2B8MA

Crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
b'GMIEKVYEFKRDAKTKVVEKLVNTEHVQINHIVLPRGEQMPKHYSNSYVHLIIIKGEMTLTLEDQEPHNYKEGNIVYVPFNVKMLIQNINSDILEFFVVKAPHPKKLNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (1499583) from METHANOCOCCUS JANNASCHII at 1.70 A resolution
rcsb
molecule keywords Hypothetical protein MJ0764
source organism Methanocaldococcus jannaschii
molecule tags Unknown function
total genus 21
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b8mA00
2PHDA 1YFWA 4XF3A 1GQHA 1PMIA 1QXRA 1J58A 5EZWA 3HIFA 3MZHA 3SCGA 2CAUA 1G6NA 2ETEA 4I2OA 3FZ3A 2Z2SB 2ZKLA 1Y3TA 2B5HA 4I02A 2BNMA 2K0GA 2IXHA 1FT9A 3GBFA 3RYKA 2H0VA 4UBGA 5BXXA 4TLFA 4R8HA 4BYYA 2D5HA 5KBFA 1OI6A 5JCTA 4BHPA 4YNIA 3ETQA 3U10A 3MDPA 3CF6E 3DL3A 1O4TA 1J3QA 1ZX5A 4KWLA 3KCCA 2O8QA 4IEVA 2OZJA 1UPIA 1L3JA 4HMZA 4QGNA 3S7IA 3KMHA 2QDRA 5I0SA 1ZRFA 1CAXB 1ZREA 5KHGA 1NE6A 4ZU5A 2FMYA 3E6BA 3M3IA 2FQPA 3ES4A 3H7JA 4IEPA 4FAGA 3SXWA 3LZZA 3BU7A 3WW1A 2CV6A 4ZU7A 4L2NA 3CO2A 2UY8A 4HN0A 1RUNA 2IXKA 1DZTA 4LLOA 3RDIA 2Z69A 1X8MA 3DKWA 3LA3A 1ZZ6A 4Z07A 4QGLA 3H1MA 3G7DA 4WVZA 4LA2A 3U0ZA 3SMHA 1XE8A 3NSTA 1QY4A 3BCWA 4Q0SA 2H6CA 4IERA 3UKVA 4OLLA 3LOIA 1SQ4A 2Y0OA 4N9IA 2CGPA 2EAAA 2ATFA 2XLFA 4IEOA 5KHIA 3KGZA 1WA4A 4NVPA 1IPKA 5CU1A 4J1XA 4IEXA 1J3PA 3H3UA 4HSLA 5JSOA 4UBHA 4WBBA 4D7TA 3E5QA 1QWRA 2BEOA 5JSRA 2P17A 2DCTA 4YSFA 1ZZ9A 2IXJA 1DZRA 2UYBA 3S7EA 4QMAA 4XFHA 3SCFA 4JVAA 3USSA 2QVSB 3TNPB 4RD7A 4QGMA 4P9GA 1CAWB 3L2HA 2F4PA 4PIZA 1NXMA 1O5LA 3I59B 2O1QA 4X6QB 4HBNA 2VECA 4MV2A 2PA7A 2IXLA 1QXJA 4MGZE 1O3QA 1O3RA 3FWEA 5CVRA 2Q4SA 1X82A 4E2SA 3HT1A 2OYZA 1SFNA 1UIKA 3ROUA 3N4MA 5LRSA 1ZZ8A 1RUOA 3RNSA 4IESA 3H7YA 3E5UA 1RL3A 1RGSA 1EPZA 3I7DA 4R52A 1RTVA 1ZZ7A 1LKNA 3R6SA 3WW3A 1CAWA 2PAEA 4LUMA 4XFGA 3EO6A 2V09A 1RC6A 2GZWA 4JTOA 4Q0VA 5EFUA 4META 4HSJA 4E2GA 5JAXA 4IEQA 3E6CC 3E6DA 1H1MA 2B8MA 3I54A 1UIJA 3LA7A 2D93A 3FHIB 4QM8A 5FDBA 4KL1A 4YRDA 3UKTA 2PAMA 2MNGA 3OGJA 2PYTA 4N9HA 4AVCA 4PIXA 1H1IA 2WFPA 5FPXA 2QNKA 2ET1A 3PVBB 1EYBA 4EWEA 1U12A 4XF4A 1O3SA 3BB6A 4A2UA 4HN1A 1JUHA 4D7SA 2GU9A 4AQ6A 4KWJA 1ZNPA 2MPFA 3WW2A 3SCHA 3SHRA 4XF1A 1PM7A 2PTMA 3D82A 3PLQA 1XE7A 4LA3A 4ORFA 4MGKE 5FCCA 1I5ZA 2GC3A 4QXKA 2GC2A 2H6BA 4OFGA 1YWKA 5BV6A 5I91A 4FAHA 3GYDA 4HVRA 2OA2A 1CAXA 3UKNA 4WZCA 3DN7A 1IPJA 4KU8A 1J3RA 4EROA 3BPZA 3OCPA 3E97A 1YFUA 3RYPA 3M70A 4H7LA 2KXLA 1CAUB 5LRRA 3MPBA 5LEJA 5E16A 5FQ0B 5C8WA 1OFNA 4Q29A 4XETA 1VR3A 2XLGA 3MYXA 1X7NA 5FLHA 4AXOA 4LEJA 1YLLA 2Q30A 2XKOA 3QOPA 2BNOA 4MX3A 5FLJA 2BGCA 2WC2A 1DGWA 4K8FA 2PAKA 1LRHA 1YFYA 5BY5A 1FI2A 3ZDSA 3LA2A 2BYVE 3H1YA 3H3ZA 3ES1A 5C6CA 4KU7A 4B29A 1OD5A 4XEZA 2OPKA 5FQ0A 2N7GA 5T3NA 2ZCWA 1YHFA 3IBMA 5D1IA 2Q1ZB 4IEUA 1I6XA 2OZ6A 5KHKA 2GC0A 3B02A 4HVOA 3FX3A 1ZRCA 1NYWA 3IIAA 4IEZA 3CJXA 1NZCA 3RZZA 3LWCA 1UW8A 4ONUA 4F7ZA 4Z82A 5FLIA 2VPVA 3CLPA 2PFWA 4JTNA 4PJYA 4MH0E 3D0JA 4XF0A 1LR5A 4ZU4A 4KWKA 4BH9A 5I8TA 4YYOA 4Q0PA 1VP6A 3EBRA 3H8UA 4E2QA 4IEWA 3I59A 4BIFA 3IWZA 3DV8A 3E5XA 5BUVA 1ZZBA 5E1RA 5J7MA 5K8SA 3CL1A 2EVXA 3HQXA 4AVAA 2E9QA 3S0MA 1X8EA 2GAUA 3TNQA 2XKPA 4LUKA 1CX4A 4GULA 2PHLA 1NE4A 2XLAA 4PIYA 4XFAA 3O14A 4LTAA 5I0RA 1J59A 4MUVA 3FE5A 1DGRA 1EY2A 3HT2A 1O7FA 4I3PA 1OMIA 5HI0A 3OTFA 2IC1A 4X6RB 2D40A 4XFIA 5J3UA 3EQEA 5AVPA 1J1LA 5I8SA 3C3VA 1SEFA 3WW4A 3NJZA 5CADA 2BNNA 1LB2A 2XL7A 5I8YA 3RYRA 1XRUA 3LAGA 1GQGA 2UYAA 5JSPA 4EV0A 3H1WA 2GH2A 5FPZA 2PQQA 1ZRRA 4QX5A 3PNAA 4Q0QA 4DINB 4Q0UA 1UD1A 2I45A 2ET7A 3IDBB 4MGIE 2GC1A 4HZFA 1O5UA 5I93A 2B9UA 4I0AA 3NW4A 4IEYA 1EP0A 4F8AA 4I0BA 4CYDA 4HLTA 4XFBA 3VHRA 4UXAA 2C0ZA 3FJSA 2IXIA 3U11A 1CAVB 2HJIA 1FXZA 2XL9A 1Q5OA 3IDCB 4JV4A 4LULA 1O3TA 3QACA 5I0TA 2EA7A 1CGPA 1WLTA 1V70A 3BALA 4EWAA 3EHKA 3OD0A 3H50A 3FFQA 3H9AA 3ACLA 2Q0AA 2UY9A 2QCSB 4XFFA 4MZUA 4J1WA 3JZVA 4I09A 4I01A 1ZVFA 3NKTA 2XHKA 4IETA 3NVCA 1Y9QA 1CAUA 3ST7A 5I0UA 1CAVA 1ZZCA 4MGYE 5KHHA 4YARA 3EJKA 1ZRDA 5BPXA 1UCXA 3OF1A 4O9EA 2IXCA 2VQAA 4AVBA 2XGXA 4FBFA 4FT8A 2MHFA 4EWDA 1YFXA 1Q3EA 1VJ2A 3ELNA 4L11A 4O9GA 4HVQA 5LEKA 3KGLA 5KHJA 2HKXA 4XFCA 1HW5A 3CEWA 4AQ2A 4XF9A 5JR7B 1TQ5A 5F1RA 3NL1A 1WGPA 3KSCA 5J48A 2CAVA 3RPQA 1YUDA 2D5FA 3D0SA 2QJVA 4QM9A 1Q43A 2K9ZA
chains in the Genus database with same CATH superfamily
2BTVC 1W3VA 5HCBA 5GZCA 5FZAA 4XF3A 1W9YA 2A7AA 2D6NA 4LHKA 3VKFC 1H0BA 1CR7A 4ATEA 4G3YC 4NAMA 5DDJ3 3TEWA 2VAUA 3O1TA 1UY1A 1D0HA 5FYTA 4C1WA 2JD9A 3NRUA 1GZWA 1PIV1 5CBLA 2UWBA 3RZKA 5EJZB 4JX0A 2Z2SB 1NZIA 2B5HA 2WAAA 2W1QA 5FZBA 5A3UA 5BNQA 2AC1A 2D7FA 4CEYB 1C8NA 3DECA 2IXHA 2HWF1 3RYKA 4OMDA 4B7KA 2IZWA 5FZEA 2J22A 1S0IA 2QQVA 1OI6A 3JU9A 3FMGA 2ZPXA 2GNMA 4Q4X1 4URAA 3DXTA 1COV2 2G1MA 4D0QA 2VZQA 3CF6E 4OZXA 4CSWA 3LD8A 2ZACA 4E4HA 1J3QA 1ZX5A 4WM7C 5KXCA 4UFLA 2W1WA 2QE3A 4HANA 4IEVA 1PGSA 2OZJA 4UFKA 4WVWA 3WSOA 4HMZA 3N9LA 4QGNA 4XURA 1HRV3 1L7QA 4LITA 2QQPA 2WO7A 1RJ8A 1W2NA 4FFIA 1TMF3 5G05L 3VD9A 1IPSA 4V2VA 1C8M2 3MFAA 1ZRFA 2VCCA 1SG3A 1LOBA 3PDQA 1NE6A 1JZ7A 3E6BA 3JUUA 4P9JA 3M3IA 1VLNA 2FQPA 4K6BA 2CDOA 