2B8MA

Crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GMIEKVYEFKRDAKTKVVEKLVNTEHVQINHIVLPRGEQMPKHYSNSYVHLIIIKGEMTLTLEDQEPHNYKEGNIVYVPFNVKMLIQNINSDILEFFVVKAPHPKKLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0764
publication title Crystal structure of (1499583) from METHANOCOCCUS JANNASCHII at 1.70 A resolution
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Unknown function
total genus 21
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b8mA00
2PYTA 4N9IA 1ZNPA 3ETQA 3SHRA 2EA7A 2VECA 4IEUA 3FJSA 1GQGA 3E5QA 2XL9A 4HN0A 4Q0SA 4QGMA 4PIXA 4XFHA 2IXCA 3ZDSA 3EBRA 2BNMA 4A2UA 3WW2A 4AQ6A 3U0ZA 3H3UA 4MGYE 4PIZA 5JSRA 1SFNA 2OPKA 4IEWA 3U11A 3WW4A 4EV0A 3QOPA 1NXMA 4QGLA 2GZWA 1RTVA 2IXIA 4L11A 4KU8A 4I02A 1CAUA 3USSA 1CAWB 5FLJA 1LB2A 5EZWA 5FLIA 3E5XA 3I7DA 4XFGA 4MGIE 1QWRA 4E2QA 4ZU5A 3LWCA 1IPKA 4Q0UA 3NKTA 2PTMA 4XFIA 3CEWA 1ZRFA 1YFWA 1FXZA 1ZX5A 3TNPB 2Y0OA 4KWKA 4IEOA 3RYKA 1NE6A 1J3PA 1YFXA 4O9EA 1EY2A 4HSJA 2PHLA 3M70A 3EQEA 1V70A 4X6RB 2BEOA 5I91A 3S0MA 3SMHA 2ATFA 1Y3TA 3BPZA 1OD5A 4RD7A 3IBMA 3CF6E 3EJKA 5FPXA 2CAUA 4D7SA 1O4TA 4IEZA 1ZZCA 1O5LA 2BGCA 2UYAA 1DZTA 4WBBA 1WLTA 2DCTA 4UBHA 1UIJA 3EHKA 4Z07A 5JAXA 4HLTA 4I3PA 2K0GA 2PAEA 1X8MA 1ZVFA 2ZCWA 3OD0A 2XLFA 3BB6A 1Y9QA 1H1MA 1L3JA 3H9AA 1ZZ6A 1O7FA 2PAMA 1SQ4A 1QXRA 4DINB 4E2SA 5KHGA 1O3TA 4AVCA 4JTNA 1OFNA 1CAXA 3SCFA 3MZHA 1VR3A 4FT8A 1ZZ8A 1J3QA 2OZJA 1X82A 3D82A 2IXJA 4PJYA 3H3ZA 2BNNA 3KSCA 2HJIA 2V09A 4ONUA 2O8QA 2B9UA 1FI2A 4K8FA 4YYOA 5KBFA 5FLHA 5KHKA 3KGLA 3SCGA 3CO2A 3C3VA 3WW1A 2UYBA 1O5UA 3RYPA 2ET1A 3UKNA 5C8WA 2PAKA 3D0SA 3RYRA 5CVRA 5FQ0B 1ZRCA 1Q5OA 1IPJA 5LRRA 2I45A 4QX5A 2N7GA 4KWJA 4OLLA 3I59B 3RPQA 3FX3A 2XLGA 2H6CA 3DL3A 4Q0PA 4J1XA 3KMHA 4R8HA 3NVCA 4LA3A 1UPIA 2Z69A 4Q29A 4XETA 5I8TA 3M3IA 4HVOA 4B29A 1XE7A 2K9ZA 3H50A 2Z2SB 1FT9A 4HZFA 1J1LA 3OTFA 1RC6A 2FQPA 1YLLA 3UKVA 5KHIA 4IERA 5I93A 4IEVA 4Q0VA 1PMIA 1CX4A 4HN1A 1Q3EA 2IXKA 4YARA 2P17A 3IIAA 3NSTA 2XHKA 1J59A 4HBNA 1VJ2A 1DGRA 3GBFA 5BV6A 1QXJA 1J3RA 4I2OA 4ZU7A 3BU7A 1YFUA 5J48A 1UW8A 2QJVA 4XF9A 2MHFA 3ES4A 2BNOA 5FDBA 1WGPA 3VHRA 4WVZA 3H7JA 4I01A 4AXOA 3LA2A 4ZU4A 5BPXA 1RL3A 1NYWA 2PA7A 4F7ZA 5AVPA 2XLAA 1CAUB 5CADA 4LTAA 2IC1A 5EFUA 1ZZ7A 1CAVA 5LEKA 3CJXA 4Z82A 3FFQA 5LRSA 5BY5A 3B02A 3IDCB 2D40A 4MUVA 4IETA 4IEPA 1XE8A 4PIYA 3UKTA 2XKOA 4MGKE 2WC2A 3ST7A 3SXWA 2IXHA 1ZRRA 3OGJA 4OFGA 3H1WA 2HKXA 1QY4A 2BYVE 4BIFA 5BUVA 1ZREA 3CL1A 1O3QA 2CAVA 2ZKLA 5JSOA 2PHDA 3LZZA 1VP6A 4META 4BH9A 4YSFA 4P9GA 5KHJA 5CU1A 3PVBB 4JV4A 2OYZA 1YHFA 3MDPA 3KGZA 1RGSA 1SEFA 2H0VA 5I0RA 4LA2A 4AQ2A 4XFFA 4EROA 1U12A 3LOIA 3HQXA 1UCXA 4MGZE 3N4MA 4QXKA 1I6XA 4MH0E 2GC0A 3H8UA 1UD1A 4YNIA 1EPZA 3BALA 1TQ5A 3S7EA 2C0ZA 4D7TA 2GU9A 2WFPA 4QM8A 1CAXB 5JSPA 2GH2A 4LULA 1OMIA 4IEYA 3WW3A 3MPBA 4YRDA 4FAHA 5C6CA 3NJZA 2PQQA 4XF0A 3I54A 3OF1A 2D5FA 4I0BA 5J3UA 5KHHA 2ETEA 2XL7A 5F1RA 2EVXA 2GC1A 3BCWA 2QNKA 4XFAA 2GC2A 4I0AA 5I8SA 3NW4A 5T3NA 1CGPA 3G7DA 1Q43A 4L2NA 1DZRA 1LKNA 5BXXA 3U10A 4WZCA 2CV6A 3S7IA 1CAWA 3OCPA 3ACLA 4LUKA 3R6SA 4ORFA 2OA2A 2EAAA 5K8SA 3QACA 3HT1A 4Q0QA 1NZCA 1YUDA 4QGNA 5I0SA 3E97A 4TLFA 3CLPA 2XGXA 2KXLA 4BYYA 1O3RA 5E16A 4XFCA 1O3SA 3PLQA 3GYDA 1XRUA 2O1QA 1UIKA 5I0UA 1YFYA 3L2HA 1WA4A 2QCSB 3FWEA 4UXAA 1LR5A 4IEQA 3TNQA 3LA3A 3FE5A 4XF3A 2D5HA 3HT2A 4N9HA 1J58A 1HW5A 2Q30A 2UY8A 3PNAA 5HI0A 4E2GA 4MX3A 2IXLA 3MYXA 3FHIB 2OZ6A 4MV2A 5D1IA 1GQHA 3D0JA 3IWZA 1PM7A 4IESA 4NVPA 5I8YA 4LUMA 3E6BA 1I5ZA 3ROUA 5JR7B 4X6QB 3E6DA 4EWEA 1OI6A 3IDBB 4AVAA 3H1MA 3SCHA 1G6NA 5J7MA 1EYBA 2MPFA 1ZZ9A 2MNGA 2QDRA 3NL1A 5JCTA 4UBGA 2UY9A 4HSLA 4XFBA 3HIFA 2PFWA 2QVSB 1RUNA 4FAGA 4KL1A 3RDIA 2ET7A 3RZZA 2GAUA 3O14A 4JVAA 2B8MA 4GULA 1X7NA 3H1YA 2Q1ZB 3LAGA 1RUOA 2F4PA 2VQAA 1X8EA 4F8AA 4BHPA 3KCCA 1NE4A 3DN7A 4KU7A 1CAVB 2Q4SA 4QMAA 4XF1A 4J1WA 4XF4A 1EP0A 4QM9A 3FZ3A 2B5HA 4HMZA 4LEJA 4MZUA 1YWKA 4IEXA 2FMYA 5FQ0A 1JUHA 4FBFA 5LEJA 5I0TA 1LRHA 3I59A 2VPVA 4EWAA 4JTOA 1DGWA 2E9QA 1ZZBA 3H7YA 3DV8A 5FCCA 4CYDA 2XKPA 2Q0AA 3ELNA 3E6CC 3E5UA 4EWDA 3DKWA 4KWLA 2D93A 3EO6A 4H7LA 3JZVA 4LLOA 3ES1A 1H1IA 3LA7A 1ZRDA 5FPZA 4R52A 4XEZA 4AVBA 2GC3A 4HVRA 5E1RA 4HVQA 4I09A 3RNSA 2CGPA 4O9GA 2H6BA
chains in the Genus database with same CATH superfamily
1JZ7A 3MIFA 3V64A 2I2SA 2RR11 3KV9A 3BYWA 5BNOA 2R6QA 1RXFA 5C3SA 2RR13 3R4DB 1FV3A 2D6PA 2EA7A 3WP5A 1G86A 2VECA 1O6UA 3FJSA 3OYWB 1PNFA 1PVC2 4UFHA 4HN0A 4PIXA 4XFHA 4ARYA 1JYIA 2WNEA 2BU9A 2IXCA 4O65A 3ZN6B 3LSEA 2BNMA 1W0NA 3GDBA 2HEYF 3ZN4A 4WV8A 2QQVA 5JIAA 3LSDA 4GA9A 1CZVA 1A34A 2VUJA 2MEV2 4OI4A 4C8DA 5ABJA 3PUQA 1ENRA 4Q4X2 2XOMA 4YVWC 3WF2A 3I2IA 4DXSA 4Z2AA 3U11A 3WW4A 4EV0A 4QGLA 3O1VA 2P3IA 2C5DA 4LPLA 1UN1A 3VDBA 3SQOA 1RTVA 2IXIA 4N53A 3RZLA 5B4NA 2J1EA 4J6GA 5FTTC 3I7DA 2RJ2A 3N9QA 3MBWA 3VBFC 5ISLA 4OQ8A 4MGIE 1AR92 1QWRA 3AP5A 4ZU5A 1FAYA 1D0HA 2VC9A 1QKQA 2XMLA 2QFEA 4JKLA 4XFIA 1QIQA 2VCBA 3IKWA 4BA6A 3BODA 1JOJA 5ERLA 4QPGC 1JZ5A 1G9AA 4KWKA 2W1SA 1RUF1 2HWD2 4Q8LA 4JZRA 3MIGA 4MXVA 2X09A 3D6EA 4Q1RA 3U37A 1UZZA 