2B94A

Structural analysis of p knowlesi homolog of p falciparum pnp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
242
Chain Sequence
b'NLYFQGHMEEEMQRHIKLTPSQTTPVVLVVGDPGRVDKVKMLCDSYVDLAEYKSVECTYKGQKFLCVSHGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPTQMKRGDICICNAAVREDRVSHLMIYSDFPAVADFEVYDTLNKVAQELEVPVFNGISLSSDLYYPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWNLVPEKLENMIKISLETCARLAKKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title Structural analysis of P knowlesi homolog of P falciparum PNP
rcsb
source organism Plasmodium knowlesi
molecule tags Transferase
total genus 84
structure length 242
sequence length 252
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2b94A01
3ODGA 1Z5PA 1PR5A 3PNPA 3QPBA 1PR6A 5F78A 4YJKA 4YO8A 4R31A 3DPSA 1TGVA 4LNAA 3O4VA 4OEHA 3E9RA 4YNBA 3IEXA 3OCCA 1JDSA 1OTYA 3FUCA 1SD2A 1Z39A 1NW4A 4GKAA 2QTGA 2H8GA 5CXQA 4TTIA 5ETJA 1TCUA 1C3XA 4TS3A 4NY1A 4MCHA 4F3CA 4OY3A 2RJ3A 3D1VA 1Y1SA 2OC4A 3MMSA 4DA0A 3DF9A 3KVVA 4LNHA 4DAEA 3KU4A 3IOMA 4KN5A 1K3FA 4PNPA 3E0QA 4EARA 1PK7A 3MB8A 3TL6A 1ODLA 1RXYA 1Z34A 1PK9A 2OC9A 5F73A 3OZEA 4WKCA 3OZDA 3PHBE 3OZBA 3LGSA 5F7XA 3KVYA 5CCDA 3UAWA 4LDNA 4X24A 2PGAA 1V2HE 4OJTA 5B7QA 4R2XA 4GLJA 1Z5NA 4ECEA 4OGKA 4DANA 5B7PA 5JPCA 4MARA 2HSWA 4JOSA 4G41A 2QDKA 4TTJA 1ODJA 1TGYA 2HWUA 1ULAA 1U1CA 2AI3A 2ISCA 4TXMA 4F3KA 3EUFA 1T0UA 1Y1QA 4F2WA 3LBAA 1Y6RA 4F2PA 1A9PA 1V3QE 3KVRA 4QEZA 1JDZA 1B8OA 1SD1A 3INYA 1YRYE 1ZL2A 4D8XA 5B7NA 3ONVA 1YQUA 1ULBA 4WKOA 1YQQA 3EMVA 1VHJA 2P4SA 1G2OA 1T8YA 1N3IA 5EPUA 1PR2A 4L0MA 1ODKA 5F76A 2QTTA 4TYMA 4WKPA 4L5YA 1TD1A 3FOWA 2B94A 3EUEA 1FXUA 2AC7A 3FAZA 1M73E 5B7GA 1PR1A 4TS9A 1PF7E 3PNSA 3OOHA 5C80A 5CYFA 5F7JA 1Y1RA 3UAYA 1VHWA 1RSZA 2Q7OE 4M7WA 1Q1GA 1PR0A 4BMYA 4LKRA 4GMHA 4D8YA 3KUKA 1RYZA 1OUMA 1B8NA 1U1FA 1A9QA 1RXCA 4TXHA 5CYGA 3K8OE 1U1EA 2IQ5A 3LA8A 1K27A 3NM5A 4K6OA 1WTAA 4DARA 2HN9A 1QE5A 1T8WA 4D8VA 4WKBA 3NM6B 1JDUA 3ENZA 4DAOA 4U2KA 4H1TA 3T94A 1SJ9A 1T8SA 1I80A 5CCEA 1OTXA 5FAKA 3NBQA 3OOEA 4BMZA 4GLFA 2ON6A 1YBFA 1JDTA 1K9SA 3C74A 1RXSA 4WKNA 2AI2A 1U1GA 1XE3A 2BSXA 4TTAA 3OPVA 4YMLA 2QPLA 3EEIA 2A0WA 2HRDA 2I4TA 1PBNA 3O6VA 1PR4A 4IP0A 4QFBA 4BN0A 3BSFA 1Y1TA 4MCIA 4JP5A 4BMXA 5DK6A 1V41E 4G89A 4QASA 1OU4A 4G8JA 1Y6QA 1SQ6A 1NC1A 1PWYE 4QAQA 3BJEA 4E1VA 4JWTA 3P0FA 3FB1A 1JYSA 1PW7A 2OXFA 1RR6A 4P54A 1JDVA 4L5CA 4RJ2A 4DA8A 4L6IA 1JE0A 4TXNA 1U1DA 3NM4A 1TCVA 3DP9A 2A8YA 4QATA 4D98A 3GB9A 3OF3A 1ZOSA 1A69A 1V48A 5I3CA 1A9TA 3KHSA 4R2WA 3BL6A 4EB8A 4F1WA 1JP7A 1Z5OA 4I2VA 1VFNA 4DA7A 1T8RA 5F7ZA 2I8AA 3FWPA 3P0EA 1CB0A 3U40A 1LVUA 1PKEA 4UC0A 2A0YA 3DJFA 1Z38A 1ECPA 1Z37A 1Z33A 4OGLA 1ODIA 4NS1A 2AI1A 2XRFA 4PR3A 3OZCA 4M3NA 1JPVA 3UAZA 1Z35A 1A9OA 1RCTE 1RXUA 1RT9A 1OVGA 3F8WA 2GUWA 5F77A 4QARA 1LV8A 4FFSA 3E9ZA 5EFOA 1LX7A 1JE1A 5IU6A 1NC3A 1A9SA 5KB3A 4TXJA 1V45E 4L5AA 1OV6A 5EUBA 3UAVA 4M1EA 2OECA 3PHCA 1YR3A 3SCZA 1RFGE 4LZWA 2A0XA 4DA6A 3GGSA 3K8QA 3DDOA 4OF4A 1CG6A 5CXSA 5K1ZA 4DABA 1VMKA 1A9RA 1Z36A 4NSNA 4TXLA 5F7OA 1V4NA 3FNQA 4D9HA 3UAXA 2QSUA 3BGSA 3UT6A 5IFKA
chains in the Genus database with same CATH superfamily
