2B90A

Crystal structure of the interleukin-4 variant t13dr85a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
HKCDITLQEIIKDLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKALDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A modular interface of IL-4 allows for scalable affinity without affecting specificity for the IL-4 receptor
pubmed doi rcsb
molecule keywords Interleukin-4
molecule tags Cytokine
source organism Homo sapiens
total genus 47
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00727 IL4 Interleukin 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 2b90A00
1CSGA 4DOHA 2B8YA 4I77Z 1HIKA 2IL6A 3SE4B 1ITIA 4WRLB 2ILKA 3BESL 1P9MB 3S9DA 1RHGA 1RFBA 1HZIA 3QB1A 3QT2C 1NBPA 1Y6ML 1Z92A 1BBNA 1M4BA 1CN4C 4NEMA 4NI7A 1ITFA 4PS4A 2B91A 4NKQC 3D48P 1LK3A 5D72A 4NEJA 1D9GA 1HULA 1HWHA 3B5KA 3D87A 3PIVA 2L3OA 3QAZA 3INKC 5KNHI 1EVSA 1HWGA 5D22A 5D28B 3UF2A 2B8XA 1BGCA 2E9WC 1ETEA 1M4RA 1B5LA 3PIWA 1Y6KL 3Q1SI 1ALUA 2D9QA 3HMXB 5L6YC 1FYHA 1VLKA 2B8ZA 1IARA 3BPNA 1IRLA 2CYKA 1PW6A 3OQ3A 1Z7CA 1AX8A 4X51A 1BP3A 1HGUA 1M48A 3NPZA 1A22A 1EKUA 5D71A 1Y6NL 2Q7NB 1M49A 2O27A 1PVHB 1ILKA 1F6FA 1RCBA 3NCBA 1RW5A 3UX9A 1HUWA 1JLIA 3UEZE 2B5IA 4MHLA 1N1FA 1GA3A 4YQXA 3D85C 1D9CA 2KZ1A 4FA8E 5D70A 4ZS7A 1M4AA 4NI9A 1KF9A 3EW3A 2L3YA 1HIJA 1BGDA 4YUEC 1SCFA 3N06A 3N0PA 1AU1A 4GRWA 1M4CA 1ITLA 3G9VB 3LB6B 1EXZA 1CNT1 2GMFA 2D48A 1YKBA 2O26A 3L5XA 1J7VL 4ZF7A 2Q98A 1A7MA 1EERA 5FUCA 1BGEA 3L5WI 1IK0A 3G6DA 2LMSA 1CD9A 2H24A 5FHXA 4RS1A 3SE3B 3HHRA 4O6KA 1QVNA 5LQBA 5C7XA 3DLQI 1PGRA 3DUHC 1I1RB 3LB6A 3VA2A 1FG9A 3QB7A 3UF5A 1M47A 1BCNA 4O9HA 1EMRA 2LAGA 1AXIA 3EJJA 1CYLA 2B8UA 3WCYI 2ERJD 2HYMB 1INRA 4YPGC 3BPLA 3BPOA 4CNIC 2B90A 1ITMA 3NCCA 3QWRB 1BUYA 3MZGA 1V7MV 1LKIA 1LQSL 1IJZA 4J4LC 5E4EA 1IL6A 1PY2A 2INTA 3NCEA 1GNCA 3NCFA 4Z5RD 4YDYI 3DGCL 1V7NV 1F45B 1WU3I
chains in the Genus database with same CATH superfamily