4O9EA 4M3CA 4HSJA 5EJ1B 2WS91 2VTFA 3PMSA 1U5YA 2W91A 3ZSLA 3JD72 1HB3A 1V70A 3ZYIB 4A45A 3S0MA 3SMHA 1RUG3 4GH4B 4DEVA 4MG2A 4RD7A 5J96B 2YXSA 2LM3A 3CF6E 2C9KA 2QE3A 4JRAA 4XIOA 4COWA 1O4TA 2RS12 3SKJE 2BBVA 1LOCA 2BGCA 1PO11 2UYAA 4B1MA 4CP9B 1PO13 1DFQA 2DCTA 3FLPA 3J8F2 3EHKA 3Q8FA 1F31A 4UBHA 5GM0A 1MS5A 3ZXKA 4AOCA 4CDXC 2BZDA 4LK7A 3UYJA 1QJX2 2AGSA 2PAEA 4Q4V2 2TNFA 3WCRA 5BNNB 3VBSC 4AGRA 1ZVFA 5FYBA 4WM8B 5FR3A 2ZCWA 2A6VA 5AC93 3THPA 3FUQA 3OG2A 1H1MA 3BIWE 1VBA2 2BVVA 2XJUA 1ZZ6A 4GAZA 3ZKYA 2A3YA 4AFAA 4D0QA 3NQHA 3O0WA 2X5IC 1O3TA 4RQPB 3LD8A 1W04A 4QX7A 3SCFA 3ZIWA 3FMGA 4FT8A 1PVC1 4MHUA 1LODA 2VO5A 4KH9A 4RSUA 3VDCA 2VU9A 1BBT3 2IXJA 4JGYA 4PJYA 2BBAA 4FP3A 2BNNA 4WM7C 1LOGA 3LFMA 2AENA 2W1WA 2V09A 4ONUA 1XNDA 3THDA 1FNYA 1MZ5A 4K8FA 5FK8A 1NCQB 3POYA 4Q4X1 1W9SA 1AR71 2HYKA 1R1A2 2ZGUA 3OGGA 1AR73 1C5IA 3N35A 5HXMA 3KGLA 4YW4A 3MLKA 3NV2A 1YQ5A 3AL6A 3WQ1A 4NIIA 3B5LB 5C8WA 2PAKA 3OBTA 1DQ0A 2NLRA 4XZUG 4NIHA 4RS5A 1QXPA 1ZA4A 4YM3A 1AR91 5FZOA 1XNTA 3CNAA 5C9AB 2VOWA 2I45A 4XMIA 3MHZA 2V73A 4KWJA 3I59B 5J36A 4K3UA 4XCBA 1HIXA 4OMDA 4EN0A 2DV9A 1AX2A 3VZNA 3FX3A 2XLGA 5EYXA 2WABA 4NE9A 3KD4A 5A6QA 5IVBA 2NP0A 2QQIA 2HWD1 1WMFA 2ZGQA 2BV4A 4QX0A 4AI1A 5KC6A 3T1MA 4EQVA 3WP6A 2DVDA 1UPIA 4LA3A 1NQJA 2Z69A 3MEPA 4R9AA 3NAPA 4XETA 4B7KA 4D8MA 1H8TC 1JHJA 1MZEA 1XE7A 4ES9A 3JD71 3IAPA 3FL7A 3NV1A 5DPNA 4BB3A 3VZOA 3WNKA 4BIOA 3OTFA 2YU1A 4LBQB 2FQPA 3VZLA 1PMJX 2HWB1 1Y7BA 5FRAA 4NPMA 3LOBA 2WNVC 2HBTA 3ZFEA 1QH7A 2HWB3 4R9DA 3UKVA 4P08A 2FBEA 2RS11 2YZ4A 5SV5A 5IW0A 2FD8A 3QH6A 5A3PA 1PMIA 5HPOA 1COV1 2WO3A 2KR2A 5LK7B 2PLV2 1COV3 3J8F1 4MSVA 1LTEA 2GSYA 2JG9C 2P5BA 3IIIA 4QPIC 4SBVA 5FZ0A 5LB6A 4E4DX 3NSTA 4FPKA 1QJX1 4G9SB 4G3YC 5LBBA 4CDWA 4Q4V1 3AK0A 5FYCA 4HBNA 1VJ2A 1J59A 5A6YA 3JU9A 1AYM2 2CY6A 3M1HA 5BV6A 1NG0A 3HQUA 2OW4A 2YYOA 1VIWB 1UOGA 4Y5Z0 1BVP1 1EPWA 1AYN1 1VBA1 1WZXA 3IDEA 3CHXA 3LEIA 1DQ4A 5D21A 5FY1A 1VBA3 1AYN3 1HDKA 2JDZA 5J48A 2ZJCA 1W9WA 2D6MA 4N43B 3RVHA 3RWKX 3OEBA 3WP3A 2OQ6A 4S2FA 5FZHA 1EAH1 4BE3A 1ND3C 4JQTA 2BNOA 1EAH3 2JE7A 1WGPA 3PIGA 1G9DA 2Q1FA 1XNKA 4FQ4A 4LHSA 2JKBA 3D4KA 2VMEA 1ULOA 4BQ2A 4LIUA 4QQPA 1W39A 2J1RA 3WINE 5F39A 1LOAA 3S5AA 2EXHA 5GALA 4YZ1A 3CKHA 4XJAA 2X8KA 1EV13 1MEC3 2PA7A 3WXPA 3HBKA 1CPMA 5CADA 3NRUA 1RVF3 2JG8C 3I2JA 3RMXA 2FDFA 4HT1T 2WINB 2VE1A 2VXJA 3EXUA 1ZZ7A 3BTAA 1YIFA 4TTGA 4FPCA 3FFQA 4W8JA 2WFF2 1QDCA 2YHJA 5LRSA 2E51A 4A6OA 1OFSA 4CEYC 5BY5A 2JICA 3B02A 3B7MA 5FJHA 4CU9A 4D7YA 5K0UB 3OUIA 2PMWB 4IETA 4MUVA 3U4SA 2DTYA 1F5JA 3DPRB 2XKOA 4LLFA 2WC2A 1V9U2 5DAXA 3LDKA 4MXWB 2WZPP 3SXWA 4B4RA 4E4HA 1I5PA 5FZ9A 3VBOC 3VZKA 1OLRA 1IS3A 4IV3A 4GIQA 3Q8BA 4IE5A 2GN3A 4A44A 3WDVA 3HQRA 3OGVA 3EYPA 4NUBA 1QOSA 2Y6HA 3ZLIA 2WO2A 4DFSA 1LJ7A 2VBBA 3CL1A 3NMBA 3T4VA 2VW2A 1O3QA 4CXYA 4JCKA 4PQ9A 1QOTA 3AMQA 5D8AA 3CJIC 1TZOA 4FFHA 2IVIB 3WSOA 1UZYA 4IXLA 2JE8A 4CP0A 1H8VA 5FJKA 3ZPYA 3T2PA 1GUIA 2A70A 5CU1A 2OYZA 1FOD3 1YHFA 1I3HA 5DG1A 1K5MA 1WD4A 2R073 2VOXA 3KGZA 3HWJA 2H0VA 1L7LA 1SEFA 1ULFA 1PK6C 4LHLA 4MADA 5E6HA 4CP2A 2V5YA 4ZZ5A 2ARAA 3LOIA 2VBPA 2RDNA 3AKTA 2YGMA 1C1LA 2PLV1 5LASA 1DZQA 3AKSA 2YC2A 2ORXA 4YPJA 4O61A 4Q27A 4PHZA 5IVCA 2GP5A 1RUJ1 1AYM1 1D7PM 1RUD2 2VNRA 3MF6A 4D7TA 3MF9A 1RUJ3 3KS7A 2ZHLA 5DAQA 2J22A 3VBRB 4FP2A 4RHV1 4QM8A 3ETPA 4RHV3 1F4HA 3M3QA 4XBLA 4LULA 5BNOC 4NIGA 5FUPA 2JWPA 5LA9A 1OMIA 3KB5A 5IJRA 2BRTA 1ASJ2 3OYWA 1YJKA 4FAHA 5C6CA 5CFDB 4XF0A 1H2NA 1QJY3 2VOKA 3ZN6A 1DHKB 2GMMA 3ZR6A 2ILMA 4GMP3 1LEMA 1UYPA 1JMUB 4LBKA 1JXNA 2WKKA 3ALQA 4OZOA 5J3UA 4LKFA 5C3OA 2XL7A 2VVEA 4NWWA 1OOPB 4L92A 1AR82 2GC1A 3BCWA 5ABJC 4PLOA 2P4EA 2QNKA 2V5DA 1OKQA 4NIAA 5LBEA 4XFAA 3HEIA 4I0AA 3HN1A 5DQ0A 1CGPA 1W8WA 4JAAA 3AX4A 2ARXA 3H0OA 4N53C 2OVUA 4P9LA 3S7IA 3VD3A 2UWBA 1LGCA 4LUKA 3ZYJB 3UL2A 3MGUA 3VZMA 1R082 1YEWA 2WFF1 4Q0QA 1SHWB 5E8AA 4D6SA 4NOTA 4I3GA 2DFCA 2RS53 3CLPA 4N7UA 3LGRA 1NA1A 2XGXA 2Z5WA 1IG3A 4H55A 1BMV1 2XXZA 1O3RA 1V9U1 3V56A 1B35B 5HBAA 3O5SA 1OF3A 1JYVA 1UY0A 1CR7A 1QJFA 2O1QA 4H2AA 5FYVA 2EICA 4UXAA 2WZR3 3ZO0B 5FYTA 1TMF2 3AJYA 4A3XA 4GWMA 5A7PA 3SH4A 3FE5A 1DG6A 4XTPA 1CX1A 2BQPA 2WN2A 2FMDA 5CYYA 1GZTA 4Y1ZA 1HW5A 2UY8A 5HI0A 4GH4A 2VD7A 2XBO2 2GMPA 1WUVA 3KWVA 3OBAA 4OHVA 4CCJA 4LOSA 1JYTA 3NNJA 5IHRA 4LBLA 4CRQA 2VUAA 4NPRA 1WW4A 5D1IA 4CP9A 1JYCA 3QBQA 3WF0A 5IK7A 4LOTA 2QZ2A 4EN8B 4HK8A 5LATA 3PIJA 2JXAA 2YY1A 2ZHMA 1I5ZA 3K4DA 2Q8OA 5C7GA 5BNNA 4X6QB 4YW6A 3E6DA 4UI9L 5A3WA 4BPZA 4EWEA 4WM8A 4AFCA 1GZWB 4HANA 1SDDB 4ISRA 5M0TA 1BEV2 1G6NA 2VZPA 3TB0A 1UY4A 2MPFA 5GLTA 4NHLA 1OUXA 1RUD1 4AK3A 4LO4B 4QB2A 5JOZA 4L8QA 1C8M3 5A33B 2PXJA 2J1UA 4Q4W2 4HSLA 2W9XA 1LHNA 3HIFA 2PFWA 4X8PA 4RQPA 4GWNA 3SITA 1ASJ1 1SMVA 4FAGA 4URTA 2GALA 4CSWA 4KL1A 4BQWA 4EYUA 2QQMA 2QQKA 4JGYC 1D4M2 5FXWA 4ASLA 2AC1A 4JVAA 5L73A 2K2SA 3ZYFA 1W0OA 1OT5A 5FUNA 4AHZA 2DCKA 2OXBA 4S2GA 1UQXA 2ARBA 5DDJ3 3GCWA 2WBKA 1NCQA 3PU8A 4RFRB 2R062 1AR81 4JQRA 4M4PA 1TME3 3KCCA 4BHPA 1NE4A 1RYYA 5ACA3 2OUJA 2F17A 3KM5A 2Y26A 2CTVA 2Q4SA 3VKFC 1S55A 