5F39A 2DTYA 3H7JA 3I2DA 3O1UA 2WS92 4MSVA 4WM8B 1R1A2 4AAPA 3AYEA 3TRSB 2JG9B 3U37A 3PVNA 4PI0A 2WA3A 4ASLA 1O91A 3CDZB 3MI8A 1PVXA 5A7WB 2TUNA 1OPMA 3O0VA 3WP3A 1XQNA 1IS4A 4HN0A 4JDOA 1GANA 2ZMNA 4W6YA 1SCRA 4A6SA 2XBO2 2JECA 5CEHA 2VNRA 4QX1A 2PHUA 4NIIA 3SKJE 3DKWA 4QGLA 1OT5A 1GP6A 1KQRA 1W6OB 2BP6A 2P1BA 1GFF2 4LA2A 2EIGA 4GXLA 5HCAA 1UWWA 3WD5A 1PO22 1E5HA 1JZ6A 1ENXA 2NM1A 2J1TA 5FPVA 1F4HA 2ARAA 2XJPA 2JG9A 4D94A 3V65A 4OLLA 2VMIA 2VMGA 5CB7A 5IVCA 2P3JA 1XNBA 1SQ4A 2RR13 3KHCA 3JXSA 2XLFA 3UGHA 5FZ9A 3O5SA 4NVPA 5GZEA 5CU1A 2X5IB 2V4AA 3LFMA 4XABA 5A7SA 4QDRA 1O4ZA 4C0BA 1RUD1 4W6XA 2WUHA 4D7TA 5B4NA 2XQXA 1VBB1 3GM8A 1E5IA 4FPYA 4JGYB 4KG0A 4L97A 4N8MA 1OVPA 1DQ6A 1S55A 3VHOA 4P9YA 2P17A 5IT6A 5JSRA 2DCTA 4E9KA 2OIIA 1SLCA 1LU2A 3KV9A 5H9PA 1LCLA 5EV7A 4AFMA 2UYBA 2JIGA 4UW5A 1W8WA 1W6OA 4FTBA 3GHMA 3CBNA 3NV3A 1X33A 3WX5A 1NY72 5ERLA 4C90A 2XVKA 3AVRA 4MGSA 1AHSA 4IE5A 5JDBA 3OY8B 3USSA 5H9SA 3ZVXA 2V72A 3HN3A 3FLPA 3WR0A 5C71A 5FP7A 3WCRA 1LHVA 4RGAA 1OBNA 1SBDA 4IQPA 1RUG2 3L2HA 1GU3A 1GLHA 3R4SA 3UT0A 4B4QA 5ACA1 4XCAA 2ZEWA 5F3GA 4X6QB 4HBNA 5LBFA 2YPJA 4MV2A 2PA7A 2IXLA 2X5IA 2X8KA 2E53A 4LKEA 4QKNA 5ISLA 5IK7A 1JYIA 4PF5A 4MGZE 3BOPA 1AR83 2VZ3A 4JGYA 4AI9A 1ND3B 1OQEA 2OYZA 1SFNA 1ZBA1 2DDUA 1QIQA 1CJDA 4ITCA 1PZ9A 1RUJ2 5JXJA 1UMHA 1OOPB 1UO9A 1RUOA 3W9AA 4YW6A 3MGUA 2FMDA 1VBD3 3LFIA 1DU3D 1RL3A 1ZBE3 3OY8A 1QJX3 2IVJA 2BERA 3WG4A 1XBFA 4B8EA 4NAOA 4CDXB 3VLBB 4WZFA 3ZYRA 1LKNA 3NKGA 1RUH3 4FPHA 3AFKA 3WF2A 3PU3A 4LUMA 3OSDA 1FAYA 4YW1A 4ZY9A 2ZTNA 4RGGA 3ZN4A 5FY4A 4JTOA 1OVSA 1SLAA 2JDNA 1V6LA 3IAPA 1PGL2 4E2GA 3WP4A 5FZ7A 3NNFA 4IEQA 3E6CC 1H6YA 1ND3A 1VBE2 2ZX1A 1ZA7A 2ZGKA 4TXWA 1KEXA 3LA7A 2D93A 2BWCA 1VBC1 2YFUA 1EV11 1E57A 2XWBB 4CP1A 5FDBA 1SLBA 2WZR1 3PUHA 1WW7A 1STMA 3CQOA 4FCAA 4Y22B 3UKTA 2E33A 3USUA 3LPGA 1MS3A 4LKDA 1BMV1 5A80A 2MNGA 2DVGA 1YC61 1UMIA 2PYTA 4Q4V1 4CDXA 4TTGA 1QNWA 5BNPB 4C8DA 4QQ2A 4EWEA 2JG9C 1TME1 4R9DA 3BGAA 1DQ2A 5FPAA 2XH6A 5B4XA 1GV9A 2A71A 2MEV3 5A3PA 2RS52 1JUHA 2ZHLA 4XJ8A 1AYN1 2JE8A 3AXEA 1CZVA 2WBKA 4AQ6A 4D7SA 5EJ1B 4LHSA 5F3IA 1YQ8A 3ZSEA 5JUVA 2BGPA 1SHWB 2YC4A 4KGGA 4BLIA 1XNKA 1HIXA 3VBSA 1FNZA 4CXYA 2Y8KA 4QX0A 4DQAA 1LJ7A 2GC3A 1D4VB 4NROA 2H6BA 4Y22A 2A6YA 2BGOA 5I91A 3GYDA 3J26N 4A3ZA 4LBMA 3ZFEB 1PGW2 2Y38A 4H14A 2ZX2A 5DXDA 2JJ6A 5FKBA 4RQPA 1IPJA 3AVSA 4XTMA 4LOTA 3OPWA 1N1VA 1HDKA 1QOOA 2R041 4Q4Y2 1VBA2 2VZVA 1RUC3 4UAPA 5BNPA 1IS5A 5LCWL 3GZEA 3AYAA 2BDRA 4JHTA 1F5FA 4Y4RA 1VPHA 2VC9A 2QDNA 1YFUA 2WIIB 4BA6A 5A70A 4CUGA 4YGBA 2CL2A 4ZXEA 3OBAA 1CAUB 1R081 3CKHA 5LRRA 5SV5A 4C91A 2Z5WA 4G4FA 1D4M2 2X5IC 3WUCA 1PM4A 5LEJA 5FQ0B 5LBEA 4ZPIA 2AREA 5IW0A 2P6CA 2PHFA 3ZYJB 4JGYC 2ZGOA 4Q29A 4A4AA 3ACFA 1XXNA 1OH3A 1C4RA 2WT1A 2Y26A 4XETA 2JENA 4LORA 5FMDA 1MS1A 1HQNA 4JHZA 4LBQB 2VL4A 1X7NA 5FLHA 1BBT2 2WO3A 4QU1A 2XKOA 3ZFEA 2W0XA 5FMBA 3VDDB 3V0BB 4IGOA 1GQPA 1DGWA 1JHJA 1TEIA 1QQP2 2BBAA 3BPSA 4GB32 4JDNA 4K8FA 1LHUA 4N53B 1LRHA 3NMBA 1YFYA 2JICA 3FLRA 1FI2A 2OQ7A 2EXHA 3RMXA 1JI6A 2WNVB 2PMWB 3APBA 3UV9A 3LA2A 4HK9A 3EMRA 2WZ8A 2VMDA 1N3OA 4HKWA 2HWB1 3AZZA 4IDZA 1U5ZA 3UETA 2HWE2 1IHMA 1Z7S1 1NQDA 2F4LA 2WWJA 4XEZA 4ARXA 5KR7A 1OKOA 2QTWB 3OOXA 4NRMA 5E6HA 5C4WB 5FQ0A 3U78A 2BWAA 5DUWA 1W0OA 3ZDVA 3IBMA 4O65A 1R64A 1COV3 1I6XA 1KITA 1ND3C 1UU4A 4GWJA 4OYUA 4EN9B 5KHKA 4QXCA 4XQWA 4LBQA 3M7AA 1ZRCA 3A7QA 3B00A 4XJZA 3CJXA 4CDQA 2VXRA 4Y5SA 1UL9A 3VDDA 3Q8CA 3AKRA 4N53A 4L9BA 4OQ8A 1W8NA 2ORZA 1V6IA 2VXJA 1KXGA 1ULGA 2NP0A 4AVTA 3KWVA 4QT6A 4A7ZA 4CDXC 3IM0A 3ZXAC 3IT8A 4FFHA 2WNVA 4PJYA 2LROA 3PUSA 4AVSA 3JD72 4MG2A 4XF0A 4Y1UA 3U75A 1LR5A 4H7MA 3ZLIA 4CP2A 2CSGA 4H55A 1I9RA 4QKBA 5C3QA 1QJY1 3MUY1 2RS12 5CISA 3H8UA 4Y4YA 3I59A 4L8QA 5C5UA 4OHYA 2VZTA 2XG3A 1R1A3 3Q8EA 3WQBA 3BTAA 5J7MA 1MPXA 3AKQA 2WYFA 3RI8A 1AL21 5C8CB 1M4WA 5IWFA 1U5XA 5FTTC 1V0AA 1VRH1 4OI0A 1VMFA 2DURA 3VBSC 1X8EA 2YC2A 4ATFA 3TNQA 4NHMA 1IZ3A 1SZBA 2XKPA 3WNLA 1ULPA 2BOJA 2XBO3 3IDEA 4GMP0 5FY0A 3OGSA 3O1SA 1W6MA 3ATGA 5C5TA 4XFAA 3SEEA 3K75B 3O14A 4MO3M 4BPZA 4LTAA 4RQPC 1YO8A 4MUVA 1ENQA 4XHBA 5BNPC 1EY2A 1VB4A 1W2TA 3AL5A 4OUSA 1OMIA 3R4UA 1BK1A 1KJLA 2IC1A 4AZZA 4ZHNA 3J7NA 4K1ZA 2D40A 2VVFA 3AFGA 1HKDA 1PO23 4AFBA 4B4RA 2X05A 1PVC1 4Y24A 5A32B 5I8SA 4A45A 3LQCA 2P6HA 3HJRA 4YM0A 3WZ1A 3I2FA 3AMPA 4KG8A 4LK6A 3THPA 5C8CA 5JOXA 5K0UB 1Z78A 2ZABA 4BXFA 1W03A 5J36A 1LB2A 1XU1A 4W6WA 1FOD1 1RUE1 3GNEA 5IVBA 2G19A 4AFCA 2ARBA 4H2AA 2UYAA 4K40A 4PDWB 5FAXA 1PO12 4GZ9A 5JSPA 5JPMB 3ZFEC 2ZZJA 4OUEA 1BYHA 1VAKA 4ET7A 4YM3A 4NWVA 4XUPA 1JS9A 1JYVA 4CCLA 2VMCA 2I45A 2ET7A 3IDBB 1LEMA 4RS5B 4FOYA 2B9UA 3JBG2 4I0AA 3NW4A 3D4KA 3SLIA 4BQ3A 5FOBB 4BQ1A 2A6WA 4AR2A 2DF7A 4AGGA 2XONA 4XFBA 5LA1A 4B7EA 1O8PA 4UFHA 4NHKA 5SV8A 2VUCA 1NLRA 1MEC2 1CAVB 2HJIA 1LHNA 5FREA 1RUG3 3IDCB 4LULA 4LHNA 2EAKA 1XYNA 4FPKA 5LA9A 2R49A 3RMYA 3K77A 1FPN2 2P4EA 1J84A 4PDWA 2PLV1 2WO2A 2WINB 4CDQC 2FDGA 4BU2A 2R072 3KT4A 3P3PA 3VDDC 5A1AA 3KB5A 4N53C 1POV3 2OPWA 2VG9A 3LE0A 4Q4W1 5FYMA 4GWIA 3UJOA 5D2AA 4DFSA 