3PV0A 3U61B 2Q6IA 4LZNA 4WERA 3SC4A 1H4QA 3BE6A 3OG9A 4N82A 2CFOA 1MB9A 3IO3A 2VAPA 1VC2A 5ELLA 5LQKA 1WCYA 4YAOA 1ZN8A 4RF5A 3T95A 4MQ5A 1ZH4A 4OXQA 4BQSA 2A9FA 2GEBA 4K88A 4LDAA 5CBKA 1UR5A 1W5EA 1M6NA 3DFFA 4OQMA 4YJKA 5IJXA 4Z7OB 4RLFA 4BJHB 5CM8B 1G20E 3Q4GA 5LC1A 4Q66C 2FZKA 3UGTA 2DTDA 2CYCA 2EX1A 2OHVA 4GPEA 5ALJA 1TLTA 3TZLA 4B6OA 4D9IA 4QG3A 5BV1A 3O4VA 1ZGGA 3IAFA 3HPQA 4NNOA 3FTNA 4L4UA 4L02A 4S12A 2QTHA 2V5UA 4QX6A 2Z57A 4CTKA 1IRXA 2OHJA 3O9VA 1QU3A 1XP5A 2G04A 2M32A 4DMLA 2FX3A 2MSWA 3NBZC 3QMWA 4HEJA 3F5DA 4N6OA 3RC9A 2ZJ2A 5TS2A 4ZYLA 2OQ2A 1NNEA 2FFHA 2LKCA 3TRFA 1TW2A 4F38A 3CT6A 4JGIA 3GR6A 3TXYA 3KP1A 3ANNA 3VXKA 4CCSA 2QUHA 4DT1A 4RD3A 2EL7A 4F12A 1OH5A 1Q7GA 2DAPA 4RFLA 4P98A 3U4QA 1KYZA 3DYBA 3EZ9A 3ZW8A 5LOVA 1F3OA 2I29A 3P9QA 1BKDR 1VE7A 2SCUB 3A4NA 3U4MA 4OLJA 2A1UA 4ONEA 3DXFA 4D9KA 4YFYA 3V34A 1JYFA 5IKOA 2JRLA 1QRTA 3H6KA 2J0UB 2OB1A 2P8SA 4MGYR 4JNCA 1PT6A 2I4LA 1K63A 4M8SA 1F06A 2PWPA 3RLFA 3UEOA 1UL1X 4XTRA 2DJ5A 3PDCA 4QEDA 3JPWA 4LAFA 4Q93A 3RPEA 2IYNA 2RJ3A 4P7JA 3GT7A 3RVJA 2ZVPX 3K1YA 1AKVA 2XNJA 1ENPA 3CRQA 4WXYB 3VHXA 4AS2A 1VIDA 5TVGA 3PQDA 5KNDA 3I6BA 1R0SA 4ZAVA 4EG7A 4LDZA 3LFHA 5BVHB 1GG2A 1UBMS 4ZA2A 5EINA 3RSLA 3TVTA 4BBZA 3I5UA 5I3ZA 3OCVA 5DNEA 1JFVA 3FPAA 2GK7A 4YP6A 2N9UA 2VRCD 1U7UA 5KX5A 1PV4A 4KN5A 3RIYA 2P65A 3NFRA 5AVXA 5FHRA 3E4DA 4WZZA 1FFDA 1Y6ZA 1FDUA 3R3ZA 4E5VA 1PFGA 1UJNA 5DU2A 5HMLA 1X14A 2VLBA 3M2TA 1FK8A 3HCBA 3ZHOA 5K4HA 2RGAA 1ODLA 3M9LA 1LF0A 3E58A 1NU6A 1SBHA 3HUTA 3ECCA 5EXXA 3RJMA 4ABYA 4I46A 4MS1A 4TLMB 4CKCA 3HU2A 4RTSA 1KI7A 4EHFA 3P27A 3IT2A 1E2JA 3MMPA 3VPBA 3PICA 5JXGA 1EFAA 1ZNWA 4YV1A 2WHPB 2WLSA 5GTDA 7AT1A 3EZYA 1U7ZA 4I3HA 3F6RA 3QV2A 1Z06A 3F96A 3PBKA 4NCAA 3VHLB 1NMEA 4I5DA 3RM3A 2HXGA 1JGTA 1KYVA 4R9NA 4DM7A 1LW7A 4C0WA 2IIQA 2AW5A 2XB4A 4LXXA 1WW3A 2LIPA 4R2XA 3RHZA 4FE4A 1CUBA 1Z5NA 1YZTA 4IIJB 1SCKA 1PJ2A 2PUVA 3RYFB 4Z1OA 1JHUA 1R74A 4MI1A 1AKQA 1VE1A 5FNVB 5AW6A 1L4KA 1T2CA 4QPNA 3I5XA 4KVZA 3T1HB 4GT1A 3KFVA 4IG4A 1RZRA 3GJ4A 4Y6LA 3LSTA 3QJ5A 3NBFA 2CEAA 3DO8A 5CA0A 1AKEA 2IYFA 4J0QA 5J2TB 3TZEA 3WFIA 2QLBA 1SQSA 1JG1A 2I4NA 5WRFA 2GPSA 4Y98A 5GP1A 5AXBA 4B43A 2OAGA 2MR5A 3LNTA 2C3YA 4B8ZA 4YJFA 1QV6A 4BKPA 5FQOA 1W88A 3BRQA 1FXWF 1VI2A 4W8GA 4UHBA 4ZO8A 3EUFA 5F35A 5CDGA 2EU8A 2NO1A 1M2JA 1N57A 5FWXB 4QUIA 2QL5A 5KWIA 3Q3VA 4FSXA 4XZ3A 1UFQA 1RM5A 3G0OA 4G9GA 3N74A 3NC0C 4YJGA 2FE1A 3MEQA 2PT9A 2B92A 3LX5A 3F5FA 2H4XA 3M1AA 5BMVF 5I9IA 2IXTA 1ZM7A 3KVRA 4H3HB 2EIXA 3PD7A 1JDZA 5DI3A 3V80A 4AECA 5K51A 4V24A 1T2AA 2Y1KA 1JEOA 1WHTB 4RY8A 2GJ9A 3ZU6A 3QIAA 3ISVA 2E5LB 2OZVA 2WM3A 2IV2X 2G25A 1E60A 2FPMA 3U3MA 3CRW1 1S96A 2V6JA 5JJ5A 2I7VA 3TAXA 5JANA 3CCFA 2GLTA 4YQFA 5DNDA 3DAPA 1HDEA 1KJJA 3Q2OA 3TPFA 4CUJA 2QR5A 4DE5A 4ZU3A 4EGQA 4KFCA 2QN6A 3GDHA 3O03A 2V58A 4WKOA 1UPCA 4A82A 1Q0LA 4J0GA 4DWOA 1ABBA 1NT2A 3PXUA 3CB2A 3IAEA 3TQTA 5KSOA 5EPUA 3NB0A 1XZHA 1FRZA 1PNQA 4IIFA 4L0MA 3WZ2A 5DJ5A 4BTLA 2ASVA 2YQZA 5KYYA 5BR7A 1FSFA 1X8KA 1F5NA 5DXFA 2CHEA 1OROA 3BGWA 5F9FA 3MYYA 5EJ2A 1EFHA 4MTCA 1GNSA 1UT5A 2IE8A 1E3WB 3EUEA 1IOWA 2G4VA 2VNKA 3ICWA 2AFRA 4NARA 4NU5A 4E4TA 5M5BA 2OWDA 3L0ZA 5IX8A 2VFAA 3ETJA 3O75A 4J43A 4FGWA 1T43A 3QBJA 3QUTA 4EQ6A 4BFVA 5DWVA 4K46A 3BL8A 3DCNA 4LK3A 4ZGWA 2A92A 4I5GA 3BJRA 2FFRA 4TMKA 3ICEA 5HCUA 1EWYA 4ZU1X 3NHLA 3RAJA 3DKVA 3H0EA 4M54A 3CO0S 1KMQA 1KH1A 2WIAA 5CT5A 4NP6A 4ALLA 2ZYDA 4DMGA 5EIXA 