2B91A

Crystal structure of the interleukin-4 variant f82dr85a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
b'HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRDLKALDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-4
publication title A modular interface of IL-4 allows for scalable affinity without affecting specificity for the IL-4 receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 47
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00727 IL4 Interleukin 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 2b91A00
4YPGC 1ITMA 1FG9A 1PGRA 1RFBA 4ZS7A 4YQXA 1CD9A 4ZF7A 1F45B 1HZIA 4O6KA 1CSGA 4X51A 1AX8A 3D85C 2B8XA 1ETEA 5D22A 3HHRA 1EXZA 1ITFA 1LK3A 2ERJD 1PY2A 1N1FA 1ITLA 4NI9A 2CYKA 4CNIC 2GMFA 1P9MB 1ILKA 5D72A 5LQBA 3S9DA 1M4RA 4PS4A 1IK0A 1Z92A 3EW3A 4J4LC 5D71A 1J7VL 3DGCL 1M49A 2B8ZA 1F6FA 1BGDA 1ALUA 1YKBA 5KNHI 1A22A 1V7MV 1EVSA 1QVNA 3UEZE 1BGCA 4NEMA 1M48A 2L3YA 4GRWA 4Z5RD 1M4CA 3NCBA 5D70A 2LMSA 1D9GA 3NCCA 1B5LA 1BCNA 4DOHA 3L5WI 1FYHA 2HYMB 3L5XA 1KF9A 1EMRA 1Y6KL 1I1RB 1IRLA 1JLIA 2D9QA 4NEJA 1M47A 2INTA 1SCFA 1D9CA 5FHXA 2L3OA 3N06A 2B8UA 1AU1A 1HIJA 4NI7A 1HWGA 1CN4C 3QB1A 1EKUA 3OQ3A 1INRA 2ILKA 2O27A 1HUWA 1IL6A 1PW6A 1M4BA 1RW5A 4I77Z 3VA2A 2E9WC 2O26A 3DLQI 2LAGA 3BPOA 3G6DA 1M4AA 3G9VB 1Y6ML 3QWRB 3UX9A 1ITIA 3B5KA 5D28B 3LB6A 4NKQC 2IL6A 3NCEA 3LB6B 2Q98A 1CNT1 2KZ1A 3NCFA 3NPZA 3QAZA 1Y6NL 1HIKA 1NBPA 3SE3B 3N0PA 3MZGA 5C7XA 1PVHB 4YDYI 1Z7CA 3QB7A 1LQSL 2H24A 4O9HA 4RS1A 1RHGA 5FUCA 1IJZA 3D87A 3INKC 3UF2A 3EJJA 3QT2C 3BPNA 3DUHC 3PIVA 1CYLA 3WCYI 1WU3I 1GNCA 2B91A 1HWHA 3HMXB 2D48A 1AXIA 1HULA 3Q1SI 3BPLA 1A7MA 1GA3A 1V7NV 1BGEA 1VLKA 1EERA 3D48P 2B5IA 1BBNA 1IARA 1RCBA 2Q7NB 5E4EA 3SE4B 1BP3A 1HGUA 1LKIA 4WRLB 4YUEC 3UF5A 4MHLA 4FA8E 5L6YC 2B8YA 3BESL 2B90A 1BUYA 3PIWA
chains in the Genus database with same CATH superfamily