5JMOA 2BW8A 1R091 3VD4A 4YW4A 4RS5A 1AR61 1FMD1 1RUF3 1YQ5A 5CKQA 4AFDA 1RUJ3 4AOCA 4D8MA 2WNVC 1EAH1 2OW4A 2J1SA 4YZ2A 1V6JA 4LK7A 3WDWA 3NKTA 1RIRA 3VL9A 1WCKA 2JDUA 3JB8A 4RHV1 5FZ1A 3VBHB 5DAQA 4BDVB 4YG3A 1CAVA 5I0UA 2WL1A 4MGYE 5KHHA 2D3PA 4DB5A 4DY3A 4YARA 3T0AA 1H2NA 3EJKA 1GNHA 2B45X 1OKQA 4U2AA 3RWKX 3FHAA 3MUZ1 4AVBA 4FBFA 2RVAA 1C8M1 1Q3EA 1LGCA 1UZVA 4L11A 4HVQA 5KHJA 2TEPA 2HKXA 2A70A 1VBE3 2VZUA 2VTXA 2XHNA 4LKFA 1RVF2 1W2AX 4AQ2A 1LGBA 1HQLA 4XF9A 5IVJA 3ZX7A 3VD7A 4Q8LA 5F1RA 1H2LA 2W46A 2WS91 1WGPA 3VBOA 1HV0A 1NLQA 3ZSJA 5J48A 5IK5A 5F5AA 2B46X 5FJKA 1DHKB 1Y7BA 2OX0A 3BVCA 4LO5B 1ODNA 3JCIA 3VBHA 2K9ZA 5KC6A 5A3WA 4RR3A 5JIAA 3ZSKA 4ASKA 5L7OB 2OXBA 1YFWA 1OLQA 5AC91 2C24A 4XACA 1MZFA 1GQHA 4LMFA 2E7AA 1UOFA 2EF6A 5BYNA 1DQ4A 5C8CC 5F3CA 1H30A 2TBVA 4CCNA 4DXSA 3HIFA 4YFWA 2ZOEB 4QKFA 2RS53 4QHBA 4N90A 1DYPA 1RHI2 5ABJA 1MQTA 2ETEA 5C9AB 2ZGTA 5A6XA 5GZGA 1Y3TA 1S0DA 2VOKA 5EYXA 5FYVA 2R062 4ZKTB 1OLME 3IB3A 3PUIA 1FT9A 1V6KA 4N43B 4Z2AA 3I3QA 4UFJA 1QOSA 1QJU2 2VCMA 2WWUA 3K48A 4UBGA 2BJSA 1AR62 4BYYA 4DXZA 4O7XA 2E26A 2EXJA 5JCTA 4BHPA 1CX1A 4Y1XA 2YBKA 5EJ3A 3ETQA 3O1MA 2LM3A 2UWAA 3FUQA 3MDPA 4QD2A 5L7OA 1G9BA 4WVVA 2OUJA 3M3QA 1NG0A 2HBTA 4FO9A 3WF0A 4Q4Y3 1BJQA 1VBA3 4KWLA 2L9LA 1MACA 2VMHA 1UPIA 1L3JA 1W8OA 3ZM8A 5GLWA 5KXEA 2ZGSA 3HAGA 4OZOA 3KMHA 2HYKA 2QDRA 5C9AA 1JW6A 1BZWA 1YJKA 1D4M3 3HQUA 3IMMA 3PTRB 2A6XA 4HPKB 2P3IA 4PDWC 3PJYA 1U0AA 1CAXB 4NPRA 1JTZX 4ZU5A 1CZSA 1X9PA 1PK6A 3MW3A 2YDEA 4XIOA 2BFUS 3RZLA 4K21A 3I3DA 3VKMA 5JXIA 3ES4A 1BBT3 4RS5C 5LASA 2WNUB 2JD4A 1HXS2 3GZTB 4Q1PA 1WLDA 4P5YA 3RQ0A 3KF5A 4YGCA 3W5MA 3QH6A 3H0OA 5FYYA 1QQP3 2W87A 4GB33 2R7EB 2E7QA 2IFRA 3BU7A 3IKWA 4XQDA 2R0HA 3T1MA 1ZYBA 3UL2A 1S0CA 3LSDA 1W0PA 2W39A 3WP6A 1UX6A 2DVFA 4S2GA 3IIIA 1O59A 1BXHA 1QMJA 2NQYA 2SLIA 4L2NA 5BNNA 4JZRA 5IUQA 4QX8A 2HWD2 3VZOA 2QFEA 3I97A 4LLOA 2HWE3 1GOGA 4HPKA 4ISRA 4UF0B 4N7IA 4PI2A 4OULA 3LA3A 4OHZA 1HX6A 4RN5A 3ZFGA 1EUUA 4BK4A 2VR4A 4I3GA 3SMHA 1XE8A 2YBPA 4M4RA 3VBOC 1UKGA 4B1MA 3PIJA 4Q26A 4YZ5A 1UY0A 3M3OA 1LHOA 5DQ0A 4UFIA 2R30A 4N9IA 1RMU1 2WFF1 3VBHC 4BJ0A 4RR3C 1IPKA 4XIKA 1WZXA 2DU1A 2YU1A 3JD73 3NJVA 1ASJ2 1W8FA 2JB4A 2FZ2A 2OQ6A 3W20A 3IPVA 5T52A 5HXMA 3B9CA 2RS13 5CZKA 2BEOA 3A4UA 4GH4A 3BTXA 3RS6A 4QPYA 2JDYA 4YSFA 5ABJC 1MQTC 4ZS2A 3OJBA 2BRTA 2EIBA 2VVDA 4LBNA 3N7JA 3OUIA 4XFHA 2RMU2 5EP9A 4FPGA 2XMLA 3SCFA 2YZ4A 3RWNA 3ACIA 1XNCA 5CKMA 3ALQA 4R4XA 2WRAA 4XOGA 3K51A 4XBQA 4XDPA 3UJQA 3WNOA 1I1EA 1CAWB 2VNOA 3N9QA 4YM1A 1AXKA 3OD4A 1O5LA 4XBNA 5FUPA 5L7OC 2WN3A 3VKOA 2VECA 2FCVA 5A3OA 5F5CA 1QXJA 1Y4WA 3JB4C 1NA1A 5FYIA 3BU0A 1N3PA 1APNA 1HRI2 3DPRB 3FWEA 5FZ4A 5CVRA 2Q4SA 5FP8A 5JOZA 1TG7A 1UYPA 3N4MA 5C9AC 3BTZA 3I3MA 1UXXX 5IVFA 1UYXA 1ACCA 1S0EA 3T2OA 1BQPA 5HXVA 2FDKA 3KV6A 4FPJA 4IESA 3RNSA 4A41A 4D6RA 3LSEA 2XQRA 4CUBA 1PK6C 1Q8SA 3ZFFA 5DABA 2QQUA 3OYWB 1LEDA 3SITA 1PZ7A 1RGSA 3AC0A 1AYM2 2F6BA 4PBPA 1PO13 1WW4A 5IK4A 3HN1A 1ZZ7A 1XJAA 2LRPA 4JKMA 1CAWA 2PAEA 3C7GA 1DLCA 3HPNA 4IE0A 4LR4A 3WW3A 1J1TA 5J09A 2JDKA 2E31A 2V09A 3UK9A 1XB9A 5L9BA 2AYHA 1XNAA 3GGLA 1XE0A 1L7RA 4TWTA 1HQWA 1LOAA 2PHTA 4AI2A 4ES9A 5EFUA 2HWC2 3JBG3 3J9SA 1HLCA 4KBZA 4XC9A 2GNTA 3DPRA 4QPWA 4CU7A 5BNNC 5JAXA 2CHHA 4CCKA 3A0NA 2OVUA 3I54A 1UIJA 2LUWA 4J25A 4P00B 3FHIB 1KS5A 2WLPA 1LULA 3DYPA 1MEC3 1LNSA 2J7MA 1NOVA 3OBRA 4IW3A 3POWA 4CCJA 3ZFGC 5L9VA 2PAMA 4CEYA 4HFSA 1HN1A 2VULA 1CIWA 1FPN3 4W65A 4FTEA 2BVBA 2LALA 4CDUB 3GALA 3I2GA 1VE0A 1LAJA 4N9HA 1VAMA 4AVCA 4PIXA 4BQ2A 5FPXA 2ET1A 2R073 1EYBA 4AGRA 1NX9A 1O8SA 1U12A 4QX7A 3BB6A 4TSVA 4XF4A 4HT1T 3J7HA 3SH5A 2A3YA 3I2IA 2QBXA 3VL8A 3O1RA 2ZGPA 1OF3A 1JZ4A 1MVQA 2WDBA 4HN1A 2RS31 4MOAA 5FFOC 3AP4A 5LA2A 4X8NA 1GICA 2GU9A 4UW6A 3WW2A 2R6QA 3F95A 1F5JA 3CJIB 3SCHA 5FOJB 1BEV1 4E4SA 2C1FA 2RM22 3D82A 3ABZA 4W50A 4CU6A 2YU2A 3MV11 4ORFA 1OA4A 1UZWA 4GH4C 1GZ9A 5FCCA 4CVUA 1WCUA 1I5ZA 2C4XA 1REDA 1KGYA 2A1XA 4OFGA 4EN8B 4O61A 1REFA 4GKXA 4HVRA 2OA2A 4QHZA 1OUSA 5GALA 3AMMA 4WZCA 4FPCA 1UYZA 2RJLA 3DXUA 4UW3A 5DG1A 3KQRA 3TN92 2Q8OA 1J3RA 4EQVA 1RUI2 4EROA 3WNPA 3OCPA 4WM8A 1RVF3 4XTPA 4OHXA 1VB2A 1W6PB 3E97A 1CZTA 2IWGB 3M70A 4FOVA 5GLUA 3T4HB 4D6SA 1G9AA 1YYNA 5FYCA 4Z92B 3NAPB 2AH2A 3S5AA 3ZN5A 1H4HA 5A7WA 2VJXA 4QAWA 1NA1C 2WA4A 4JQRA 4XJ9A 1JUIA 4QHOA 1DQ1A 1ALYA 2VOXA 3KT1A 4XJAA 5DAVA 2XJTA 4KBBA 5FP3A 3U07A 3ZIWA 3WF1A 3MO4A 2AR6A 5FLJA 2BNOA 4MX3A 2BGCA 4XDQA 3ZFFC 4CU8A 2FDHA 1LTEA 4PHZA 1RHI3 3AYCA 4K8RB 1LESA 3RGBA 1W06A 2D6KA 2XXZA 4LO8A 3ZDSA 1K45A 2R063 4DRRA 1WCDJ 3H8XA 1W6PA 4DXRA 2BYVE 5DDJ1 4AQTA 3KVAA 3H3ZA 2GN3A 2QQLA 2B39A 1I3HA 1QJU3 5C6CA 3K46A 3U1XA 4GWMA 2ZGLA 4QWNA 3VBUB 1R1ZA 3T2TA 3O0XA 4XXAA 3U4SA 3DGTA 1YHFA 4YZ3A 5FYBA 4FOQA 3DPRC 5D1IA 4BQWA 2YG0A 5FMCA 2GC0A 2CTVA 2ZBJA 3B02A 2OT7A 3I2HA 3I3EA 3FX3A 2VCAA 2XVGA 4IEZA 4NE9A 2JE9A 1JU3A 3VHPA 5GZFA 1UW8A 1RUF2 4ONUA 3N9PA 3D8CA 1GYKA 1ZRIA 2D6PA 5FLIA 2VPVA 3WG3A 4CEYC 1YQ2A 4LT5A 2AACA 5T5PA 3CIHA 2I07B 3POGA 1AF9A 3TAYA 4MH0E 1NQJA 5L73A 2C5DA 4CCCA 4BH9A 3ZOIA 