXA 3FNBA 3NDPA 2ZI3A 4G89A 5HS4A 4YA6A 2UUOA 1O8BA 1GGFA 2VVTA 2JJ1A 3EW9A 3OZAA 5HJEA 4LF6B 1RE0A 4JN6B 1U99A 4KITB 1BOFA 4TMVA 5K0JA 1MO4A 4GXQA 3RUAA 2CE7A 2FUG6 2JD2A 4LYAA 2AKAB 3BIWA 2A9FA 2RAVA 4WK4B 4AIRA 1YT5A 2R8XA 3KTDA 3L0IB 4J0KA 3UQYS 4LE1A 4C04A 1T36B 2O3UA 1YJBA 2ZULA 2LPMA 1TRKA 2QQFA 2XUZA 3HU5A 4UMVA 3CTPA 4RHUA 5EWJA 5B3AA 1KEEA 1W0KA 2MSEB 2CDBA 4CV1A 2JFNA 3SFTA 4JP2A 4KQCA 1JMKC 2PEZA 3HV0A 4IGKA 1WVGA 1PL0A 3GBVA 4FPXA 5L4LA 4IIGA 3Q2OA 3IO3A 4JLAA 2OB2A 4M83A 2C98A 1SC1A 3JD4A 3QFTA 3BTUA 1QH8B 4F8JA 4I3FA 1PGNA 1ZP6A 1ZBQA 4Q4DA 1GY8A 3SBEA 1GJRA 1N6HA 2FFJA 2P9TA 4L78A 4XXHA 3W3ZB 4AYWA 5IT5A 4Q16A 3IALA 3VJKA 4E3WA 5K0GA 2J0UA 2R1TB 4WXRA 1YOBA 2PKWA 3DH0A 1YBVA 5B58T 4OXQA 2F9MA 1V2HE 4BNGA 4DIMA 5IUKC 4H7FA 3WRXA 1GPAA 2NVBA 4J1QA 2O8BB 4HQFA 1R0ZA 3QHQA 1C4WA 4OU4A 5GOZA 1DKPA 5AM5A 3IIJA 4ZZ0A 5A03A 1A9YA 5CB4F 5FF9A 1DTWB 4DQKA 4TT8A 3U0BA 4DKJA 3PJDA 3RC7A 3QTTA 1ZHOA 1PR6A 4ND5A 3V2UA 2MWMA 1QFZA 2HA0A 4ZODA 2BKAA 2JLQA 4FE3A 2I80A 4V02A 3QEBZ 1XMQB 1IDOA 5KBYA 2C0CA 4YMUA 4DDMA 4RM2A 1IAQA 3T1HB 1DFIA 3E9DA 4ARZB 2CXUA 1AK2A 5EMNA 2JFQA 1S3FA 4KQJA 2HSJA 1C9DB 3D7MA 5AYVA 4YT4A 5JPDA 3DQZA 4QYSA 2C54A 4CKYA 3F73A 5AK4A 4EA8A 2IDKA 5KU1A 3P45A 3ID6C 5FEUA 4S04A 1DIRA 3CRZA 1DO8A 4J9UE 3T9FA 1YTLA 1X7DA 5CK4A 3PLAE 1T9DA 2XCQA 1V7CA 1A72A 1U98A 3IRUA 2IHNA 1QKIA 1RLUA 1PNTA 3BXXA 3RC3A 4H3KB 3DF7A 1RIIA 1U8XX 3HA5A 4WI1A 3UN1A 1OOEA 1UZUA 2VL7A 1L4NA 3PNSA 1PS8A 2MMGA 1QKKA 4BFYA 3RADC 1JXMA 5FULA 3FNHA 1STOA 1RXUA 1MW8X 1ZXXA 2WT4A 5CK5A 4QTTB 1CEQA 1WXFA 2QSJA 4MB2A 5LYJA 4CQJA 4DBZA 4YCSA 3AVWA 4IH4A 5NULA 2WP8J 1UXGA 1NMSA 3O3MB 3V3KA 1XHLA 4ECEA 5KTTA 1ZAKA 3FN4A 1ZZEA 1V11B 3PSHA 4BNZA 4DY4A 3FZEA 1V16B 1SA0A 3RHSA 5DM70 1PQUA 3CJTA 5AXBA 7ABPA 3VO1A 2ZROA 2NO4A 1RW4A 1Q95A 2UZ1A 4N0PA 2BBTA 1A5BB 2BMFA 4KN5A 4HAUA 5D3MB 4HLUC 3QVJA 3TDKA 2H0QA 2EW1A 3TGWA 2GK6A 5DLQC 4D43A 3O9VA 4WD3A 4K26A 1E2JA 2JGRA 3WTCA 2COEA 1J39A 2QN1A 2ZE6A 4OIMA 3JQAD 4UBLA 5FR2A 4QU8A 3RYFA 2A3NA 3WLFA 5DYGA 2JH3A 1BRMA 1EHYA 2BGRA 2VTBB 4QELA 1YIAA 2XIQA 4ZYTA 4IW3B 4Y6SA 1NUPA 1G9TA 2YHSA 1BFUA 3F8TA 3GL9A 2C59A 4DLWA 1ZJ4A 2PKXA 1G9SA 3ZTYA 3T54A 1E5DA 2GHQA 4UHFA 4TV8A 1CBUA 5E1OA 2XV1A 2I1WA 2A9QA 4ZANA 1OUMA 3CNLA 4AO8A 1QRTA 4KIJA 5SICE 2YVQA 1PL8A 1M6WA 1E5XA 3IP8A 4OHFA 4X95A 2Q2NA 4E31A 2XDQA 2EWMA 1GT91 5L51A 4LPSA 3CLHA 3ENVA 5F21A 2IJGX 1X6VA 3WNVA 1GNPA 5EL0A 1FXSA 2Z6UA 1E79D 1G9XA 3QLJA 4NJMB 2PRIA 5BN4B 1U3DA 5K4GA 1EG7A 4RWZA 2A59A 3EZGA 2NXCA 4NH0A 1TF5A 3TKLA 4A8PA 3MILA 4FEEA 5AT1A 3WO0A 1UZMA 1CZUA 3N28A 1IQ0A 4H6XA 1A2KC 4A0SA 1BRTA 1FFEA 1N2XA 1P2BA 2MSCB 2IPNA 3BIXA 4FR5A 3AC0A 2X40A 3S55A 5ESDA 1I7NA 1DBIA 3JSXA 1Y8CA 5I7SA 2Q3FA 3PNKA 2R6JA 4Y6RA 5EP2A 3IPYA 4HPJB 1L1FA 2IC5A 1IWBB 1WE2A 1WTCA 2VAXA 3GLHA 3LV8A 4DJEC 3R75A 2RB4A 2IU6A 5CX1A 3Q7PA 2F7SA 2FI1A 1KPHA 4NOMA 3V8MA 5BQFA 1BW9B 5BR7A 1LNQA 3AU8A 4L9WA 3U80A 1SUBA 3CG4A 4MV5A 4LPKA 4I2VA 1OAAA 3WISA 4K9LA 4I4TA 2QE7D 1XPOA 2ID8A 3ZVRA 4A91A 4DCOA 2QTTA 1JHXA 2OC9A 1JHVA 5BNIA 1F8XA 4ND7A 4WNCA 4MUEA 4C4ZA 3HQ4O 1QVRA 2O3QA 2HJRA 2HSDA 1S2MA 3NBZC 4TLLB 3W06A 1Z12A 2GGSA 4PIMA 1H3FA 3TQHA 4OGFA 3E15A 3GEIA 3PK0A 3FPFA 3S6JA 4CUZA 2YMPA 3RSSA 3FUUA 1USWA 4XQ9A 4GRDA 4I5GA 5IDVA 1N8KA 1T36A 2HLDA 2QZ4A 4N41A 1PI3A 3M4JA 4IEEA 2GBLA 4UPEA 2F90A 3T95A 2D0OB 3AL0C 4J76A 2C3OA 5DHFA 2YWJA 4PG5A 3E2MA 5AP9A 2NV6A 4WFQA 5E9QA 3VAYA 1KU6A 3ROTA 2G88A 3OI7A 1E3IA 2HIMA 4DLUA 3SVZA 1CY6A 1ZIXA 2R9VA 1NMXA 3N74A 3FTCA 3QVUA 1R0YA 4OATA 4W7IA 5B1EA 1I3CA 5KWIA 1TOAA 1TFUA 1WG8A 2H1FA 3I42A 3KBBA 1IXYA 2ZJ5A 3PHLA 1QH8A 1YB6A 3O0DA 3OAAD 4J16A 4UHCA 1AVTA 2CHEA 1E5TA 2PFSA 2WVHA 3Q3EA 4EGAA 4EKEA 5HBGA 4S1OA 1R8SA 3TTSA 2IZOA 5JZMA 3VH4A 4UVIA 3NUZA 5U1PA 3AK4A 1FYDA 4UPVA 1GKKA 5F4BA 2R1TA 2O3TA 4CV3A 4Y0AA 3FVVA 4R8VA 2P5SA 1KPGA 2G04A 4M7PA 1C9KA 2NZ8A 2ZWAA 3COSA 4K5QA 2HU5A 5JC1A 2O8BA 5GV8A 4E1BA 2FQWA 1SUDA 3G8AA 3D3NA 1U8EA 1UXHA 4IDNA 1WCXA 1YE5A 3U0VA 2WF7A 4AZSA 3IL2A 1DTWA 1LKZA 3EOAI 3F9IA 2JIZA 2YH2A 1FDVA 4ZO6A 3TR5A 3H97A 5D6OA 4DRZA 5DW0A 5SYNA 