3WDOA 3O7QA 1PGRA 4ZS7A 4IU8A 3D85C 3HHRA 4A3ID 4UVMA 2O6IA 5EQHA 1PY2A 4NI9A 4CNIC 4IU9A 2GMFA 2XQBA 2JA5D 1ILKA 4U4TA 4NN5A 1IK0A 4J4LC 4A3FD 5GXBA 1F6FA 1BGDA 5IP9D 1EVSA 1QVNA 4Z5RD 2R92D 4GC0A 3L5WI 2HYMB 3L5XA 1KF9A 3PO3D 5D58A 1M47A 2INTA 4APSA 2L3OA 1AU1A 4IKXA 4NN6A 2R93D 1EKUA 2O27A 4I77Z 3DLQI 5D6KA 4IKWA 3NCEA 4W6VA 2Y5YA 3NPZA 3QAZA 4OAAA 1NBPA 3SE3B 5C7XA 1RHGA 3D87A 3INKC 5A2OA 3QT2C 4D2BA 3WCYI 3IRHA 4TPHA 4JREA 4U4VA 4A3KD 3H3VE 1BGEA 2B5IA 5C65A 1BBNA 5E4EA 1Y14A 1HGUA 4WRLB 4YUEC 3UF5A 4MHLA 3BESL 3PIWA 4LDSA 4YPGC 1FG9A 4YQXA 1CD9A 4Q65A 1F45B 4O6KA 1CSGA 2B8XA 1ETEA 1ITFA 1LK3A 1ITLA 3HOZD 5LQBA 1M4RA 4PS4A 5TS9A 4BXXD 1J7VL 4JR9A 4A3GD 4ZWCA 1A22A 1V7MV 3UEZE 1BGCA 1M48A 2L3YA 4A3BD 2LMSA 3NCCA 3O7PA 4XNJA 4TPJA 2VUMD 4BY7D 4ZW9A 5IYBD 1JLIA 4A3DD 3N06A 2B8UA 1HWGA 1CN4C 1INRA 1PV6A 1PW6A 1M4BA 1RW5A 4DKDA 3HOXD 4D2CA 3HOYD 3G6DA 4A3MD 1M4AA 3G9VB 3QWRB 4EXNA 2PSMA 3MZGA 5IP7D 3QB7A 1LQSL 4RS1A 5FUCA 4BBRD 5EQGA 3UF2A 3AYHA 1GNCA 2B91A 5A2NA 2D48A 1AXIA 3Q1SI 3DI3A 3I4ND 3BPLA 3HHCA 1GA3A 1V7NV 3OG6A 2Q7NB 1BP3A 3H0GD 3FKID 5D70A 1ITMA 3HOWD 4U4WA 1HZIA 4X51A 1AX8A 3OG4A 5C44D 5D22A 5EQIA 4BY1D 1PV7A 3HOVD 2CYKA 4JA3A 3TGXB 3EW3A 2B8ZA 4DKCA 4NEMA 5D59A 4YB9D 1M4CA 3NCBA 4LRLA 1D9GA 4A3CD 5C4XD 2XUTA 1FYHA 1Y1VD 1EMRA 4A3ED 1IRLA 4NEJA 1SCFA 1D9CA 5FLMD 3QB1A 1HUWA 4PYPA 1PW4A 4J05A 4LEPA 5IYDD 2LAGA 3BPOA 4EXPA 1ITIA 5IYCD 3B5KA 3PO2D 2IL6A 2KZ1A 3NCFA 4QIQA 3N0PA 4YDYI 2Z3RA 1Z7CA 2OQPA 1IJZA 2CFPA 1Y1WD 3EJJA 2C35A 3BPNA 4IKZA 2JA7D 1CYLA 1WU3I 4DKEA 4GBYA 4OH3A 3HMXB 1RCBA 4ZWBA 4A93D 1LKIA 2B90A 1BUYA 1RFBA 4IKVA 4ZF7A 2B63D 2V8NA 4TPGA 1EXZA 2ERJD 1N1FA 2R7ZD 3DI2A 1P9MB 1WCMD 5D72A 3S9DA 1Z92A 5D71A 3DGCL 1M49A 4GS7A 1YKBA 1ALUA 5KNHI 3I4MD 4IKYA 4GRWA 1B5LA 4NN7A 1BCNA 4DOHA 4YBQA 2CFQA 4DKFA 1Y6KL 1I1RB 3HOUD 2D9QA 5FHXA 1HIJA 4NI7A 3OQ3A 2ILKA 4GBZA 1IL6A 2JA8D 3VA2A 2E9WC 2O26A 5C3ED 2Z3QA 1Y6ML 3UX9A 5D28B 3LB6A 4NKQC 3LB6B 2Q98A 1CNT1 1Y6NL 1HIKA 4XNIA 1PVHB 4O9HA 4ZYRA 4A3JD 4BBSD 3DUHC 3PIVA 1HWHA 4A3LD 1HULA 1A7MA 1VLKA 1EERA 3D48P 4D2DA 2Q14A 2JA6D 1IARA 3SE4B 4FA8E 5L6YC 2B8YA 2H24A