3ZYPA 1XYPA 1JXNA 4YYOA 3ZO0B 1VP6A 3EBRA 3BUCA 4L92A 4E2QA 1HRV1 1BHGA 5DZFA 1O4YA 1UN1A 2VUAA 1HXS3 3WDVA 4BZ4A 1TMF1 2IFWA 2WNOA 3Q9OA 4BQ4A 3GCWA 3ZMOA 5E1RA 5C3PA 2V4VA 2XJUA 3H8RA 3CL1A 2BV4A 3AKTA 4JRAA 1FPN1 1SBFA 1JODA 3MICA 3S0MA 2GAUA 2ZGMA 5JWPA 1FNYA 2G9ZA 3J8F2 2RDSA 4JKLA 4BLJA 5LW9A 3TBDA 4BK5A 2XLAA 4LO6B 1D7PM 1OOPA 2HWD3 3J7LA 4AI0A 5EHDA 1IS6A 5DN2A 1CESA 2Y34A 4KQ7A 5I0DA 1V9U2 3ASIA 5JLVA 4I3PA 4COWA 1O7FA 2B4KA 3PUAA 5JOWA 1LOCA 3AZVA 4WM8C 2ZHNA 3OTFA 2W1UA 4YW7A 4G9SB 5FZLA 3WG2A 1XNDA 4X6RB 2EIDA 1HB1A 3VKLA 5J3UA 5DAPA 2WZPP 1W8ZA 3VBFB 1YXWA 3C3VA 1YNAA 2Y6HA 3MBWA 5L9RA 4CP9B 1UAIA 4LBQD 1SFPA 4AHWA 3NJZA 3LEKA 1UU6A 1B09A 3VBRB 1IOAA 2C26A 4LIVA 4D69A 4FPLA 5I8YA 2XPJA 5FY8A 1XC6A 4QB1A 4PBOA 3RYRA 1C5IA 1F4AA 3PMEA 2B7YA 1ASJ3 2JKBA 3ENRA 2EALA 1DP0A 4UT5A 2W3JA 3ZYBA 4P08A 2CU5A 3MLKA 3O12A 4N7UA 3H1WA 2KA3A 4BQ5A 4L0PA 5HPOA 1BK0A 3IDAA 3PNAA 2KD7A 4Q0QA 2I2SA 2AUYA 2RR11 5FZ6A 1NCQB 4DINB 4Q0UA 3B01A 4WV8A 1RXFA 2W94A 4QKDA 5ANNA 3N7LA 5GM0A 5J98B 3B7MA 2Q5TA 4AWDA 1Q8OA 3AP5A 1V6MA 4IEYA 4F8AA 2RMU3 3AM2A 3DYOA 4TN7A 4UI9L 4QQHA 1CWPA 2VGDA 3T2PA 1W3XA 3VBFA 3Q8FA 2C0ZA 4CP9A 3FJSA 2IXIA 4IGQA 1C28A 1Z0HA 2XL9A 3VBRA 5FPLA 3O1VA 1O3TA 1LOGA 1A8DA 1LECA 2A3WA 1PIV2 2YGLA 3NJYA 5I0TA 2EA7A 2DVDA 2AEYA 1CGPA 2RDQA 4YW2A 3PJQA 4EWAA 3ON7A 3ILRA 3LPFA 3OD0A 4PQQA 3CZJA 5APAA 4OCTA 4AEKA 1HRI3 3K4DA 4GALA 2RJKA 4LE3A 2UY9A 2HWF2 4MGQA 4PT6A 4W4ZA 3HNYM 4QPIB 1NKGA 5CIRA 1A6CA 5A7QA 4MZUA 3FBYA 5LY1A 5KC5A 4JGZB 1YCIA 4Q4X2 5FZOB 3TB0A 5KXDA 4I09A 3T30A 4XHXA 1ST8A 3ILFA 4GD4A 4I01A 1AR81 3M8LA 4QXBA 1H2KA 2XHKA 4CUAA 1MS0A 5JPNB 2CDPA 2DBIA 3NVCA 2GMMA 1AYM3 3PMSA 1WMDA 2D43A 1CAUA 1SPPB 3P1IA 1OFSA 3N36A 3ST7A 1ZZCA 4P14A 4HKLA 3VZLA 1PX3A 2YV8A 3OF1A 1GUIA 2D3SA 2ZGUA 1UF2C 1AXZA 3KZ4C 2VBPA 1VBD1 2J1AA 4LBJA 3NV1A 2WYSA 4CTEA 1ZBE1 1OSGA 4O9GA 2BQPA 1QJX1 2D6LX 2DV9A 3D6EA 2HWC3 3MLJA 1A78A 4YZ1A 4XFCA 5HV4A 1RUH1 3CEWA 5K7PA 4QPIA 1OOPC 5FZDA 5JR7B 4IE4A 3V0BA 2JXAA 2CYFA 1L7LA 1TQ5A 5A1LA 1NUKA 4YM2A 4EN7B 4P9WA 4AHZA 2CAVA 1OQ1A 3PVOA 4AL9A 1G9FA 2QJVA 3N9NA 5FYHA 2Y0IA 2D44A 1Q43A 4F3JA 2YUEA 1DGWX 3WDXA 2JWPA 1JU4A 3QD6A 5ANQA 4R9AA 2XUMA 4FTSA 1PMIA 3MHZA 2JG8B 1QXRA 5JIUA 5C4WA 1J58A 1DLLA 4IL7A 5EZWA 2D97A 5A6ZA 3POIA 3TEYA 3GCXA 4NUBA 5LK7B 3AKPA 5HV0A 4XPVA 3T3YA 3AMQA 3L9JT 3FC0A 1F31A 2BNMA 2RM23 4LBOA 3ZIXA 2H0VA 1A8MA 2K46A 2VCBA 5FZFA 4TLFA 1SACA 4R8HA 2J42A 2VU9A 3H3LA 4ZXKA 3VUOA 2MEV1 3MEPA 4UWDA 5IVVA 1UKRA 2GP3A 3HOBA 4OUMA 2AEZA 5IAXA 4AW7A 2F17A 5FMOS 1AXYA 5DUUA 4TLGA 3V0AB 3I4IA 4XCBA 3DL3A 1O4TA 3TN93 3ZXKA 1Y9GA 3VBFC 1RUI3 3KCCA 2O8QA 4HOOA 1RUD2 1UY2A 5DUXA 1KS4A 4XUQA 3VBRC 4CPBA 4DMIA 1VBB2 1UMZA 1F35A 5FKCA 4AFAA 3T4VA 4GMP3 2FDJA 5I0SA 1ZREA 5KHGA 1RUC1 4KGQA 1H9PA 2LTNA 2W47A 5JZGB 4Y1YA 3MIHA 2FMYA 4FXGB 4AQSA 3JQXA 2E6VA 1GNZA 5FUNA 1LODA 5JXHA 2Z4FA 3WDTA 1SDWA 3A21A 3KD4A 1T6BX 4IV3B 2Y60A 5DMYA 4IEPA 4FAGA 2ZEXA 2KM2A 4M3CE 3BODA 5CA6A 1CD3G 3M1HA 5ACA2 3UYJA 3FBMA 3VB9A 3WW1A 3D3AA 1DQ0A 1G8WA 2A3XA 3N9MA 3AKSA 3VZMA 1HJFA 4P9IA 2P5BA 3F2ZA 3GZAA 3HBKA 4EJRA 1PX4A 3KLSA 5A32A 3CO2A 2UY8A 3ORJA 4FVVA 1JOBA 4LHLA 1UZYA 2Y6KA 1VALA 5K0UA 1UU5A 1ZBA2 1DZTA 4BXSV 5IHRA 2EIEA 2Z69A 4Q5OA 1A34A 2Y64A 1QF3A 1X8MA 2QQMA 1ZZ6A 4Z07A 2P3KA 4DUWA 4WVZA 1GOHA 3SKVA 1QU0A 1ULOA 1DYOA 1MS9A 2VW2A 2ZAHA 4OI1A 3C7OA 5KXBA 1D2QA 4QPIC 3U0ZA 3PU8A 5BNOB 1WLWA 3NSTA 1QY4A 1AJOA 4IV3A 1BKZA 3BCWA 2IVIB 3OG2A 4YZ4A 3K3OA 2H6CA 4IERA 3C2UA 3N35A 4JC1A 3UKVA 5FK8A 2AENA 4DY5A 1Q8QA 4XAEA 2Y0OA 4QX3A 2CGPA 2EAAA 1COV1 2ATFA 3U14A 4M00A 1FX5A 5KHIA 3KGZA 2BVVA 2VW1A 5FRAA 4J1XA 5LY2A 4LO7A 4IEXA 3H3UA 1J83A 2VH9A 4Q27A 5C4WC 1N1SA 3AP6A 2DUOA 2VY0A 4WBBA 4QXHA 3TWIA 3VD3A 5AFBA 3K3NA 4ZS3A 1VBC2 3I49A 1HJGA 2Z79A 1EV12 2YC0A 1ZZ9A 2IXJA 3DCQA 2WZR2 4E4ZA 3THDA 2G4IA 5J37A 1OPOA 1IKQA 3MIFA 4QMAA 1BMV2 2Q8EA 4XILA 1F15A 5BNOA 4IGPA 2AZ5A 4Q4V2 2PELA 4JVAA 3WOGA 3ZMNA 1US2A 1XU2A 3DKQA 1WW6A 4K7JA 5F2WA 2WQ4A 3B69A 3J8F3 1GMMA 1IGOA 4RD7A 4J6GA 1TME2 3N3HA 4P9GA 1R1A1 1X36A 4QGMA 3SISA 3RZMA 3T09A 3KF3A 4GKYA 5H9RA 1GWKA 1AL0G 2FZ1A 1CONA 4CE8A 3L2YA 2BU9A 2YB7A 1AYN2 1V9U3 5IAVA 4LNVA 4EE2A 3EB7A 2VQTA 1WLCA 4E27A 2W91A 5F6KA 3FFZA 5K9YA 2JX9A 2XBO1 2BPA2 1X82A 3AMHA 3HT1A 4LE4A 4LQRA 1POQA 3ROUA 2D6MA 1GWLA 1WD4A 3HNMA 5C3SA 5LRSA 1LENA 2W5FA 5HBAA 2XJRA 3WVJA 1PNGA 2K2SA 4GJZA 2WT0A 4UYBA 3UNPA 3ZYIB 1Q8PA 2W9XA 4ISQA 3E5UA 3WF4A 5E88A 1YEWA 3AZWA 4OVEA 5LB6A 4A7YA 3SC7X 1EPZA 1VRBA 1Q8VA 1PO21 2R042 5CNAA 1QH6A 3VN4A 3R6SA 3J7MA 1US3A 1WUVA 2X09A 2YYOA 4RSUA 5LATA 1R082 4R9CA 3AX4A 4AHXA 1WCSA 2OKXA 4Q1RA 4S2HA 1H1AA 4V2WA 5E8AA 3ZYHA 2QUOA 5FY7A 3VDBA 3E6DA 1H1MA 4KNCA 2B8MA 5K0UC 1IG3A 2ZMLA 1K5MB 2WABA 4A3XA 2ZGRA 4YWAA 3LCPA 1JOJA 5FBZA 1RB8G 2G9GA 4QM8A 4BE3A 1S4CA 3WNKA 3W5NA 2UU8A 2XWJB 4YRDA 5F7UA 2A75A 3KCYA 1PIV3 4MHRA 1NY71 3QH7A 4OQ9A 4N43A 1X50A 4AI8A 2D3RA 4M4PA 4IV3C 3ZSMA 1H1IA 2Y6GA 2QNKA 4QQOA 1O3SA 2DFBA 2HWF3 1URXA 2XJQA 2HWB2 1RUG1 1E5SA 1YQ6A 2DVAA 3MF9A 1UPSA 