4PSCA 3QEKA 2RONA 2NQTA 3FTPA 3ESXA 1K88A 4L3OA 4YAUA 1WDLA 1D8AA 1QGDA 3P0RA 4C4RA 4WMLA 4NY1A 5JBNA 4U2KA 5IVPA 4MMZB 2JFHA 4FBGA 2PKQP 3N6XA 4I9NA 5FUYA 3S3TA 4EGCB 5KSYA 4C4OA 3P9SA 4R9RA 4ARZA 5C1BA 2HNKA 4GLOA 4C29A 5TJHA 4PVDA 5FT9A 3UK7A 3EOBI 5LZ9A 1ILWA 4HRAA 2CLMB 1XVTA 3VM6A 2UYHA 1MOPA 2C9CA 1EP9A 4WOKA 1BVRA 4RVCA 5FNZA 4AS2A 3OPYI 4Z4GA 3PQFA 4E12A 1UM8A 3RVSA 5JRDS 2CFSA 1CZOA 1QB7A 2R8PA 4CGYA 2D4AA 4A92A 2PYZA 3THOA 2D1RA 4CW7A 4G4SP 3V4LA 1QVAA 5EHGA 4KXFB 1AJEA 2UV8A 4R69A 4M54A 4RW0A 1J1ZA 2QMUA 4DVJA 1VSUA 3AVQA 1E59A 4UHBA 3C41J 2F1JA 3FYUB 2ZXEA 2PGIA 1FQJA 1HYGA 3WS7A 1V11A 3GFPA 4EPWA 5FKJA 1V16A 1VG9B 2WKPA 1EX1A 4ZEMA 2H1LA 3A0RB 5JXWA 5AQ1A 2ETVA 4JSYA 4ZYXA 3OTIA 4WOJA 1BX0A 3T99A 4GM1A 5D3MA 2J31A 3M83A 3MS4A 1VIVA 1YRYE 1E9CA 3D1VA 4L15A 3OQIB 2LW7A 2C2YA 3AR3A 2CNWA 1QK3A 3UA4A 2WSBA 5BMOA 2O0MA 2WSYB 3T7DA 3R7FA 3ZY5A 4DYDA 2VTBA 2PJZA 1ND6A 2AWOA 3IP7A 4LVCA 4OG2A 4HMOA 2HLPA 3ISVA 2KWIA 5DHAA 4A03A 5EE5B 2X2OA 5IBQA 2G1JA 2PMWB 2HPVA 5DHRA 4YY3B 4ZO4A 1EB9A 1DC3A 3FPGA 3L6BA 2ZIXB 4DUYB 4WWHA 1KMIY 1FVHA 1TM3E 3AUFA 3FAZA 4X91A 1G21B 1JXOA 3C3CA 3P0HA 4ZAYA 5G0SA 3AG6A 2E4WA 2L82A 1OTYA 4NJMA 4AMZA 1Z2PX 3F98A 4DDTA 2G5PA 5BN4A 3B1WA 1DEAA 4BO5A 4NYIQ 3WFIA 1AF7A 2WC1A 1VLZA 1ADFA 3IMGA 1PWXA 4LGCA 4Y9RA 1Z4PX 5FJIA 1ZNZA 2WY2D 2R1UA 4Y1GA 3LKZA 4XLTA 3RRYA 2F3TA 1P9LA 1I2MA 1RM0A 5JFOA 3A25A 1L7RA 1BYUA 2Q0HA 2JFFA 3R6GA 3DAFA 1Y8QB 1C3XA 5T4FA 4KFCA 3ZDXB 2NU8B 5DM4A 1M2FA 3SEQA 3A9VA 1GFSA 1JLSA 3H1EA 3OM0A 2F8SA 2DWPA 1CKEA 3BAZA 1BW9A 2Z04A 2VPXA 2JAQA 2VSXA 4FIDA 4ZU3A 2NW6A 3AUYA 4WOBA 2ZZMA 3GRKA 1K27A 3K0FB 1ZRHA 2BDUA 1RKVA 3OEHD 1A77A 3RC9A 6GPBA 4F5ZA 1T2NA 1MOSA 3AF5A 3K1TA 4BRUA 3KG2A 3FDIA 1M2EA 2RDMA 5AVRA 3TWOA 1NUSA 1KETA 3QBVA 4FJ2A 4KJXA 3AV3A 1CU1A 2UU9B 2W93A 2GXSA 1DCFA 2Y71A 1ENZA 4ZQBA 5KOIA 3EPKA 1ARZA 1V9CA 3CEMA 3NATA 4WL0A 5EFZA 3ABOB 3I73A 5HK9A 3IPLA 1T8RA 3UB2A 3RQSA 1FRFS 3QVGB 1PJ8A 5G1OA 2CBZA 2KMLA 2PMBA 3L82B 3CMCO 3BERA 4BAZA 2P2DA 1FRQA 3AVOA 4XPZA 2J0VA 2Q5LA 3VQTA 3TL6A 2WWXA 3CT6A 5TF4A 3U81A 4LC0A 1NE2A 5FH9A 2J5XA 2VDPB 2EJCA 3OCXA 4RK1A 1S96A 1XB2A 2DZDA 3I92A 4LXXA 4C9BA 3A4MA 1EE2A 3AL3A 3S4YA 4BO4A 4MVJA 3CF2A 3DWIA 2I1VB 2H7XA 1U5AA 2ZRHA 3E0QA 5D51S 3SEZA 4TYYA 2XE4A 3TQCA 4R84A 2IUUA 4RESA 2MR5A 1SCJA 1L9XA 1JXAA 1U0LA 3ZJUA 4EGSA 2PX6A 4JJFA 5IH3A 2DFDA 3HWWA 3KPYA 4KJZA 4P92A 2Y0BA 3G3EA 3GH3A 3H75A 4NYMQ 4PC7A 2NZWA 1GYRA 2OLJA 2OBFA 5E6SB 4HAWA 4JLVA 2FF5A 4NCIA 4RIGA 1D9XA 3IGFA 4RQUA 2OA0A 3KZVA 3V1UA 4A27A 2ZS7A 5DBGA 4BBJA 3MQ2A 2HR1A 2XSZD 1GSAA 2VAMA 3RVJA 1I2BA 1I4LD 1UKBA 1WS6A 1HE4A 1IUOA 2YFKA 5JNWA 5DBIA 3NWJA 3O7WA 1RYYA 4NAUA 4MUIA 5FLEX 4DSOA 2BN4A 1G8SA 1LPNA 1CP2A 3WO1A 4BGDA 1GUAA 3JPYA 1A8HA 2JKYA 4DIUA 5LXTA 2NYAA 3D2LA 2QZSA 1LDYA 1JDTA 1ZOIA 4QYMA 4BZZA 4X92A 4V03A 2QJFA 1RYMA 5JCJD 3P19A 1E1KA 2H0AA 4YT2A 1Q77A 1APBA 1DEOA 3MT7A 1GKLA 4BEWA 4YCMA 4XR9A 1K7SN 4IIXA 5C4GB 2ZCJA 2V1UA 1MEOA 3MCZA 3GLFE 3PLNA 5BQXA 1G60A 1ONBA 2I3AA 4M8SA 3N0WA 3M6FA 1FVOA 4V0RA 1UBNA 4OHYA 3RYIB 2RG1A 4ZV7A 1UKCA 2AYZA 3U2QA 4IQ0A 4BO9A 1ULZA 2NADA 2RGBA 1WUJS 4XVUA 5HJ7A 1S4MA 2GCNA 1KVRA 4QDKA 5TGDA 4EM6A 3I09A 1DE0A 1OFVA 4W9RA 4B6QA 2PVCA 3FYUA 4EJ0A 5H1YA 4UE6A 2CXTA 2NT3A 1L5GB 1JDPA 5EXSA 3LXMA 5CDSA 1KHHA 4YIHA 7MDHA 1PJZA 1Z0JA 3KT6A 1V4BA 2OPBA 1M67A 3HA7A 3FX2A 4HWKA 4KCGA 5JFTA 2FMKA 5I9NA 5I48A 2GM9A 1SZDA 3EVFA 4P81A 5CFMA 2OQ2A 4KPEC 2C77A 3OQIA 4JGBA 4Z9XA 1VP3A 1AZTA 4BZXA 4TRJA 2IITA 3EMBA 1Y1RA 4YP5A 2C2HA 3V2HA 1QQ5A 3AUXA 2XGGA 2GZRA 3FI0A 3S28A 1QB8A 4MUKA 3I9LA 3WB0A 1WKCA 1H2RS 2OAP1 2Z1MA 4R8SA 4RLQA 5DYWA 5JAIA 2IK8A 5AICA 1XDUA 4MGIR 5CFOA 1YQTA 2BCJQ 3WYEA 2TS1A 1UIRA 1KKUA 1DQPA 2LBPA 2ZIXA 3EF3A 3PICA 3HRHA 3WRXC 2BTQB 1P91A 4ZOLF 4DG9A 1NAIA 3M49A 4HEA1 5LQDA 2HM7A 1G21A 1NE7A 1Z08A 3OX3A 3PFIA 4HX5A 4JP5A 5B1SA 2JDID 4K88A 4DRXB 5M04A 1CNEA 2NZVG 3GAFA 3FPAA 1N5RA 1KA9H 3L1JA 3KQHA 5AI6A 5FWNA 4MB6A 3BD6A 2AB0A 3H18A 4IQFA 1MXFA 3CLUC 2D7DA 4JIGA 1YZQA 1C4KA 4F5WA 3KVVA 3NM6B 4M22A 3KD3A 1JFFB 3MA0A 5IJZA 2CFRA 1SXGA 4HI0E 2P3LA 