chains in the Genus database with same CATH topology
4YPGC 1ITMA 1FG9A 1PGRA 1RFBA 3HOWD 4ZS7A 4YQXA 1CD9A 4ZF7A 2B63D 1F45B 1HZIA 4O6KA 1CSGA 4X51A 1AX8A 3D85C 3OG4A 5C44D 2B8XA 1ETEA 5D22A 3HHRA 4A3ID 1EXZA 2O6IA 4BY1D 1ITFA 1LK3A 2ERJD 1PY2A 1N1FA 1ITLA 4NI9A 3HOVD 2CYKA 4CNIC 2R7ZD 2GMFA 3DI2A 3HOZD 2XQBA 2JA5D 1P9MB 1WCMD 1ILKA 3TGXB 5D72A 5LQBA 3S9DA 1M4RA 4PS4A 5TS9A 4NN5A 1IK0A 1Z92A 3EW3A 4J4LC 4A3FD 4BXXD 5D71A 1J7VL 3DGCL 1M49A 2B8ZA 1F6FA 1BGDA 1ALUA 1YKBA 4GS7A 4DKCA 5IP9D 1A22A 5KNHI 4A3GD 1V7MV 1EVSA 1QVNA 3I4MD 3UEZE 1BGCA 4NEMA 1M48A 2L3YA 4GRWA 4Z5RD 4A3BD 1M4CA 3NCBA 4LRLA 5D70A 2LMSA 1D9GA 3NCCA 1B5LA 4NN7A 4A3CD 1BCNA 5C4XD 4DOHA 2R92D 4DKFA 2VUMD 4BY7D 3L5WI 1FYHA 1Y1VD 2HYMB 3L5XA 1KF9A 1EMRA 1Y6KL 1I1RB 4A3ED 3PO3D 5IYBD 3HOUD 1IRLA 1JLIA 2D9QA 4NEJA 1M47A 2INTA 1SCFA 1D9CA 5FHXA 4A3DD 2L3OA 3N06A 5FLMD 2B8UA 1AU1A 1HIJA 4NN6A 4NI7A 1HWGA 1CN4C 3QB1A 2R93D 1EKUA 3OQ3A 1INRA 2ILKA 2O27A 1HUWA 1IL6A 1PW6A 1M4BA 1RW5A 4I77Z 3VA2A 4DKDA 2JA8D 2E9WC 2O26A 3HOXD 3DLQI 5IYDD 2LAGA 5C3ED 3HOYD 2Z3QA 3BPOA 3G6DA 4A3MD 1M4AA 3G9VB 1Y6ML 3QWRB 3UX9A 4EXPA 4EXNA 5IYCD 1ITIA 3B5KA 5D28B 3LB6A 4NKQC 3PO2D 2IL6A 3NCEA 3LB6B 2PSMA 1CNT1 2KZ1A 2Q98A 3NCFA 3NPZA 3QAZA 1Y6NL 1HIKA 1NBPA 3SE3B 3N0PA 3MZGA 5IP7D 5C7XA 1PVHB 4YDYI 2Z3RA 1Z7CA 3QB7A 1LQSL 2H24A 2OQPA 4O9HA 1RHGA 4RS1A 5FUCA 4BBRD 1IJZA 3D87A 1Y1WD 3INKC 3UF2A 3EJJA 2C35A 3QT2C 4A3JD 3AYHA 3BPNA 4BBSD 3DUHC 2JA7D 3PIVA 1CYLA 3WCYI 1WU3I 3IRHA 1GNCA 2B91A 4DKEA 1HWHA 3HMXB 4A3LD 2D48A 1AXIA 1HULA 3Q1SI 3DI3A 3I4ND 3BPLA 3HHCA 4A3KD 1A7MA 1GA3A 1V7NV 1BGEA 1VLKA 1EERA 3D48P 3H3VE 3OG6A 2B5IA 1BBNA 2Q14A 2JA6D 1IARA 1RCBA 4A93D 2Q7NB 5E4EA 3SE4B 1Y14A 1BP3A 1HGUA 1LKIA 4WRLB 4YUEC 3UF5A 4MHLA 4FA8E 5L6YC 2B8YA 3BESL 3H0GD 3FKID 2B90A 1BUYA 3PIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPG C;  1ITM A;  