2CT8A 1LWOA 2G9VA 4Y2XA 3FPGA 1SIUA 6NULA 4G8DA 1WXFA 2O52A 3H9BA 4KACA 3TDKA 4A16A 1U3DA 4ZEMA 1VLZA 1TOAA 5JMOA 3C70A 1JLRA 2CJYA 5FV4A 2RG7A 1PDOA 5ITWA 2AZTA 2B4RO 1ZRMA 4X7RA 3R76A 3SX4A 3O3MB 4UXIA 2VCYA 9ABPA 1N2GA 3TLKA 2OZEA 3BD7A 3WJ7A 4RD0A 4UUQA 5BQ5A 4DLRA 3FDZB 3K73O 2FJPA 4EB3A 2VPWA 3UXYA 4E51A 2WNHA 1VE6A 3CU5A 3UZUA 4KUHA 1PDVA 3M6VA 1SCBA 2EW8A 1HYEA 4TS4A 2UXCB 3I28A 4NG4A 3CWZA 1E1CA 1GG5A 3BWEA 3DWFA 3UANA 2P2CA 2PO5A 2ZTUA 2EQBA 3G6KA 1E2HA 2YFYA 4ILEA 3HGTA 4FZ5A 4NMHA 3WHPA 4AYTA 521PA 2C77A 5FUXA 3WG9A 3ZY4A 1AH2A 4QYTA 3OETA 3QE2A 3KPVA 3W1EA 4D02A 4OX9Y 1G5QA 4C0XA 4YV2A 2IPLA 3Q6NA 1DBQA 4MQ4A 1SZDA 3UKJA 2KWIA 3FMPB 3TTXA 2HB6A 4GXNA 4S0ZA 4QOHA 1RPJA 3JZAA 4FHEA 1GGFA 4K05A 4ZPXA 5FBHA 2IP2A 3V5NA 1CXZA 4C76A 3S1SA 4TLBA 2P91A 1C8VB 2OAQ1 1JQ5A 2CK3D 3DQZA 4TKMA 1FVOA 4HV4A 5JCPA 1MAHA 4B7XA 1TKRA 3FA2A 4U5XA 3S5UA 1PWZA 4LWZA 5B3KA 2IOFK 1CUGA 3EA5A 2YUIA 4MINA 1HNZB 3H1FA 4CM4B 5JSYA 1B2RA 4Q7QA 1EFCA 4DW8A 4P7BA 1BVUA 1GNRA 1L1EA 5IDVA 4C4OA 3CUKA 1SOUA 4E5SA 2UYCA 1H3FA 3IEUA 2EZ8A 5C0OE 5K5EA 2BTQA 5D3ZA 4R05A 3RSHA 1RM3A 3PEFA 2AVNA 2X14A 3SNHA 1TU0A 5BN3B 5HM8A 3EIWA 2C31A 2A0WA 1W46A 2WE8A 3TQQA 3U5TA 3FDJA 3U4IA 5I7VA 2RC6A 1A8QA 1T9AA 1XYVA 2WUDA 3M89A 5JZSA 3L5KA 3T5BA 3C5VA 1NMQA 4RK0A 2QE7A 4X20A 2H52A 2KBEA 4IQ0A 4BNXA 3HVUA 1PR4A 1IXRC 3U4AA 1UBKS 1P4RA 3N75A 4G5QA 4A8HA 4FFOA 4CPDA 5KQMA 1KMHB 1XAIA 3GGOA 1UMCA 4YT4A 1WXHA 4D81A 4R5HA 3GFSA 4PGMA 4CE6A 3C3CA 3V7YA 1I3MA 3WV5A 4LQ4A 4RF3A 3LXUX 4D0SA 4W4TA 5FIUA 1W5BA 1K7YA 4GBGA 4FB5A 5J4LA 2GF0A 3LBYA 1DAIA 3G88A 4R98A 1QG4A 4UASA 1SULA 3CVUA 1MTOA 1N77A 2BI8A 4MJXA 3EVEA 3U7FB 2ORED 4G5SA 2PLAA 1T25A 2RH8A 3M6WA 4UEOA 1E18A 5CX1B 5SZIA 1KI6A 1OU4A 3CLTD 4G8JA 4UNNA 4AL4A 1U6JA 1E79D 3P2KA 3KL4A 4AJEA 2EP5A 3A4MA 5K99A 2I7XA 1DOAA 1JEEA 1D5WA 2I62A 2OV2A 2V8BA 2YMPA 3GH1A 4PG4A 3LSYA 4AI6A 1HNWB 5F9MA 5LKRA 1WOMA 4PX3A 1CR4A 4NJEB 3WK9A 3FB1A 2ZS8A 4M1OA 4N7JA 5H9VA 1R8YA 2D7CA 2MDTA 3IBGA 4ZP1A 5ALFA 4BFLA 4EI8A 2Q3LA 4L5CA 1VKJA 2GUGA 1IONA 2FMFA 4QSMA 3MC1A 3P2MA 4IF4A 1UPBA 1Q20A 4UZEA 3WC4A 5FPTA 4O2AB 4Q4HA 3ROMA 1TCVA 4GQIA 4RGQA 3CNBA 2HA6A 2XMDA 4TQGA 3TL2A 4DDHA 1U2GC 4ZYVA 3NWBA 2IUSA 2CVOA 3CURA 3PQCA 3USCS 4DSTA 5IH3A 3F2VA 4TUYF 2V7EA 4CLEA 3IL2A 3R7NA 1Q77A 1Z4QA 2C96A 2OVBA 5FUVA 1BNCA 1EMDA 4J07A 4FDAA 1TA0A 2WWVD 1NW3A 3IV9A 4P8RA 2OTCA 4IDEA 4D80A 1JJAA 3DONA 1R7RA 3PHHA 3HY4A 1T6NA 3U19A 1QPZA 5JQGB 3A10A 2GERA 1CD5A 3G68A 3LKDA 1IAVA 4DBZA 4BMCA 2RB4A 3CJTA 1U11A 1W85B 3EAGA 3DDUA 5DF1A 4YJ2A 2I8AA 1ZZEA 1EHYA 1ZJ4A 3FWPA 4ENRA 2AZ4A 3V42A 2O2XA 4N65A 3H65A 2ZBVA 3K15A 3IQDB 5IXSA 3H5TA 1Z26A 1GN8A 4OXYA 5TQVA 3ZV4A 4AD8A 3D81A 4Q3DA 5BN5B 2RFLA 4CL2A 1FBNA 1P81A 3K9QO 5EP2A 2WUWE 1L4UA 2DBYA 1ZH0A 3CF4G 1HT1E 4W5NA 1ECPA 5CG1A 3LMKA 1Z37A 1Z33A 2DMRA 1DAOA 2Z9CA 3C3KA 3EDQA 2FWBA 3NP7A 1SQ5A 2QR2A 4FS8A 3ZUGA 1C7RA 4R1TA 1JMKC 3B20A 4XIJA 2ISQA 5C81A 4O4IF 3F9IA 4ED9A 4X84A 3CLVA 3UAGA 3H97A 3HACA 4NBLA 4DSUA 2PK3A 2Y0CA 4KO4S 4IFIA 3ZNQA 1NPDA 4OU5A 3X1JA 1UZNA 3F2IA 3N8HA 3NOOA 4JJZA 1P2VA 5ESXA 2FVYA 4YJHB 1C50A 1KQPA 5BR1A 2R6FA 4MRAA 1FFEA 2ODAA 5FBVB 2YHSA 1YVPA 3QOFA 4RIHA 1V4BA 3U2QA 2QUJA 4TSKA 1XYGA 4A9AA 1LDBA 2C8JA 5CHEA 4OQEA 2R6JA 2WD8A 4ZGBA 3Q7SA 4GL4A 1A8IA 1PL7A 