3OIFA 1JAZA 5A4DA 1HKUA 1E77A 3WRVA 1Y8QA 4B3GA 1W2GA 1ZIYA 3CBGA 4Z2YA 2NU8A 1YBAA 2BM1A 4IDAA 1U9JA 4UTOA 4UUNA 1Z0IA 2C7BA 3AI1A 4C5CA 1WCWA 2DFLA 1NVAA 2QTNA 2ZU0C 4V38A 1TNDA 4EHHA 2J08A 2WB4A 3L8YA 4RV4A 3CVWA 3OD5A 3KEFA 4F5YA 2QROA 4IIYA 3K0FA 4IGAA 3ZXYA 3CH5A 4D41A 2LRHA 4XLZA 3KXDA 5TE9A 1GAJA 3CVYA 5JS1A 3K8OE 3NH6A 5DGCA 3USES 1IN8A 3D4LA 4B9AA 4R8MA 3O47A 1G8FA 1RACA 4HWSA 5KTSA 4Q02A 5DTEA 5IJWA 1YQDA 5KKAA 2WKQA 5F76A 4GPTA 1SQ5A 1EA5A 1R0SA 4AY5A 3VU8A 5I3ZA 5EG5A 2XITA 1NRWA 1XZJA 2I71A 3QVGA 2UZ0A 4M9RA 1WDKA 3H86A 3BL8A 1R1DA 4MUXA 1H42A 3UW3A 4UBJA 1Q3TA 4FN5A 1DFGA 3GEGA 1N5OX 1Z5VA 2A33A 2CXNA 3H1FA 4LZAA 5A05A 1P5FA 3VYSB 1CUWA 3E8MA 1IJFA 2WHEA 4GE3A 1VTKA 3LXXA 3LUGA 4L1KA 3VHRA 1PFQA 3IR6A 1V8BA 5KYNA 1WV1A 1J22A 3VDQA 3S68A 1ZZGA 1XTQA 4CKZA 1G38A 4E13A 1VKZA 4TWBA 1IE3A 2Q5HA 1GPYA 5BYBA 3PXDA 3OZVA 1UBCA 1HZJA 1EKXA 1RC0A 1CZLA 5E6SA 1QH9A 2ZIAA 5CNMA 5ALNA 4QZVA 1EWKA 3QBJA 5DBOA 3SBXA 1MO5A 3GJ6A 3RG2A 2P9YA 1ZXBA 4DC1A 2YIJA 1XRSB 1ZMXA 3ILYA 2VNAA 2C9OA 1LXCA 4AF6A 3EZNA 2PZFA 5ENDA 2QZJA 3M6AA 2AFIE 2EF1A 2YWEA 5AW5A 5EIBD 1EFAA 2RKBA 1D2MA 4R1LA 4FN4A 1Q6YA 1WXHA 3V32A 3KHUA 1ZN2A 3UHOA 4F12A 1XZCA 2ZBGA 3ZDBA 1IHXA 1ENPA 1VBNA 2HBRA 3GGSA 3M89A 3MWEB 5LYYA 1ZMRA 1ODJA 1T1EA 3DLIA 4CM1A 3WGYA 1PVDA 4KI0A 3C7AA 4GOLD 3DEIA 5T4BA 5FEMA 1EK2A 4ODIA 4ZVSA 1DS6A 4PLGA 2VBFA 4RGVA 2DQYA 3KZOA 3UW1A 3LFUA 3RVKA 4WA8A 1QOZA 1BCSB 4S0ZA 2OHOA 4QGFA 4DA9A 3A1UA 2HL6A 3K8QA 1TJYA 1GTMA 2WW8A 3K9LA 3PQ3A 4O1MA 3TEMA 5ALLA 3E3AA 3UFXB 1N34B 1LTKA 1Q16A 3WNQA 3ZGZA 3R8CA 1F7UA 3SYLA 4BMOB 4NESA 3RYIA 2QAJA 4MNTA 2ZJOA 5HIMA 4HNTA 1CUVA 2IE8A 5F1YA 1GUDA 3KT3A 1CDZA 2X0RA 2EKLA 1DV2A 2GZHA 3CNQS 1SXJE 4EENA 5CLJA 3FOBA 4W5NA 3AR4A 3LC1O 2QMQA 2A67A 4TS3A 4DILA 2JCBA 3BXEA 3CSSA 1R5JA 3ST7A 1NQOA 3TLXA 1ZD5A 3Q8XB 3QKTA 2W2LD 5TGTA 5E8JA 5G40A 2QVGA 3FZYA 1ZJJA 1QGZA 3SBDA 2HYIC 2LGJA 2W4MA 3PNVA 5B4UA 2GBLC 3SF8B 3WZ2A 2WZBA 3ICPA 5COQA 2A5FA 2B35A 4FQ5A 4BECA 3KUDA 3HP4A 1JMVA 2AJ8A 4EUEA 5IFKA 4NCNA 2X9QA 1HMYA 1Q11A 1G5PA 3H5VA 2E21A 4D3SA 3TBHA 4Z7QB 1Y81A 2RHHA 3ANMA 2AC7A 4J16C 1PZNA 1XYYA 2I4MA 2ADFA 5B6IA 1LPSA 2O2JA 4BQSA 4EK9A 2C5BA 4Z4IA 3LC7O 2DQZA 3FKSA 2A9RA 5LMUB 2H1WA 2RGWA 4BMNA 2GJAA 1Y8RB 3M34A 1MRSA 3C5WP 4MWSA 3B8EA 1DARA 1I10A 5A4AA 3LX8A 4YI3A 3TL3A 4GI5A 3ZWCA 5AW4A 1OREA 3V8BA 4EHAA 1VCOA 2BTQA 4S05A 1YS6A 3BSYA 1TPZA 3F6EX 4DRXA 4UM9B 4CR7A 3PR3A 5LZ2A 3OZRA 3DBLB 3IEIA 1MZVA 1XCJA 3PNYA 4BO2A 1P9WA 3HI4A 2WE7A 4Z1MA 2EBUA 1IH8A 4ZVUA 5EMJA 4OSOA 3QY0A 4RD0A 3A6GA 3O82A 4G5XA 2PVSA 3TJMA 4Q1BA 1UODA 1AU9A 4DLLA 4JR1A 2GHIA 2WVGA 5CCDA 3QFRA 1EXNA 1ZMBA 1VGVA 2ZBPA 4GH5A 3S2SA 3ZJTA 4U7DA 3RTBA 1JFFA 2XMQA 2G4CA 1KS2A 1PDWA 2B1RA 3BD8A 2B2XA 3G9UA 4KFSA 3KZ1E 4LXQA 3N3BC 3OQBA 1M83A 1FDRA 4R2KA 2HWUA 3JQPA 4L4RA 3UK1A 1JR3E 3VH2A 4NPCA 2PG3A 2Y1FA 4BEVA 2I4NA 5EIOA 3PEYA 4MLPA 3OJWA 3QRWA 4Q3DA 1O6BA 3SOZA 4DIOA 1J8VA 1ELOA 1WP4A 2I2XB 3EEIA 1K8QA 2Y0DA 5L3RA 4YDRA 4DWVA 3DC7A 1JIQA 5ALXA 4KU4A 4E2YA 2XUPA 1NKTA 3WLSA 1LF5A 1XHEA 3KYCB 5FBVB 5FV4A 5K4HA 5JY6A 5ALJA 4JKIA 5KVSA 4P4UA 2BY4A 3QG5A 3IHKA 4YNBA 3MJ4A 4N5LA 3ASUA 3ELYA 1FLAA 3A1EA 2WB2A 1H6AA 1WUIS 2CDNA 3BVPA 3CRQA 4L9RA 1AOXA 4TMWA 5CM9C 4AECA 3OIGA 5DSXA 3DD5A 1PJRA 1QHSA 4JHXA 4LRSB 4YIKA 3GA0A 5IDWA 1NFQA 1HA3A 3TLKA 5DK4A 1NXWA 2PZJA 4MW2A 1NSFA 1EFLA 3CX7A 3SR3A 3DDWA 4BKRA 3ZTWA 2BP7B 3M1AA 2QLBA 2AYXA 2VP3A 4PQYA 5LQMA 4Y2HA 3U19A 1R0KA 4FYYA 1V4VA 4KUEA 2YJ4A 2CMGA 4G5YA 4RE6A 3GLGE 2DM6A 1ABFA 4B87A 3EC1A 1OH8A 2P40A 1KDYA 4BBPA 3IE1A 2WYVA 3LU1A 4WEQA 3F5FA 3S70A 1E6MA 1KFBB 4IJWA 1GLGA 3V7UA 1XWIA 2FX3A 4YUVA 1X8JA 1VXRA 1Y37A 1ZGZA 4FYWA 4P3YA 3NHZA 1A1SA 4DCMA 3RYCB 1JHPA 4J4TA 1RVV1 4U5XA 1U02A 1XX6A 4ZU1X 3VR1A 3UTCA 3U4AA 3VZRA 4DDKA 2CL7X 4HN9A 3PC6A 4A16A 4Y1RB 3L41A 4XJSA 4AVYA 1RQ7A 4JROA 4G5GA 4TS4A 2FZKA 3N07A 5AI4A 1JLRA 1QIKA 2DY1A 2Q4TA 5IDQA 1YVUA 3CYFA 2RB5A 4Q9JA 2XOEA 3LQ4A 3MBOA 1EVIA 5EQDA 4TM8A 2QAIA 3MWEA 4KXVA 2O2XA 3WQQA 1MCZA 5JSUA 4FX5A 3U40A 2ZJBA 2NOAA 3A1NA 2XXAB 1HL7A 2XYGA 4YP7A 2GQ0A 3NYIA 1NC3A 