1FG9 A;  1PGR A;  1RFB A;  4ZS7 A;  4YQX A;  1CD9 A;  4ZF7 A;  1F45 B;  1HZI A;  4O6K A;  1CSG A;  4X51 A;  1AX8 A;  3D85 C;  2B8X A;  1ETE A;  5D22 A;  3HHR A;  1EXZ A;  1ITF A;  1LK3 A;  2ERJ D;  1PY2 A;  1N1F A;  1ITL A;  4NI9 A;  2CYK A;  4CNI C;  2GMF A;  1P9M B;  1ILK A;  5D72 A;  5LQB A;  3S9D A;  1M4R A;  4PS4 A;  1IK0 A;  1Z92 A;  3EW3 A;  4J4L C;  5D71 A;  1J7V L;  3DGC L;  1M49 A;  2B8Z A;  1F6F A;  1BGD A;  1ALU A;  1YKB A;  5KNH I;  1A22 A;  1V7M V;  1EVS A;  1QVN A;  3UEZ E;  1BGC A;  4NEM A;  1M48 A;  2L3Y A;  4GRW A;  4Z5R D;  1M4C A;  3NCB A;  5D70 A;  2LMS A;  1D9G A;  3NCC A;  1B5L A;  1BCN A;  4DOH A;  3L5W I;  1FYH A;  2HYM B;  3L5X A;  1KF9 A;  1EMR A;  1Y6K L;  1I1R B;  1IRL A;  1JLI A;  2D9Q A;  4NEJ A;  1M47 A;  2INT A;  1SCF A;  1D9C A;  5FHX A;  2L3O A;  3N06 A;  2B8U A;  1AU1 A;  1HIJ A;  4NI7 A;  1HWG A;  1CN4 C;  3QB1 A;  1EKU A;  3OQ3 A;  1INR A;  2ILK A;  2O27 A;  1HUW A;  1IL6 A;  1PW6 A;  1M4B A;  1RW5 A;  4I77 Z;  3VA2 A;  2E9W C;  2O26 A;  3DLQ I;  2LAG A;  3BPO A;  3G6D A;  1M4A A;  3G9V B;  1Y6M L;  3QWR B;  3UX9 A;  1ITI A;  3B5K A;  5D28 B;  3LB6 A;  4NKQ C;  2IL6 A;  3NCE A;  3LB6 B;  2Q98 A;  1CNT 1;  2KZ1 A;  3NCF A;  3NPZ A;  3QAZ A;  1Y6N L;  1HIK A;  1NBP A;  3SE3 B;  3N0P A;  3MZG A;  5C7X A;  1PVH B;  4YDY I;  1Z7C A;  3QB7 A;  1LQS L;  2H24 A;  4O9H A;  4RS1 A;  1RHG A;  5FUC A;  1IJZ A;  3D87 A;  3INK C;  3UF2 A;  3EJJ A;  3QT2 C;  3BPN A;  3DUH C;  3PIV A;  1CYL A;  3WCY I;  1WU3 I;  1GNC A;  2B91 A;  1HWH A;  3HMX B;  2D48 A;  1AXI A;  1HUL A;  3Q1S I;  3BPL A;  1A7M A;  1GA3 A;  1V7N V;  1BGE A;  1VLK A;  1EER A;  3D48 P;  2B5I A;  1BBN A;  1IAR A;  1RCB A;  2Q7N B;  5E4E A;  3SE4 B;  1BP3 A;  1HGU A;  1LKI A;  4WRL B;  4YUE C;  3UF5 A;  4MHL A;  4FA8 E;  5L6Y C;  2B8Y A;  3BES L;  2B90 A;  1BUY A;  3PIW A; 
#chains in the Genus database with same CATH topology