4PAWA 3OT4A 1I4DD 3BWMA 4GX0A 1QQ5A 5LQRA 2WINI 2PY6A 4DGSA 2A5JA 1Y5IA 2VNAA 5IS2A 2A9QA 3EVAA 4MVJI 2BI7A 2C58A 1IZ9A 4GYJA 5EFOA 3QVOA 4DDMA 3ABOB 1FUEA 3VR3A 1V8FA 3EXFB 4FFDA 4IV5A 3QX9A 3KB2A 4A0SA 1KZ7B 1PR3A 4TXJA 2WB4A 2D13A 4JD5A 4D56A 4MPRA 4BUCA 1SHZA 2P2GA 1HTBA 1NVVR 3BL5A 2CDBA 2W4QA 1E1LA 4KLRA 4WA7A 3EPLA 4Y9TA 5CA1B 1OI3A 3FCOA 4OJYA 5DOVA 1BS1A 1G59A 3RC3A 2P30A 1MOSA 1K3UB 5DO9A 1ZY2A 2PGOA 4M9SA 4COKA 3MOSA 3REGA 1X0VA 1QO7A 1EXMA 2G4LA 2OECA 4X1KB 2GR9A 2VTBB 3PC3A 2DJIA 4KE9A 1OOEA 5TPZA 1KK3A 2WYWA 3G7UA 1KIAA 4Q1FA 1BWQA 3WLHA 4AXXA 5C5EA 1GFIA 1JR4A 4XLTA 5CGQB 3ZWCA 3V46A 4ZGGA 3HKEB 4YA6A 4B7ZA 5CXSA 1WDKA 5FPPA 5CYOA 2D6FA 4UHCA 1KKLA 1JDPA 2K4MA 3U9LA 4LBWA 1UINA 2HC9A 3WFZA 3D2CA 4YIHA 4N54A 2H9IA 1FJXA 2G9ZA 2CJPA 4D9HA 3OPXA 4XDGA 4LEIA 3DBLA 3NHBA 2IY8A 3SS7X 4AIIA 4LDRA 5KOHA 2UXBB 1SC3A 2ZM5A 2OORA 3URKA 3P5BA 3ZZNA 1R0LA 3PJDA 4P81A 1Y7LA 3G0DA 4PX5A 1NVXQ 1WIWA 2FCRA 4MQBA 5GQSA 3SYRA 1M1NB 3LKZA 1QWOA 3ELYA 1OXKB 2MMGA 3L1IA 5EZSA 3WDMA 2F3QA 1LD3A 1ADGA 2YWFA 3MJ4A 3QPBA 4MK4A 1RYDA 3DMPA 1WKBA 4M55A 5JATA 3V7NA 3ZWQA 1H66A 1NVWQ 4QGSA 4LSMA 2WFLB 4DKJA 3ETNA 3AXTA 2O23A 3P4YA 5G1OA 5JSFA 4INOA 3MCVA 1C80A 1QG0A 3PFHA 4FFBA 4R31A 4HFRA 3RQSA 2G88A 4CL0A 4MW6A 5EIBC 1QHNA 1D0IA 1TMOA 1P3Y1 1A7AA 1PV1A 5T6BA 3TPZA 5HCIA 4C5CA 5ECYA 3GLGA 1CUJA 2HU5A 2ZWVA 4I9GA 3OAAD 4BWGA 1XROA 3DTTA 1VIAA 3GEMA 3VJLA 2W2MA 1P1CA 2FLKA 4IFTA 3UWSA 1D2CA 1HT0A 3CPSA 3KSAC 3CX7A 2QVLA 1M2OA 5I7AA 4LWPA 1ILWA 2BHTA 2RAFA 2IBSA 1DDGA 3TW4A 3D7KA 3UCEA 2FKAA 4A8JC 3AF5A 4LF4B 1UEIA 2LWIA 3FM9A 3KCQA 1K3TA 4E22A 2FR8C 4M36A 1V8BA 1DTSA 3D4BA 2BGRA 3ZW7A 3FMGA 2VPXA 3UF0A 2ZPUA 2FHPA 2X7HA 4EY4A 3RIGA 2YY5A 5B3LA 4BO1A 1ZU4A 2EP7A 1A77A 2YYAA 2Q3MA 1SU7A 4Y30A 1CTQA 1SBNE 3DNPA 5GPBA 4TTIA 4UTPA 2NOAA 2OOKA 1ZK1A 1W1UA 1YH3A 1HC7A 4OIMA 5BVGA 4P3XA 1GV1A 4N3GA 2NUAB 3IP7A 4MCHA 3G2LA 2RE8A 4BU0A 1XA0A 3AIKA 2JIQA 1IN8A 5JMWA 1MZPA 5KSPA 3GEEA 5LMNB 1SU8A 3VBCA 2OSVA 1N5LA 1X7YB 1V35A 3OQIB 1D2GA 1Q83A 3QVLA 3JAKA 1GEEA 2FEMA 1X0XA 3KKKA 1EX9A 4KX3A 2ZG6A 3I6QA 1XU9A 3H9CA 2MSEB 3LOUA 5JCJA 1N6IA 4NCNA 2C4WA 5B1IA 5ADWA 3PC8C 4O5AA 2CF6A 3UHFA 3ISJA 1L3CA 1OPXA 2VF5X 5REQB 1NG9A 1W4RA 3QUBA 4JDUA 4FIDA 3DEIA 1J2RA 2UUAB 4F3TA 3PCTA 3KXKA 1BA3A 3G6WA 1KMNA 3WY9A 2DERA 1GYRA 2HMTA 4MYCA 3N8IA 1B16A 4BQEA 3IJRA 4KIGA 4PHGA 5BW4A 2VF4X 8LDHA 3TNFA 2A5DA 4TL8A 3NRJA 4JKOA 1NDUA 4MV1A 5I4KA 2GCPA 1F5SA 4L4XA 2I2CA 1DXOA 3AL2A 2XQKA 2JFNA 2WVJA 3AIMA 2XQVA 1UXOA 4W1SA 1AXRA 2GT1A 3BK1A 1RKXA 5ER6A 4PRZA 1XPUA 2J6HA 2IU0A 4JLNA 3MUFA 1KI9A 4R84A 1NXQA 4UDYX 1BXGB 3HO8A 3WBFA 5C4GB 3CONA 2HLPA 1VXRA 2PQMA 1IXSB 1ST2A 1TQ6A 3BKXA 5KCMA 1P0PA 4X24A 2B8JA 2WJZB 4HH0A 1T2NA 1HPLA 1FUIA 2LIVA 3O3OB 1GL3A 2RKWA 3FHOA 1RJGA 2ZSJA 3RYTC 3SYMA 1X92A 3WSVA 4DV3B 1Z18A 4OSEA 3M2PA 4W5WA 4ZOLF 3C5CA 1A7KA 1COWD 4PZZA 1JTFA 4A6PA 3PUVA 2DB3A 2A84A 1PLJA 2YMMA 1B15A 3HEMA 3LHDA 1AGPA 4W9MC 1DAPA 1I1NA 1DHTA 1OVMA 2ZBFA 2HRRA 3B70A 3NAQA 1I0ZA 3L4KA 3GZTB 3AI7A 1N1DA 2HMVA 3O1JC 1C14A 3FKQA 4RETA 4DJ5X 3I5MA 2ZRPA 3Q7IA 4LHZA 5AW3A 5FFMA 5C8XA 4RKYA 3OEEA 5DPMA 1WSAA 3OOWA 1EVLA 1U3UA 3H2YA 2GJ4A 1QVWA 1SBCA 1UPAA 4L57A 1GNVA 2B2NA 2XIJA 3HI4A 4XQCA 3X43A 4R0MA 4Q9DA 2V65A 3BFPA 1RBMA 1E4YA 4G25A 4F3KA 