2C35A 3SE4B 2JA7D 2B63D 1RFBA 1HZIA 4U4TA 5D6KA 4NEMA 3HOWD 4ZW9A 4NKQC 1LK3A 1HWHA 5KNHI 1EVSA 5GXBA 3OG6A 1ETEA 1ALUA 4A3BD 5L6YC 4YB9D 4JR9A 1AX8A 3H0GD 1M48A 3NPZA 1A22A 1Y6NL 2CFPA 4IU9A 1PVHB 1F6FA 1PV7A 1RCBA 3NCBA 3FKID 3WDOA 3D85C 2KZ1A 4NI9A 2L3YA 1HIJA 5EQGA 3G9VB 3HHCA 3LB6B 2D48A 1YKBA 4A3FD 4ZF7A 1EERA 4A3LD 1IK0A 2PSMA 1CD9A 5FHXA 2XQBA 5FLMD 4QIQA 5LQBA 4A3ED 3AYHA 1I1RB 2ERJD 1INRA 2B90A 4BY7D 1Y1VD 4APSA 3NCEA 1GNCA 3NCFA 4Z5RD 1V7NV 4IKZA 1F45B 4LDSA 1CSGA 2B8YA 2V8NA 3I4MD 5D59A 3S9DA 5C65A 1RHGA 3QB1A 4PYPA 1Y6ML 1CN4C 4NI7A 4A93D 4TPHA 4LEPA 4UVMA 4A3CD 2Z3RA 4D2CA 3HOYD 1HULA 3PIVA 3D87A 3HOUD 2R93D 5IP9D 4OH3A 5D28B 3UF2A 3I4ND 1M4RA 1B5LA 1Y6KL 3HMXB 1FYHA 4BBSD 1IRLA 3IRHA 1PW6A 1Z7CA 1BP3A 5D71A 1PV6A 4IKYA 4Q65A 1HUWA 1JLIA 3UEZE 1M4AA 3EW3A 3N06A 4BXXD 3PO2D 4A3DD 1M4CA 4A3ID 2GMFA 3L5XA 2O6IA 4A3JD 5FUCA 2H24A 3SE3B 4W6VA 4O6KA 5C7XA 3DLQI 1PGRA 3LB6A 3VA2A 3O7PA 1BCNA 4U4WA 1EMRA 2LAGA 5IP7D 4BY1D 4CNIC 3NCCA 4GS7A 3H3VE 5C44D 1LKIA 1LQSL 1IJZA 5E4EA 1PY2A 4IU8A 4DOHA 4I77Z 2IL6A 4A3KD 4D2DA 2ILKA 3BESL 1P9MB 3QT2C 1M4BA 4PS4A 2B91A 3D48P 5D72A 4NEJA 2R92D 3B5KA 3INKC 2Q14A 5D22A 4ZWBA 5A2NA 1BGCA 5TS9A 1VLKA 2Z3QA 2CYKA 3OQ3A 4LRLA 3HOXD 4OAAA 1ILKA 2JA6D 1RW5A 4MHLA 1N1FA 1GA3A 4YQXA 5D70A 4A3GD 1KF9A 4YUEC 4IKWA 1AU1A 1CNT1 2O26A 3L5WI 3G6DA 5IYBD 4RS1A 3HHRA 1QVNA 3DI3A 4D2BA 3DUHC 2CFQA 1FG9A 3DI2A 3UF5A 4O9HA 4GBYA 4ZYRA 4GBZA 4NN5A 4YBQA 3BPLA 2JA8D 1WCMD 2XUTA 1BUYA 2INTA 1WU3I 4TPJA 5C4XD 4NN7A 1HIKA 1ITIA 4WRLB 4DKFA 4DKCA 4ZWCA 1NBPA 1Z92A 1BBNA 3HOZD 1ITFA 1D9GA 2L3OA 3QAZA 5C3ED 3PO3D 1Y1WD 1HWGA 4JREA 4XNJA 2B8XA 2E9WC 4GC0A 3PIWA 2Y5YA 2D9QA 4EXNA 1Y14A 4IKVA 2B8ZA 1IARA 3BPNA 5IYDD 4X51A 1HGUA 5EQHA 1EKUA 3HOVD 2Q7NB 1M49A 2O27A 2JA5D 3UX9A 2B5IA 5EQIA 4BBRD 1D9CA 4FA8E 4ZS7A 4JA3A 1BGDA 1SCFA 3TGXB 3N0PA 4GRWA 1ITLA 1EXZA 4NN6A 1J7VL 2VUMD 1A7MA 2Q98A 1BGEA 5A2OA 4IKXA 2LMSA 5IYCD 4DKDA 4XNIA 3O7QA 2OQPA 4A3MD 1PW4A 3QB7A 4DKEA 1M47A 1AXIA 5D58A 3EJJA 1CYLA 2B8UA 3WCYI 2HYMB 4YPGC 2R7ZD 3BPOA 1ITMA 4J05A 3OG4A 3QWRB 4TPGA 4EXPA 3MZGA 1V7MV 4J4LC 1IL6A 4YDYI 3DGCL 3Q1SI 4U4VA