 3WDO A;  3O7Q A;  1PGR A;  4ZS7 A;  4IU8 A;  3D85 C;  3HHR A;  4A3I D;  4UVM A;  2O6I A;  5EQH A;  1PY2 A;  4NI9 A;  4CNI C;  4IU9 A;  2GMF A;  2XQB A;  2JA5 D;  1ILK A;  4U4T A;  4NN5 A;  1IK0 A;  4J4L C;  4A3F D;  5GXB A;  1F6F A;  1BGD A;  5IP9 D;  1EVS A;  1QVN A;  4Z5R D;  2R92 D;  4GC0 A;  3L5W I;  2HYM B;  3L5X A;  1KF9 A;  3PO3 D;  5D58 A;  1M47 A;  2INT A;  4APS A;  2L3O A;  1AU1 A;  4IKX A;  4NN6 A;  2R93 D;  1EKU A;  2O27 A;  4I77 Z;  3DLQ I;  5D6K A;  4IKW A;  3NCE A;  4W6V A;  2Y5Y A;  3NPZ A;  3QAZ A;  4OAA A;  1NBP A;  3SE3 B;  5C7X A;  1RHG A;  3D87 A;  3INK C;  5A2O A;  3QT2 C;  4D2B A;  3WCY I;  3IRH A;  4TPH A;  4JRE A;  4U4V A;  4A3K D;  3H3V E;  1BGE A;  2B5I A;  5C65 A;  1BBN A;  5E4E A;  1Y14 A;  1HGU A;  4WRL B;  4YUE C;  3UF5 A;  4MHL A;  3BES L;  3PIW A;  4LDS A;  4YPG C;  1FG9 A;  4YQX A;  1CD9 A;  4Q65 A;  1F45 B;  4O6K A;  1CSG A;  2B8X A;  1ETE A;  1ITF A;  1LK3 A;  1ITL A;  3HOZ D;  5LQB A;  1M4R A;  4PS4 A;  5TS9 A;  4BXX D;  1J7V L;  4JR9 A;  4A3G D;  4ZWC A;  1A22 A;  1V7M V;  3UEZ E;  1BGC A;  1M48 A;  2L3Y A;  4A3B D;  2LMS A;  3NCC A;  3O7P A;  4XNJ A;  4TPJ A;  2VUM D;  4BY7 D;  4ZW9 A;  5IYB D;  1JLI A;  4A3D D;  3N06 A;  2B8U A;  1HWG A;  1CN4 C;  1INR A;  1PV6 A;  1PW6 A;  1M4B A;  1RW5 A;  4DKD A;  3HOX D;  4D2C A;  3HOY D;  3G6D A;  4A3M D;  1M4A A;  3G9V B;  3QWR B;  4EXN A;  2PSM A;  3MZG A;  5IP7 D;  3QB7 A;  1LQS L;  4RS1 A;  5FUC A;  4BBR D;  5EQG A;  3UF2 A;  3AYH A;  1GNC A;  2B91 A;  5A2N A;  2D48 A;  1AXI A;  3Q1S I;  3DI3 A;  3I4N D;  3BPL A;  3HHC A;  1GA3 A;  1V7N V;  3OG6 A;  2Q7N B;  1BP3 A;  3H0G D;  3FKI D;  5D70 A;  1ITM A;  3HOW D;  4U4W A;  1HZI A;  4X51 A;  1AX8 A;  3OG4 A;  5C44 D;  5D22 A;  5EQI A;  4BY1 D;  1PV7 A;  3HOV D;  2CYK A;  4JA3 A;  3TGX B;  3EW3 A;  2B8Z A;  4DKC A;  4NEM A;  5D59 A;  4YB9 D;  1M4C A;  3NCB A;  4LRL A;  1D9G A;  4A3C D;  5C4X D;  2XUT A;  1FYH A;  1Y1V D;  1EMR A;  4A3E D;  1IRL A;  4NEJ A;  1SCF A;  1D9C A;  