3MIGA 5K4LA 4A2UA 1OURA 4Q4X3 3H8OA 1Y43B 5CFDB 4M01A 4KWJA 5L36A 1ZNPA 2MPFA 4U36A 1HV1A 5M0TA 3MW4A 4XF1A 4AAXA 5JR2A 3PLQA 3OB8A 2EXKA 5L19A 1K5MA 1XE7A 4LA3A 4S2FA 1POV1 5TSWA 5CFCB 2E51A 2J1EA 4COYA 2VVEA 5A33B 1TZOA 2Q1MA 3LEGA 1RUF1 2GC2A 3LEMA 1RUJ1 5BV6A 4FAHA 3RI9A 1CAXA 4PF1A 3KT7A 1OLMA 4CU9A 4E8CA 2XB6C 5BNOC 3DN7A 2RDRA 1JHNA 4JRLA 4JKKA 3IN9A 1WMEA 3ZR5A 2WNUA 4MXWB 3GF6A 3RYPA 3HMYA 4H7LA 3A22A 3I3BA 5KWRA 2KXLA 2BBVA 3CZUA 2WLQA 1LHWA 3MPBA 2XJVA 5CFDA 4NRQA 3ILNA 3MIDA 4A7KA 2DYCA 3URFA 3VZKA 1PGL1 2DCZA 3HR9A 1OFNA 5C8WA 1VRH2 1VBE1 3WDYA 4HXCA 5CFCA 1VR3A 1ULFA 5A33A 2XLGA 4UF0A 5LWBA 1FATA 2ZX0A 5EXOA 1YLLA 2JDAA 2B42B 2Q30A 2RHPA 2WSUA 3QOPA 1AX1A 3SH4A 4DEQA 3NV2A 5F8PA 1AX2A 4DS0A 1UOJA 3ZXDA 2PAKA 5BY5A 3UGFA 4X8PA 2GNBA 3N9OA 4COUA 2HEYF 4A42A 3BI3A 4MXWA 4GQ7A 4Z1VA 3ES1A 3VZJA 4XJUA 2LS6A 2P2KA 3KM5A 2RDNA 3H42B 2H0BA 3TOJA 1UXZA 4Y20B 4AEMA 3CHXA 4B29A 1OD5A 1JZ5A 2RS51 4M3CF 4DNYA 2OPKA 2ZCWA 2G9FA 3ZSLA 2VW0A 2Q1ZB 2VZOA 1GZWB 1H9WA 1F9KA 2NMOA 3WT3A 1AX0A 1FOD2 1RUE2 2GP5A 4HVOA 4NWWA 1NYWA 3IIAA 2VD7A 4OI4A 3J4UH 2BFUL 5GLVA 1WD3A 5AVAA 1RUD3 3POJA 4Y5TA 5FWJA 3LWCA 5JOYA 5HCHA 1RJ7A 2JDMA 1UZ0A 3GZUC 1VBB3 3FLTA 4IXLA 4F7ZA 1K12A 4Z82A 1PGW1 2VQUA 1E5RA 3I2OA 2PFWA 4N43C 3ZPYA 3KCXA 4JTNA 2RG4A 2ZJCA 4LO4B 3WNNA 2JKXA 2PHXA 4Q4Y1 4AVVA 1VBA1 4NRPA 3D0JA 1FV3A 3K2OA 3LDRA 4JAAA 3HVDA 4QDQA 5EQUA 4Y5Z0 4KWKA 5FY9A 3G6JB 1ND2B 3SEPA 2CY6A 4Q0PA 3ECQA 4LPLA 1NAEA 1C3HA 3TEXA 4Y20A 1N1YA 2CNAA 5FZHA 4IEWA 4DPNA 4BISA 3KV5A 4BIFA 3T0DA 3AZYA 2KR2A 3MIEA 3DV8A 1D4M1 5JI9A 1S0GA 1SLLA 3E5XA 3B3QE 4NMIA 5DUVA 3S5QA 5ACA3 3WLUA 2EVXA 3HQXA 4IE6A 3NNMA 2BUKA 1K5MC 4AVAA 4MYEA 2PLV2 2VMEA 4XMAA 1XSQA 1BBT1 1A3KA 2X29A 5FYSA 3GXUA 4GULA 1NE4A 2C6SA 4Q4W2 1GR3A 4URTA 1ZBA3 5FP9A 5IFPA 5AFEA 1QQP1 3WUDA 4GB31 1R092 5A1FA 1FMD2 2Q1FA 4Y1VA 5FIXA 5I0RA 3NV4A 3OYWA 1PZ8A 3AB0A 2NZ9A 1DGRA 4R4ZA 4JDMA 1EAH2 4M0NA 3VKNA 4BQYA 2WNUC 1UOBA 1ND2A 5FYUA 2GMEA 5EPAA 2E32A 3RG0A 4RHV2 1JYTA 2VTFA 2FCUA 4AYUA 2HWE1 1AJKA 1LGNA 2VZ1A 4KI5M 4D7YA 1J1LA 5A3MA 5CFDC 3AL6A 2DBNA 3NJXA 1S2EA 1JYWA 2EICA 3WW4A 3BYWA 1DFQA 2JB8A 2VZSA 5CADA 4NIGA 2BNNA 1FYUA 1Y9MA 2W08A 5CFCC 1XPWA 1DDLA 4YLZA 1XRUA 3LAGA 1GKBA 1GQGA 5LBCA 2YFZA 4TZDA 2ZHMA 4FPEA 5IVEA 4EV0A 5F2SA 1VAVA 1BVVA 2PQQA 5FPZA 1ZRRA 3RVHA 1S0JA 1VBC3 2VO5A 4TYSA 3WNMA 1JYXA 1IQDC 1EV13 3DYMA 2WZR3 1B35B 4CDUA 5LZ6A 2D98A 2NMNA 1S0FA 4HZFA 4JCKA 4QX2A 4ZONA 1IS3A 1AR92 1ULDA 2ARXA 3JD71 3RZJA 2V5YA 1VMHA 1EP0A 1YI7A 3KV4A 4CRQA 4I0BA 1XSRA 2HEWF 2WT2A 4BB3A 2P3YA 4Q4V3 4K1YA 4SLIA 2RS11 3LEIA 5AC92 1KDKA 4Z2WA 5A7NA 3QCWA 1TME3 4JQTA 4DO0A 2W52A 1UNBA 1Q5OA 3CJIA 1D2SA 4JV4A 1ZA4A 1KDMA 3ME2A 4I0WB 1GOFA 1AYN3 1V70A 1WCQA 3BN6A 1EPWA 5DG2A 2IUWA 3V64A 3EHKA 5EIYB 3HNBM 1P8JA 3H50A 3FFQA 4DIQA 3ACLA 4FSJA 4L99A 3LIHA 2Q0AA 4PQ9A 3RFRA 5C70A 3TNPB 4I30A 4NR1A 1GBGA 3IZOA 2ORXA 3WXPA 2QCSB 2ZEYA 1W9SA 1YI9A 2ADDA 3O0WA 4XFFA 1B35A 1OUXA 2YXSA 2ZS6B 3JZVA 3QLQA 4J1WA 1OA3A 5FPUA 5T5OA 3OBZA 1WBLA 2I74A 2GSYA 1MS5A 1Q56A 2ZA9A 2FHRA 4F83A 5FZCA 4BQXA 5IATA 2R043 3INAA 3LGRA 4NJ4A 3VHNA 4COVA 2FCTA 3NAPA 4FQ4A 3W58A 4WVMB 2XR4A 5BPXA 1DQ5A 5FXZA 1R083 2WZEA 4O9EA 2VQAA 4XDOA 4KH9A 4Z8BA 3B94A 3LDBA 1SBEA 2MHFA 3GHNA 4IUGA 4NOTA 4D6QA 3OBTA 1VJ2A 2R1DA 4BMEA 3KGLA 1AR72 3X29B 1PO11 3POFA 2HBUA 1XNTA 1G9CA 1HW5A 3HEIA 5T54A 1JZ8A 3C7HA 1DGRN 4NPLA 1C1FA 1V6NA 1GP4A 3KSCA 4W8JA 3ZXLA 5T50A 1MR5A 3C7FA 3RPQA 2VNVA 1ND2C 3JBG1 1ENRA 4FP3A 2ES3A 3ZXGA 1ONAA 2CWSA 4RA0A 1UZZA 3GJBA 3O1OA 3IAQA 2PHDA 3QBQA 1S2BA 4AF9A 4CDWB 4WVMA 3VBUA 1MEC1 2WJSA 3MPPG 4H3WA 4AGVA 2HWB3 3A23A 3T0BA 2A6VA 3VD5A 1Z7S3 2DWRA 3SCGA 3MZHA 2QQIA 2CAUA 2QQKA 1G6NA 3HD8B 5FZGA 4I2OA 3FZ3A 5FJHA 2ZKLA 4LJHA 1TNFA 3USUB 3PTYA 5FO9B 4I02A 2R071 2AGSA 2QQWA 3MFCA 2K0GA 1ODMA 1H6XA 3GBFA 4HK8A 4GAZA 1K42A 5BXXA 4DEVA 2D5HA 2YMZA 4LLFA 4CDUC 2VOTA 5A3TA 2JDZA 5F32A 4EZHA 5KBFA 2R16A 5FZMA 4HG6B 1IQAA 4YNIA 2QKDA 1UX7A 3AYDA 4FOWA 4QB6A 2EXIA 4INDA 3U10A 5IYYA 3LB9A 1RMU2 5J1XA 2WFF2 1W05A 3RRDA 3B9IA 2V5DA 4LBLA 4CDWA 2FDIA 4A6OA 2BZDA 2GMPA 4XUOA 3WP5A 4CEWB 3KS7A 5F5IA 4EZ4A 3KVBA 1QJY3 1YIPA 3E1F1 3CJIC 1NCRB 1W0NA 4Q2FA 3AP7A 3RSJA 3S7IA 3VBSB 3BIWE 1WMFA 3B5LB 2QQNA 5FBJA 1ULEA 3M2MA 2TNFA 1KFUL 2Q8CA 3LF7A 1JZ3A 3ACHA 1GWMA 2FDFA 2XVLA 3IMNA 3THTA 1AL23 4CCDA 4COZA 1VRH3 2BOIA 4DUXA 1RVF1 1SFYA 5T55A 1YJLA 4RQPB 4IV1B 1MZEA 2D6OX 1B35C 3TEZA 4M0HA 1IKPA 4GIQA 3AZXA 1W8UA 3SXWA 3LZZA 4DXTA 1DIWA 3NNGA 4YFZA 3WHUA 4CEWA 4E4DX 4AEJA 2VOWA 2ZGNA 3NAPC 4IE7A 1QKQA 2CV6A 3P6BA 4ZU7A 1REEA 3W59A 1NCRA 2J1UA 4NIAA 1RUNA 4B4PA 2SBAA 2IXKA 2ZMKA 2VZRA 1CQ9A 3S30A 5FV3A 4NHLA 1HB3A 5FZ3A 1PVC3 3DF0A 2Y6JA 3RDIA 1SLTA 2PHWA 3PVEA 4PLOA 1RHI1 3U4XA 3V56A 4ZZ8A 3C8XA 3H1MA 3G7DA 3MV01 3ZYGA 3NO8A 1UYYA 2R061 4XAAA 4IV1A 3P3NA 1FOD3 1RUE3 2GH8A 2VUJA 1GSLA 1QJU1 4XQ4A 1DBNA 1NCQA 3D5OA 4Q8KA 4Q0SA 1K5JA 5CAZA 3RZHA 1MZ6A 3ZKUA 5T5JA 2JDHA 4BCUA 3LOIA 4DOUA 3VDAA 4GWNA 1DF0A 3WQ0A 1T6GC 1QJEA 1RYYA 4MLOA 4IEOA 4YG6A 1WA4A 4CPBD 