4QMAA 1POV3 3AFKA 4J1WA 2WWJA 4C1XA 4FPLA 2VQ0A 3DF0A 1XE0A 4BOWA 4DNYA 4XMAA 2WNUB 3P6BA 4P5YA 2FMYA 1H30A 4RS5C 5FOBB 5C9AA 1HRI2 4TZDA 1LRHA 1F8VA 1GR3A 3I8TA 3I59A 2VNGA 2E26A 4BWOA 1FATA 1VB4A 1PGL1 4CCLA 1F35A 5FY5A 4LR4A 5BNQA 3MIHA 2VPVA 5FPAA 4BM8A 2YFUA 3VHNA 1W9YA 4CA9A 3H7YA 3DV8A 1TMF1 1TE1B 4CYDA 3NAPC 2DWRA 3AZYA 3JCIA 1FPN1 2Q1MA 1E5IA 3ECQA 1FPN3 5JIUA 2E63A 1SPPB 1OA3A 3PJYA 3E5UA 2JDAA 4LBQA 1NCRB 4LMFA 2J1VA 1PMHX 4QPWA 4QX3A 3B00A 1H1IA 3ES1A 4Y33A 3LA7A 1IHMA 5FZLA 2ZGNA 5FO9B 3RZKA 3ZXLA 4R52A 5FZMA 3PUHA 5FMBA 4XEZA 5E1RA 4I09A 3PUIA 4CP1A 4CDWC 4CUBA 3AL5A 1W2OA 2PYTA 3HOBA 4GD4A 1RUC3 1IS5A 3DCQA 1H2KA 1ZNPA 2DU0A 1JHNA 3KVBA 4CEWB 3ETQA 1QQP1 1DCSA 3ZPOA 5H9SA 4LBMA 5FKCA 3I2OA 1QQP3 1RXGA 1GQGA 1HB2A 2GDFA 4JGZB 4QGMA 1RUI3 4GB32 2NMNA 4Q4W1 4LBOA 4N43A 1AR62 3EBRA 4Z2WA 1ULPA 1U5ZA 4A2UA 2F4LA 4LO7A 4CCMA 4AQ6A 5FO7B 4YZ4A 3ZR5A 2VM9A 2X29A 4XXAA 5FYIA 3U0ZA 4C91A 3DYOA 3H3UA 4PIZA 3U1XA 3R4UA 2XJSA 1GP4A 4R9CA 3PTYA 1PZ7A 1X9PA 3QOPA 1NXMA 2GZWA 3VHPA 2R061 4CXWA 1BVVA 2P34A 1POQA 2HH9A 4ZXEA 1ENXA 4L11A 4AEDB 2R063 1JZ6A 5LY1A 1V6IA 3POIA 1CAWB 5FLJA 3ZFFC 5CFCA 5EZWA 1JW6A 3Q8EA 5FAXA 4BXSV 5A7QA 1URXA 2VW0A 5KR7A 2Y38A 3OUHA 2XJTA 3LKJA 2WQZC 1EUUA 3LWCA 3P5BA 3VL9A 3ZSKA 3U75A 1M06G 3NKTA 4B3NA 1YFWA 2XR4A 3PTRB 4NHYA 2A6YA 3ZXGA 5CBLA 2FDHA 3I2DA 5K0UA 4MVTA 3VN4A 4AQSA 1UXZA 1FX5A 1H2MA 1ZX5A 2WUHA 2CYFA 1HRI1 4ARXA 3RYKA 3DPRA 2RR12 4QHBA 2UWAA 4ZS2A 2X53S 3BUCA 4MXWA 3T0DA 2HWF1 4UW3A 3TWIA 3AYCA 1YFXA 4XUTA 5CB7A 2HWF3 4IL7A 1NX9A 4IV3C 1RUE1 3BN6A 1RUE3 3KV5A 3UGHA 4X6RB 2BEOA 2ATFA 1BZWA 5C5TA 1GNHA 4MLOA 1POV0 2EALA 2WAOA 3WG2A 4B4PA 2Y6FA 1CD3G 1OD5A 1V6JA 2VAUA 4YFWA 4RR3B 3EJKA 1WCUA 5D8AC 1PGW1 2CAUA 4BU2A 3TEYA 4D7SA 4IE0A 3VD9A 1I1EA 1O5LA 2FHRA 2DVAA 5FZ6A 1MPXA 1JH5A 2XQRA 4K8RB 4Z07A 1H0BA 4E8CA 4L9BA 1K5MC 4OQ9A 2AEYA 2DU1A 4IGOA 2XJPA 1K45A 2YBSA 4OUEA 5J37A 3K4AA 4TN7A 3WG4A 5AFEA 2PHTA 4ASKA 4EE2A 1S2KA 2XLFA 2ZBJA 3RRDA 2G1MA 4AYUA 3BB6A 5J09A 1SLTA 3KF3A 5H9QA 3NNGA 1C4RA 1L3JA 5BNPB 2W68A 5ANNA 3LCPA 2R0HA 2JD9A 2A3XA 1HXS1 2PAMA 3IZOA 3KCXA 3VBRA 5KHGA 1HXS3 4AVCA 4JTNA 5FWEA 3FHQA 5C4WB 3MZHA 1VR3A 2VCCA 5CG8A 5GZEA 3G6JB 3VD5A 4KQ7A 3TAYA 3AMHA 1AR61 2DUQA 5CFDA 3ZXJA 2XVLA 2JX9A 4D3WA 5DAVA 3KSCA 1V6MA 2HJIA 2ZTNA 2B9UA 3N7KA 2VMHA 1PZ8A 5FPBA 2XJRA 5LZ6A 1RUG2 3HD8B 4O7XA 4FXGB 5EPAA 5FZ8A 1OOPA 4Y3OA 4XILA 4Y5SA 1PIV3 1AXKA 3PURA 5EWSA 3SCGA 3CO2A 3B9IA 3WW1A 1PO12 1YQ6A 3K77A 4P9YA 5A3MA 1BK0A 1ACCA 1OH4A 3GBWA 2ET1A 3W58A 3H8RA 1GNZA 1JODA 1NZIA 1XJAA 1ZA7A 2LW8A 3WNMA 4FOVA 2HBUA 4D6RA 1UOBA 2W08A 1JTZX 1LCLA 2TUNA 5FQ0B 3BKZA 4QXBA 3DXTA 1Q5OA 3MIBA 2VXRA 2LROA 5IK8A 1IQAA 2K46A 5AC92 2N7GA 4P5HA 3IT8A 4XZPA 4TYSA 2W0XA 5FPUA 2R042 4OHZA 5A6ZA 5B2GB 2OQ7A 4AHYA 2DTWA 1V6KA 3KCYA 3DL3A 3VBHB 5LA2A 2A5ZA 5SV8A 4HKOA 3TYJA 4UFMA 1B35A 1WBLA 3ACGA 3JB4C 2G9ZA 3RJRA 1W6NB 2A3WA 3GJBA 4Q29A 5F3CA 3WNNA 1BBT2 4MHRA 2FZ2A 4B29A 1SDWA 4XACA 1WW5A 3THTA 1JUIA 2K9ZA 4XDQA 5F3IA 4QWNA 2Z2SB 5G05L 1DIWA 4HZFA 1HV1A 2XJQA 1W2TA 4Y1YA 2OKXA 1O8SA 4FO9A 1GLHA 1VALA 3CBNA 3M3CA 4GH4C 4IERA 4OVEA 4KWUA 1AR72 4IEVA 5FMOS 5FYYA 5JXHA 4Q0VA 3ZXFA 3WHUA 2V4VA 3NNFA 1CX4A 1E57A 1XB9A 4HXCA 4YGEA 1ND2B 4L0PA 3J7LA 5LBCA 2ZACA 2FZ1A 3MW3A 4Q8KA 3K3NA 4PLMA 1GKBA 1X9TA 1UKGA 3I2KA 3DGTA 1W8FA 4UFLA 1O91A 3GBFA 4PCRA 5BNNC 4ZU7A 3NV3A 1GZWA 3HBZA 4WM8C 3VKOA 4H3WA 5GZFA 2JKXA 2Y6LA 5JZGB 3H42B 4RYDA 1NA1B 3W21A 1D2QA 4KNCA 3WD5A 1JYWA 5A33A 1GFF2 2MHFA 3ES4A 2WDBA 3VUOA 1OC1A 5EHDA 3VKNA 2ZZJA 5F3GA 3VHRA 1LGBA 2D6KA 4RQPC 4WVZA 4YWAA 2RMU1 4I01A 3LA2A 2ES3A 2HWE2 2O14A 1YYNA 2QKDA 2RMU3 5BPXA 3AC0A 3WX5A 4W6WA 4B4QA 4YZ5A 1NYWA 2E7TA 3K51A 5IVVA 1VMJA 2R1DA 3UGGA 1RUG1 1ZBA1 4F7ZA 5AVPA 5T5PA 4DXTA 1ZBA3 2FDKA 2D7FA 1H4GA 3NV4A 3PUAA 1NCQC 2HWB2 3ON7A 2CDOA 4QDSA 4V1PA 2J42A 1K3IA 3L2YA 1YJLA 5LCWL 2IC1A 2NQYA 5IVYA 1H9WA 4I30A 5FMDA 5FP7A 3ZOIA 3F2ZA 1VPHA 3A23A 1COV2 5HCFA 2VZVA 4Z82A 4IE4A 4N8MA 4YM2A 5A7SA 4AGGA 1D0GA 2XG3A 1NY72 2D40A 5DZEA 3B3QE 2WNUA 2Z42A 2ZGPA 4IEPA 4PIYA 5AC91 1KEXA 1DQ1A 4MGKE 3I2HA 5CKQA 1H1AA 1UY2A 1V6LA 2ADDA 2R041 2PN5A 4XJ8A 1KDMA 5C9AC 1S0CA 1ZRRA 2A6WA 2R043 2SLIA 4KG0A 3WHTA 4EN7B 4HL0A 1AYN2 2EXKA 3M3OA 4FCAA 4OFGA 2VR4A 1E5RA 4XW3A 3U78A 1Q8QA 1NOVA 4TWTA 4BIFA 1PNGA 2C1FA 2I07B 2CAVA 3AZVA 1K5JA 1EAH2 2NPIA 2PHDA 3LZZA 1VMHA 3QLQA 1BBT1 4PLNA 5CFCB 3H8XA 3O12A 5F5AA 4CUAA 3OB8A 2W52A 3ME2A 1TNRA 1OQEA 1WBFA 4AHXA 1VLNA 1H9PA 1Y9MA 1SPPA 2B7YA 3PVBB 3SH3A 3UT0A 1OQ1A 3LF7A 3RS6A 5IVFA 1EV12 1MEC2 2D3SA 2OT7A 3T2QA 1NCRA 5I0RA 1RVF2 3MFCA 4AQ2A 4DY5A 4EROA 1DYKA 2YC4A 1U12A 4NHMA 5T5JA 3ZMOA 3HQXA 1VRH3 2V4AA 4PBPA 3DEMA 3SH5A 3WLUA 1I6XA 5HXVA 4DMIA 3WUDA 1GZCA 3I3EA 3WG1A 2BGOA 2GC0A 1UD1A 3BALA 1TQ5A 3SLIA 3ZYHA 1U5XA 4MOAA 3S7EA 3WCSA 1AJOA 1QU0A 1REFA 1SG3A 3MLJA 4QPYA 1H2LA 4W6YA 3UGFA 1A8MA 3AP9A 4ZPIA 4QU2A 4CCDA 2ZMKA 2WFPA 4LHNA 3T2OA 4ZY9A 1XC6A 1KGYA 1UU5A 2VOTA 2E7AA 1MQTB 1CAXB 1US2A 3N7MA 4CEWA 2GH2A 1KRIA 1BCXA 1KQRA 3KVAA 3ZKUA 4XQDA 4CU6A 