5FLM D;  3QB1 A;  1HUW A;  4PYP A;  1PW4 A;  4J05 A;  4LEP A;  5IYD D;  2LAG A;  3BPO A;  4EXP A;  1ITI A;  5IYC D;  3B5K A;  3PO2 D;  2IL6 A;  2KZ1 A;  3NCF A;  4QIQ A;  3N0P A;  4YDY I;  2Z3R A;  1Z7C A;  2OQP A;  1IJZ A;  2CFP A;  1Y1W D;  3EJJ A;  2C35 A;  3BPN A;  4IKZ A;  2JA7 D;  1CYL A;  1WU3 I;  4DKE A;  4GBY A;  4OH3 A;  3HMX B;  1RCB A;  4ZWB A;  4A93 D;  1LKI A;  2B90 A;  1BUY A;  1RFB A;  4IKV A;  4ZF7 A;  2B63 D;  2V8N A;  4TPG A;  1EXZ A;  2ERJ D;  1N1F A;  2R7Z D;  3DI2 A;  1P9M B;  1WCM D;  5D72 A;  3S9D A;  1Z92 A;  5D71 A;  3DGC L;  1M49 A;  4GS7 A;  1YKB A;  1ALU A;  5KNH I;  3I4M D;  4IKY A;  4GRW A;  1B5L A;  4NN7 A;  1BCN A;  4DOH A;  4YBQ A;  2CFQ A;  4DKF A;  1Y6K L;  1I1R B;  3HOU D;  2D9Q A;  5FHX A;  1HIJ A;  4NI7 A;  3OQ3 A;  2ILK A;  4GBZ A;  1IL6 A;  2JA8 D;  3VA2 A;  2E9W C;  2O26 A;  5C3E D;  2Z3Q A;  1Y6M L;  3UX9 A;  5D28 B;  3LB6 A;  4NKQ C;  3LB6 B;  2Q98 A;  1CNT 1;  1Y6N L;  1HIK A;  4XNI A;  1PVH B;  4O9H A;  4ZYR A;  4A3J D;  4BBS D;  3DUH C;  3PIV A;  1HWH A;  4A3L D;  1HUL A;  1A7M A;  1VLK A;  1EER A;  3D48 P;  4D2D A;  2Q14 A;  2JA6 D;  1IAR A;  3SE4 B;  4FA8 E;  5L6Y C;  2B8Y A;  2H24 A; 
#chains in the Genus database with same CATH homology
 4YPG C;  1ITM A;  1FG9 A;  1PGR A;  1RFB A;  3HOW D;  4ZS7 A;  4YQX A;  1CD9 A;  4ZF7 A;  2B63 D;  1F45 B;  1HZI A;  4O6K A;  1CSG A;  4X51 A;  1AX8 A;  3D85 C;  3OG4 A;  5C44 D;  2B8X A;  1ETE A;  5D22 A;  3HHR A;  4A3I D;  1EXZ A;  2O6I A;  4BY1 D;  1ITF A;  1LK3 A;  2ERJ D;  1PY2 A;  1N1F A;  1ITL A;  4NI9 A;  3HOV D;  2CYK A;  4CNI C;  2R7Z D;  2GMF A;  3DI2 A;  3HOZ D;  2XQB A;  2JA5 D;  1P9M B;  1WCM D;  1ILK A;  3TGX B;  5D72 A;  5LQB A;  3S9D A;  1M4R A;  4PS4 A;  5TS9 A;  4NN5 A;  1IK0 A;  1Z92 A;  3EW3 A;  4J4L C;  4A3F D;  4BXX D;  5D71 A;  1J7V L;  3DGC L;  1M49 A;  2B8Z A;  1F6F A;  1BGD A;  1ALU A;  1YKB A;  4GS7 A;  4DKC A;  5IP9 D;  1A22 A;  5KNH I;  4A3G D;  1V7M