1UPUA 3O4IA 1GGJA 2YRFA 2QRKA 4TXMA 1H65A 1NX6A 2H2IA 4WGGA 5DNCA 4RCVA 2PKCA 1BCSA 1H0SA 1DIGA 1R4MB 2GKGA 3QXCA 4FCWA 1FNNA 3N75A 4BE7B 1H6DA 3TB4A 1XVVA 4JWKA 1O94D 3JARB 4RHEA 3UFXA 3VZDA 4BJ1A 4BWYA 2N3ZA 2YZNA 2EFGA 2LIPA 4RCYA 3L02A 3DAYA 1N36B 1JHRA 3X43A 1W96A 2HMSA 3BWBA 3EGDB 3QITA 1OFUA 4QHSA 5ALIA 1ZM2A 2GS9A 2PJUA 3G6WA 3WYAA 5I9BA 3KDSE 4PHFA 4Q6WA 2SKEA 3R77A 5C52B 1PR5A 1PSZA 2I2AA 2ZT8A 3FTDA 2QX8A 3HR4A 5JCPA 4XWAA 4KUHA 1IY1A 5A5VA 3C6YA 3ZR4B 2VOJA 2C1XA 2F17A 4N0QA 3EG9B 1V96A 2OCDA 1VYUA 2E4YA 3KAPA 2V3CC 1NI3A 1GRRA 2XUDA 3DZFA 1GQYA 5FTJA 2REBA 3Q1KA 1XMSA 3HB0A 4D96A 3IPAA 1C0IA 2WSSA 3IQWA 4AUEA 2A9PA 2OESA 1NJ2A 4H3HB 4ZI5A 3SF8A 3CLTC 1YKSA 3FKSD 4QO7A 4FZ5A 3RUPA 4YCNA 4FHEA 2PM8A 3MERA 4LJ8A 1OB5A 1IY8A 3D6UA 4BQPA 4YHHB 4DN6A 1TU4A 3E05A 4NOJA 4CF3A 1GFZA 2Z98A 3AEXA 2FWPA 3F6BX 1JU4A 1R7RA 1TF2A 4HBZA 5JXHA 2C7QA 4LBVA 4W8HA 5FWDA 5HUQA 4HRYA 2BGUA 3Q11A 1NQWA 2B2NA 2BGIA 1U81A 1CJUC 1K7FB 2R4UA 3FUWA 1QF6A 2J87A 4ZFNA 4G26A 4TYPA 2QMHA 3K2BA 4QTXA 3PE4A 1Q14A 1ESDA 1YMUA 1UDCA 5CTAA 3HKBB 4D4IA 3RT9A 7REQB 1Y8RA 2B2CA 5JSFA 2W42A 2O5VA 4MVJP 4YCAA 2EZTA 2QM0A 3PXAA 3B1FA 4DJJA 2FR0A 3G0HA 4JOBA 2HREA 2Q2OA 3SQMA 2PAAA 1PJTA 2DFVA 4H7DA 1AUVA 1M0WA 1WXEA 4HCJA 4MWEA 4V2IA 4B3JA 2WTUA 1JA1A 4QULA 5AJZA 3DBLA 2GD1O 2Q3BA 4INOA 2EFCB 4UQPA 4CMAA 5BWCA 3X3HA 1NURA 2AG1A 4KLAA 1JEDA 2F6RA 4JBGA 1E6CA 5IZ4A 2VPZA 4FMCF 4LGVA 4N8SA 5DYIA 3KM0A 2Q4EA 2Q6KA 5MDHA 3CZMA 2V4UA 2B94A 4TWRA 4EHJA 5HDQA 3OKPA 4B75A 4I7EA 4L0MA 5C1PA 2WF5A 1Z26A 5H4HA 3W8NA 1GXSB 3HXQA 5B55A 4P35A 5IEBA 4B6RA 4E4TA 4MV0A 1T6BY 4YVFA 5C8ZA 4V3CA 1I7DA 1BS2A 2F1KA 1X80B 1Z83A 2VK4A 3PHHA 2VRCD 3QWFA 5EIBC 3T8YA 2HHLA 4C0XA 5JIBA 2G9VA 5JYBA 1GNQA 2ZPUA 3HVRA 2I4IA 1P5HA 1P81A 2Y99A 1L5QA 3ESZA 3PUZA 1KDZA 1MC8A 1V3VA 2CFCA 4YP9A 3WK8A 4ZICA 1AS2A 3JZAA 5DTMA 3BGSA 5H16A 3QTBA 1TKAA 1J0CA 2HD4A 3CUEF 2QT9A 3DL7A 3VC3A 1J9EA 1LPMA 1I33A 2SNIE 5I8ZA 2JG3A 1IG3A 3KYCA 1ONSA 1Y1TA 4WW0A 1T5DX 2HUPA 1U28A 3O4HA 4B44A 2BTEA 1SKAA 4GBGA 1XAIA 4S1VA 2XMDA 4MV6A 3FYUC 3SI7A 1ZY2A 1FZQA 4M76B 4MIEA 4RJLA 5FRDA 3QLUA 3OOHA 1V6AA 4D4HA 1Z4MA 1F0NA 1DWPA 2DTXA 5KI6A 1XZLA 4FOTA 5CLFA 2O8EB 2QYHA 4YAKA 2W83A 1UZNA 3G2JA 5ITZB 2EWVA 1JE1A 1FDWA 3FUVA 4WINA 4MPTA 3RK4A 4BO3A 4R2IA 4DG8A 3U3RA 2BP7A 2H08A 4N5DA 3Q0EA 4PLCA 1VMEA 4REOA 5AUQA 3SN6A 4YRKA 4XLLA 2ZW9A 3NX4A 5FI3A 1QZXA 2C4HA 4J90A 5T3YA 4C30A 1IQPA 1USUA 3PQEA 4JA0A 4KYTA 3TAUA 3AV0B 2IGTA 4LHWA 2PBFA 4X5OA 3WL3A 4HNRA 6CHYA 2H63A 2Z5FA 3HVIA 3Q7EA 3F3MA 4QTZA 2J6BA 3DDCA 3DE5X 3FCEA 4Y6LA 3WWZA 3L7DA 3VR4D 1X9IA 3DE0X 2VDUE 4KSYA 4RA9B 2OGZA 2I5PO 3NKVA 4UBKA 1OKKA 2ZI4A 4Z7NB 5FWXB 3RYCA 5BWOA 1FFYA 4CG2A 3HWRA 3D7LA 4XVRA 3HN7A 5L40A 2XHEA 2WKWA 4PGMA 4C7KA 2FZVA 3C14C 2QRLA 3PNMA 2I6QA 4Y1RA 1EZ1A 4DREA 2XUKA 1BE0A 1NC1A 1QDEA 4KMRA 3ZCSA 5FUMA 3S81A 5J23A 2WICA 5E3HA 4JYZA 3MHTA 3AUTA 2OZEA 4MI9A 1QLJA 4JBXA 1PR2A 1E9EA 3CU5A 4PC2A 1KU0A 4TTVA 3T41A 3S5UA 1IZZA 2ZUEA 1X86B 1I1NA 4YAFA 3H6HA 3L01A 2OHVA 2G67A 1KR5A 1QHXA 4L7VA 3LHFA 3WICA 2L69A 4H35A 3B1XA 2XXAA 1HDEA 4FHDA 1DKRA 2FP3A 4J0FA 3D4IA 4MV9A 4XUCA 3KC2A 3T3MB 4OQLA 2PRYA 3PI7A 1R4MA 4FSXA 2GFQA 3KRTA 3PTAA 4AG3A 2IFTA 2OLKA 1IBCA 4P6VF 4BLOA 4G5FA 3JARA 3D6TB 4OQZA 3VZCA 4Y6QA 3A6JA 4UD2A 3B1JA 4Z0PA 1VZ2A 3T4PA 2LWIA 4JB2A 1WHTB 3PXUA 3VISA 2GXAA 3KUXA 1X38A 2O7QA 3EGDA 2C2OA 3S2ZA 3WAKA 4PSDA 1D4ZA 2VYVD 2WSSD 4L57A 3V5NA 1ZGBA 1W75A 2IZ1A 3OF3A 4CL8A 3HB4X 2QT0A 4RPHA 1HGXA 1SVOA 5CFZA 2I2DA 1UJMA 3PKJA 2OV1A 3UMRA 2MHCA 1Z4QA 3EG9A 4F21A 2GAOA 2D2IA 3MTJA 3PJEA 3FZNA 4PFJA 4UNSA 2RH5A 4OQYA 1YZTA 1U0GA 2D5IA 2JJMA 1FSGA 3UJ8A 3BXFA 1JQEA 1K98A 2BR4A 1A9SA 3OQPA 1FNMA 4FBMA 1YC5A 2YJTD 3T6KA 5C7IO 4KI7A 1F2TB 3T5CA 1YFLA 3GW8A 4TTSA 2YN2A 3OIYA 4FX2A 3K73O 3GN2A 2W4QA 2YINC 3ZLUA 1NZJA 1ULHA 2FQ1A 4ALNA 1K5DA 2VP9A 2VJBA 3ECCA 3TFWA 1QIDA 4MGEA 2LKDA 5LQCA 1EVLA 2C5GA 1E7MA 1S1MA 2XCOA 4JQSA 4LDQA 4MPJA 4R0NA 3RUEA 1NNEA 1S02A 5DIFA 4OLAA 2J8ZA 1EP3B 4F38A 3NGXA 4FYIA 4OQFA 2I29A 1SCNE 2A30A 3HKBA 7REQA 1BHJA 5JASA 1TQ2A 5FLXA 3FSJX 1T8PA 