3BOPA 3WW3A 3NJXA 3T09A 2FDGA 1HQNA 2VZ3A 4JGZA 4CU7A 4AF9A 3LPGA 4N43C 2RG4A 1UZ0A 2ZMNA 1L7QA 4A7YA 5FYUA 1GYKA 2A75A 1QGLA 4V2WA 2HWE1 5F1RA 3ZSJA 1VRBA 2VCMA 4M4RA 2HWE3 2RVAA 4UW4A 3FC0A 4Q1PA 1FOD2 2W46A 2R072 4L2NA 2UU8A 4AL9A 3URFA 3U10A 4AEDA 4WZCA 3UNPA 2PHFA 2R49A 3I2GA 1CAWA 3OCPA 3PMEA 4P9WA 3IPVB 4R4XA 3EMRA 5JOWA 2ZMLA 2QQOA 4BQ4A 1Z7S3 1YQCA 1JZ8A 1N1VA 1S0FA 3LEKA 1YUDA 1WA6X 4KMQA 1NY71 3E97A 4TLFA 3ASIA 4M0NA 4FFFA 1RUJ2 2WYFA 1HRV1 2Y64A 4PBOA 5K0UC 4OULA 1HRV3 2RS31 3LPFA 4RHV2 1O3SA 1GZ9A 3PLQA 1UIKA 2RS33 1XYOA 3DPRC 4WVMB 3FWEA 5A3NA 5F2WA 1BXHA 1VBD2 3QCWA 5H9RA 4U2AA 1QJY2 3O1PA 4QKBA 3OJBA 4DUWA 1BKZA 2ZEYA 3HT2A 5C33A 3RZHA 5L19A 4NO4A 2BOIA 3VV1A 3H3LA 3RZMA 4XJZA 4DS0A 3S30A 4FPEA 2Z4FA 3ABZA 4D69A 4RR3A 5FP4A 3AVSA 1R64A 2VVDA 4PI0A 4YW5A 2OZ6A 2YMZA 1OKOA 1EV11 1MEC1 2DCZA 2P6CA 4DRVA 2XUMA 3IMMA 1RVF1 3BGAA 5LBFA 2DURA 4BZ4A 4LUMA 1AHSA 1OHFA 1W6OB 3HJRA 3IDAA 2X10A 3AYEA 4DRRA 5JR7B 2QQWA 4C90A 4AVAA 1W3XA 1HQLA 3H1MA 1W8HA 3N9OA 1JS9A 1GOGA 1AL23 1EYBA 5J7MA 1H8TB 3B94A 1Q8OA 3KZ4C 2RS52 2IZWA 3WEZA 4D94A 5BNPA 4KBZA 3WOGA 1X50A 2BP6A 4UBGA 4CDQB 2YG0A 4XFBA 1BMV2 4CCKA 3VBRC 1APNA 2QVSB 3RGBA 1DLCA 3GF6A 1IOAA 2CGNA 5C4WA 2WZR2 4Q5OA 5FY9A 3AYAA 2IFRA 1CIWA 4IE6A 2ET7A 4MGTA 1AJKA 4QQLA 5CFDC 4GULA 1ODNA 2FDIA 4GKYA 3WNOA 2JDYA 1SCSA 1BK1A 2F4PA 2R0FA 1CJPA 4NHXA 4W65A 2OIIA 2W87A 2ZAAA 3POGA 2BW8A 1RUH1 4KU7A 2KA3A 1OOPC 1CAVB 1MZFA 1RUH3 3GNEA 3USUB 1FOD1 4XUQA 4JKKA 5FXZA 4AFDA 4CPBA 2GMEA 4CPBD 2HWC2 2R071 4BISA 1RMU1 3RZGA 3VZJA 2L9LA 1RMU3 3KQ4B 1D4VB 3MW4A 4HMZA 3MLLA 4MYEA 1HQWA 1HV0A 5DUVA 5FQ0A 1JUHA 3O1RA 4FBFA 1YO8A 5HCHA 5I0TA 1PZ9A 2QQNA 2YROA 3POWA 3U4XA 3WDXA 1LHVA 3O0VA 4DO0A 5FO8B 4HONA 5CISA 1C8M2 3VBHA 3IM0A 1BHGA 3R0RA 2E53A 2NM1A 4IDZA 4JTOA 1F2NA 4Y20B 1B35C 1VBD1 1W6NA 1NLQA 2E9QA 3AKPA 2C4XA 3J9SA 3D8CA 1VBD3 4LHKA 2JDPA 1QJY1 4ASMB 1S2EA 4GMP1 1O4ZA 2OUHA 1S2BA 1OVSA 2W95A 5A3OA 4EWDA 4JKMA 5DDJ2 4HETA 3HNYM 2QDNA 3ZIXA 1TME2 2WT2A 5ACA2 5EYYA 3JZVA 4LLOA 4XPVA 5L9RA 1ZRDA 4F3JA 1MS4A 1RJ7A 5L36A 3AP4A 1ND2A 4PDWB 3VHOA 5JWPA 1WW6A 4HVRA 2DCYA 1US3A 2VZRA 3C7HA 3ZSMA 1O8PA 2B39A 1KS5A 1YQ8A 3ZFEB 4GJYA 2W94A 3J4UH 5FZBA 3LEMA 4N9IA 5IVJA 2CHHA 2PQSA 4RGGA 1J1TA 3SHRA 2DUPA 5CIRA 2RS51 2ZHNA 3UESA 4K21A 1IGOA 3E5QA 4Q0SA 5JZGA 3O1OA 1JZ3A 3TN91 4OMCA 3WDYA 3AZXA 2C9AA 1PGL2 1DP0A 3TN93 1XNCA 4YGCA 3V0BB 2W39A 3AZZA 5DABA 2WZR1 2YU2A 1UWWA 1CIYA 1LOBA 4KGGA 4H7MA 2DVGA 5FY7A 4OI1A 1VAVA 3C7GA 3WNXA 5FMCA 1W2UA 1FPN2 1XU1A 4ZONA 3KT1A 3M3EA 1GWLA 2CNAA 3T3YA 4Z1VA 3OPTA 3GZEA 1G9BA 5T5LA 4URAA 3I3MA 5T55A 3USSA 2BGPA 3N7LA 1A3KA 3E5XA 3K2OA 2HWC1 3VDDB 1QJU3 4XFGA 2CWSA 5FY0A 2HWC3 4JDMA 5F2SA 2D97A 3AXDA 1JOPA 5A1LA 2EIDA 2VZQA 2RJLA 2O8OA 2PHXA 4Q0UA 2A6ZA 1HJGA 1HN1A 2QQPA 2BJSA 3CEWA 2X05A 1KITA 1OF4A 1FXZA 5E89A 4ISQA 3ZSEA 1ZBE3 1RUC2 2VG9A 3TNPB 1JZ4A 1LU1A 1OSGA 2WNUC 4P9IA 1XQNA 2YBPA 5D2AA 2PHUA 1CZSA 1G7YA 1QQP2 3B01A 1EY2A 3KV4A 1SLIA 1C8M1 3OGRA 4GJZA 1RUI2 4QQHA 2ERFA 5FIXA 2Y8KA 3S57A 1AXZA 1W6QB 1R091 4AI8A 1S0JA 3POJA 4R4ZA 1R093 5I91A 2C24A 2VZ1A 4XDPA 3RJ2X 3A21A 4IW3A 4AW7A 4UT5A 3VKMA 1WW7A 3TEXA 2DF7A 5J98B 2TEPA 1VBB1 4AHWA 3P1IA 4K9SA 3M4FA 2ZEZA 4M0HA 5FXXA 3H8OA 1VBB3 4ZS3A 3TOJA 4QD2A 3JBG2 1DZTA 5DDJ1 2I74A 2JD4A 3B69A 5BYNA 1FYUA 1TME1 2PHRA 3WF4A 5ACA1 4A7KA 2R1BA 2WSVA 2DDUA 4I3PA 4XQWA 3U14A 2WQ4A 3FLTA 1NCRC 4IGPA 3T30A 1M4WA 1X8MA 5FYMA 1POV1 2W92A 2Y0IA 2XPJA 1D2SA 2WAAA 3OD0A 4Y22B 3NKGA 3MW2A 2DYCA 1MS3A 2WT0A 2EXIA 1GV9A 1DQ2A 1Y9QA 3C7EA 1KJRA 1UY1A 3POFA 4BK5A 4YW3A 3H9AA 1UZVA 2ID4A 3GHMA 4N90A 4XHXA 5JDBA 4LT5A 1UY3A 2OX0A 1SQ4A 4DINB 4E2SA 4NHKA 1MQTA 1CAXA 1OFNA 3IAQA 3O0XA 4BMBA 1OXCA 1ZZ8A 3W9AA 2WSUA 4GMP0 4CEWC 2C6SA 1UMHA 2D44A 2HWF2 4XJ9A 4M3CF 4AI0A 4GWIA 4DUVA 4HOOA 4JGZC 2CL2A 1RUE2 1GANA 4IUGA 4ZHNA 3UV9A 2RJKA 2O8QA 3UETA 3GZTB 3RQ0A 4XVHA 4Y26A 1KFXL 5FZFA 3ZFGB 3SKVA 2LRPA 1E5HA 2EIGA 5A6XA 4AFBA 1KD7A 2W5FA 3INAA 1PGW2 5KHKA 4BLJA 3C3VA 1O5UA 1MZ6A 2C26A 1UYXA 1SZBA 4COYA 2XJVA 4FVVA 5LK5A 3UKNA 1PM4A 4INDA 4LBQD 3WNLA 4AEDC 3OUJA 5CVRA 5EXOA 1UXXX 1ZRCA 4OCTA 5JXJA 3IPVA 4NIDA 4OI2A 4QX5A 2G9FA 4BK4A 5IVEA 2ZZQA 5C8CB 2VNVA 2D6OX 4XAEA 2Q5TA 4OYUA 2WWUA 4YVSB 3ZXEA 4BQ3A 5LA1A 4Y4RA 2E31A 1UNBA 1KFUL 1XBFA 2E7QA 5FP3A 1RUC1 3CU7A 3DKQA 5A7NA 4COZA 1HXS2 4HKLA 4ITCA 1W0PA 2JB4A 5F37A 3VKLA 4WVMA 1RUI1 3OY8B 5DN2A 3WVJA 3R05A 1V00A 4QXHA 1K42A 4PF1A 5HV4A 2YPJA 2ORZA 3H50A 1O59A 5FYHA 1J1LA 2ZX0A 2FDJA 1SBDA 4XE9A 1YLLA 1TVGA 4XABA 1VBE1 1PIV2 2WJSA 5I93A 3JBG1 3OOXA 1VBE3 3DYPA 3CZJA 4RR3C 4ET7A 3JBG3 1DYOA 4W6XA 4UFJA 1R1ZA 4HN1A 5LY2A 3BTZA 3IIAA 4DEQA 3PVNA 4QXCA 5FZKA 3THCA 3HPNA 3KLSA 1W6OA 1MVQA 2ARCA 5A1FA 4CTEA 1DGRA 1TG7A 2RV9A 1QXJA 3HR9A 5FMOL 3MI8A 1NLSA 5JI7A 2J1AA 2Y6GA 1AX1A 3BU7A 1JBCA 1H8TA 2JDUA 2WO1A 4XHBA 2LALA 4DUXA 4BQYA 2WYSA 4S2DA 5BNPC 5KXDA 3I97A 1GQPA 2WLPA 3P3PA 4CDQA 2Y34A 3WQBA 1PX3A 2WNVA 5EP9A 2Q8DA 4CVUA 3BI3A 5C4WC 2H0BA 4AXOA 5GJ6A 2BERA 2AZ5A 5JXIA 2VOVA 1RL3A 4IV1B 2YBKA 3B9CA 