chains in the Genus database with same CATH topology
1CSGA 5C4XD 2C35A 4NN7A 2B8YA 4I77Z 4DOHA 1HIKA 2IL6A 3SE4B 2JA7D 1ITIA 4A3KD 4WRLB 3I4MD 4DKFA 2ILKA 3BESL 1P9MB 4DKCA 3S9DA 2B63D 1RHGA 1RFBA 1HZIA 3QB1A 3QT2C 1NBPA 1Y6ML 1Z92A 1A7MA 1BBNA 1M4BA 3HOZD 1CN4C 4NEMA 4NI7A 3HOWD 4A93D 1ITFA 4PS4A 2B91A 4NKQC 3D48P 1LK3A 5D72A 4A3CD 2Z3RA 4NEJA 2R92D 3HOYD 1D9GA 1HULA 1HWHA 3B5KA 3D87A 3PIVA 3HOUD 2R93D 2L3OA 3QAZA 5IP9D 3INKC 5C3ED 3PO3D 5KNHI 1EVSA 2Q14A 1Y1WD 1HWGA 5D22A 5D28B 3UF2A 2B8XA 1BGCA 2E9WC 3I4ND 3OG6A 1ETEA 1M4RA 1B5LA 3PIWA 1Y6KL 3Q1SI 1ALUA 2D9QA 5TS9A 3HMXB 4A3BD 5L6YC 1FYHA 4EXNA 1VLKA 1Y14A 2B8ZA 1IARA 2Z3QA 3BPNA 4BBSD 1IRLA 2CYKA 5IYDD 3IRHA 1PW6A 3OQ3A 1Z7CA 1AX8A 3H0GD 4X51A 4LRLA 1BP3A 1HGUA 1M48A 3NPZA 1A22A 1EKUA 5D71A 3HOXD 1Y6NL 2Q7NB 3HOVD 1M49A 2O27A 1PVHB 1ILKA 1F6FA 2JA5D 1RCBA 3NCBA 1RW5A 2JA6D 3UX9A 1HUWA 1JLIA 3UEZE 3FKID 2B5IA 4MHLA 1N1FA 4BBRD 1GA3A 4YQXA 3D85C 1D9CA 2KZ1A 4FA8E 5D70A 4ZS7A 1M4AA 4NI9A 4A3GD 1KF9A 3EW3A 2L3YA 1HIJA 1BGDA 4YUEC 1SCFA 3N06A 3TGXB 3N0PA 1AU1A 4GRWA 1M4CA 3PO2D 4A3DD 4BXXD 1ITLA 3G9VB 3HHCA 4A3ID 3LB6B 1EXZA 1CNT1 2GMFA 2D48A 1YKBA 2O26A 3L5XA 4NN6A 1J7VL 2O6IA 4ZF7A 2Q98A 4A3FD 1EERA 4A3JD 5FUCA 1BGEA 2VUMD 3L5WI 2PSMA 4A3LD 1IK0A 3G6DA 2LMSA 1CD9A 2H24A 5FHXA 4RS1A 3SE3B 3HHRA 2XQBA 5IYBD 5IYCD 5FLMD 4O6KA 1QVNA 3DI3A 4DKDA 5LQBA 4A3ED 3AYHA 5C7XA 2OQPA 1PGRA 3DLQI 3DUHC 1I1RB 3LB6A 4A3MD 3VA2A 1FG9A 3DI2A 3QB7A 4DKEA 3UF5A 1M47A 1BCNA 4O9HA 1EMRA 2LAGA 1AXIA 5IP7D 4NN5A 3EJJA 1CYLA 2B8UA 3WCYI 2ERJD 2HYMB 1INRA 4YPGC 3BPLA 4BY1D 2JA8D 2R7ZD 3BPOA 4CNIC 2B90A 1ITMA 4BY7D 1WCMD 3NCCA 3OG4A 3QWRB 4GS7A 4EXPA 3H3VE 1BUYA 3MZGA 1V7MV 5C44D 1LKIA 1LQSL 1IJZA 1Y1VD 4J4LC 5E4EA 1IL6A 1PY2A 2INTA 3NCEA 1GNCA 3NCFA 4Z5RD 4YDYI 3DGCL 1V7NV 1F45B 1WU3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSG A;  4DOH A;  2B8Y A;  4I77 Z;  1HIK A;  2IL6 A;  3SE4 B;  1ITI A;  4WRL B;  2ILK A;  3BES L;  1P9M B;  3S9D A;  1RHG A;  1RFB A;  1HZI A;  3QB1 A;  3QT2 C;  1NBP A;  1Y6M L;  1Z92 A;  1BBN A;  1M4B A;  1CN4 C;  4NEM A;  4NI7 A;  1ITF A;  4PS4 A;  2B91 A;  4NKQ C;  3D48 P;  1LK3 A;  5D72 A;  4NEJ A;  1D9G A;  1HUL A;  1HWH A;  3B5K A;  3D87 A;  3PIV A;  2L3O A;  3QAZ A;  3INK C;  5KNH I;  1EVS A;  1HWG A;  5D22 A;  5D28 B;  3UF2 A;  2B8X A;  1BGC A;  2E9W C;  1ETE A;  1M4R A;  1B5L A;  3PIW A;  1Y6K L;  3Q1S I;  1ALU A;  2D9Q A;  3HMX B;  5L6Y C;  1FYH A;  1VLK A;  2B8Z A;  1IAR A;  3BPN A;  1IRL A;  2CYK A;  1PW6 A;  3OQ3 A;  1Z7C A;  1AX8 A;  4X51 A;  1BP3 A;  1HGU A;  1M48 A;  3NPZ A;  1A22 A;  1EKU A;  5D71 A;  1Y6N L;  2Q7N B;  1M49 A;  2O27 A;  1PVH B;  1ILK A;  1F6F A;  1RCB A;  3NCB A;  1RW5 A;  3UX9 A;  1HUW A;  1JLI A;  3UEZ E;  2B5I A;  4MHL A;  1N1F A;  1GA3 A;  4YQX A;  3D85 C;  1D9C A;  2KZ1 A;  4FA8 E;  5D70 A;  4ZS7 A;  1M4A A;  4NI9 A;  1KF9 A;  3EW3 A;  2L3Y A;  1HIJ A;  1BGD A;  4YUE C;  1SCF A;  3N06 A;  3N0P A;  1AU1 A;  4GRW A;  1M4C A;  1ITL A;  3G9V B;  3LB6 B;  1EXZ A;  1CNT 1;  2GMF A;  2D48 A;  1YKB A;  2O26 A;  3L5X A;  1J7V L;  4ZF7 A;  2Q98 A;  1A7M A;  1EER A;  5FUC A;  1BGE A;  3L5W I;  1IK0 A;  3G6D A;  2LMS A;  1CD9 A;  2H24 A;  5FHX A;  4RS1 A;  3SE3 B;  3HHR A;  4O6K A;  1QVN A;  5LQB A;  5C7X A;  3DLQ I;  1PGR A;  3DUH C;  1I1R B;  3LB6 A;  3VA2 A;  1FG9 A;  3QB7 A;  3UF5 A;  1M47 A;  1BCN A;  4O9H A;  1EMR A;  2LAG A;  1AXI A;  3EJJ A;  1CYL A;  2B8U A;  3WCY I;  2ERJ D;  2HYM B;  1INR A;  4YPG C;  3BPL A;  3BPO A;  4CNI C;  2B90 A;  1ITM A;  3NCC A;  3QWR B;  1BUY A;  3MZG A;  1V7M V;  1LKI A;  1LQS L;  1IJZ A;  4J4L C;  5E4E A;  1IL6 A;  1PY2 A;  2INT A;  3NCE A;  1GNC A;  3NCF A;  4Z5R D;  4YDY I;  3DGC L;  1V7N V;  1F45 B;  1WU3 I; 
#chains in the Genus database with same CATH topology