4BNIA 2PE5A 3UPUA 4V39A 2C83A 2EX4A 2MYUA 3A26A 3AEQB 1VLMA 2ZPAA 3NTRA 3PHGA 4XLZA 5BSTA 5BXQC 4CNQA 1TJ5A 4TV9B 4F2WA 1F12A 2OKCA 4ZJUA 4Q4LA 5HR5A 1GGMA 1OC4A 1C4OA 4OQNA 3RHSA 4FOSA 2IXAA 3Q6MA 1XZBA 5HUJA 5KNCH 2WWFA 1ODTC 2DECA 5AVOA 5C52B 3NTLA 4JLPA 2DWCA 2K87A 4TT3A 3OX3A 4RIIA 3T06B 5I7FA 3CPJB 1SCIA 4G37A 4GPAA 5FI3A 1E62A 1JJBA 3LLCA 4PLFA 2PTGA 1E77A 1RJ9B 2GEJA 2JGLA 1EBBA 4AKIA 5K0SA 3TGWA 5LLSA 4I1UA 3I4LA 3SS9X 2PT5A 2RAPA 1H4TA 1TAUA 4PIPA 1JF8A 3S2IA 1B6TA 2ZZMA 3NDPA 5F4ZA 1N6LA 2H7XA 1TKBA 1XWIA 2AN1A 4G0MA 4NMXB 4HDNA 4S1OA 5CDYA 1RRMA 1FNDA 3JASB 4GZ6A 2C95A 1S4QA 2OESA 3OZUA 1SELA 2HA5A 4IZIA 4XE5A 1OYWA 4E1AA 5HVNA 3CF6R 3REOA 1MAVA 2B4YA 2GN9A 3ITEA 3RYCA 2V96A 2K7FA 4D4LA 1KXZA 3JR7A 3RRYA 2VYND 4F7WA 5K6TA 4DVGA 4J03A 1XMIA 2DSNA 4LJ6A 3OICA 1MT0A 1QANA 1G2IA 3LZDA 3PC7A 2OBYA 3UAYA 1EFTA 1NVEA 2JH9A 2VHCA 4IIUA 4TYPA 3HB5X 3JZIA 3C6MA 1KDTA 4UAJA 5EP4A 2FQ1A 3AF1A 4HPXB 1OW3B 1S8FA 4IUDS 2CDNA 5SZKB 3U1BA 4WCDA 4YN3A 3RCBA 3QPCA 2ODTX 1HSZA 2VAMA 1X1CA 2P68A 3KS9A 2MIIA 4UVIA 4NULA 2JHPA 4M8IA 3DE2X 1OUMA 4TWIA 3ND5A 2JLUA 2C94A 2D0DA 1YCGA 3MFYA 1ZU5A 5K09A 3OBBA 4IIYA 3A58B 4EPVA 1IY8A 2X6RA 1EA7A 4NJOA 4Q6BA 1QC5A 4D8WA 1HQYE 2Y77A 4QA9A 3PE6A 5F4BA 3C7TA 3RRJA 4A3SA 1AUVA 2ZIGA 2N47A 4NCHA 3LQ2A 3V1LA 5B6PA 4IVRA 4O4JA 3A9SA 2N3ZA 3NHZA 2E5WA 4UU1A 4CW7A 5K0GA 5TR9A 3HL0A 2WYOA 3EIEA 3I23A 4FCCA 4UDOA 3ICPA 4C7VA 3IILA 1CC1S 2ZAIA 4FJ2A 4NESA 1Y48E 3ZEAA 1AN0A 2VRNA 1XF1A 2MJLA 4PTYA 5A6VA 3AHJA 2JD0A 2JJ1D 3NGMA 1HNXB 2OFXA 2R00A 1GZVA 3BXHA 3MAJA 1S8OA 4L0DA 3WIEA 1OWOA 4XKJA 2G8NA 3L5OA 4X8OA 1H93A 1O6CA 2ODBA 4JP1A 3VNQA 2J9ZB 5E3JA 4FFRA 3N86A 1LKZA 1OFGA 2Y2UA 1E2MA 2OMKA 1P5ZB 4BECA 2XD9A 3HCPA 5DLPA 4L3OA 3OD1A 3O7WA 3PUJA 4KLNA 5ALHA 4DIEA 1BXRB 3A9UA 2DM6A 1P4SA 3BQNB 4ZDKA 3PUZA 5FBRB 3ETCA 4B76A 5KQRA 3ZGYA 1CY0A 4H7KA 3OX2A 3B36A 3J7TA 4YLYA 3NIGB 4WKNA 2PRIA 4WQMA 2QMYA 2A2ZA 1Y42X 1L7OA 4RMNA 3W7BA 3AUYA 3AVUA 3LGXA 5CLHA 3SS8A 4M87A 3AG5A 4ZZIA 2I2DA 4IV8A 3MWEB 1MRSA 1PX2A 5BSWA 4ERXA 4CHTA 3EEBA 4KQ1A 3G9ZA 4NIMA 4P4UA 1YCDA 4QFDA 4XFDA 2QRVB 1I5OA 2YCBA 4LYAA 4F71A 5EWJA 2WU4A 2PSHA 4RSRA 2VZ9A 1RWNA 3GEIA 1T6ZA 2UUOA 7REQB 4MI9A 4HGQA 1KZGB 2NXWA 2VDRB 4PO9A 2NYVA 3O2QB 1D6NA 1DKNA 2B4AA 3QXHA 4Z7JA 4WACA 2BEUB 3LECA 1NYLA 5LJIA 1KTIA 3WXBA 2LVBA 2P2ZA 2ZYVX 4MS4A 4RTOA 3HYCA 1YULA 2NU9B 3P32A 2FA9A 3BB1A 3BAFA 1Y1TA 4EF6A 2QN9A 2HHJA 3V4VB 2YJ6A 2FGKA 2X58A 4HYYA 4J3FA 3NWOA 3TI9A 2PKQP 3AEKB 3QOYA 1X7GA 4Q9KA 3L4JA 4K7JA 3FNIA 4L7VA 1MGPA 2GNOA 4FGLA 4ISCA 5JMTA 3SE0A 1EZ4A 2BFEA 4IDOA 4D3SA 1ZD8A 3EQ2A 4W1RA 5C8YA 3UTCA 1TPZA 3RLIA 3TUJC 5LIRA 4Y0VA 1FUUA 3GPBA 5DCUA 1SCAA 3E1KA 4HNSA 5AKIA 1ZC3A 2B9VA 1Y1LA 2ERXA 1PWYE 4WX2B 1ST3A 3TRHA 1SD5A 5ALEA 4QAQA 2M6KA 3ZE8A 1TEHA 2FETA 2Y1FA 4QDJA 2QYHA 5IYZF 3QEKA 4CLXA 4YMVA 3P0FA 2P3LA 3KK0A 2JF0A 1H1LB 4I6GA 4AN4A 1RR6A 3BSWA 1Z4JA 3SI7A 5FLXA 4HBGA 1ESEA 4B3JA 1PGNA 3LS2A 4LYYA 4O0LA 4C08A 4PXYA 1P75A 1CLEA 1Z4OA 3WE7A 3WRVA 1LQ2A 5H82A 5AK0A 2JBHA 3E9DA 5AW9A 2DR2A 2IP4A 4MV8A 2AC2A 3A2NA 4DJDC 4XSVA 2XT9A 2A88A 3EEYA 4OA8A 5JXWA 5JWRA 2JKVA 3CE9A 3KR0A 5G4KA 1OBHA 3OF3A 1XEFA 2YZ2A 2NU7A 4AICA 1IG3A 1D0VA 4XJSA 4RQTA 1WULS 2FPWA 1A69A 3R3UA 3K96A 4P0PB 4BVFA 1W8IA 1RCUA 1T3ZA 4AROA 4JFRA 5I9BA 