2WQ8A 4YVWB 4QQLA 1W28A 1QEXA 1J3PA 1OQDA 4HSLA 3VBUC 4UBHA 2V73A 5JSOA 1G9DA 1H2MA 1CPNA 5JMCA 5A3LA 3E5QA 3AP9A 1QWRA 1M06G 2YPDA 1UY4A 4CDQB 1NXD1 1DCSA 4P02B 3ZN6B 3ZXFA 1DZRA 1WMXA 4RYDA 2VUDA 4XZUG 4HL0A 1QH7A 3S7EA 5IFTA 3TYJA 3OUJA 5FO8B 4DRVA 2PLV3 1QHDA 2QVSB 3K4AA 4JGZA 4NPMA 1HXS1 1YRZA 5FZIA 5FZOA 4FI9A 1UY3A 3PUQA 4Q4W3 3POYA 5D8AB 4PIZA 2F4PA 1HB4A 1NXMA 1MS8A 1R093 1CJPA 3I59B 1QJFA 4RFRB 1AR63 1FMD3 1G7YA 1RITA 2O1QA 2RS32 4FFGA 2ZXQA 1LOEA 2ILMA 4YVWA 3THCA 4CDWC 1EAH3 1PNFA 1QNYA 1SPPA 2YROA 1BEV2 3GJAA 3HBZA 5A7PA 3OGGA 3T08A 4QB2A 1O3QA 4NHXA 1O3RA 2W68A 1W8HA 1D0GA 1AUYA 2YHJA 1W8TA 1HB2A 4E2SA 1BLZA 2HWD1 4RHV3 5FWEA 4R9BA 1UIKA 3ZPOA 2FBEA 1ZZ8A 1W39A 3M3EA 1LU1A 1W6MB 1YIFA 3H7YA 1MVEA 1X9TA 1C8M3 5A6QA 4FPFA 3I7DA 4EYUA 3I8TA 4R52A 2YBSA 4QDSA 1RTVA 2WWSA 4YW5A 3SQOA 1F2NA 5D8AA 1KRIA 4XFGA 5A6YA 3EO6A 3I2KA 3OGVA 2XUEA 4Y3OA 1JMUB 2C9KA 2ZAAA 5FZ8A 4EN6B 3SNMA 2GNDA 2WS93 3FN9A 4LIUA 1RC6A 4RL7A 3MW2A 2VM9A 4OI2A 2GZWA 4AEDB 4CP0A 4CEWC 4Q0VA 4XZPA 2LW8A 4META 1AR93 4HSJA 4QU2A 1ASJ1 1K3IA 2VOVA 2JG8A 2DCKA 1NCRC 3PURA 4A44A 4BWOA 3LDKA 4PLNA 5AC93 2W95A 5F37A 5FK7A 4KL1A 2W92A 2YY1A 4S2DA 1V00A 4CCMA 4IV1C 2RMU1 3GDBA 4OMCA 1RXGA 3OGJA 4B3NA 1PMHX 5EYYA 2Q8DA 2DUPA 4NIHA 2WQZC 1NCQC 4YPJA 4FPOB 2WFPA 5F9TA 3PVBB 3POEA 5DDJ2 5FY5A 3WQ7A 3LOBA 3ZN6A 1GP5A 4CXXA 3V0AA 1SDDB 3ITQA 5CKNA 1DZQA 5B2GB 3SHRA 4LBKA 1PM7A 5C7GA 1W2UA 2PTMA 3WG1A 1W9WA 5JXGA 1HRI1 1WW5A 4ASMB 2UURA 3ETPA 3UGGA 2P34A 4MGKE 3BOWA 3KHBA 4LOSA 1OLRA 1LOFA 2Y6FA 4QXKA 5CYYA 1YWKA 2VBDA 3OPZA 1KD7A 3EYPA 3UKNA 4NN0A 3C7EA 1WA6X 1YQCA 5JZGA 4UOJA 3WDUA 1WBFA 1JYNA 1UQXA 1IG0A 1POV0 3AXDA 3RJRA 4KU8A 4UW4A 1AYM1 3T1LA 1AR73 4MXVA 4JGZC 3BPZA 4RFT0 4ZZ5A 1H8VA 4M3CB 5GLZA 1KJRA 1HRV2 2NN8A 1C57A 2O0OA 2RE9A 3JQWA 3BKZA 2WN2A 4XMIA 1TMF2 2WKKA 2HLEA 4LKSA 4YVWC 5DZEA 3AK0A 5JI7A 2QZ2A 5E16A 2WO1A 2HWC1 5D21A 4XUTA 2GN7A 3OGRA 5C3OA 4XUNA 3CMGA 3OPTA 4SBVA 1QOTA 1UOGA 1H8TB 3MYXA 2ZZQA 2PQSA 4XXPA 4AXOA 4LEJA 1JZ2A 5FZ0A 2WC2A 3N7KA 1BCXA 3VBOB 4AHYA 2W1SA 5FYZA 5DZGA 3N7MA 4XBLA 5FMOL 3WHTA 2R1BA 1S1AA 2DCJA 1DGLA 5C3RA 3SH3A 3VGIA 2DUQA 2W2IA 2JEMA 4M3CA 4MHUA 3H1YA 3NNLA 5D8AC 3GBWA 4RR3B 1OC1A 4QPGB 4KU7A 5F3EA 4V1PA 3I2JA 3WEZA 5FZKA 3AMNA 2QQOA 2N7GA 5T3NA 3BIEA 2J1VA 3NWKA 2JG8C 4IEUA 4AE2A 1NLSA 2GDFA 1RMU3 2OZ6A 1MS4A 1H8TA 2RM21 2WFF3 4YGEA 1W90A 1W99A 5ABJB 1GZCA 1MQTB 1QGLA 2WR9A 3ZKYA 3BTYA 2DFCA 2A5ZA 4MGTA 1NZCA 2J1RA 1XYOA 3O1PA 2ZHKA 3RZZA 4XYXA 5A7OA 3HWJA 4YVSB 1N3QA 4XW3A 4DZGA 1U5YA 1QXPA 4Y33A 4HETA 4P5HA 4Y1ZA 3PIGA 2JDPA 2RR12 3CLPA 3DEMA 2R32A 3NQHA 4K3UA 3WQ1A 1H4GA 1I5PA 4ES8A 5DPNA 1VMJA 1WWYA 3TN91 1AR91 1ENSA 1JN2P 2VE1A 3W21A 3VDCA 4PCRA 3LKJA 2RJ2A 4KMQA 3FL7A 1RUI1 5FXXA 5GZDA 4AEDA 4ZU4A 3O7OA 5I8TA 2VTXJ 5FPBA 2QZ3A 1S0BA 4QPGA 2ZKNA 3UESA 3EXUA 4PLMA 3T2QA 4B1LA 4BMBA 2X53S 3IWZA 2ARCA 3VZNA 1OD3A 1OA2A 2B9VA 1O6UA 2XDVA 1ZZBA 3R4DB 4GMP1 5BUVA 2ERFA 5K8SA 1CN1A 2CGOA 2ZEZA 4DUVA 3KQ4B 2VMFA 5F6LB 3GBGA 2E9QA 2ZX3A 4P9LA 4CCEA 4AI1A 2ADEA 1W6QB 3NNJA 5LBBA 1FV2A 4GJYA 1JOPA 1LOFC 5LA0A 4LUKA 1CX4A 4YVSA 1PK6B 1CIYA 2ID4A 2PHLA 1HN0A 3Q8BA 4XE9A 2RV9A 5JZGC 4PIYA 1DG6A 3ZXEA 4YW3A 3M3CA 1J59A 3R0RA 2X10A 3FE5A 5FXVA 5HCFA 3HT2A 1W2OA 3R05A 1AVBA 1PHMA 1JYCA 1TVGA 3K4ZA 4LXLA 1W04A 5HI0A 1AR82 2FD8A 3RJ2X 3OUHA 2UWCA 1ULCA 1G86A 2WAOA 3ZR6A 5FR3A 3S6PA 1SCSA 1KFXL 4XFIA 1V6OA 3EQEA 3OEBA 5AVPA 5BNNB 4Y26A 1Z7S2 1EUTA 4WM7B 1SEFA 1W6NB 2HH9A 2C9AA 3ZXJA 4YGDA 1RINA 2GALA 2XL7A 1MZ5A 3WNXA 1VBD2 2PHRA 1W6QA 4FQZA 5CG9A 1ZBE2 5F5QA 2OS2A 1AR71 1QJX2 2VQ0A 2Y6LA 5FUIA 2YGMA 3ZFGB 2JIJA 1DYKA 1RUH2 1N1TA 2GH2A 1PMJX 3WV6A 4CCOA 3CNAA 4QX5A 5G04L 5J96B 2VNGA 4OHVA 3WINE 1QDOA 2HYXA 1UD1A 4HONA 3MLLA 2XOMA 4MGIE 3VV1A 5A3NA 2GC1A 4MADA 4XJWA 1O5UA 4MVTA 4ARYA 4CA9A 5I93A 3A0KA 2A73B 3WY6A 2O8OA 3WCSA 5DAWA 4CYDA 3ACGA 5IK8A 4HLTA 4GA9A 1QJY2 2PN5A 2NYYA 3VHRA 2WNEA 4KWUA 5T5LA 4UXAA 3HQRA 4WM7A 4FFFA 3POBA 4P9XA 3U11A 4OHWA 1W6NA 3IPVB 1FXZA 3FHQA 3S57A 4NIDA 4GH4B 3QACA 2WSVA 1H8TC 1AL22 1XOYA 2R0FA 1TNRA 2RS33 1WLTA 2E63A 1JBCA 3AJYA 4CZSA 3BALA 1C5HA 2ENRA 5FY1A 1C1LA 3RZGA 2XJSA 1BEV3 5GJ6A 1T2XA 3H9AA 3J8F1 5FO7B 2VZPA 1OF4A 2DVBA 4NO4A 1BVP1 1WKYA 3Q8AA 1SLIA 2DCYA 5LK5A 2MEV2 4BM8A 1V9U1 3OEAA 2NPIA 4D3WA 2JE7A 3DUIA 3CU7A 1OXCA 1S2KA 4AEDC 4E8DA 2Z42A 1ZVFA 1OH4A 4NHYA 4QPGC 4IETA 5EWSA 1N47A 3MF6A 4C1XA 1Y9QA 1JH5A 2DU0A 5DAXA 5IVYA 3POSA 4CUCA 1SMVA 1NA1B 5C33A 4AK3A 1GNYA 1PVC2 4RGKA 4HKOA 2QQJA 1U5IA 5GLTA 3LIGA 1TE1B 1W9FA 3P5BA 4CXWA 5LEKA 1ZRDA 1OHFA 1AZDA 1UCXA 2NLRA 2Y33A 2OUHA 3PHMA 2IXCA 2VBBA 4FP2A 2DTWA 2XGXA 5IJRA 4BIOA 4FT8A 3ZYFA 2O14A 2HEVF 3AJZA 1YFXA 2PXJA 3ELNA 4EWDA 5CG8A 3FUOA 1RUC2 4EN0A 5FXWA 4YVSC 5H9QA 4C0HA 4XVHA 3ZFFB 1CVNA 3B93A 2CWMA 4K20A 4K9SA 2ZX4A 3PL0A 1GZTA 5E89A 3NL1A 1NT0A 4BOWA 2ZGQA 4QQPA 1QDCA 5JVVA 3WF3A 4AI3A 1VIWB 5GKAC 4AG4A 1YUDA 2D5FA 1ZM1A 2A6ZA 3D0SA 3MIBA 4FXKB 5FP4A 1W9TA 3M4FA 4YG0A 4UFMA 1CPMA 4QM9A 2E7TA 1QJZA 1F8VA 2CGNA 2P37A
chains in the Genus database with same CATH topology