3Q9OA 2KD7A 1N1TA 1W6MB 1XOYA 2JECA 1CAUB 1RITA 3HNMA 4DZGA 4LTAA 1CWPA 1DGLA 1G9FA 2ZOEB 2GNDA 2D3RA 2VL4A 4I0WB 5FKBA 5K9YA 4HG6B 3VBUB 1LENA 3USUA 1CAVA 3CZUA 1BQPA 5LEKA 4AEMA 3WV6A 1WMXA 3CJXA 1W2AX 1BLZA 1SCRA 5KXBA 3N9MA 1T6GC 5L9VA 1UU4A 2GP3A 5DUUA 1GMMA 3K3OA 4AEJA 4UF0B 3O7OA 4C0BA 1YI7A 3MICA 2IXHA 4QX8A 2RM23 5FZDA 1OBNA 3TEZA 1ALYA 3OGJA 4ZXKA 3IB3A 3OPWA 4XDOA 4UOJA 5FXVA 3RI9A 3V0AB 5CNAA 2EXJA 3I4IA 2BYVE 4JDNA 4DPNA 4EZHA 1GSLA 2J1SA 2VH9A 1JOBA 1W99A 3HNBM 5JSOA 1O4YA 5C70A 3OGSA 2J1TA 1UF2C 4Y20A 4AI9A 1RB8G 4META 4QKFA 4P9GA 5HV0A 4DB5A 2RMU2 5F6LB 3SNMA 1VBC2 4NRPA 3T1LA 4LE4A 1WKYA 5FPVA 4XTMA 4JV4A 4Q4Y3 4CDUB 1NUKA 2IUWA 3MDPA 4XUOA 2YGLA 1GOFA 2PHWA 5FZ3A 4E4SA 1RGSA 1ZBA2 1QNYA 1E5SA 1PIV1 4XFFA 1PO22 3OBZA 3OEAA 1IKQA 1UCXA 1UO9A 4MGZE 4QXKA 4LO8A 1MS0A 4BCUA 3VBOA 4PDWA 3Q8AA 1EPZA 1ND2C 1XYPA 4FTEA 1ONAA 1FMD1 5LA0A 5C3PA 1AVBA 3BTXA 1SLCA 1VB2A 2P3KA 4NPLA 3AKQA 1FMD3 1RHI3 1UMZA 5A7WB 3RSJA 3VLBB 3UJQA 2QBXA 2JIJA 2G9GA 4LKDA 1OPOA 2WO7A 4N7IA 2LS6A 3KHCA 2CDPA 2KM2A 2HEWF 1OLME 4YW7A 3C8XA 4AVVA 3A22A 2JDKA 4MO3M 3MPBA 3SISA 3I3QA 4DIQA 4NN0A 5JZGC 2PQQA 5A7OA 3AP7A 3WDUA 1NA1C 5FV3A 2BUKA 3I54A 2Y6KA 3PL0A 2XQXA 3V0BA 5FZCA 3ZM8A 4EJRA 4LBNA 5JR2A 2RDRA 1WMEA 1X33A 3AFGA 2VVFA 2Y33A 3MUY1 5I8SA 3NW4A 3AJZA 3MV01 4C1WA 1SLLA 1Q43A 1LKNA 3CIHA 4JDOA 5GLZA 5BXXA 1YI9A 3OD4A 4LK6A 2CV6A 2ZAHA 2RDQA 2BWAA 4P9XA 5L7OB 1HB4A 1VRH2 3R6SA 4ORFA 3VDDA 1W8ZA 2EAAA 2OA2A 3QACA 4LKEA 4YLZA 3FUOA 1NZCA 2JENA 5JPNB 1OA2A 4XUPA 2VCAA 2WQ8A 2DUOA 4QGNA 5I0SA 4Z92B 1DGWX 1NAEA 3ITQA 4YZ2A 5F3EA 1HB1A 3GXUA 2FCUA 2KXLA 1ZYBA 4XJWA 4FPYA 4HK9A 5E16A 1NXD1 3FFZA 3GBGA 4K40A 5JOYA 1XRUA 1JU3A 1LNSA 4P00B 1YFYA 3L2HA 5I0UA 5FP8A 5JI9A 1KXGA 1DDLA 5JVVA 2VQUA 4K1YA 1LR5A 1GP5A 1SBFA 1W6QA 1IQDC 1WD3A 3LA3A 1MACA 1OPMA 4S2HA 2D5HA 4XF3A 1UOFA 2QQLA 4N9HA 4WVVA 5B4XA 4EN6B 1OLQA 2ZGLA 3PNAA 4QX1A 4E2GA 4MX3A 2IXLA 1HN0A 2B9VA 2YV8A 4KG8A 4BDVB 5CFCC 1VBC1 3MUZ1 3MYXA 3FHIB 1IKPA 1VBC3 4L97A 4LO6B 2XB6C 4MV2A 5FZAA 4OHWA 3W5NA 3POEA 1GP6A 3PVOA 3IWZA 1PO21 4OHXA 4YW1A 1C8NA 1PO23 4AR2A 5C5UA 3ZDVA 3WF3A 1A6CA 1OI6A 2ZX4A 3ACFA 3M7AA 3SEPA 1HLCA 1Z7S2 4Y22A 1REEA 2A6XA 1RUF3 3ENRA 4BQ1A 3MIDA 2YPDA 4E9KA 2QDRA 3NL1A 3TEWA 2NYYA 5GLWA 2VMGA 2D3PA 2NN8A 3NJVA 3A0KA 5K7PA 2WS93 2UY9A 5DUWA 1GU3A 4ATFA 1HRV2 1ODMA 4XBNA 1CONA 4NR1A 2RS32 1RUNA 4YVWB 1MQTC 1RJ8A 4HFSA 5FP9A 2NZ9A 3BPSA 4QDQA 1W28A 5FPLA 1N3QA 3RZZA 3WDTA 3L9JT 1DQ5A 2BTVC 4JHTA 2Q1ZB 5FBZA 1W6PB 3UK9A 1U0AA 4OUMA 2BFUS 2UURA 4F8AA 3NWKA 4FPOB 2A71A 2FCVA 1EUTA 2ZXQA 3GJAA 3GZAA 3VBFB 3ZFGA 2A73B 5FOJB 5JUVA 4LE3A 5A32B 1DQ6A 4EN9B 2ENRA 3KHBA 4QX2A 3WG3A 4XF1A 1GICA 2GN7A 3VL8A 5IWFA 1UYZA 5IATA 1QF3A 2VMIA 3CDZB 4XF4A 2ZGRA 4QPGB 3PJQA 4A4AA 4MZUA 5A3UA 4CUGA 4B7EA 1VRH1 4IEXA 1AL0G 5LEJA 1OA4A 3W59A 2AACA 4LITA 2B45X 1AL22 3OSDA 1FV2A 5ANQA 3CMGA 5C8CA 5FYZA 3ZVXA 1PVC3 4YVSA 3S5QA 5FBJA 4SLIA 1IS4A 4R9BA 4AE2A 1DU3D 3MFAA 3WZ1A 4EWAA 3K46A 4FOQA 5F5IA 5JXGA 4AI2A 1SACA 1YCIA 2MEV1 3DUIA 3K48A 5FZ7A 4B8EA 2MEV3 2ZA9A 3BVCA 2P2KA 3OY8A 4Q4X3 1ENSA 2D6LX 1ULGA 1XXNA 3VGIA 3ELNA 4FQZA 3C7FA 5EJZB 4CDXB 2E6VA 1J84A 4E4ZA 4DXRA 3DKWA 5HCAA 4PF5A 3W20A 1LOFA 2P6HA 4CCOA 3VBSB 2D93A 3WF1A 1W05A 1RUH2 3JQXA 2XDVA 1STMA 1Z0HA 1AR93 1MR5A 3E1F1 2AH2A 1YIPA 4LO5B 1A8DA 2EAKA 2GC3A 5CKNA 1RMU2 4HVQA 4E8DA 2ZX3A 4O9GA 1HX6A 4B1LA 2RHPA 2WL1A 3GALA 3ILNA 2VMCA 4FTSA 2X5IB 2QQUA 1Z7S1 1NLRA 1P8JA 2R32A 3PU3A 4RGAA 1V6NA 3AM2A 2AUYA 4YM0A 1QH6A 1JZ2A 2HWD3 3ZMNA 1OD3A 2NMOA 3JQWA 4FPGA 4IEUA 5C3QA 2XL9A 3QH7A 5IAVA 2GNBA 4WM7B 4HKWA 3TRSB 4BQXA 4XCAA 3ZDSA 2OPWA 3AZWA 3JD73 2EIEA 2VW1A 3WW2A 5EJ3A 4NRMA 4CDQC 2XVKA 1S0IA 4XIKA 3C7OA 4RA0A 4MGYE 5FY8A 1SFPA 4JC1A 5JSRA 1SFNA 2OPKA 2RS13 4IEWA 4LJHA 4FTBA 1DGRN 2W1QA 3ACIA 2AREA 1OH3A 1DLLA 4IV1A 4YGDA 4FOYA 1S0EA 2GNTA 3AMNA 1KJLA 3HAGA 3J8F3 2G19A 1W6MA 1OVPA 3MIEA 4I02A 1CAUA 4KU8A 1QJX3 5DUXA 4AWDA 1LB2A 1SBEA 4Q4V3 1LESA 1CQ9A 5FLIA 3VBUA 3BU0A 3VB9A 1QEXA 4UAPA 1N1SA 4E2QA 1IPKA 2DBNA 3ZYGA 3ILFA 2PTMA 3C2UA 5E88A 1ZRFA 3WT3A 4AEKA 1C57A 1IZ3A 3ZN5A 1Y43B 3GM8A 2Y0OA 3HMYA 3J7MA 2VNOA 3A4UA 1AL21 4IEOA 1OUSA 1I9RA 4QHZA 4UF0A 1NE6A 4XAAA 1H4HA 2XVGA 1J3PA 2CGOA 3R4SA 1W06A 4GKXA 4FPHA 2DVFA 2PHLA 2ZPXA 2JDMA 2RDSA 2VQTA 3ACHA 3M70A 4M00A 4LNVA 4Y1UA 5DXDA 5FZ4A 1QJZA 3EQEA 3TN92 3V0AA 4CCEA 5FYSA 5T54A 2QUOA 3A0NA 4OI0A 4KI5M 1Y3TA 2WNVB 2AR6A 4QAWA 3HN3A 1NT0A 4QU1A 1R1A1 1U5IA 3BPZA 3ZFFA 5IFTA 3W5MA 3IBMA 3LDBA 1R1A3 3PDQA 5K4LA 5FPXA 2J7MA 4IEZA 1UAIA 1ZZCA 5GKAC 2JG9B 4QPIB 5F8PA 4FOWA 1JYXA 4WBBA 4CDUA 1WLTA 1W8NA 1REDA 5IYYA 1UIJA 2YUEA 4YGBA 2O0OA 5JAXA 3N3HA 2CSGA 4HLTA 1IS6A 1YQ2A 2Z79A 2K0GA 4LQRA 4Q2FA 3WY6A 4FSJA 4F83A 3MO4A 1QJU2 3BOWA 1AZDA 3TBDA 3PUSA 1W8UA 2JDHA 1N3OA 4XOGA 2YC0A 5C71A 4PDWC 5FUIA 1PHMA 1S0DA 1Y4WA 3NO8A 5A7WA 1ZBE2 1ND3B 1O7FA 3AMMA 3ZFEC 1QXRA 5F32A 2V72A 3BIEA 5TSWA 4AG4A 1OURA 4CU8A 3JB8A 1WCSA 1J3QA 2OZJA 3T08A 2VJXA 1X82A 3D82A 3I3DA 1GBGA 2R16A 4GQ7A 3WNPA 5JPMB 2ZGOA 2P1BA 3H3ZA 