3MFQA 1ODFA 3BWEA 3MG9A 4RCZA 5DTJA 1IFXA 2JLWA 1TZKA 4RPIA 1RI3A 3AEQB 3TINA 3TR0A 4LMAA 4MUMA 2VHTA 1TTTA 3NANA 2A3RA 1U8CB 4ZOBA 1N5KA 1VRWA 1ZQ9A 2PD4A 3DYIA 2P2LA 3O2NA 3WYNA 1XV5A 4Z9YA 5I9SA 2PZMA 1P3Y1 3M1IA 2HWKA 2ZTVA 4GI3A 4JXJA 1GTVA 3EDMA 3MS7A 5COBA 2AOVA 2P9EA 3ES9A 3G0BA 1BGXT 2FZCA 4AAYA 4OUKX 1MJHA 3ETNA 3ZWNA 4ARAA 5BWMA 1A7UA 3KPUA 5E7JA 3S2EA 1J49A 2L19A 4R7TA 1KFJB 3B1ZA 1AO3A 1NU8A 1EFVB 1SO8A 3T52A 4MXDA 1PSDA 4TS1A 4JZYA 4C7JA 1GXSA 2GX6A 2NTEA 1XCBA 2UUCB 3Q9SA 3BWXA 2ET6A 4RF5A 3TPFA 1DAEA 1X80A 2FPKA 2ZYDA 5GQSA 2UXBB 1FTSA 4QVKA 4ARVA 1DAPA 2VPWA 2OZVA 2ERXA 2B20A 3HYRA 4I14A 1QHFA 3NRCA 1XRJA 4RIFA 1IWOA 1E6KA 4IWYA 5F52A 3W1WA 3AHHA 5IEJA 1EU1A 1LVHA 3NXKA 4Y9DA 1N75A 1Z75A 5AK3A 4EKNB 5ALMA 4LRTB 4RFVA 6LDHA 3DCIA 1QYRA 3B3FA 3WMXA 1WZUA 2NXNA 1U3UA 2R7AA 3WBJA 1O94C 2BMVA 2I78A 5JZ9A 2XUHA 4N18A 1JR2A 4AKGA 3LUAA 4MGKR 1NKVA 1S01A 1ZNWA 4PE5B 2Q27A 3PA6A 1I24A 4IIVA 3TGPA 2O8EA 4P3XA 4F2DA 1D2EA 1SBTA 2B8TA 5JG7A 5ITZA 1EA7A 1GPLA 1QZZA 1Y8ZA 4OEHA 1UP7A 3P9KA 4ZYYA 3O8DA 1PZMA 1I3KA 2Q4DA 1ML3A 2D2XA 4KWTA 2ZBVA 3NHLA 4DVGA 4V1CI 1WSBA 1OLOA 3QLEA 1IBLB 1QP0A 4QREA 2QGFA 3I05A 3PUXA 4CTMA 2DJIA 2QIOA 1SU8A 4GVLA 3U1TA 4DOMA 4KXQA 9LDTA 5EEHA 3CUSA 1JJFA 4YH1A 1VG0B 2B9VA 5IUJC 3EFHA 3T3DA 2VO1A 3KV3O 1XAGA 5C5CA 4HB0A 5G2OA 1DEKA 1PF7E 3M33A 4E09A 4PG8A 3GLSA 4RA9A 5FWXA 5K0ZA 1EBUA 5L6MB 3INTA 4UTVA 2Q5QA 3H5LA 1U0SY 4MLZA 3ABRB 3OO0A 2QN9A 4WLEA 1U9IA 1G20E 1F51E 3CLRC 5CHEA 1MB9A 2OCBA 1G4UR 3OZFA 4TVBA 2VNHA 4H1WA 5DO9A 3SYNA 3ZU3A 2GEKA 2HBYA 2BFCB 2E4UA 2EOAA 2YVUA 5KNLA 1X1QA 4KVFA 4JI0B 3MPUA 1UH5A 2A1IA 3DULA 4PYOA 4RL4A 3I34X 1N2IA 2JCSA 4O2RA 2M2IA 4RTQA 2RH8A 1G8PA 3NP9A 1CF9A 2HFKA 2ZQZA 4M0PA 4BVAA 3NT4A 1XR3A 4N0MA 4PZZA 2B69A 2ZUWA 2B1IA 1OXUA 4ILEA 3BH0A 1N7IA 3PYMA 3KUUA 1R2QA 2VZ8A 5CPBA 4L95C 3HJCA 5E1DA 2YWXA 1N3LA 2VT7A 4HNSA 2UVPB 4YB8A 2TYSB 2C9ZA 1NBMA 3CVXA 2OYSA 2CBXA 4PS1A 2AW3A 5ER9A 4Q82A 1R0XA 3OQNA 4M1TA 5HKAA 5DBHX 5I3CA 1WHTA 4BLSA 4DLVA 1Y3DE 2Y4NA 4G4JA 4US2R 2JI9A 1AA6A 1K8YB 2RARA 3KKKA 3P8ZA 4DMUB 1MV8A 1L5FA 3DB1A 5AVXA 5F23A 1E8DA 1GR1A 1G41A 2VJCA 2BJWA 1SXJD 2A9KA 1XG5A 3B1VA 4FCTA 4GMDA 1XQ6A 5JU6A 1Q6ZA 1Z4IA 3OVMA 4ZVQA 4PGAA 4N1AA 2F1HA 4RY2A 1PTKA 2BFAA 4BX8A 2W8BB 3KKMA 4BBZA 5AOBA 3LY9A 1GA6A 5CT8A 5AI5A 3RSQA 5DGIA 1OXBB 3UXYA 1OCEA 5HF9A 3H2GA 1LPPA 3G49A 4FU0A 1F2TA 3A3NA 3K09A 1P1FA 3ZOKA 2ZSFA 3TLAA 4R83A 2PGNA 1QH0A 3AILA 5BXQC 1DAHA 2H0RA 3HA3A 4FI3C 3ZY4A 2P9FA 1NQVA 2GTPA 2GMWA 5AKJA 3DBOB 2QZZA 3UHPA 1NUQA 1QFSA 1B6TA 1LUAA 5U4XA 2PZLA 3FOZA 3ZBQA 4UULA 3OX2A 4Q1EA 3KTOA 1TVCA 4WAUA 2XQVA 1LTHR 2SKDA 3RSCA 1MJGM 2B7LA 2AL7A 5ETJA 5K4AA 4FXOA 4M8KA 1JQKA 2Y1LA 3OZDA 3AEQA 1B76A 3ILHA 1KZ1A 1D4OA 2A7XA 3N2ZB 1CP3A 5CH5A 1MGOA 3U16A 4BS9A 4EA7A 3HM9A 4OX9B 2EZ9A 4NV3A 2Y9PB 2QPAA 1NLMA 4A6PA 1SZJG 3CG0A 3MYYA 1AKEA 2G6TA 4AXBA 4O6VA 2GXUA 5LDHA 3I1IA 2EIHA 1BA3A 5JPIA 3TLGB 4MYHA 1ZWLA 2ASEA 2EP8A 2GBFA 1OWMA 4BX9A 4YRDA 3CUKA 1DBVO 2BEKA 1EFVA 3CVOA 4JIMA 1UF9A 2DY0A 2VSQA 3QOFA 4M38A 4R2HA 4M3NA 5EGSA 1SUAA 1YWGO 3ANTA 3L92A 4Z8YA 5J2UF 1LDGA 3U4CA 2JEOA 4P8RA 4U8HA 5JJBA 5LQKA 1WXQA 4N7MA 1JR3D 3FTNA 4NNOA 3LY8A 5DM60 2UUAB 5KYYB 2G09A 4CZ2A 5IAOA 4FWBA 2QT1A 5IVIA 3L6UA 1E6UA 3KX2A 4XUDA 3O75A 4ESHA 3FIUA 2PPVA 4GW3A 4NOLA 1EK0A 2AR0A 2XXJA 3JS5A 4CKCB 1ZC4A 4MYCA 5LZ4A 3MW8A 1I3NA 1NFFA 3UFBA 4C1NA 4LC1A 2XE6A 4U7TB 1X42A 3JYQA 1E0AA 4G0OA 3MB5A 4FMBB 3SZLA 3RU7A 4KRFA 2IXBA 4GM0A 5E6UB 4OGWA 4BFCA 5H83A 4ZARA 1ZGCA 1UBFA 4JOQA 2HT6A 1D0VA 4YXWA 1A5SB 2WNHA 3A4LA 3CLVA 4Z86A 5JDCC 3K9FC 3O0TA 5F2OA 4ZVOA 1ZO8A 3AY6A 4B71A 1HYBA 1SU6A 5MN5A 1Q12A 5JNLA 1ORIA 1Z62A 4XGRA 2QMOA 2P6NA 1JAXA 3SDZA 2P9GA 2FOLA 2PV7A 1Z4NA 3NH9A 5KTOA 5FA6A 2P4HX 4HXGA 1ZRMA 5CGQB 3SE0A 1EJ2A 3UKJA 3W8DA 1JQLB 1JDUA 3RUHA 2E4XA 4TN1A 4OJMX 121PA 2XRFA 1GD1O 4Q19A 3RSGA 2DT5A 4EP1A 1EHCA 4I1RA 1GITA 2KB0A 3DJYA 3IESA 1F2VA 3WKEA 4DXAA 2EX4A 3AY3A 3RRJA 5THXA 3ZHZA 3GFSA 3OE5A 4KC0A 3IUJA 4Z5XA 4CLHA 4CDNA 1RYEA 3H65A 3HDHA 2FJ0A 5I7AA 3K92A 2VSYA 4FIZA 5JAZA 4OKSA 1QFYA 1WB4A 