2GPYA 3MGAA 1ACLA 2NSDA 4JBXA 1PGOA 2QKYA 3EGWA 2I54A 1TAGA 3P9PA 3VPHA 1AZWA 3I53A 5EXTA 1Z5OA 3Q7QA 1I3NA 1YKGA 1JQBA 5FUWA 4F60A 2E0IA 3EXIB 3C4JA 3WTBA 2IS6A 2ZZKA 4GLOA 3P96A 3QFCA 1E2UA 4WZBB 4KR2A 3T3IA 3GJ8A 5BQ3A 4ZYXA 2JIDA 3SM3A 1PJCA 2DY0A 1PKEA 2E3JA 5D7NA 3TLJA 1SCUB 2XI4A 4C0AC 2R6HA 3FZGA 4GOJA 4R51A 4DCUA 2ZIAA 1ISSA 3ZWYA 1YI0A 1WU8A 1MC5A 5BSMA 4PAQA 3GLSA 4DMKA 3HYTA 3MD9A 1Z6YA 1NYTA 3GFQA 5ES4B 2TS1A 4TQ9A 3OZCA 4A2CA 3O84A 4PGGA 3AOEA 3AW9A 5D7BA 2V8OA 3IVRA 2BM9A 4XARA 1DWQA 4PYIA 3BM5A 5HG0A 1WUTA 3BJMA 4PFQA 1RXUA 1SVWA 3G2QA 5A05A 3F4LA 1KFJB 2DH5A 1ECGA 3BMCB 4LVNA 3VNAA 4D44A 2ZUTA 3U09A 1R00A 1U0GA 2E4WA 2AEFA 4URYR 3Q41A 4OAPA 4D5GA 4XVCA 4M38A 4R2JA 3PCRB 4HCJA 1MPXA 1QTRA 3DF7A 3ZUPA 5EYPB 2AFIB 2VHWA 4TSFD 1F17A 4B6FA 5EP3A 4NHEA 5TGTA 1VSTA 1NMYA 4JC8A 3TF5A 4V0LA 4FFSA 4XEUA 3ENQA 2Q27A 4MV7A 1QQ7A 3OIGA 3EDRA 1FMTA 3D4IA 4OYLA 5K2OA 4HX5A 2ZTLA 4EG4A 3CT4A 1MAAA 2FUCA 5JD5A 5IU6A 1MNQA 1NBMD 1G291 1D6MA 3I45A 4L2IB 2C78A 4M1YA 1Y8RB 4AUEA 3F1KA 3OH8A 1DIOB 4D92A 5IH7A 4AZ0B 1UUFA 2EKQA 2J6BA 1KJIA 1U28A 3C24A 3NU1A 3ETDA 4PICA 3JQCA 4QUJA 3UGQA 5A5VA 4BHTA 4Z0NA 1AKUA 5LYYA 3RSCA 4FFVA 3DFKA 3W1WA 3WLJA 3F5QA 3S2UA 1U99A 5GMOA 1E9RA 2OBFA 3VBEA 4BVLA 1VMEA 4U6NA 5JCOC 3AV3A 2WTXA 3I9FA 1Z4KA 4RJJA 5DLDA 4E94A 4HUTA 2PUFA 4HEQA 5CB4F 1YVDA 3G9UA 4NCXA 1ONNA 4JLDA 4TQUS 1Q1QA 4UE6A 4WCFC 3ZV5A 4H9GA 3BPSA 3H13A 2VI5A 4IDFA 3KHUA 1AIPA 1OI4A 1ZOLA 2WMYA 4G01B 2EZ4A 3EAFA 4JUDX 4NBRA 1T6XA 3DXXA 4XYMA 4A0GA 10MHA 4ZFNA 2EOAA 2EFYA 1U90A 4IV0A 2DBQA 4WZBE 2BCJQ 1A9RA 4DG8A 1YVEI 3FMVA 2YKGA 1UDRA 4PPYA 3VPGA 1JQ3A 1JKIA 1XCOA 3LBNA 1X7DA 1MT3A 3QX8A 1FMFA 2NZVG 3H5AA 4I4TA 4QVKA 3WFJA 1YDEA 5ARBA 1UFKA 5LP6C 1GTZA 3LIIA 3O9MA 2O0LA 4W63A 3AEYA 2Z2XA 3DAFA 1SXIA 1KO4A 1XLVA 3UT6A 3IUPA 3R0IA 2B3TA 2GESA 2QMHA 4I81A 1Q74A 5BN1A 3SEQA 1Z5PA 2J8ZA 3L1VA 3PXDA 1OT3A 4Q15A 2AN5A 2PN1A 4CM1A 5H81A 4YAIA 3WP0A 5B2FA 1Y4AE 5JCZA 1F60A 3WAKA 1RWQA 2ONJA 1RHRA 3R5FA 3L6RA 3U7HB 1PZMA 3R3VA 1W2GA 1V25A 4X63A 2G1AA 3OPYB 4JYBA 3PG5A 4PSDA 1RACA 3VOSA 4BFTA 5MHTA 3JX9A 2FUG6 1SCJA 3Q7EA 4HTAA 1TT5B 2J4FA 4A8JB 1MG5A 2WU1A 1QFYA 4MV4A 3TI7A 3R4CA 1GGJA 4FHDA 5DN6A 2ZUCA 1M2VA 3O38A 4B48A 4H31A 4BFZA 1U02A 4N0DA 2AFIE 1M34B 1H5UA 3PEEA 4FGKA 4ERNA 1RJDA 4DZRA 3PFFA 5FCDA 2WJPA 4HZGA 4PZPA 5IC4A 2XB6A 2J9YB 2BMDA 2Y1OA 2HLDD 3GAFA 4BYMA 4CG3A 5BWOA 3GXOA 2J46A 2WTMA 1V11A 2Z4SA 3G1UA 4YGYA 4ZDWA 3LUDA 1WPGA 1J2JA 1PE0A 1FY2A 1Y4ZA 2WZDA 1G8PA 3AVQA 4AWBA 1G8FA 2VHXA 2X23A 3JRWA 3K94A 4HTFA 4JJ7A 5IKEA 3F9RA 1WMFA 3O94A 4MSUA 4QBTA 5LU8A 2FDRA 1JIXA 2VHTA 2WA1A 4RZUA 4LVOA 4KJXA 4BX2A 1VIMA 3ZD9A 2OCDA 2AEEA 2FPGA 2HSEA 2QRJA 2EAUA 1JVSA 3RUFA 1NZJA 4QGHA 1KK0A 5K3OA 4HNAA 2HV8A 4B35A 2PSJA 1HZZA 1JILA 4B44A 1GUYA 1AA6A 4DUGD 4JT2A 4M8LA 5JJIA 1I4TD 2BN4A 3OZXA 4GNKA 4HGZA 4MO9A 3K16A 3V4ZA 5AHXA 3E03A 4H15A 4PLWA 5KQPA 1NQTA 2OVFA 5KNBH 5ECWA 5C5IA 2EFDB 4HGPA 2YRXA 3JATA 1DEXA 1KYQA 2WUVA 3MSCA 3IGFA 1NN1A 2ZJZA 5A0TA 4IINA 1TNDA 2XITA 3L6CA 4IDPA 3WYNA 5HHTA 2BMWA 2GVZC 2BEVB 3A6EA 4P4SB 4F4IA 1FIUA 4BAZA 2OEPA 1QE3A 1KRWA 4KO1S 4REQA 2J5RA 1G1AA 1YZKA 3V8RA 4LUCA 2PS9A 4N0EA 2PRJA 5B1EA 4I9UA 1EUZA 4BIIA 3BIXA 1WXQA 1XMOB 3OFSA 4Q7KA 2VT7A 4PHHA 2IYPA 1Z2EA 4MRRA 3N2GA 4LYGA 