2BTVC 5HCBA 5GZCA 4XF3A 2A7AA 2D6NA 4LHKA 3VKFC 1H0BA 1CR7A 4G3YC 5DDJ3 1D0HA 4C1WA 1GZWA 1PIV1 5CBLA 2UWBA 2Z2SB 2B5HA 5BNQA 2D7FA 4CEYB 1C8NA 2IXHA 2HWF1 3RYKA 4B7KA 2IZWA 1S0IA 1OI6A 3JU9A 3FMGA 2ZPXA 2GNMA 4Q4X1 1COV2 3CF6E 4OZXA 2ZACA 1J3QA 1ZX5A 4WM7C 5KXCA 4HANA 2QE3A 4WVWA 4IEVA 1PGSA 2OZJA 4HMZA 4QGNA 1HRV3 2QQPA 1RJ8A 1TMF3 1ZRFA 1C8M2 3MFAA 1LOBA 1NE6A 3E6BA 3JUUA 4P9JA 3M3IA 1VLNA 2FQPA 4K6BA 2DTYA 3H7JA 3I2DA 2WS92 4MSVA 4WM8B 1R1A2 3AYEA 3TRSB 2JG9B 3PVNA 2WA3A 1O91A 3MI8A 1PVXA 2TUNA 1OPMA 3O0VA 3WP3A 1XQNA 1IS4A 4HN0A 4JDOA 1GANA 2ZMNA 4W6YA 1SCRA 2XBO2 2JECA 2VNRA 2PHUA 3DKWA 4QGLA 1KQRA 1W6OB 1GFF2 4LA2A 2EIGA 4GXLA 5HCAA 3WD5A 1PO22 1ENXA 2NM1A 2XJPA 2JG9A 4D94A 3V65A 4OLLA 2VMIA 2VMGA 5CB7A 2P3JA 1XNBA 1SQ4A 2RR13 2XLFA 3O5SA 4NVPA 5GZEA 5CU1A 2X5IB 4C0BA 1O4ZA 1RUD1 4W6XA 4D7TA 1VBB1 4JGYB 4FPYA 4KG0A 4L97A 1DQ6A 1S55A 3VHOA 4P9YA 2P17A 5IT6A 5JSRA 2DCTA 4E9KA 2OIIA 1SLCA 1LU2A 5H9PA 1LCLA 5EV7A 4AFMA 2UYBA 4UW5A 1W6OA 4FTBA 3GHMA 3NV3A 1X33A 3WX5A 1NY72 4C90A 2XVKA 1AHSA 5JDBA 3OY8B 3USSA 5H9SA 3ZVXA 3FLPA 3WR0A 3WCRA 1LHVA 4RGAA 1SBDA 4IQPA 1RUG2 3L2HA 3R4SA 1GLHA 4B4QA 5ACA1 4X6QB 4HBNA 2YPJA 4MV2A 2PA7A 2IXLA 2X5IA 2X8KA 2E53A 5IK7A 1JYIA 4PF5A 4MGZE 3BOPA 1AR83 4JGYA 1ND3B 1OQEA 2OYZA 1SFNA 1ZBA1 1CJDA 4ITCA 1PZ9A 1RUJ2 1OOPB 1RUOA 3W9AA 3MGUA 2FMDA 1VBD3 1DU3D 1RL3A 1ZBE3 3OY8A 1QJX3 3WG4A 4B8EA 4CDXB 3VLBB 4WZFA 3ZYRA 1LKNA 3NKGA 1RUH3 4FPHA 3AFKA 4LUMA 1FAYA 4YW1A 2ZTNA 4RGGA 3ZN4A 4JTOA 1SLAA 1V6LA 1PGL2 4E2GA 3WP4A 4IEQA 3E6CC 1VBE2 1ND3A 2ZX1A 2ZGKA 3LA7A 2D93A 2BWCA 1VBC1 1EV11 1E57A 2XWBB 4CP1A 5FDBA 1SLBA 2WZR1 1WW7A 4FCAA 4Y22B 3UKTA 3USUA 1MS3A 1BMV1 2MNGA 2DVGA 4Q4V1 2PYTA 4CDXA 1QNWA 5BNPB 4QQ2A 4EWEA 2JG9C 1TME1 4R9DA 1DQ2A 2XH6A 1GV9A 2A71A 2MEV3 2RS52 1JUHA 2ZHLA 4XJ8A 1AYN1 3AXEA 4D7SA 4AQ6A 3ZSEA 4KGGA 4BLIA 1XNKA 1HIXA 3VBSA 1FNZA 4DQAA 1LJ7A 2GC3A 1D4VB 2H6BA 4Y22A 2A6YA 5I91A 3GYDA 3J26N 4LBMA 3ZFEB 1PGW2 2Y38A 4H14A 2ZX2A 5DXDA 2JJ6A 4RQPA 1IPJA 4XTMA 1N1VA 1HDKA 1QOOA 2R041 4Q4Y2 1VBA2 5BNPA 1RUC3 1IS5A 3AYAA 1F5FA 2QDNA 1YFUA 2WIIB 4BA6A 4YGBA 2CL2A 1CAUB 1R081 5LRRA 5SV5A 4C91A 2Z5WA 4G4FA 1D4M2 2X5IC 3WUCA 5LEJA 5FQ0B 2AREA 2PHFA 3ZYJB 4JGYC 2ZGOA 4Q29A 1XXNA 1C4RA 2WT1A 2Y26A 4XETA 2JENA 1MS1A 1HQNA 4LBQB 1X7NA 5FLHA 1BBT2 2XKOA 3ZFEA 2W0XA 3VDDB 3V0BB 1TEIA 1DGWA 4JDNA 4N53B 1QQP2 4K8FA 4GB32 1LHUA 1LRHA 1YFYA 2JICA 3FLRA 1FI2A 2EXHA 3RMXA 2WNVB 3APBA 3UV9A 3LA2A 4HK9A 1N3OA 4HKWA 2HWB1 3AZZA 1U5ZA 2HWE2 1IHMA 1Z7S1 1NQDA 4XEZA 5C4WB 5FQ0A 2BWAA 5DUWA 1W0OA 3IBMA 1I6XA 1COV3 1KITA 1ND3C 1UU4A 4EN9B 5KHKA 4XQWA 4LBQA 3M7AA 1ZRCA 3B00A 4XJZA 3CJXA 4CDQA 2VXRA 1UL9A 3VDDA 3AKRA 4N53A 4L9BA 1V6IA 2NP0A 1KXGA 1ULGA 4AVTA 4QT6A 4A7ZA 4CDXC 3IM0A 3ZXAC 3IT8A 4PJYA 2WNVA 4AVSA 3JD72 4XF0A 4Y1UA 4CP2A 1LR5A 4H7MA 4H55A 1I9RA 1QJY1 2RS12 3H8UA 4Y4YA 3I59A 4L8QA 4OHYA 2XG3A 1R1A3 3BTAA 5J7MA 3AKQA 3RI8A 1AL21 5C8CB 1M4WA 4OI0A 1U5XA 5FTTC 1VRH1 2DURA 3VBSC 1X8EA 4ATFA 3TNQA 4NHMA 1IZ3A 2XKPA 3IDEA 2XBO3 4GMP0 1W6MA 3ATGA 4XFAA 3O14A 4BPZA 4LTAA 4RQPC 1YO8A 4MUVA 1ENQA 4XHBA 5BNPC 1EY2A 1VB4A 4OUSA 1OMIA 3R4UA 1BK1A 1KJLA 2IC1A 4K1ZA 2D40A 2VVFA 3AFGA 1HKDA 1PO23 4AFBA 4B4RA 1PVC1 4Y24A 5A32B 5I8SA 4YM0A 5C8CA 3WZ1A 4KG8A 3AMPA 5JOXA 3THPA 5K0UB 1Z78A 2ZABA 5J36A 1LB2A 1XU1A 4W6WA 1FOD1 1RUE1 3GNEA 4AFCA 2ARBA 5FAXA 2UYAA 4K40A 4PDWB 5JSPA 1PO12 5JPMB 3ZFEC 2ZZJA 1BYHA 1VAKA 4YM3A 4NWVA 2I45A 2ET7A 3IDBB 1LEMA 4RS5B 4FOYA 2B9UA 3JBG2 4I0AA 3NW4A 3D4KA 3SLIA 5FOBB 4BQ1A 2A6WA 2DF7A 4AGGA 4XFBA 4B7EA 4NHKA 5SV8A 1NLRA 1MEC2 1CAVB 2HJIA 1LHNA 5FREA 1RUG3 3IDCB 4LULA 4LHNA 2EAKA 1XYNA 4FPKA 2R49A 3RMYA 1FPN2 4PDWA 2PLV1 2WINB 4CDQC 2R072 3KT4A 3P3PA 3VDDC 3KB5A 4N53C 1POV3 2VG9A 4Q4W1 3UJOA 4DFSA 2BW8A 1R091 4YW4A 4RS5A 1AR61 1FMD1 1RUF3 4AFDA 1RUJ3 2WNVC 1EAH1 2OW4A 4YZ2A 1V6JA 3WDWA 3NKTA 1RIRA 3VL9A 1WCKA 3JB8A 3VBHB 4RHV1 4YG3A 1CAVA 5I0UA 2WL1A 4MGYE 5KHHA 2D3PA 4DB5A 4DY3A 4YARA 1H2NA 3EJKA 1GNHA 2B45X 1OKQA 4U2AA 4AVBA 4FBFA 1C8M1 1Q3EA 1LGCA 4L11A 4HVQA 5KHJA 2TEPA 2HKXA 2A70A 1VBE3 1RVF2 4AQ2A 1LGBA 1HQLA 4XF9A 3ZX7A 4Q8LA 5F1RA 1H2LA 2WS91 3VBOA 1WGPA 3ZSJA 1HV0A 5J48A 5IK5A 2B46X 1DHKB 1Y7BA 4LO5B 3JCIA 3VBHA 5KC6A 4RR3A 5JIAA 3ZSKA 5L7OB 1YFWA 1OLQA 5AC91 1MZFA 1GQHA 2E7AA 2EF6A 5BYNA 1DQ4A 5C8CC 1H30A 2TBVA 3HIFA 4YFWA 2ZOEB 2RS53 4QHBA 4N90A 1DYPA 1RHI2 5ABJA 1MQTA 2ETEA 5C9AB 2ZGTA 5GZGA 1Y3TA 1S0DA 2VOKA 5EYXA 2R062 4ZKTB 1FT9A 1V6KA 4N43B 1QOSA 1QJU2 3K48A 4UBGA 4BYYA 4DXZA 2EXJA 5JCTA 4BHPA 4Y1XA 5EJ3A 3ETQA 2LM3A 2UWAA 3FUQA 3MDPA 4QD2A 5L7OA 1G9BA 4WVVA 2OUJA 3M3QA 1NG0A 4FO9A 4Q4Y3 1BJQA 1VBA3 4KWLA 1MACA 2VMHA 1UPIA 1L3JA 5GLWA 5KXEA 2ZGSA 3HAGA 3KMHA 2HYKA 2QDRA 5C9AA 1JW6A 1BZWA 1YJKA 1D4M3 4HPKB 4PDWC 2A6XA 2P3IA 3PJYA 1U0AA 1CAXB 4NPRA 1JTZX 4ZU5A 1PK6A 3MW3A 2YDEA 4XIOA 2BFUS 4K21A 3VKMA 3ES4A 1BBT3 4RS5C 2WNUB 2JD4A 1HXS2 3GZTB 4Q1PA 1WLDA 3RQ0A 4YGCA 3QH6A 3H0OA 1QQP3 4GB33 2E7QA 2IFRA 3BU7A 3IKWA 4XQDA 2R0HA 3T1MA 1ZYBA 3UL2A 1S0CA 3LSDA 