3EXHB 3E3OA 2Q62A 1UK7A 2PUDA 1KOGA 3R3HA 1D2CA 4V3BA 5CDFE 1KFCB 2OQIA 4GM4A 2QLJA 2CMFA 4B7UA 3EZXA 3HFJA 2X6QA 3OJLA 3L0CA 3VR3A 5KNBH 4CQNA 1Y33E 3IIEA 3L7JA 4LJ4A 5DTQA 3I5UA 3T12A 2NYRA 4QQRA 1NL3A 2BFCA 2IODA 3TLMA 1KJWA 1PYGA 1NPTO 3JXEA 2X3YA 1PT8A 3O1IC 3GGGA 4XIJA 2DHRA 2XOKA 4LK2A 3W04A 2CEAA 1SQFA 2WJIA 4R1NA 2E4VA 3AF1A 4FJ0A 3Q40A 3RO7A 3T15A 1L6IA 2Z57A 1D1QA 1ZHFA 2DTEA 3FPCA 1U9YA 3GFQA 3LP5A 4GGOA 3EMDA 4IS3A 3LLUA 1XKXA 3RTGA 3QBTA 2OXIA 4RADA 2RAPA 2OGSA 4G56A 4GKVA 3CWCA 4UXJA 3TQOA 4BAUA 1QOQB 1XJ0A 5L8VA 1T6NA 2C5EA 2JNWA 3N5CA 1VYVA 3JYLA 4JX9A 5BQ3A 1LSSA 1Q0TA 3H2JA 3GLRA 2ZJ2A 1DKQA 3DLPX 2O20A 4MCAA 2UVPA 4IJKA 5D2CA 5DISB 3QVSA 1EWTA 3ZS9A 3LDUA 3TCKA 3NMUF 1BOOA 2ECKA 3LG2A 4DA4A 3D7NA 3GDHA 5I9IA 1XC7A 2R8EA 3P2IA 1XELA 4O4HB 3FR8A 1C4OA 3GJRA 5K3BA 1BEEA 1LJUA 4WV3A 1JIUA 3W2TA 2JFGA 4HFRA 2Q3HA 3WWCA 4BP9A 3ADOA 1P8AA 2AOUB 1OLSB 3DFIA 2KSQA 1JKMA 3N59A 1DMRA 3H3XA 5A0FA 3NYQA 3PGLA 1DAGA 1EB8A 4EWLA 2XIJA 5AFSA 4B8YA 3VKVA 1UMBB 4Z49A 2C4TA 1U28C 3E7DA 3UC9A 3TZKA 2QW1A 1GGVA 2QYTA 3FSGD 5CT5A 3SGLA 4BKPA 3VSEA 5C1DA 1XJWA 2W8BA 1NM5A 5CLGA 5F64A 1GN8A 1C8BA 3PV0A 1NRJB 1A5ZA 2JGLA 2EW2A 4CG0A 1U7WA 3AR9A 2XDAA 3FY4A 3H42B 1IBKB 3QLUC 3VR6H 3N9IA 1K6MA 4NR0A 4AZVA 4OV6B 4RSRA 3DR3A 5EMKA 5FP0A 4FONA 3MRVA 4WRRA 5ITVA 4IDBA 4CM6A 3A1VA 3ABZA 4FYKA 4X6UA 3T9BA 1XLTA 1AKVA 3K9GA 1CJTC 1Y9ZA 1QAOA 1A3CA 2CUZA 2OECA 2V1XA 2WQZA 3D2BA 4J0QA 4KOAA 4BJ5A 1PHRA 1EWRA 1A0OA 1CIJA 1KGDA 2ZB7A 4YJDA 2CUKA 4IOLA 5AWFC 4HB2A 3R1IA 1JIIA 2YXEA 2ZKLA 2W6ZA 2IVFA 1EDZA 3KBOA 3GD5A 5A7FA 4G41A 1KP2A 4M53A 5C8XA 4D3ZA 3SFZA 1M34E 1XCLA 5FIUA 3NAZA 2HWYA 2X6TA 1KQNA 3UV3A 4E94A 1CRWG 1EJ6A 1ULAA 2CVQA 3ZHVA 4D7AA 4EHDA 4DV2B 1R9JA 3UM9A 2J3KA 3EOZA 4F7DA 5BSTA 3U7EB 3WK6A 2WF9A 4KMSA 5C8YF 1ZOPA 2LR0A 1XYGA 1FDSA 2I87A 1E89A 1MR3F 3A9SA 1N6PA 5IVDA 3U62A 3ETDA 1BO6A 3KOYA 1WDTA 5A71A 1G59A 4CU5A 1E2KA 3IFSA 3KQKA 5ALZA 1SOMA 3D8SA 2FXVA 2GWRA 1O5OA 1ZEJA 2P7HA 1IOZA 2WWRA 3C6QA 3MAAC 2NUTB 5K8VA 3AVXA 3TLGA 4C5AA 1RRPA 3TE6A 4G0MA 5KREA 1SUSA 1B6RA 4I9HA 2GFHA 3VZQA 2DT8A 4F8YA 2CXSA 4QTYA 1EAMA 4W6ZA 1N6OA 5B2ZA 2HI0A 1PX2A 3EGOA 4DYHA 4EB6B 5CDTA 1EE9A 3PTLA 2I66A 4CHGA 1SBCA 3FFBA 2VPYA 3B3AA 4RD3A 3TW4A 4QM7A 1ORDA 4CM9A 2VC2B 1KYZA 3CHYA 5DX1A 1TK3A 4B3IA 1EEXB 3DPIA 4MUGA 5KYYA 4G4GA 4ZJZA 4FZJA 1J2RA 1SBYA 3GRRA 2BT4A 3KB1A 1JSLA 5CR9A 4ZDJA 3MD0A 3KVOA 1JKFA 1X1SA 1GCGA 4Q4JB 1MOQA 1NYTA 5C80A 3KFVA 4J75A 2D2EA 2D1TA 1XN1A 4GEKA 1ZINA 3QWBA 4FDLA 1SXIA 4GXRA 1I8TA 2ZBUA 2DKFA 1Y9EA 3MJTA 1GGHA 4GMFA 4KG7A 4S2EA 3WGKA 4KAAA 3OIWA 1GL3A 4ETWA 5KO2A 5E6UA 1M2OB 2GBGA 1IHUA 4N5NA 5D84A 1AK1A 2QTRA 3UWSA 3R9WA 2WA2A 2DUJA 5AVUA 3I37X 4PZUA 4Q4AB 4LXIA 4YAEA 1R6DA 4OJQA 2H57A 1O95D 2ZAGA 1D1SA 3H9GA 2QW0X 3U5TA 5H82A 3V9PA 4OREX 1VHJA 3WL6A 3BTSA 1IEVA 4P36A 1BWSA 4EECA 4UUAA 3I32A 2X9NA 3OSUA 3LPCA 4JBNA 3IUYA 2O3JA 1HNNA 1SXJC 1TGVA 5BNZA 1N57A 5EINA 1G2PA 2VDNB 4V24A 4X54A 3BOSA 5I45A 1B2LA 4N8DA 1D09A 5JVDB 3GB9A 1O57A 1N2OA 3Q88A 2Q3CA 1SEVA 1ZU4A 4XD7A 5TQ0B 3VR3D 3GPBA 1JS1X 4JX8A 3PBKA 2OD7A 4UCQA 3D4NA 4BMYA 4UEQA 3TZEA 2O3RA 2ZE7A 3WLAA 3WQRA 3EXHA 4NYJQ 1FUKA 2BISA 5GJWC 1PWZA 4ARSA 4P53A 1X70A 1NJ5A 4CLOB 5JCZA 3FSRA 1ZSVA 4BV2A 3WGGA 2B21A 4EFDA 5DI9A 5JYCA 3PL5A 4RAOA 4ROSA 2QVLA 3QWIA 4JJGA 1Z4OA 3DT6A 1JLHA 3C4JA 2H92A 3HXKA 3IAHA 3QOXA 2YZ2A 3RFUA 1G5QA 1JHYA 4QPDA 1Y98A 4LYDA 3RD5A 3UJBA 2WWYA 3ZJ4A 3SF0A 3INGA 4DF3A 3NHUA 1A7AA 1BFDA 3VR2A 3IS3A 3HRKA 3HDJA 4OSPA 4MV4A 3IB6A 4FT2A 5K05A 4QLOA 3ZZ0A 2G40A 1UDWA 2SHKA 4YV0A 1KERA 3P97A 2WJPA 5EERA 3IE2A 3U13A 3SQNA 1GCUA 1WLSA 3R76A 2Q9AA 3PGJA 4XSGA 2IGBA 1DC7A 1PIWA 2ZWOA 2JGNA 1YL6A 4XQEA 3RJZA 1FZTA 3BSFA 1VL1A 4DUPA 2ESRA 4O4HA 4UHJA 5LNK6 4QPNA 3DO6A 4A3SA 4XSVA 4G67A 2SICE 3IQXA 5AVYA 2XMCA 1IVSA 1BE6A 3A36A 1VHWA 3EYAA 1N92A 2QTAA 3KZMA 1FTYA 1Z36A 1JSXA 4KDFA 4PAQA 4BATA 4MEJA 3WGLA 2AOUA 1OLSA 4OFWA 4HMQA 3ZVNA 3IR5A 2J6IA 2AA3A 4MQ4A 3STWA 1HT3A 4HEHA 2XRZA 2PXCA 1UMBA 1F1JA 1QCCA 3BA1A 2HHCA 4B83A 4LYJA 5BXYA 4UQLA 3MOSA 3BX1A 5CB4B 1L5VA 4X7BA 13PKA 2ZB3A 