1I94B 4EJSA 4IUBS 5AKKA 3M4XA 3FOFC 2A1IA 1UF9A 5K6AA 5E3IA 5GAJA 4KXVA 1FFBA 4C88A 1Z2AA 3DKRA 2JANA 4NABA 3T4EA 4ZEOA 4AO6A 3ESCA 1JV2B 1LS6A 4DDUA 4XRGA 5U1PA 4U7GA 1WUKS 3ZQUA 4NH4A 5ALPA 1FJGB 2ATXA 5COBA 1Q3KA 3LGSA 4BGEA 2VDMB 2NU8A 5M34A 1SK9A 2HCTA 2OMEA 2ZI4A 4CIDA 4EDFA 3IHKA 1G18A 4G0ZA 2G06A 4ARVA 3GPLA 2QI9F 5CT4A 1HLDA 1XI2A 2H1IA 3EXHC 5AP9A 4J7CA 2HREA 4OJTA 3WI7A 4ZJYA 4JI2B 3AM5A 3SXUA 1M34E 4XM0A 2W6JA 4C4YA 2CMDA 3WQBA 1IPEA 4AP9A 1O1YA 3OKFA 2R2GA 1EZ1A 2O4CA 1YFLA 3K9HA 2AA3A 2VF8A 3B2NA 1QNFA 3VKFA 1HSOA 4WI1A 1KC1A 3IALA 1P7CA 3K9CA 4WMLA 3IUNA 1AY0A 5E7QA 2PBRA 3CZQA 1T0HB 3QJGA 2PX0A 2CLKB 2JJ2A 2HR1A 2P8JA 4CR6A 4HB2A 2OV4A 3DC7A 5HNKA 1KRXA 1UK9A 3IPLA 3L0CA 1IN5A 1UOQA 2JHCA 3TOZA 1E1YA 3GIWA 2UZAA 4RDHA 3RSSA 2WZCA 4EBBA 2HHHB 1Z5UA 2BVNA 1Z8DA 7ABPA 3OIDA 3NHJA 5JH7F 2VYVA 1YZFA 4KOEC 1NMSA 1DVRA 1AF7A 2PS3A 3HYSA 3HWX1 3QE0A 4WZAB 3SEAA 2GXUA 4RWEA 1JDJA 1W4AA 3BIOA 3NVKI 2IE0A 4OP2A 1E6KA 3A1SA 2XNHA 1GA1A 4KKVA 4OXKA 1VCOA 3UWDA 3I5YA 4BXOA 2E49A 1VHTA 3B89A 3ZNOA 1TI7A 3VR2A 2QRUA 1JU4A 3KAKA 4BRWA 3KETA 2Q1WA 2AF4C 4ETMA 1X9GA 4MOWA 1XMPA 4RLQA 2GXQA 5IZ4A 5KMGA 1YRYE 3C98A 1KJQA 3H1BA 4OM7A 1WNTA 2IYRA 2B35A 2VWQA 3ESZA 1VPEA 5CTAA 2JRCA 5CW1A 3W2EA 3S27A 2Y92A 3W6NA 3ZYZA 3K4HA 1QFMA 1WVMA 4EHJA 4IZHA 2XTNA 3EBOA 3WICA 3K0EA 4K9RA 3FCYA 3SYNA 2O5EA 3FNGA 2KHZA 3OCXA 3U9SA 1VG0B 3CH5A 3G2IA 5EXPA 5SYNA 2CV0A 1J7KA 4X95A 1JHDA 5EMLA 5JZ9A 4LF7B 3CRNA 1UH5A 2OHGA 1QFJA 3PSHA 1IBKB 2FQQA 1ILEA 1B7GO 2Z9DA 3WL5A 1FXWA 4A4DA 1E69A 1FTWA 4NQZA 3MRXA 2ZIXB 2J0EA 4JVSB 3RUIA 3V4RA 4GOXA 3PFCA 3IH5A 3KR1A 4X8MA 2BE7A 1WDTA 3I0MA 3RGWS 4C0QC 2G63A 4JAVC 1PIWA 2VBGA 1U2PA 1KQOA 2ZUUA 3TIFA 3ZLBA 4MUMA 2PL3A 5KS2A 2ZAYA 3VAAA 2R8XA 3HSKA 5GZ6A 3MJCA 2HIAA 2FR1A 4Q39A 4BLOA 2EFCB 2ZEJA 4F5YA 3SIWA 5A1JA 1H22A 5CYFA 1QU2A 3GRKA 1Y1RA 2C29D 1WLSA 1Z6XA 4YACA 4JI5B 4CIXA 2O0KA 4F4CA 3TGLA 5EJ8A 4JHLA 1OX6A 3T7TA 1A4RA 3BWDD 1OH6A 4LI0A 2QMOA 1MEEA 1MOPA 4E6EA 2FW7A 2NSLA 3WIBA 3PGMA 4LKRA 2WJJA 1DRUA 3KUKA 3PKZA 4QIHA 1T4CA 4M2LA 4OB8A 3KOOA 1J39A 4CM9D 2BCGY 2C7VA 4L6CA 5BYBA 4CQMD 1QLHA 2OYRA 2BW0A 2UZ1A 2XUKA 2PRKA 4Z4IA 9LDBA 1ITZA 1T5TA 1WF3A 2OKGA 2QAGC 5DK4A 5KYXA 1UDXA 2BGLA 1YNOA 2QWXA 3BRCA 3FNHA 1RADA 1TEVA 1YUNA 1AS3A 2GM3A 1DIAA 2JIOA 2YS6A 2HFJA 3C2QA 3T35A 1DKQA 4KHZA 1XAGA 2X13A 3F6PA 4AY4A 2HL6A 3LA8A 4MMZB 3UBTA 4U6QA 2P5SA 4LOKA 3OZRA 1TL7C 4WZAE 3I62A 1VG9B 1G21A 4HLUA 4V02A 2X1MA 4X1IA 1T0JB 1UMKA 5C1BA 2O8DB 2G36A 4QRIA 1DBVO 3CEPB 2XGOA 3MBOA 4HXYA 4W5JA 3WP1B 3UK1A 1LDMA 4WKBA 3B9PA 4MS3B 3IXMA 2QQEA 3JQBC 3ZH2A 3S2YA 5J4KA 1IPFA 2AJCA 4DZZA 3FHLA 3UB2A 4GRDA 1OLOA 2QZSA 3RS9A 2ANCA 2WE7A 3NYQA 2P75A 4J3JA 2WOOA 4QULA 4TKVB 2EJVA 2C88A 1LS1A 1Z0DA 4MTLA 2H31A 3BDVA 5IVDA 4EY5A 1QOPB 4KQJA 1CV2A 2A9OA 3DLPX 1ZLYA 5FUBA 2DQZA 2QENA 4Z4HA 1C1DA 5LUBA 1RXSA 3GHHA 3GJ3A 3HLKA 3KZVA 3RS0A 1DT5A 1ZAKA 3JQ9A 4PG8A 1O0BA 3TNYA 4R5MA 2V7VA 3T8YA 2BFBA 5D6NA 3THWA 2GRJA 4U8GA 5ALDA 2V55B 3DZ8A 4NEGA 5K0FA 1U9YA 2R8EA 4CM8A 3BTOA 1LDYA 4GX1A 3EC2A 1W6UA 2JGRA 3PD0A 4M53A 3ZCRA 1XVLA 4TT8A 3KDPA 3VDQA 4AY5A 5FOTA 3K0HA 3RT7A 2QPAA 4YPFA 4GVXA 3GJZA 4I6EA 1KEVA 4E03A 3AM4A 4YRJA 5FKJA 3MQFA 2DFTA 2ZIZA 3PWZA 2BBTA 4YFVA 5EMKA 1ZH8A 1Y7TA 2FMHA 5HDBB 4URHA 1ECBA 3DFZA 