1JU4A 4QKNA 3ZX7A 1KDKA 1C1FA 2VZTA 4NJ4A 3SEEA 1R092 2HLEA 4WVWA 4BMEA 5DG2A 1FI2A 4YYOA 1AUYA 2JG8B 5KBFA 3WQ7A 1WLCA 3F95A 5FLHA 2BDRA 4UW5A 4LBJA 1VBB2 2A7AA 2RE9A 3T0BA 2BVBA 4HPKB 5DAWA 4EZ4A 1W9FA 2UYBA 2PLV3 3KF5A 5FZGA 3RYPA 1NKGA 4ZKTB 5AFBA 2WA3A 4CEYB 3KT4A 4MGQA 1QOOA 3D0SA 3D5OA 1HKDA 3FLRA 5CZKA 5CEHA 3PVEA 3RYRA 5L7OA 1AYM3 1JI6A 5GZDA 4AFMA 1IPJA 5F7UA 5IK5A 4FFGA 5H9PA 5LRRA 3VBOB 3VDDC 4QB1A 4P9JA 4QB6A 5T5OA 4OLLA 2SBAA 3GCXA 3AMPA 3RPQA 4JX0A 4GZ9A 1LHOA 2H6CA 4Q0PA 1RINA 2UWCA 3GGLA 1CN1A 4J1XA 1QJEA 3KMHA 3CJIB 4R8HA 3NVCA 4COVA 1JN2P 5I8TA 1SLBA 3M3IA 4HVOA 1QDOA 2F6BA 2YB7A 5GZGA 1FT9A 5EQUA 1DF0A 2JIGA 2DVBA 4CXXA 1RC6A 2WZEA 1PK6B 1VMFA 4G4FA 3T2TA 2BWCA 3K4ZA 1W2NA 5KHIA 1OLMA 4CUCA 2W1UA 5GLVA 3JXSA 3Q8CA 5FFOC 1XNAA 1YC61 1UYYA 5FWJA 1Q3EA 4M3CE 5DAPA 2IXKA 2G4IA 4YARA 5IK4A 2P17A 2WFF3 4UWDA 1PVXA 1UMIA 2P3JA 2XHKA 2LUWA 2ZX2A 4A6SA 5DMYA 3FN9A 1ULDA 1QJU1 4A3ZA 3J7HA 2ZGTA 4I2OA 1J3RA 2ZX1A 4K1ZA 5BNOB 4PT6A 2WNOA 4WZFA 1V9U3 3LEGA 4YG3A 3SC7X 3RFRA 5T50A 1YFUA 1ST8A 5LW9A 1UW8A 2VUCA 3O1TA 4L99A 1ZBE1 2XUEA 5JMOA 1CZTA 2JDNA 1KS4A 1GNYA 2QJVA 4XF9A 1Z78A 4CCCA 2LTNA 2IVJA 5FDBA 4XQ4A 5IT6A 1DBNA 1NQDA 5ABJB 4YVWA 2VBDA 3H7JA 3LQCA 1G8WA 4YG0A 5JLVA 1C5HA 3B93A 4FI9A 4KBBA 2WT1A 4ZU4A 2Q8CA 4DXZA 1AF9A 1Y9GA 4RL7A 3VD7A 2BPA2 2Y60A 4H14A 1UL9A 4OUSA 1QMJA 3NNMA 4K6BA 4N53B 1N3PA 1UU6A 1W6PA 4IE7A 2XLAA 2R30A 1BYHA 3IMNA 1LHUA 1N47A 5KXCA 3VBFA 3GHNA 5EFUA 3ZFGC 2WN3A 1VBE2 5A32A 1MS9A 5FZIA 3AP6A 4XBQA 5A3LA 1Q56A 1UOJA 5IUQA 3CQOA 1T6BX 4CZSA 4QPGA 4FFIA 3IDCB 1RUD3 4TSVA 3ZYBA 2VMFA 1XE8A 3UKTA 2VZSA 1ULCA 4Y5TA 1L7RA 3ST7A 3S6PA 4BXFA 2JB8A 5F9TA 4M3CB 4YG6A 1ASJ3 4UFIA 3RMYA 5C8CC 4Y1XA 4YVSC 3H1WA 2JE9A 1S0GA 1QY4A 2HKXA 3ILRA 4YZ3A 5BUVA 3KV6A 1H6YA 3FHAA 4FXKB 1FNZA 2ZKLA 4JRLA 5CKMA 1QNWA 1XSRA 1ZREA 3T0AA 1H6XA 1LECA 1WCKA 1Q8PA 1QHDA 1VP6A 4MGSA 2JJ6A 4BH9A 1BJQA 4YSFA 3VDAA 1AR83 1V6OA 1X36A 2VULA 4YW2A 5KHJA 1XYNA 3N36A 4XXPA 1LGNA 1UX6A 1WCQA 4XYXA 4CDXA 4AQTA 4A41A 4PI2A 2W47A 4LA2A 5FY4A 2YDEA 4RFT0 3VBSA 1LOFC 2DCJA 1UZWA 3IN9A 4W50A 4CCNA 4FPFA 1R081 1XU2A 1LU2A 1K12A 1W90A 5FK7A 2AYHA 5A3TA 1W3VA 3N4MA 1R083 2YFZA 3HVDA 4MH0E 1Q8VA 4LORA 3I3BA 1VAMA 3H8UA 4Y24A 4YNIA 5C3RA 4Y1VA 5F5QA 4GXLA 1CPNA 2C0ZA 5F6KA 2AEZA 2VTXA 2HEVF 3A7QA 2CWMA 2X5IA 5GLUA 2GU9A 3AB0A 2WR9A 4BQ5A 5JSPA 2RM22 4TXWA 3WQ0A 4IEYA 3M8LA 4JGYB 4YRDA 1XPWA 4WM7A 1TMF3 3NJZA 4IGQA 2W2IA 1W9TA 1TNFA 3ZYRA 1WLDA 2P3YA 2XHNA 3OF1A 5LWBA 2D5FA 2GNMA 2VZUA 3X29B 4A42A 4AVTA 4I0BA 3ZYPA 1W8TA 5KWRA 1IG0A 4QQ2A 5KHHA 3VD4A 2ETEA 2XBO1 2XWJB 3APBA 3EB7A 3I2FA 3ORJA 4KGQA 2XBO3 5APAA 2EVXA 3AKRA 3N7JA 3M2MA 2ZGKA 2ZEXA 3O1UA 3NNLA 2VGDA 3N9NA 1OQDA 2GC2A 5JOXA 1C3HA 2PELA 3N9LA 3D3AA 5T3NA 5CAZA 2ZEWA 1VE0A 4Q4Y2 3WDWA 3O1MA 2WZ8A 1GWMA 3G7DA 1DZRA 2HYXA 4IV1C 5F5CA 1UKRA 2B4KA 3K75B 2ZABA 1LEDA 4RS5B 5G04L 2W3JA 3ACLA 4AAPA 5FZOB 1ZM1A 3WR0A 1BEV1 5K8SA 3VBUC 3HT1A 3RG0A 2EIBA 1BEV3 1XNBA 3N9PA 4QHOA 4ES8A 1F5FA 3PHMA 2B46X 4J25A 1UX7A 5FREA 2Y6JA 1FMD2 1RHI2 1W8OA 4Q26A 4BYYA 4Q4W3 4DQAA 3RWNA 3J7NA 4XFCA 4NAOA 5GZCA 3GYDA 1MVEA 4QT6A 5JMCA 1CJDA 3FBYA 1WA4A 2IFWA 2QCSB 1AX0A 3NAPB 5L9BA 3LIGA 4NMIA 3T4HB 4AGVA 5I0DA 1D4M1 5A70A 1ENQA 1WMDA 2WWSA 4IEQA 1D4M3 3RI8A 3TNQA 1V0AA 4NRQA 4ATEA 5KXEA 4AZZA 4YM1A 4AAXA 1GOHA 5KC5A 3ATGA 1Q8SA 3AVRA 1J58A 1W03A 2Q30A 3J26N 4W4ZA 4PQQA 3QD6A 1YXWA 5DZGA 4XC9A 2CU5A 2ZS6B 4V2VA 1G9CA 2WRAA 4COUA 2VTXJ 2JG9A 3RZJA 4QPIA 3LDRA 3DECA 4QQOA 4E27A 1GQHA 2WA4A 4CDUC 1ZRIA 2QTWB 1PM7A 3D0JA 4IESA 4NVPA 4UW6A 5AVAA 4CDWB 4DY3A 3E6BA 5I8YA 2WIIB 3ROUA 2WLQA 2P37A 1WWYA 3IDBB 4UFKA 4LKSA 3SCHA 2JEMA 1HRI3 4M01A 1YNAA 5HCBA 2VZOA 1ZZ9A 2MNGA 2XONA 5JCTA 1VAKA 5CA6A 3UJOA 2ZKNA 4GALA 1MS8A 5EIYB 1ND3A 4P02B 4OZXA 1N1YA 1B09A 1CESA 1LULA 2QQJA 2RM21 3KQRA 2ZGMA 4AVSA 1SFYA 1S0BA 4TLGA 3AXEA 4D6QA 4Z8BA 3LFIA 3RDIA 2B42B 5J1XA 2DBIA 2QZ3A 2GAUA 2D43A 2GH8A 3JUUA 2BOJA 2B8MA 3O14A 4XURA 1X7NA 4RGKA 3POSA 5EV7A 3H1YA 5T52A 3VBHC 1RIRA 3WUCA 1IPSA 3LAGA 3BTYA 1RUOA 4XUNA 2JG8A 2VQAA 1X8EA 3ZFFB 2ADEA 2EF6A 4LIVA 5FZ1A 3DN7A 4YFZA 4ZZ8A 1TEIA 4Q4Y1 4HPKA 4Y4YA 5A1AA 2ZGSA 2E33A 3GZUC 1WCDJ 3O1SA 4U36A 4DOUA 3I49A 4P14A 4CEYA 1EP0A 4RN5A 4QM9A 2D98A 3FZ3A 2B5HA 2TBVA 3DYMA 4LEJA 1LOEA 1F9KA 1ULEA 2BFUL 5IAXA 1C28A 1F15A 1YWKA 1J83A 2VUDA 1T2XA 4CE8A 1XSQA 5L7OC 1HJFA 5CG9A 2VY0A 4NROA 2E32A 3LIHA 1RUF2 4NAMA 2OS2A 4IV3B 1F4AA 4BLIA 4GB31 5A80A 1RHI1 3OPZA 3POBA 4IQPA 4K20A 4UYBA 4GB33 2ZHKA 2FCTA 3WP4A 1JYNA 1AR63 1GWKA 2WS92 1PX4A 4QKDA 1LHWA 4LXLA 1MS1A 5DZFA 4BJ0A 1WLWA 3AYDA 4A7ZA 1YRZA 3NJYA 3CJIA 1DGWA 1DYPA 3ZXDA 5D8AB 1AXYA 1ZZBA 3MPPG 3OBRA 5FCCA 4X8NA 4C0HA 2XH6A 2XKPA 3LB9A 3MV11 1SLAA 4NWVA 3LE0A 2Q0AA 4GWJA 4QDRA 3E6CC 5FZEA 2IWGB 2Q8EA 1S1AA 4JHZA 3U07A 1K5MB 3DXUA 4FPJA 2D6NA 1LAJA 4OHYA 1PK6A 3V65A 4KWLA 2A1XA 3FBMA 1S4CA 3ZXAC 2VMDA 3EO6A 4H7LA 2DFBA 4XJUA 5FPZA 3KT7A 1A78A 4K7JA 2R7EB 1PGSA 5IFPA 3P3NA 4AVBA 1CVNA 4AI3A 3RNSA 2XWBB 2CGPA 2H6BA 1UPSA
chains in the Genus database with same CATH topology