5F9MA 1ZJ5A 2I99A 3FDJA 4XIYA 5C46F 3FGNA 4NG4A 3SR0A 1N5DA 1J4AA 1T0IA 1N8SA 1VE5A 2Z4RA 1VL0A 3NHAA 4FOPA 4UEKA 1Y7LA 1OFHA 4QAQA 1M5UA 1Y7PA 5AHXA 2GN1A 5E2AA 1O96B 1Z7GA 2FV8A 2ODWA 3H4VA 4D9MA 2XWQA 3AMVA 5L53A 4KV9A 1Z2OX 3W1VA 3FBGA 3KQNA 3WGUA 5JOQA 2D5CA 2H16A 1N2BA 3ND9A 3AESB 1IOLA 1YGPA 1KL7A 4NQZA 3TEFA 3UWOA 5K8TA 5L4SA 1DRJA 4GT1A 2G3YA 5F78A 1L7MA 2PT5A 1OA1A 2VCYA 4Q48A 4YK7A 5HHTA 2R6HA 3ICWA 1OFIA 1CQJB 3BUSA 2CXRA 4DXHA 2OD9A 3IT2A 9ABPA 3GT7A 1A76A 2VUTA 4J7UA 3X2FA 3I1YA 1V5EA 3FLAA 2C0PA 4QUJA 2JLVA 1OSNA 3DDSA 1U9IC 4GLBA 2VXCA 2I8LA 3E9EA 4EO4A 3UMMA 4CUKA 2WAMA 1SKQA 1M34B 2Q0SA 4N3BA 4CM9D 5BN3A 2P77A 2PSDA 3CNOA 5LC1A 2FUG1 2G08A 3U61B 1P0PA 2NUTA 4RDCA 3S99A 1E18A 3T5MA 2VLIA 4NJEB 4KBFA 3HVHA 2JFUA 4YJ2B 2J41A 3NIBA 3T5DA 3U56A 1JSZA 3FNRA 2AXEA 2QMEA 1E1DA 4TSKA 2AQKA 1ONNA 4ISCA 3RIGA 1K08A 4K9MA 2J45A 1PEDA 3PHBE 4O2AB 5IK2A 2YWDA 4CKCA 1FYEA 5CPFA 4AU1A 1J5XA 4E2XA 4EB6A 2HCJB 1GHTA 1KI2A 4K9DA 4K1XA 3MLAA 1M1NB 3ICCA 2ZANA 5DXAA 3KOZA 4OQNA 2WWWA 2VJMB 5BSKA 2O2ZA 3I2KA 3K9WA 5J1TB 1E62A 3EZ6A 2VTVA 3HPRA 3S8EA 3LBYA 1INLA 4Q4JA 4R1MA 1P9OA 1MVOA 3VU0A 3SC4A 2B5OA 2RK3A 2AJBA 4Q4LA 1FMTA 5KSPA 1ZN7A 2Q7XA 1YUBA 4TV8F 1Z5UA 4FR2A 3E9CA 8AT1A 1CYEA 4URZR 3TFQA 3NU1A 1CF4A 3QX7A 2AFHE 3X1ZA 2IVZA 1XZAA 1M2OA 5BOSB 1SBHA 1NBWB 1GUFA 4GKAA 2SBTA 4BMDA 4Q4AA 3U7QB 4E5MA 3GCZA 1KI8A 4N12A 5CAEB 4F3KA 2ES4A 4FHGA 3NM4A 5BVHB 1HG1A 4EOGA 2C42A 2D8AA 3ACDA 3BN3A 3PVCA 4IOKA 1FQWA 1WBBA 2HMUA 4FS8A 4YP0A 2PSJA 4I08A 3MSCA 2HHAA 4GX0A 2VLBA 2XD4A 3DLAA 4AQ7A 4CKWB 1Q1NA 1CIPA 3RTDA 3EPJA 4X8OA 2XUIA 1X1CA 3NLLA 3WV5A 3URMA 4EZEA 4PSAA 3JZFA 1K2WA 2A0WA 4DLRA 3AONB 5JVDA 2PLRA 3BKWA 3H2KA 3RYTC 3FYHA 2JRCA 4EUNA 1VKJA 5TQ0A 3MAGA 3PHCA 1L4BA 1F8UA 4DSZA 5IVKA 4E2FA 2XGOA 5LP1A 1RTTA 3TKYA 4XX1A 5AW8A 6AT1A 3AF0A 5LKAA 1PQPA 3E6AA 3PNPA 3RTEA 4AKTA 4D3YA 5J4KA 3I5YA 5CRIA 2DR0A 3GC6A 2KHZA 3PEUA 2EYQA 3C1AA 4I4TF 3VR2D 3DE1X 4CLOA 4ZV9A 4M0UA 4HH0A 2EBWA 1S4QA 5IVHA 1K63A 1E66A 1SC4A 2YQZA 4BV8A 5EPOA 5TARA 2XWBF 2RKOA 4BRSA 1DC8A 2V6GA 1HWYA 2YQ4A 4F2GA 1VL2A 1RP1A 1X92A 2C2XA 3OU7A 3EQ2A 3SLKA 1X9GA 1XQXA 3BPSA 3ZK8A 4OP2A 3E3NA 1BVHA 2EBHX 5DYYA 5C0OE 2O2DA 3EGIA 1H2WA 4A5OA 3FPSA 3AIOA 2AUMA 2ORIA 2WJWA 3OEWA 4G0PA 1G6KA 2BR5A 4LSMA 1U8TA 2OBYA 4NNPA 4OK6A 3N6RA 4AS3A 2NUPB 2YWFA 5AW2A 4IFTA 1P33A 2YV5A 3F7NA 4K86A 3MT8A 1CV2A 5BSWA 1E2LA 5CLIA 2IYXA 3ECAA 2DBQA 3AJRA 5D5HA 1R8XA 2XYQA 3IBTA 2GZ1A 3RU9A 4BO7A 1YI0A 3TQQA 2EJUA 4DCCA 2YFHA 3H1GA 3DAOA 4QD3A 5HCIA 3V33A 5A06A 1Z6XA 1B0PA 3HTXA 2C9DA 2PWZA 5CBPA 1QK4A 3E70C 3IPRA 4TPKA 5DLPA 3DNFA 5JI3E 2H54A 3SR4A 3UJCA 1NUHA 4BPRA 2QY9A 3ENNA 2VRBA 5LFAA 5C3MA 4S1TA 1LK5A 5LJLA 3R3VA 3K71B 1MPTA 4A2CA 5CB4A 2JPDA 3A6KA 1A9RA 4Z4CA 3LUKA 2Q9CA 1FU8A 2MSKA 1PWEA 1KQ3A 4MW1A 4KIGA 4A6XA 4PYQA 3QIVA 5E1MA 2AZMA 4J6EA 1USVA 4A6DA 1Z8NA 4AQYB 1O96A 5C4IA 3L1HA 2V7XA 1OJ7A 2IHBA 2J7PD 1KYIA 3Q15C 2IXTA 4JVOA 4MLCA 4JVMA 4B6EA 1ZGGA 3R7LA 1TUBB 3KKPA 2QSZA 3G2HA 3I2JA 2QI9F 5JS2A 1Y6RA 3PFFA 1BMTA 1K7XB 1F5SA 3QE0A 4Q93A 2V0NA 4RH0A 3AESA 2XI4A 4R0MA 4Y3UA 1QJ4A 2VIIA 4P86A 2WIDA 1Z0UA 3AEZA 4QJIA 3BD9A 2C92A 4E32A 4AJ1A 2OCYC 3LNCA 4PLVA 5TJ9A 1CQJA 2F2TA 5DCWA 1C0LA 1T5TA 3VR5H 1DRWA 2XVXA 3QF4B 4ZGGA 3KLBA 4RTPA 3UAWA 3GJTA 4D4MA 5H5JA 3DOUA 1E9AA 3ZGVA 4IGEA 3CA8A 5IK2D 3JV7A 4Z4QA 2CLEB 5EHXA 4WK0B 1ZD4A 1DOHA 1Q91A 1QDLB 3D6VA 3F3SA 3Q3IA 5T64A 2FQYA 3BQ9A 4EPTA 2WZQA 1M34A 4ECAA 1Y1KE 4J3FA 4TM7A 2ZFUA 4BFTA 4HQKA 2PS9A 2YV2A 4JKOA 4NJEA 3AH8A 2EP7A 1DQSA 1DNPA 4YJ2A 2QTLA 1RLOA 2IDZA 3IP6A 3RNLA 1GSIA 1O0CA 1T1GA 3ODPA 3Q6MA 4B2YA 3OFNA 1NMYA 4O2AA 9GPBA 2VNIA 4DV7B 1Q2UA 4PCLA 2GEVA 1J25A 4TSFD 4WZAE 1H9CA 2NUBA 2YZKA 3VVMA 4DIFA 4PR0A 1M1NA 4GR5A 1H5QA 4ZAFA 3WLLA 1P5RA 5LDGA 3K0CA 3O95A 4UUBA 2EFEB 3PVZA 3RVOA 4C08A 2V8OA 1F8GA 2VJMA 2YTZA 4G9BA 1VPLA 1TB4A 4P4GA 4UEWA 4HK4A 3JQ9A 5BWBA 3BL5A 4Q47A 1SVLA 2CCJA 3CN9A 5AVZA 3DHYA 1OC2A 2DEUA 4ZOAA 3O91A 4H4EA 4TUYB 1WETA 2REXB 3DOIA 1QPZA 1HYHA 1PZGA 1I1HA 1KF0A 1TVMA 1LQ2A 2P6UA 2WSMA 4HNUA 5AW6A 3ZHCA 1J8FA 4ER7A 1Z82A 