V;  1EVS A;  1QVN A;  3I4M D;  3UEZ E;  1BGC A;  4NEM A;  1M48 A;  2L3Y A;  4GRW A;  4Z5R D;  4A3B D;  1M4C A;  3NCB A;  4LRL A;  5D70 A;  2LMS A;  1D9G A;  3NCC A;  1B5L A;  4NN7 A;  4A3C D;  1BCN A;  5C4X D;  4DOH A;  2R92 D;  4DKF A;  2VUM D;  4BY7 D;  3L5W I;  1FYH A;  1Y1V D;  2HYM B;  3L5X A;  1KF9 A;  1EMR A;  1Y6K L;  1I1R B;  4A3E D;  3PO3 D;  5IYB D;  3HOU D;  1IRL A;  1JLI A;  2D9Q A;  4NEJ A;  1M47 A;  2INT A;  1SCF A;  1D9C A;  5FHX A;  4A3D D;  2L3O A;  3N06 A;  5FLM D;  2B8U A;  1AU1 A;  1HIJ A;  4NN6 A;  4NI7 A;  1HWG A;  1CN4 C;  3QB1 A;  2R93 D;  1EKU A;  3OQ3 A;  1INR A;  2ILK A;  2O27 A;  1HUW A;  1IL6 A;  1PW6 A;  1M4B A;  1RW5 A;  4I77 Z;  3VA2 A;  4DKD A;  2JA8 D;  2E9W C;  2O26 A;  3HOX D;  3DLQ I;  5IYD D;  2LAG A;  5C3E D;  3HOY D;  2Z3Q A;  3BPO A;  3G6D A;  4A3M D;  1M4A A;  3G9V B;  1Y6M L;  3QWR B;  3UX9 A;  4EXP A;  4EXN A;  5IYC D;  1ITI A;  3B5K A;  5D28 B;  3LB6 A;  4NKQ C;  3PO2 D;  2IL6 A;  3NCE A;  3LB6 B;  2PSM A;  1CNT 1;  2KZ1 A;  2Q98 A;  3NCF A;  3NPZ A;  3QAZ A;  1Y6N L;  1HIK A;  1NBP A;  3SE3 B;  3N0P A;  3MZG A;  5IP7 D;  5C7X A;  1PVH B;  4YDY I;  2Z3R A;  1Z7C A;  3QB7 A;  1LQS L;  2H24 A;  2OQP A;  4O9H A;  1RHG A;  4RS1 A;  5FUC A;  4BBR D;  1IJZ A;  3D87 A;  1Y1W D;  3INK C;  3UF2 A;  3EJJ A;  2C35 A;  3QT2 C;  4A3J D;  3AYH A;  3BPN A;  4BBS D;  3DUH C;  2JA7 D;  3PIV A;  1CYL A;  3WCY I;  1WU3 I;  3IRH A;  1GNC A;  2B91 A;  4DKE A;  1HWH A;  3HMX B;  4A3L D;  2D48 A;  1AXI A;  1HUL A;  3Q1S I;  3DI3 A;  3I4N D;  3BPL A;  3HHC A;  4A3K D;  1A7M A;  1GA3 A;  1V7N V;  1BGE A;  1VLK A;  1EER A;  3D48 P;  3H3V E;  3OG6 A;  2B5I A;  1BBN A;  2Q14 A;  2JA6 D;  1IAR A;  1RCB A;  4A93 D;  2Q7N B;  5E4E A;  3SE4 B;  1Y14 A;  1BP3 A;  1HGU A;  1LKI A;  4WRL B;  4YUE C;  3UF5 A;  4MHL A;  4FA8 E;  5L6Y C;  2B8Y A;  3BES L;  3H0G D;  3FKI D;  2B90 A;  1BUY A;  3PIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...