 2C35 A;  3SE4 B;  2JA7 D;  2B63 D;  1RFB A;  1HZI A;  4U4T A;  5D6K A;  4NEM A;  3HOW D;  4ZW9 A;  4NKQ C;  1LK3 A;  1HWH A;  5KNH I;  1EVS A;  5GXB A;  3OG6 A;  1ETE A;  1ALU A;  4A3B D;  5L6Y C;  4YB9 D;  4JR9 A;  1AX8 A;  3H0G D;  1M48 A;  3NPZ A;  1A22 A;  1Y6N L;  2CFP A;  4IU9 A;  1PVH B;  1F6F A;  1PV7 A;  1RCB A;  3NCB A;  3FKI D;  3WDO A;  3D85 C;  2KZ1 A;  4NI9 A;  2L3Y A;  1HIJ A;  5EQG A;  3G9V B;  3HHC A;  3LB6 B;  2D48 A;  1YKB A;  4A3F D;  4ZF7 A;  1EER A;  4A3L D;  1IK0 A;  2PSM A;  1CD9 A;  5FHX A;  2XQB A;  5FLM D;  4QIQ A;  5LQB A;  4A3E D;  3AYH A;  1I1R B;  2ERJ D;  1INR A;  2B90 A;  4BY7 D;  1Y1V D;  4APS A;  3NCE A;  1GNC A;  3NCF A;  4Z5R D;  1V7N V;  4IKZ A;  1F45 B;  4LDS A;  1CSG A;  2B8Y A;  2V8N A;  3I4M D;  5D59 A;  3S9D A;  5C65 A;  1RHG A;  3QB1 A;  4PYP A;  1Y6M L;  1CN4 C;  4NI7 A;  4A93 D;  4TPH A;  4LEP A;  4UVM A;  4A3C D;  2Z3R A;  4D2C A;  3HOY D;  1HUL A;  3PIV A;  3D87 A;  3HOU D;  2R93 D;  5IP9 D;  4OH3 A;  5D28 B;  3UF2 A;  3I4N D;  1M4R A;  1B5L A;  1Y6K L;  3HMX B;  1FYH A;  4BBS D;  1IRL A;  3IRH A;  1PW6 A;  1Z7C A;  1BP3 A;  5D71 A;  1PV6 A;  4IKY A;  4Q65 A;  1HUW A;  1JLI A;  3UEZ E;  1M4A A;  3EW3 A;  3N06 A;  4BXX D;  3PO2 D;  4A3D D;  1M4C A;  4A3I D;  2GMF A;  3L5X A;  2O6I A;  4A3J D;  5FUC A;  2H24 A;  3SE3 B;  4W6V A;  4O6K A;  5C7X A;  3DLQ I;  1PGR A;  3LB6 A;  3VA2 A;  3O7P A;  1BCN A;  4U4W A;  1EMR A;  2LAG A;  5IP7 D;  4BY1 D;  4CNI C;  3NCC A;  4GS7 A;  3H3V E;  5C44 D;  1LKI A;  1LQS L;  1IJZ A;  5E4E A;  1PY2 A;  4IU8 A;  4DOH A;  4I77 Z;  2IL6 A;  4A3K D;  4D2D A;  2ILK A;  3BES L;  1P9M B;  3QT2 C;  1M4B A;  4PS4 A;  2B91 A;  3D48 P;  5D72 A;  4NEJ A;  2R92 D;  3B5K A;  3INK C;  2Q14 A;  5D22 A;  4ZWB A;  5A2N A;  1BGC A;  5TS9 A;  1VLK A;  2Z3Q A;  2CYK A;  3OQ3 A;  4LRL A;  3HOX D;  4OAA A;  1ILK A;  2JA6 D;  1RW5 A;  4MHL A;  1N1F A;  1GA3 A;  4YQX A;  5D70 A;  4A3G D;  1KF9 A;  4YUE C;  4IKW A;  1AU1 A;  1CNT 1;  2O26 