1W0PA 2W39A 3WP6A 1UX6A 2DVFA 4S2GA 1BXHA 1QMJA 2NQYA 2SLIA 4L2NA 5BNNA 5IUQA 2HWD2 3VZOA 2QFEA 4LLOA 2HWE3 4HPKA 4ISRA 4N7IA 4OULA 3LA3A 4OHZA 1HX6A 3ZFGA 4I3GA 3SMHA 1XE8A 3VBOC 1UKGA 4Q26A 4YZ5A 3M3OA 1LHOA 2R30A 4N9IA 1RMU1 2WFF1 3VBHC 4RR3C 1IPKA 4XIKA 2DU1A 3JD73 1ASJ2 2FZ2A 3IPVA 5T52A 3B9CA 2RS13 2BEOA 3A4UA 4GH4A 3RS6A 4QPYA 4YSFA 5ABJC 1MQTC 3OJBA 2VVDA 4LBNA 3N7JA 4XFHA 2RMU2 4FPGA 3SCFA 2YZ4A 3RWNA 1XNCA 3ALQA 4R4XA 4XOGA 3UJQA 3K51A 4XBQA 1I1EA 1CAWB 2VNOA 4YM1A 1AXKA 3OD4A 1O5LA 4XBNA 5L7OC 3VKOA 2VECA 1QXJA 3JB4C 1NA1A 1N3PA 1APNA 1HRI2 3DPRB 3FWEA 5CVRA 2Q4SA 5JOZA 3N4MA 5C9AC 1S0EA 1BQPA 5HXVA 4FPJA 4IESA 3RNSA 5JOYA 3LSEA 1PK6C 1Q8SA 3ZFFA 3OYWB 1LEDA 3SITA 1PZ7A 1RGSA 1AYM2 2F6BA 4PBPA 1PO13 1WW4A 5IK4A 3HN1A 1ZZ7A 4LR4A 3WW3A 1CAWA 2PAEA 5J09A 5J37A 1J1TA 2V09A 3UK9A 2AYHA 4TWTA 4AI2A 4ES9A 1HQWA 1LOAA 2PHTA 5EFUA 2HWC2 3JBG3 3J9SA 1HLCA 5BNNC 2GNTA 3DPRA 5JAXA 3A0NA 2OVUA 3I54A 1UIJA 2LUWA 3FHIB 1KS5A 2WLPA 1LULA 1MEC3 3OBRA 1NOVA 3POWA 3ZFGC 2PAMA 4CEYA 4HFSA 2VULA 1CIWA 1FPN3 4W65A 4FTEA 2BVBA 2LALA 4CDUB 3GALA 4N9HA 1VAMA 4AVCA 4PIXA 5FPXA 2ET1A 2R073 1EYBA 4AGRA 1U12A 4ASLA 4XF4A 4TSVA 3BB6A 4HT1T 3SH5A 2A3YA 3VL8A 2ZGPA 1MVQA 4HN1A 2RS31 5FFOC 3AP4A 4X8NA 1GICA 2GU9A 4UW6A 3WW2A 2R6QA 1F5JA 3CJIB 3SCHA 5FOJB 1BEV1 4E4SA 2C1FA 2RM22 3D82A 4ORFA 1OA4A 4GH4C 1GZ9A 5FCCA 1I5ZA 1REDA 4OFGA 4EN8B 1REFA 4GKXA 4HVRA 2OA2A 5GALA 3AMMA 4WZCA 4FPCA 2RJLA 4UW3A 5DG1A 3KQRA 3TN92 2Q8OA 1J3RA 1RUI2 4EROA 3OCPA 4WM8A 1RVF3 4XTPA 4OHXA 1VB2A 1W6PB 3E97A 2IWGB 4FOVA 3M70A 5GLUA 1G9AA 1YYNA 4Z92B 3NAPB 2AH2A 3ZN5A 1H4HA 1NA1C 2WA4A 4JQRA 4XJ9A 1JUIA 1DQ1A 1ALYA 2VOXA 3KT1A 4XJAA 2XJTA 4KBBA 3U07A 3ZIWA 2AR6A 5FLJA 2BNOA 4MX3A 2BGCA 4XDQA 3ZFFC 1LTEA 1RHI3 3AYCA 1LESA 2D6KA 4LO8A 3ZDSA 2R063 4DRRA 1WCDJ 1W6PA 2BYVE 5DDJ1 4AQTA 3H3ZA 2GN3A 2B39A 1I3HA 1QJU3 5C6CA 4GWMA 2ZGLA 3VBUB 1R1ZA 3T2TA 3O0XA 4XXAA 3DGTA 1YHFA 4YZ3A 4FOQA 3DPRC 5D1IA 2GC0A 2CTVA 2ZBJA 3B02A 3FX3A 2XVGA 4IEZA 2JE9A 3VHPA 5GZFA 1UW8A 1RUF2 4ONUA 3D8CA 1GYKA 2D6PA 5FLIA 2VPVA 3WG3A 4CEYC 4LT5A 5T5PA 2I07B 1AF9A 3TAYA 4MH0E 1NQJA 5L73A 2C5DA 4BH9A 3ZYPA 1XYPA 1JXNA 4YYOA 3ZO0B 1VP6A 3EBRA 4L92A 4E2QA 1HRV1 5DZFA 1O4YA 1UN1A 2VUAA 1HXS3 3WDVA 4BZ4A 1TMF1 2IFWA 3Q9OA 3ZMOA 5E1RA 2XJUA 3CL1A 3AKTA 4JRAA 1FPN1 1SBFA 3MICA 3S0MA 2GAUA 2ZGMA 5JWPA 1FNYA 3J8F2 4BLJA 3TBDA 2XLAA 4LO6B 1OOPA 2HWD3 4AI0A 1IS6A 1CESA 4KQ7A 1V9U2 3ASIA 5JLVA 4I3PA 4COWA 1O7FA 5JOWA 1LOCA 3AZVA 4WM8C 2ZHNA 3OTFA 4G9SB 3WG2A 1XNDA 4X6RB 3VKLA 5J3UA 2WZPP 3VBFB 1YXWA 3C3VA 1YNAA 1UAIA 4LBQD 4AHWA 3NJZA 1UU6A 1B09A 3VBRB 1IOAA 4D69A 4FPLA 5I8YA 2XPJA 3RYRA 4PBOA 1C5IA 3PMEA 2B7YA 1ASJ3 2JKBA 3ENRA 2EALA 3MLKA 3O12A 4N7UA 3H1WA 2KA3A 3PNAA 4Q0QA 2I2SA 2AUYA 2RR11 4DINB 1NCQB 4Q0UA 3B01A 4WV8A 3N7LA 5GM0A 5J98B 3B7MA 2Q5TA 4AWDA 1Q8OA 3AP5A 1V6MA 4IEYA 4F8AA 2RMU3 3AM2A 4QQHA 2VGDA 3VBFA 2C0ZA 3FJSA 2IXIA 1C28A 1Z0HA 2XL9A 3VBRA 1O3TA 1LOGA 2YGLA 1A8DA 1LECA 1PIV2 2A3WA 5I0TA 2EA7A 2DVDA 1CGPA 4YW2A 3PJQA 4EWAA 3ILRA 3OD0A 4AEKA 1HRI3 4GALA 2RJKA 4LE3A 2UY9A 2HWF2 4QPIB 5CIRA 1A6CA 4MZUA 3FBYA 5KC5A 4JGZB 1YCIA 4Q4X2 3TB0A 5KXDA 4I09A 4XHXA 3ILFA 4I01A 1AR81 3M8LA 1H2KA 2XHKA 1MS0A 5JPNB 3NVCA 2GMMA 1AYM3 3PMSA 1WMDA 2D43A 1CAUA 1OFSA 3N36A 3ST7A 1ZZCA 4P14A 4HKLA 3VZLA 2YV8A 3OF1A 2D3SA 2ZGUA 1UF2C 1AXZA 3KZ4C 1VBD1 4LBJA 3NV1A 4CTEA 5LEKA 1ZBE1 1OSGA 4O9GA 2BQPA 1QJX1 2D6LX 2DV9A 3D6EA 2HWC3 3MLJA 1A78A 4YZ1A 4XFCA 5K7PA 1RUH1 3CEWA 4QPIA 1OOPC 5JR7B 3V0BA 2JXAA 2CYFA 1TQ5A 4YM2A 4EN7B 4P9WA 4AHZA 2CAVA 1OQ1A 3PVOA 1G9FA 2QJVA 2Y0IA 2D44A 1Q43A 4F3JA 2YUEA 1DGWX 3WDXA 3QD6A 4R9AA 2XUMA 4FTSA 1PMIA 5JIUA 2JG8B 1QXRA 5C4WA 1J58A 1DLLA 4IL7A 5EZWA 2D97A 5LK7B 3AKPA 4XPVA 3AMQA 3L9JT 3FC0A 1F31A 2BNMA 2RM23 4LBOA 3ZIXA 2H0VA 1A8MA 4TLFA 1SACA 4R8HA 2VU9A 4ZXKA 3VUOA 2MEV1 3MEPA 1UKRA 4OUMA 4AW7A 5FMOS 1AXYA 5DUUA 3V0AB 3I4IA 3DL3A 1O4TA 3TN93 3ZXKA 3VBFC 1RUI3 3KCCA 2O8QA 1RUD2 5DUXA 1KS4A 3VBRC 4DMIA 1VBB2 1UMZA 4AFAA 4GMP3 5I0SA 1ZREA 5KHGA 1RUC1 4KGQA 1H9PA 2LTNA 5JZGB 4Y1YA 3MIHA 2FMYA 4FXGB 4AQSA 3JQXA 2E6VA 1GNZA 1LODA 3WDTA 1SDWA 3KD4A 4IV3B 4IEPA 4FAGA 5CA6A 2KM2A 4M3CE 3BODA 1CD3G 3M1HA 5ACA2 3FBMA 3WW1A 1DQ0A 1G8WA 2A3XA 3AKSA 3VZMA 4P9IA 3GZAA 4EJRA 5A32A 3KLSA 3CO2A 2UY8A 4FVVA 4LHLA 1UZYA 1VALA 5K0UA 1UU5A 1ZBA2 1DZTA 2Z69A 1QF3A 1X8MA 1ZZ6A 4Z07A 2P3KA 4WVZA 1QU0A 2VW2A 1MS9A 2ZAHA 4OI1A 5KXBA 1D2QA 4QPIC 3U0ZA 5BNOB 1WLWA 3NSTA 1QY4A 1AJOA 4IV3A 1BKZA 3BCWA 4YZ4A 2H6CA 4IERA 3C2UA 3N35A 4JC1A 3UKVA 2AENA 4DY5A 1Q8QA 2Y0OA 2CGPA 2EAAA 1COV1 2ATFA 4M00A 1FX5A 5KHIA 3KGZA 2BVVA 2VW1A 5FRAA 4J1XA 4LO7A 4IEXA 3H3UA 2VH9A 4Q27A 5C4WC 1N1SA 3AP6A 2DUOA 2VY0A 4WBBA 5AFBA 3TWIA 1VBC2 2Z79A 1EV12 2YC0A 1ZZ9A 2IXJA 4E4ZA 2WZR2 2G4IA 1OPOA 1IKQA 3MIFA 4QMAA 1BMV2 4XILA 5BNOA 3ZMNA 2AZ5A 4Q4V2 2PELA 4JVAA 3WOGA 1XU2A 1WW6A 4K7JA 4ATEA 2WQ4A 3B69A 3J8F3 1IGOA 4RD7A 4XZPA 4J6GA 1TME2 3N3HA 4P9GA 1R1A1 1X36A 4QGMA 3SISA 4GKYA 5H9RA 1AL0G 2FZ1A 1CONA 3L2YA 1AYN2 1V9U3 4LNVA 1WLCA 4E27A 5K9YA 5F6KA