3ZGNA 3NV7A 1J1UA 4AKHA 4HLQB 2FMHA 2R8BA 5BOSA 2YIDA 1QWSA 5AO9A 5BNTA 2JLRA 4PHCA 1EFHA 1PJLA 3GGJA 4XQGA 3U7QA 1PLJA 5BVHA 1BNCA 5CAEA 4X41A 1NM5C 1NVXQ 2YL2A 3ZJYA 1G6HA 4JB3A 3VNSA 2GVNA 4HUTA 1K4YA 1XFDA 4YRSA 5JADA 5LN1A 3PT5A 2CFOA 1H8EA 4HPXB 3HADA 1NYLA 5J3JA 2VRNA 3CISA 2QD2A 2WNSA 3PXCX 2O0KA 1DUVG 5TS2A 3M9XA 2AFHB 4QQ8A 4CKWA 5DCLA 3MJEA 1JLLB 1O03A 3O6VA 4X6LA 2Q5CA 4MZDA 2GYVA 3FOCA 3FCYA 5HEKA 4DEVA 3OLVA 3ILXA 3TI7A 3TAHA 1XLTC 4EYQA 1JA0A 1YZUA 4HYEA 2YJNA 3IUQA 1HEYA 5F77A 5SY6A 3RWMB 4LRWA 1HX7A 2W4IA 3U7HB 4M0LA 3U6BA 1PBTA 1Y6ZA 2AH5A 3F5MA 4XDGA 3TXXA 4KWHA 2Y77A 2DERA 1HRKA 2D1QA 3CC8A 3LVQE 3LWBA 2FG5A 3BGDA 1NVTA 2E6UX 2FMXA 1OROA 2M1XA 2LKCA 1Z2CA 1YD7A 3HKCB 3LLVA 4NONA 1HG0A 1DIBA 1BZYA 2Q4RA 2M6LA 3EVEA 4N48A 1RAHA 2OILA 4NCKA 1WMEA 2YV1A 1T5LA 1PT7A 3WLIA 5U9CA 4GWLA 3I04M 5FOTA 3IV7A 4KP7A 1PFVA 2PK3A 4BMVA 1RPNA 2CJFA 1SD1A 2O7VA 3FF4A 3KXLA 2RI6A 2GF9A 2VJOA 4B48A 5JZSA 4RM3A 3EBPA 1XSEA 1FDUA 2BGLA 4I46A 5EZYB 2F9LA 2IYQA 2Q0QA 3LT1A 1MF7A 4L5JA 4DR1B 5FBQB 4NL4H 2JI4A 1M2NA 1N8NA 4QICA 4Z0NA 3T38A 4AJOA 2NUPA 2FSIA 4FT4A 5E4TA 2YCBA 3H5NA 1RJFA 3HJFA 3WJAA 4G8DA 3NASA 4FHFA 1WDWB 3X1YA 3PGXA 2G1AA 5DMXA 3HI6A 2ZIZA 1NA5A 3QM1A 2VPTA 3HPQA 3T0GA 2NQ8A 1KSHA 3V97A 4HBGA 2OAGA 2GK4A 2XCSB 3K5WA 3E58A 1GPNA 1K5HA 1QO0A 2YDYA 3U1BA 2H07A 1S9DA 3OZCA 1BGVA 4J0IA 2CFTA 4JVSB 1TZMA 1PFUA 5LLTA 3CVUA 1IM5A 1QIFA 4HC4A 3WKCA 4DC0A 5K8CA 5IX8A 1ZU5A 3PA8A 2QEQA 4LVUA 4D46A 5E9AA 2PU7A 1ATZA 4JR0A 1P0CA 4LJ6A 1YR3A 2C04A 1WIWA 2VDKB 4B9EA 3O74A 1IY2A 3SK0A 3TR6A 3ROZA 1E9RA 1SJ9A 3KSDO 2Y05A 2VUUA 2K7FA 3HGMA 4O63O 5DNDA 1CC1S 1OAKA 3WNCA 1G8MA 3H3JA 4D74A 4NZ9A 5BN3B 2PA3A 1RZUA 2IYLD 4DM7A 4Q1CA 5ED4A 2YYAA 3N2EA 4JCOA 1OZFA 4KPUB 5LXTF 4RZUA 4YFVA 5D5PA 1L7AA 1EX7A 2JGEA 4X1YB 1DQZA 1DI0A 3EAFA 3IAXA 4JLDA 1TUBA 5G1PA 3NDIA 3TI9A 2B25A 4BN4A 1C1YA 1NXVA 1WUKS 2PT9A 3K6JA 4LZWA 4PQRA 1QJCA 4ZO7A 3TF5A 4RTSA 1N0UA 3TIGA 3D5EA 4QJBA 4Y30A 4HNAB 4JJZA 4CG1A 1J24A 3PNLA 5C37A 3GVCA 2N1MA 4L8LA 1C9YA 4LJAA 4POAA 3VBEA 4CMHA 1JQDA 1R9MA 1AGYA 4L51A 1JPNA 4Y6PA 5CYOA 4QRIA 2VK8A 3H2YA 1M73E 1QIEA 1ZJYA 1FMJA 1TO1E 1AQLA 2JGJA 2PY6A 3NUGA 3QF4A 1PQWA 2P9HA 3BB3A 3K6KA 5GMOA 3SM9A 3W3AD 2WQ7A 1DJPA 3EQ7A 4LMBA 4RHXA 4TWIA 4ZQEA 3B89A 1T8UA 3RT7A 1M2HA 1YSCA 2HNAA 2J9GA 1E2FA 1BU8A 4G1UC 1J42A 2IEIA 2VF8A 2Q2WA 3KCQA 3LFTA 221PA 5A4KA 5CB6A 1GFIA 5G4LA 5DHQA 1IVYA 4B8ZA 2JLUA 3AW8A 3OEEA 2B3TA 2CLSA 2EG5A 2YXBA 3O1LA 4RHCA 4X60A 1YV9A 4JA2A 4Y2VA 3V7YA 1DIAA 5U4QA 2I8AA 4YJGB 4CVNA 4YRZA 2NMVA 1G18A 3A6HA 2OBLA 1ZNYA 1ZIOA 5F5LA 3ZUPA 5D3KA 3L1IA 4D1YA 2IH4A 3DE2X 1NVVR 3LIIA 4GX2A 4ANFA 3LS2A 4JYBA 2BKXA 2HEGA 4RLSA 4YCBA 1SOVA 2EFDB 4I9GA 2YXDA 2FKAA 3RBZA 4N7BA 4KE9A 2O8DB 1QRRA 1J06A 3GDWA 1RYNA 2AMVA 2QL7A 3GCXA 4TUYA 5JE8A 3TOCA 2IYZA 5EIEA 4RV5A 1AUXA 3LCVB 2WIGA 4NU0A 1EGQA 2HZ7A 3TJZA 4EJSB 3EZ7A 3IVGA 1AS0A 2BUBA 2WWVD 4TWJA 4PGHA 5EGNA 4R81A 4NBVA 3OTWA 3W5CA 2HFJA 3HG7A 4G01B 1VCMA 3H4TA 3P0JA 2YX1A 3IQDB 3UMGA 1KMQA 5CYGA 8OHMA 4QM6A 4CGZA 5DWVA 1ZQ1A 3KZCA 2FG6C 3BE8A 3H9EO 1PCXA 2WWTA 2XCTB 3BSWA 3PENA 1DOZA 2W11A 3E8SA 5A62A 2P78A 1NXOA 4BVKA 4X6XA 1AG9A 4QTUB 3CZ9A 4U9IS 4E5SA 2AFHA 4KZKA 2H9YA 2QP9X 2IF0A 1JLLA 4I5FA 4PPYA 1Y5MA 1UXKA 2Y27A 1GPWB 2FPMA 2YIMA 4Z4HA 2JHPA 3JSAA 4HAVA 1V8ZA 4MI3A 1HLPA 2QD5A 5I7RA 4BP8A 1UBLS 4TTQA 1P60A 2YWBA 2BH2A 4C0SA 3L7BA 4FBLA 5CYFA 5TGZA 1VL6A 4A23A 2GEFA 3OMLA 3U6KA 1DQRA 1XO1A 4UHDA 1XVUA 2OG1A 1BMDA 3HKCA 1F8YA 3OURA 2CLFB 1BN7A 4HWRA 2RGYA 1ZD3A 4EHNA 1Y7IA 5BN1A 4RFLA 3I9JA 1NTOA 5JNVA 4TMXA 4GMHA 4W1SA 5AOCA 4LJRA 2B30A 3VHQA 3DEYX 4PLWA 5EXTA 5C4MA 5KSZA 3K1JA 1OLXB 3UHAA 3V2GA 3EVZA 3GJYA 2CXOA 2PZBA 4RWEA 5BRAA 1HE5A 1WKVA 3WJ2A 4O25A 1PJ4A 2R84A 4PZDA 5EZYA 3K0EA 5FPPA 3NRBA 4BNDB 4OD0A 1XMPA 5DVZA 1P80A 1ZK0A 4J07A 3IP5A 3KYJB 4FXPA 4YBRA 3VMMA 2IZ7A 2WRZA 4F3RA 1NVEA 1QO0D 1Y7HA 3JWGA 1Z4KA 1P2DA 1W5SA 3JQ8B 4QBHA 5AHOA 4F3NA 1L3IA 1YR8A 5AD1A 5IT0A 1KO8A 3GLQA 2O8FB 4HQNA 3IVRA 1Z37A 1QP4A 1YRAA 2JS7A 4WQMA 1VHLA 3K0BA 1QE5A 3NIDB 1IHYA 1MAUA 4LJSA 1KFEB 3QMWA 1B74A