A;  3L5W I;  3G6D A;  5IYB D;  4RS1 A;  3HHR A;  1QVN A;  3DI3 A;  4D2B A;  3DUH C;  2CFQ A;  1FG9 A;  3DI2 A;  3UF5 A;  4O9H A;  4GBY A;  4ZYR A;  4GBZ A;  4NN5 A;  4YBQ A;  3BPL A;  2JA8 D;  1WCM D;  2XUT A;  1BUY A;  2INT A;  1WU3 I;  4TPJ A;  5C4X D;  4NN7 A;  1HIK A;  1ITI A;  4WRL B;  4DKF A;  4DKC A;  4ZWC A;  1NBP A;  1Z92 A;  1BBN A;  3HOZ D;  1ITF A;  1D9G A;  2L3O A;  3QAZ A;  5C3E D;  3PO3 D;  1Y1W D;  1HWG A;  4JRE A;  4XNJ A;  2B8X A;  2E9W C;  4GC0 A;  3PIW A;  2Y5Y A;  2D9Q A;  4EXN A;  1Y14 A;  4IKV A;  2B8Z A;  1IAR A;  3BPN A;  5IYD D;  4X51 A;  1HGU A;  5EQH A;  1EKU A;  3HOV D;  2Q7N B;  1M49 A;  2O27 A;  2JA5 D;  3UX9 A;  2B5I A;  5EQI A;  4BBR D;  1D9C A;  4FA8 E;  4ZS7 A;  4JA3 A;  1BGD A;  1SCF A;  3TGX B;  3N0P A;  4GRW A;  1ITL A;  1EXZ A;  4NN6 A;  1J7V L;  2VUM D;  1A7M A;  2Q98 A;  1BGE A;  5A2O A;  4IKX A;  2LMS A;  5IYC D;  4DKD A;  4XNI A;  3O7Q A;  2OQP A;  4A3M D;  1PW4 A;  3QB7 A;  4DKE A;  1M47 A;  1AXI A;  5D58 A;  3EJJ A;  1CYL A;  2B8U A;  3WCY I;  2HYM B;  4YPG C;  2R7Z D;  3BPO A;  1ITM A;  4J05 A;  3OG4 A;  3QWR B;  4TPG A;  4EXP A;  3MZG A;  1V7M V;  4J4L C;  1IL6 A;  4YDY I;  3DGC L;  3Q1S I;  4U4V A; 
#chains in the Genus database with same CATH homology
 1CSG A;  5C4X D;  2C35 A;  4NN7 A;  2B8Y A;  4I77 Z;  4DOH A;  1HIK A;  2IL6 A;  3SE4 B;  2JA7 D;  1ITI A;  4A3K D;  4WRL B;  3I4M D;  4DKF A;  2ILK A;  3BES L;  1P9M B;  4DKC A;  3S9D A;  2B63 D;  1RHG A;  1RFB A;  1HZI A;  3QB1 A;  3QT2 C;  1NBP A;  1Y6M L;  1Z92 A;  1A7M A;  1BBN A;  1M4B A;  3HOZ D;  1CN4 C;  4NEM A;  4NI7 A;  3HOW D;  4A93 D;  1ITF A;  4PS4 A;  2B91 A;  4NKQ C;  3D48 P;  1LK3 A;  5D72 A;  4A3C D;  2Z3R A;  4NEJ A;  2R92 D;  3HOY D;  1D9G A;  1HUL A;  1HWH A;  3B5K A;  3D87 A;  3PIV A;  3HOU D;  2R93 D;  2L3O A;  3QAZ A;  5IP9 D;  3INK C;  5C3E D;  3PO3 D;  5KNH I;  1EVS A;  2Q14 A;  1Y1W D;  1HWG A;  5D22 A;  5D28 B;  3UF2 A;  2B8X A;  1BGC A;  2E9W