3MIFA 3V64A 2I2SA 2RR11 5BNOA 2R6QA 2RR13 3R4DB 1FV3A 2D6PA 2EA7A 3WP5A 1G86A 2VECA 3FJSA 3OYWB 1PNFA 1PVC2 4HN0A 4PIXA 4XFHA 1JYIA 2WNEA 2IXCA 3ZN6B 3LSEA 2BNMA 3ZN4A 2HEYF 4WV8A 5JIAA 3LSDA 4GA9A 2VUJA 2MEV2 4OI4A 5ABJA 1ENRA 4Q4X2 4YVWC 3U11A 3WW4A 4EV0A 4QGLA 2P3IA 2C5DA 1UN1A 1RTVA 2IXIA 4N53A 4J6GA 5FTTC 3I7DA 3VBFC 4MGIE 1AR92 1QWRA 3AP5A 4ZU5A 1FAYA 1D0HA 1QKQA 2QFEA 4XFIA 4BA6A 3IKWA 3BODA 1JOJA 4QPGC 1G9AA 4KWKA 1RUF1 2HWD2 4Q8LA 3MIGA 4MXVA 4Q1RA 3D6EA 1UZZA 4O9EA 4M3CA 4HSJA 2WS91 3PMSA 1U5YA 3ZSLA 3JD72 1V70A 3ZYIB 3S0MA 3SMHA 1RUG3 4GH4B 4RD7A 5J96B 2YXSA 2LM3A 3CF6E 2QE3A 4JRAA 4XIOA 4COWA 1O4TA 2RS12 2BBVA 1LOCA 2BGCA 1PO11 2UYAA 1PO13 1DFQA 2DCTA 3FLPA 3J8F2 3EHKA 4UBHA 1F31A 5GM0A 4CDXC 1MS5A 3ZXKA 1QJX2 2AGSA 2PAEA 4Q4V2 2TNFA 3WCRA 5BNNB 3VBSC 4AGRA 1ZVFA 4WM8B 2ZCWA 2A6VA 5AC93 3THPA 3FUQA 1H1MA 3BIWE 1VBA2 2BVVA 2XJUA 1ZZ6A 2A3YA 4AFAA 3O0WA 2X5IC 1O3TA 4RQPB 3SCFA 3ZIWA 3FMGA 4FT8A 1PVC1 4RSUA 1LODA 4KH9A 2VU9A 1BBT3 2IXJA 4JGYA 4PJYA 4FP3A 2BNNA 4WM7C 1LOGA 2AENA 2V09A 4ONUA 1XNDA 1FNYA 1MZ5A 4K8FA 1NCQB 3POYA 4Q4X1 1AR71 2HYKA 1R1A2 2ZGUA 3OGGA 1AR73 1C5IA 3N35A 3KGLA 4YW4A 3MLKA 3NV2A 3WQ1A 3B5LB 5C8WA 2PAKA 3OBTA 1DQ0A 2NLRA 4RS5A 1QXPA 1ZA4A 4YM3A 1AR91 3CNAA 5C9AB 2VOWA 2I45A 4XMIA 2V73A 4KWJA 3I59B 5J36A 4K3UA 4EN0A 1HIXA 2DV9A 1AX2A 3VZNA 3FX3A 2XLGA 5EYXA 3KD4A 2NP0A 2HWD1 1WMFA 2ZGQA 4AI1A 5KC6A 3T1MA 3WP6A 2DVDA 1UPIA 4LA3A 1NQJA 2Z69A 3MEPA 4R9AA 3NAPA 4XETA 4B7KA 1H8TC 1MZEA 1XE7A 4ES9A 3JD71 3NV1A 3VZOA 4BIOA 3OTFA 4LBQB 2FQPA 3VZLA 2HWB1 5FRAA 1Y7BA 3LOBA 2WNVC 1QH7A 2HWB3 4R9DA 3UKVA 2FBEA 2RS11 2YZ4A 5SV5A 3QH6A 1PMIA 1COV1 5LK7B 2PLV2 1COV3 3J8F1 4MSVA 1LTEA 2GSYA 2JG9C 4QPIC 4SBVA 4E4DX 3NSTA 4FPKA 1QJX1 4G9SB 4G3YC 4CDWA 4Q4V1 3AK0A 1J59A 4HBNA 1VJ2A 3JU9A 1AYM2 2CY6A 3M1HA 5BV6A 1NG0A 2OW4A 2YYOA 1VIWB 4Y5Z0 1BVP1 1EPWA 1AYN1 1VBA1 3IDEA 5J48A 1DQ4A 1VBA3 1AYN3 1HDKA 2JDZA 2ZJCA 2D6MA 4N43B 3WP3A 4S2FA 1EAH1 4BE3A 1ND3C 2BNOA 1EAH3 2JE7A 1WGPA 1G9DA 1XNKA 4FQ4A 2JKBA 3D4KA 4QQPA 1W39A 3WINE 1LOAA 2EXHA 5GALA 4YZ1A 4XJAA 2X8KA 1EV13 1MEC3 2PA7A 3WXPA 1CPMA 5CADA 1RVF3 2JG8C 3RMXA 4HT1T 2WINB 3EXUA 1ZZ7A 3BTAA 1YIFA 4FPCA 3FFQA 2WFF2 1QDCA 2YHJA 5LRSA 2E51A 1OFSA 4CEYC 5BY5A 2JICA 3B02A 3B7MA 4D7YA 5K0UB 4MUVA 4IETA 2DTYA 1F5JA 3DPRB 2XKOA 4LLFA 2WC2A 1V9U2 3SXWA 4MXWB 2WZPP 4B4RA 3VBOC 3VZKA 1OLRA 1IS3A 4IV3A 4GIQA 2GN3A 3WDVA 1QOSA 4DFSA 1LJ7A 3CL1A 1O3QA 2VW2A 4JCKA 4PQ9A 1QOTA 3AMQA 5D8AA 3CJIC 4CP0A 1UZYA 4IXLA 1H8VA 3ZPYA 2A70A 5CU1A 2OYZA 1FOD3 1YHFA 1I3HA 5DG1A 1K5MA 1WD4A 2R073 2VOXA 3KGZA 3HWJA 1SEFA 1ULFA 2H0VA 4LHLA 1PK6C 4CP2A 2V5YA 3LOIA 3AKTA 2YGMA 1C1LA 2PLV1 1DZQA 3AKSA 4Q27A 2VNRA 1AYM1 1RUD2 1RUJ1 3MF6A 4D7TA 3MF9A 1RUJ3 3KS7A 2ZHLA 3VBRB 4FP2A 4RHV1 4QM8A 4RHV3 3M3QA 4XBLA 4LULA 5BNOC 1OMIA 3KB5A 1ASJ2 3OYWA 1YJKA 4FAHA 5C6CA 5CFDB 4XF0A 1H2NA 1QJY3 2VOKA 3ZN6A 1DHKB 2GMMA 2ILMA 4GMP3 1LEMA 4LBKA 1JXNA 2WKKA 3ALQA 5J3UA 2XL7A 2VVEA 4NWWA 1OOPB 4L92A 1AR82 2GC1A 3BCWA 5ABJC 4PLOA 2QNKA 1OKQA 4XFAA 4I0AA 3HN1A 1CGPA 4JAAA 3AX4A 2ARXA 3H0OA 4N53C 2OVUA 4P9LA 3S7IA 2UWBA 1LGCA 4LUKA 3ZYJB 3UL2A 3MGUA 3VZMA 1R082 2WFF1 4Q0QA 5E8AA 4NOTA 4I3GA 2DFCA 2RS53 3CLPA 4N7UA 3LGRA 1NA1A 2XGXA 2Z5WA 4H55A 1BMV1 1O3RA 1V9U1 3V56A 1B35B 5HBAA 3O5SA 1CR7A 2O1QA 4UXAA 2WZR3 3ZO0B 1TMF2 3AJYA 4A3XA 4GWMA 3SH4A 3FE5A 1DG6A 4XTPA 2BQPA 2FMDA 4Y1ZA 1HW5A 2UY8A 5HI0A 4GH4A 2XBO2 2GMPA 1WUVA 4OHVA 4LBLA 4CRQA 2VUAA 4NPRA 1WW4A 5D1IA 1JYCA 3QBQA 5IK7A 4EN8B 2QZ2A 4HK8A 2JXAA 2YY1A 2ZHMA 1I5ZA 2Q8OA 5BNNA 4X6QB 3E6DA 4EWEA 4BPZA 4WM8A 4AFCA 1GZWB 4HANA 4ISRA 1BEV2 1G6NA 3TB0A 2MPFA 5GLTA 4NHLA 1RUD1 4AK3A 4LO4B 5JOZA 4L8QA 1C8M3 5A33B 4Q4W2 4HSLA 1LHNA 3HIFA 2PFWA 4X8PA 4RQPA 4GWNA 3SITA 1ASJ1 1SMVA 4FAGA 4URTA 2GALA 4KL1A 4JGYC 1D4M2 4ASLA 4JVAA 5L73A 2K2SA 1W0OA 4AHZA 2DCKA 4S2GA 2ARBA 5DDJ3 1NCQA 2R062 1AR81 4JQRA 4BHPA 1TME3 3KCCA 1NE4A 5ACA3 2OUJA 3KM5A 2Y26A 2CTVA 2Q4SA 3VKFC 1S55A 4QMAA 1POV3 3AFKA 4J1WA 4C1XA 4FPLA 2VQ0A 3DF0A 4BOWA 4DNYA 4XMAA 2WNUB 2FMYA 1H30A 4RS5C 5FOBB 5C9AA 1HRI2 4TZDA 1LRHA 1F8VA 1GR3A 3I8TA 3I59A 2VNGA 4BWOA 1FATA 1VB4A 1PGL1 4LR4A 5BNQA 3MIHA 2VPVA 4BM8A 3VHNA 3H7YA 3DV8A 1TMF1 1TE1B 4CYDA 3NAPC 2DWRA 3AZYA 3JCIA 1FPN1 2Q1MA 3ECQA 1FPN3 5JIUA 2E63A 3PJYA 1OA3A 3E5UA 4LBQA 1NCRB 3B00A 1H1IA 3ES1A 3LA7A 1IHMA 2ZGNA 5FO9B 3ZXLA 4R52A 4XEZA 5E1RA 4I09A 4CP1A 4CDWC 2PYTA 1RUC3 1IS5A 1H2KA 1ZNPA 2DU0A 1JHNA 4CEWB 3ETQA 1QQP1 5H9SA 4LBMA 1QQP3 1GQGA 2GDFA 4JGZB 4QGMA 1RUI3 4GB32 2NMNA 4Q4W1 4LBOA 4N43A 1AR62 3EBRA 4Z2WA 1U5ZA 4A2UA 4LO7A 4AQ6A 5FO7B 4YZ4A 2X29A 4XXAA 3U0ZA 4C91A 3H3UA 4PIZA 3R4UA 2XJSA 4R9CA 3PTYA 1PZ7A 3QOPA 1NXMA 2GZWA 3VHPA 2R061 1BVVA 2P34A 4AEDB 1ENXA 4L11A 2R063 1V6IA 1CAWB 5FLJA 3ZFFC 5EZWA 1JW6A 5FAXA 1URXA 2VW0A 2Y38A 2XJTA 3LKJA 2WQZC 3LWCA 3ZSKA 3VL9A 1M06G 3NKTA 4B3NA 1YFWA 3ZXGA 2A6YA 5CBLA 3I2DA 5K0UA 4MVTA 3VN4A 4AQSA 1ZX5A 1FX5A 1H2MA 2CYFA 1HRI1 3RYKA 3DPRA 2RR12 4QHBA 2UWAA 2X53S 4MXWA 2HWF1 4UW3A 3TWIA 3AYCA 1YFXA 