C;  3I4N D;  3OG6 A;  1ETE A;  1M4R A;  1B5L A;  3PIW A;  1Y6K L;  3Q1S I;  1ALU A;  2D9Q A;  5TS9 A;  3HMX B;  4A3B D;  5L6Y C;  1FYH A;  4EXN A;  1VLK A;  1Y14 A;  2B8Z A;  1IAR A;  2Z3Q A;  3BPN A;  4BBS D;  1IRL A;  2CYK A;  5IYD D;  3IRH A;  1PW6 A;  3OQ3 A;  1Z7C A;  1AX8 A;  3H0G D;  4X51 A;  4LRL A;  1BP3 A;  1HGU A;  1M48 A;  3NPZ A;  1A22 A;  1EKU A;  5D71 A;  3HOX D;  1Y6N L;  2Q7N B;  3HOV D;  1M49 A;  2O27 A;  1PVH B;  1ILK A;  1F6F A;  2JA5 D;  1RCB A;  3NCB A;  1RW5 A;  2JA6 D;  3UX9 A;  1HUW A;  1JLI A;  3UEZ E;  3FKI D;  2B5I A;  4MHL A;  1N1F A;  4BBR D;  1GA3 A;  4YQX A;  3D85 C;  1D9C A;  2KZ1 A;  4FA8 E;  5D70 A;  4ZS7 A;  1M4A A;  4NI9 A;  4A3G D;  1KF9 A;  3EW3 A;  2L3Y A;  1HIJ A;  1BGD A;  4YUE C;  1SCF A;  3N06 A;  3TGX B;  3N0P A;  1AU1 A;  4GRW A;  1M4C A;  3PO2 D;  4A3D D;  4BXX D;  1ITL A;  3G9V B;  3HHC A;  4A3I D;  3LB6 B;  1EXZ A;  1CNT 1;  2GMF A;  2D48 A;  1YKB A;  2O26 A;  3L5X A;  4NN6 A;  1J7V L;  2O6I A;  4ZF7 A;  2Q98 A;  4A3F D;  1EER A;  4A3J D;  5FUC A;  1BGE A;  2VUM D;  3L5W I;  2PSM A;  4A3L D;  1IK0 A;  3G6D A;  2LMS A;  1CD9 A;  2H24 A;  5FHX A;  4RS1 A;  3SE3 B;  3HHR A;  2XQB A;  5IYB D;  5IYC D;  5FLM D;  4O6K A;  1QVN A;  3DI3 A;  4DKD A;  5LQB A;  4A3E D;  3AYH A;  5C7X A;  2OQP A;  1PGR A;  3DLQ I;  3DUH C;  1I1R B;  3LB6 A;  4A3M D;  3VA2 A;  1FG9 A;  3DI2 A;  3QB7 A;  4DKE A;  3UF5 A;  1M47 A;  1BCN A;  4O9H A;  1EMR A;  2LAG A;  1AXI A;  5IP7 D;  4NN5 A;  3EJJ A;  1CYL A;  2B8U A;  3WCY I;  2ERJ D;  2HYM B;  1INR A;  4YPG C;  3BPL A;  4BY1 D;  2JA8 D;  2R7Z D;  3BPO A;  4CNI C;  2B90 A;  1ITM A;  4BY7 D;  1WCM D;  3NCC A;  3OG4 A;  3QWR B;  4GS7 A;  4EXP A;  3H3V E;  1BUY A;  3MZG A;  1V7M V;  5C44 D;  1LKI A;  1LQS L;  1IJZ A;  1Y1V D;  4J4L C;  5E4E A;  1IL6 A;  1PY2 A;  2INT A;  3NCE A;  1GNC A;  3NCF A;  4Z5R D;  4YDY I;  3DGC L;  1V7N V;  1F45 B;  1WU3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...