5CB7A 2HWF3 4IL7A 4IV3C 1RUE1 1RUE3 4X6RB 2BEOA 2ATFA 1BZWA 1GNHA 4MLOA 1POV0 2EALA 3WG2A 4B4PA 1CD3G 1OD5A 1V6JA 4YFWA 4RR3B 3EJKA 5D8AC 1PGW1 2CAUA 4D7SA 1I1EA 1O5LA 2FHRA 2DVAA 1JH5A 4Z07A 1H0BA 4L9BA 1K5MC 2DU1A 5J37A 2XJPA 3WG4A 5AFEA 2PHTA 1S2KA 2XLFA 2ZBJA 3RRDA 4AYUA 3BB6A 5J09A 1SLTA 5H9QA 1C4RA 1L3JA 5BNPB 2W68A 3LCPA 2R0HA 2A3XA 1HXS1 2PAMA 3KCXA 3VBRA 5KHGA 1HXS3 4AVCA 4JTNA 3MZHA 5C4WB 5CG8A 1VR3A 5GZEA 3G6JB 4KQ7A 3TAYA 3AMHA 1AR61 2DUQA 5CFDA 3ZXJA 2XVLA 2JX9A 4D3WA 3KSCA 1V6MA 2HJIA 2ZTNA 2B9UA 3N7KA 2VMHA 1PZ8A 2XJRA 1RUG2 3HD8B 4FXGB 1OOPA 4XILA 1PIV3 1AXKA 5EWSA 3SCGA 3CO2A 3B9IA 3WW1A 1PO12 5A3MA 4P9YA 3GBWA 3W58A 2ET1A 1GNZA 4FOVA 2W08A 1JTZX 1LCLA 2TUNA 5FQ0B 1Q5OA 3MIBA 2VXRA 5IK8A 1IQAA 5AC92 2N7GA 4P5HA 3IT8A 4XZPA 4TYSA 2W0XA 2R042 4OHZA 5B2GB 4AHYA 2DTWA 1V6KA 3KCYA 3DL3A 3VBHB 5SV8A 2A5ZA 4HKOA 3TYJA 1B35A 1WBLA 3JB4C 3RJRA 1W6NB 2A3WA 4Q29A 1BBT2 2FZ2A 4B29A 1SDWA 1WW5A 3THTA 1JUIA 2K9ZA 4XDQA 2Z2SB 1DIWA 4HZFA 1HV1A 2XJQA 4Y1YA 4FO9A 1GLHA 1VALA 3M3CA 4GH4C 4IERA 4OVEA 5FMOS 1AR72 4IEVA 4Q0VA 3ZXFA 3WHUA 4YGEA 1CX4A 1E57A 1ND2B 4Q8KA 2ZACA 2FZ1A 3MW3A 4PLMA 1GKBA 1UKGA 3DGTA 1O91A 3GBFA 4PCRA 5BNNC 4ZU7A 3NV3A 1GZWA 3HBZA 4WM8C 3VKOA 4H3WA 5GZFA 5JZGB 1NA1B 1D2QA 4KNCA 3WD5A 5A33A 1GFF2 2MHFA 3ES4A 3VUOA 3VKNA 2ZZJA 3VHRA 1LGBA 2D6KA 4RQPC 4WVZA 2RMU1 4I01A 3LA2A 2ES3A 2HWE2 2QKDA 1YYNA 2RMU3 5BPXA 3WX5A 4W6WA 4B4QA 4YZ5A 1NYWA 2E7TA 3K51A 2R1DA 1RUG1 1ZBA1 4F7ZA 5AVPA 5T5PA 1ZBA3 2D7FA 1H4GA 3NV4A 1NCQC 2HWB2 4V1PA 3L2YA 1YJLA 2IC1A 2NQYA 1H9WA 4I30A 1COV2 5HCFA 4Z82A 4YM2A 4AGGA 1D0GA 2XG3A 1NY72 2D40A 5DZEA 3B3QE 2WNUA 2Z42A 2ZGPA 4IEPA 4PIYA 5AC91 1DQ1A 4MGKE 1H1AA 1V6LA 4XJ8A 2R041 2PN5A 1KDMA 5C9AC 1S0CA 1ZRRA 2A6WA 2R043 2SLIA 4KG0A 3WHTA 4EN7B 4HL0A 1AYN2 2EXKA 3M3OA 4FCAA 4OFGA 4XW3A 1Q8QA 1NOVA 4TWTA 4BIFA 1PNGA 2C1FA 2I07B 2CAVA 3AZVA 2NPIA 1EAH2 2PHDA 3LZZA 3QLQA 1BBT1 4PLNA 5CFCB 3O12A 2W52A 3ME2A 1TNRA 1OQEA 1WBFA 4AHXA 1VLNA 1H9PA 2B7YA 3PVBB 3SH3A 1OQ1A 3RS6A 1EV12 1MEC2 2D3SA 5I0RA 1NCRA 1RVF2 3MFCA 4AQ2A 4DY5A 4EROA 1DYKA 1U12A 4NHMA 3ZMOA 3HQXA 1VRH3 4PBPA 3SH5A 3WLUA 4DMIA 5K7PA 1I6XA 5HXVA 3WUDA 1GZCA 3WG1A 2GC0A 1UD1A 3BALA 1TQ5A 3SLIA 1U5XA 3S7EA 3WCSA 1AJOA 1QU0A 1REFA 3MLJA 4QPYA 1H2LA 4W6YA 1A8MA 3AP9A 4QU2A 2ZMKA 2WFPA 4LHNA 1UU5A 2E7AA 1MQTB 1CAXB 3N7MA 4CEWA 2GH2A 1KRIA 1BCXA 1KQRA 4XQDA 3BOPA 3WW3A 1HQNA 4JGZA 4AF9A 4N43C 2ZMNA 4A7YA 1GYKA 2A75A 1QGLA 2HWE1 5F1RA 3ZSJA 2HWE3 4UW4A 3FC0A 4Q1PA 1FOD2 2R072 4L2NA 2UU8A 3URFA 3U10A 4AEDA 4WZCA 2PHFA 2R49A 1CAWA 3OCPA 3PMEA 4P9WA 3IPVB 4R4XA 5JOWA 2ZMLA 1Z7S3 1N1VA 1S0FA 1YUDA 1NY71 3E97A 4TLFA 3ASIA 4M0NA 1RUJ2 1HRV1 4PBOA 5K0UC 4OULA 1HRV3 2RS31 4RHV2 1O3SA 1GZ9A 3PLQA 1UIKA 2RS33 1XYOA 3DPRC 4WVMB 3FWEA 1BXHA 1VBD2 3QCWA 5H9RA 4U2AA 1QJY2 3OJBA 1BKZA 3HT2A 5C33A 4NO4A 3VV1A 4XJZA 4DS0A 3S30A 4FPEA 4D69A 4RR3A 4YW5A 2VVDA 2OZ6A 2YMZA 1EV11 1MEC1 2DCZA 4DRVA 2XUMA 1RVF1 2DURA 4BZ4A 4LUMA 1AHSA 1OHFA 1W6OB 3AYEA 4DRRA 5JR7B 4C90A 4AVAA 1HQLA 3H1MA 1AL23 1EYBA 5J7MA 1H8TB 3B94A 1Q8OA 3KZ4C 2RS52 2IZWA 5BNPA 3WOGA 1X50A 4UBGA 4CDQB 4XFBA 1BMV2 3VBRC 1APNA 2QVSB 3GF6A 1IOAA 2CGNA 5C4WA 2WZR2 3AYAA 2IFRA 1CIWA 2ET7A 1AJKA 4QQLA 5CFDC 4GULA 4GKYA 1SCSA 1BK1A 2R0FA 2F4PA 1CJPA 4W65A 2OIIA 2ZAAA 2BW8A 1RUH1 4KU7A 2KA3A 1OOPC 1CAVB 1MZFA 1RUH3 3GNEA 3USUB 1FOD1 4AFDA 2GMEA 2HWC2 2R071 1RMU1 3VZJA 1RMU3 1D4VB 3MW4A 4HMZA 3MLLA 4MYEA 1HQWA 1HV0A 5DUVA 5FQ0A 1JUHA 4FBFA 1YO8A 5I0TA 1PZ9A 2YROA 3POWA 3U4XA 3WDXA 1LHVA 3O0VA 5FO8B 1C8M2 3VBHA 3IM0A 3R0RA 2E53A 2NM1A 4JTOA 1F2NA 4Y20B 1B35C 1VBD1 1W6NA 2E9QA 3AKPA 3J9SA 3D8CA 1VBD3 4LHKA 1QJY1 4ASMB 4GMP1 1O4ZA 2OUHA 1S2BA 4EWDA 5DDJ2 4HETA 3ZIXA 2QDNA 1TME2 2WT2A 5ACA2 5EYYA 3JZVA 4LLOA 4XPVA 1ZRDA 4F3JA 1MS4A 1RJ7A 5L36A 3AP4A 1ND2A 4PDWB 3VHOA 5JWPA 1WW6A 4HVRA 2DCYA 3ZSMA 2B39A 1KS5A 3ZFEB 3J4UH 4N9IA 4RGGA 1J1TA 3SHRA 2DUPA 5CIRA 2RS51 2ZHNA 4K21A 1IGOA 3E5QA 4Q0SA 5JZGA 3TN91 3WDYA 3AZXA 2C9AA 1PGL2 3TN93 1XNCA 4YGCA 3V0BB 2W39A 3AZZA 2WZR1 1LOBA 4KGGA 4H7MA 2DVGA 4OI1A 1VAVA 3WNXA 1W2UA 1FPN2 1XU1A 3KT1A 3M3EA 2CNAA 4Z1VA 1G9BA 5T5LA 5T55A 3USSA 3N7LA 1A3KA 3E5XA 2HWC1 3VDDB 1QJU3 4XFGA 2CWSA 2HWC3 4JDMA 2D97A 3AXDA 2RJLA 2O8OA 2PHXA 4Q0UA 2A6ZA 2QQPA 3CEWA 1KITA 1FXZA 5E89A 4ISQA 3ZSEA 1ZBE3 1RUC2 2VG9A 3TNPB 1LU1A 1OSGA 2WNUC 4P9IA 1XQNA 2PHUA 1G7YA 1QQP2 3B01A 1EY2A 5T5JA 1SLIA 1C8M1 4QQHA 1RUI2 2ERFA 1AXZA 1W6QB 1R091 4AI8A 1S0JA 4R4ZA 1R093 5I91A 4AW7A 3RJ2X 3VKMA 1WW7A 5CFCA 2DF7A 5J98B 2TEPA 1VBB1 4AHWA 4K9SA 4M0HA 3M4FA 1VBB3 3TOJA 4QD2A 3JBG2 1DZTA 5DDJ1 2I74A 2JD4A 3B69A 5BYNA 1FYUA 1TME1 2PHRA 5ACA1 4A7KA 2R1BA 2WSVA 4I3PA 4XQWA 2WQ4A 3FLTA 1NCRC 1M4WA 1X8MA 2XPJA 1POV1 2Y0IA 1D2SA 3OD0A 4Y22B 3NKGA 3MW2A 2DYCA 1MS3A 2WT0A 2EXIA 1GV9A 1DQ2A 1Y9QA 1KJRA 4YW3A 3H9AA 4N90A 4XHXA 3GHMA 5JDBA 4LT5A 1SQ4A 4DINB 4E2SA 4NHKA 1MQTA 1CAXA 1OFNA 3O0XA 4BMBA 4D94A 3W9AA 1ZZ8A 2WSUA 4GMP0 4CEWC 4XJ9A 2D44A 2HWF2 4AI0A 4M3CF 4JGZC 2CL2A 1RUE2 1GANA 3UV9A 2RJKA 2O8QA 3GZTB 3RQ0A 4Y26A