2ILTA 2GTHA 3DOJA 4MCIA 4AZWA 5HP4A 2AT1A 3I2KA 4PLHA 5A7GA 2IC5A 2JI6A 3CYFA 4PC2A 2RDMA 3UO8B 3RYHA 5HE8A 3KSDO 2YIVX 3KUDA 3B7PA 1DG9A 4BY9E 2P2LA 1JG3A 2J6IA 3QLUC 3EQ6A 2AH5A 3STYA 4WOJA 2WWYA 2XYPA 4ER7A 5TQ0A 4CNBA 4Y9SA 4U2FA 5KYNA 1EB8A 2KSQA 1THTA 3DDSA 3I34X 1GRQA 1FSZA 1SQ6A 1ZR2A 2IH5A 2PX3A 2XGSA 1GZSA 3IQIX 5BV2P 4P31A 1UQRA 1V5IA 4UJ3A 3PXCX 5CHYA 1CNMA 1RYEA 4GRAA 2R8BA 3FWHA 2WNSA 1JYSA 1T0BA 1RYFA 2GCOB 2OXFA 2IXDA 2FWJA 4Y9RA 1JDVA 4RMIA 5J2UB 5BN4B 4AQDA 4KRXA 3MGGA 4WADA 4BO7A 4LVUA 3U7RA 2J9FA 1OLUB 3AHFA 1O6BA 2YZKA 3ISTA 1C81A 3OU6A 3Q9UA 4N7RA 4NZNA 4QDZA 2ZJ1A 2FW9A 2JASA 5HZMA 5CGZA 3QLEA 1LF5A 3TQRA 2R6ZA 1DEKA 1SKBA 2JGNA 3UJCA 4BNUA 4IFEA 3SC2B 3S1AB 5IT9A 3BYZA 5A5EA 2XXAB 3BGDA 1VPWA 2IHNA 3EUAA 4G9BA 1P19A 2GYYA 1XR3A 1EXNA 1DQYA 3NBUA 3ZGVA 1KDPA 2AK2A 3VZCA 4W5QA 2AXPA 1KAHA 1THZA 1G3MA 3JSAA 4QFCA 3CFYA 4W99A 3WZLA 1XTPA 2EF1A 3QBVA 3H4MA 4RZHA 2H08A 4ZQBA 5ALOA 5EZYB 3ZQKA 2ZRQA 4BAUA 3C3WA 2UUBB 3EIFA 2HJSA 3DUFB 2HA3A 2FVXA 4IRXA 1FF9A 1JFFA 1BCRA 5CRIA 4OQQA 1FX1A 1CHNA 4DR2B 3DOUA 4IVQA 2ROQA 2H2DA 2QBYA 1VKRA 3W8RA 2OXIA 5TC4A 3U17A 3U40A 1TAQA 1IMJA 3RNOA 3C3MA 2IYVA 1H2FA 1MDBA 3HJTA 2ZVJA 1H3NA 4OLBA 1QX3A 2BFDA 3II6X 1GSIA 4TMWA 4MYDA 3M1LA 1ZM3A 3BIWA 2EFGA 4ZHQB 1ZGZA 3RYIA 4NS1A 1K98A 1MD9A 2P5TB 3D02A 4HZUB 4LJ9A 1NTRA 4MA0A 4BVAA 1FZTA 1T8TA 1AURA 2CNOA 4UBNA 5A62A 1ZD9A 1USKA 1L7PA 2Q1XA 3EK2A 3GLHA 3TMYA 3I9LA 4JL5A 3LT4A 3SK0A 1XCJA 2FPKA 2KLHA 4TV8A 4I14A 4G0NA 5FI0B 1ESNA 3RWBA 3LU1A 3F7TA 3SDBA 4YUZA 4ZZ0A 1YB5A 2CZCA 1UM9B 2CUZA 2F64A 3AF3A 4HWSA 4M60A 4MYRA 1KSJA 3CX8A 3UJHA 3WWDA 5CEJA 2C1ZA 3NHUA 3N2KA 5CDTA 4NZMA 4YREA 5JAHA 4JXXA 3BA1A 4LNUB 1H6DA 2Z8YA 4MQFB 2P0AA 2PD3A 2H1WA 1JPNA 2HM7A 4MPDA 4ZU6X 4YPOA 4MMXB 3KKPA 2OP0A 3STTA 1V39A 5KDLA 1V43A 2ZRGA 3RVMA 4M88A 4D9FA 2J09A 1QDUA 3E5NA 4IJWA 4YRIA 4FOPA 3E27A 1JZQA 3TO5A 3DH0A 2P9ZA 4XFKA 2YJ3A 1CE8A 2F1IA 3TLGB 2VDWA 2GJKA 4S2EA 5CPBA 5DNYB 3KG2A 5D2CA 4A03A 4NU8X 3O4RA 3OWHA 2NZUG 3ICCA 3QWHA 5BQPA 4PNEA 4DC1A 1CJCA 1LPBB 4RDIA 3B48A 2QT0A 4DV7B 1Z2PX 3JZFA 4LDJA 3LUCA 4JYPA 4U2BA 2HU7A 3NYWA 1J97A 1W9MA 4J0JA 3ZTWA 2HMUA 3TDMA 3V2UA 1PVDA 1B42A 3W04A 5LQUA 1GDHA 1MNAA 4C0BA 1CB7A 1T5HX 5AVWA 4BO2A 4LMAA 1OCEA 1E59A 1MQSA 1Z0AA 4ID3A 5KSZA 3JD2A 3K0BA 1L4GA 3RASA 1D2MA 4B80A 1NBIA 3SCZA 1M6YA 2A14A 5CFQA 3MWDB 2E48A 3ZHBA 2JGAA 3DOEA 3HFSA 2HGZA 3L6OO 3W0LB 2C5GA 2ZB2A 1MOQA 3NTVA 4IEEA 3PNQA 1XTJA 4HX9A 4OF4A 3EIQA 3CA8A 3EOZA 2B20A 4E5DA 4HYEA 3T3GA 4DYDA 3LY7A 1P74A 1ZA1A 4BZQA 4TRJA 2NTVA 3R7SA 4CVNA 2GJ8A 3AFMA 2AFHA 1JFSA 4FWBA 1KDZA 3GJTA 2IYSA 1R12A 2RGCA 2ONKA 2Z2IA 4HC4A 3R4VA 2YNMD 3I3SR 2G28A 1C2TA 3EGCA 1V6AA 4NZZA 3VM6A 1NKSA 3UGJA 1D9XA 3TKLA 1SM4A 1DUVG 3NONA 3DTVA 4Y9UA 5EWMB 3S2GA 1FSPA 1SN7A 1ZNXA 2BSAA 4UAGA 5DM0A 3LRTA 4GE0A 4B3CA 2OD7A 2ZTSA 3CLRD 4M7PA 2RC5A 4YK7A 4RA9B 3PWSA 5EVJA 4CU5A 4HNUA 4NS4A 1GVHA 1BCSB 4IDHA 4FYIA 3RODA 5EHQA 3Q8KA 1SC4A 1QO0D 1L5MA 1G7RA 2PQ2A 1UWLA 5FA8A 2IUEA 2ZXUA 3DPSA 1HE5A 4BUZA 1N5JA 4I7EA 1E7MA 5KWEA 3FB4A 1ULHA 4YPVA 4IDGA 3VR4D 1JLLB 1OFIA 5SV2A 3FH0A 3QRWA 1B0ZA 4XDYA 1G66A 4TWZA 3E7XA 4BV2A 4HNTA 3KSRA 1T3TA 3L0YA 1RRGA 5JBNA 2FJ0A 3HZHA 3GWGA 3H8WA 5T67A 4A27A 2OBLA 3A9VA 4R3UC 2O8EB 2DHEA 3I09A 4DMCA 3GFTA 4YCMA 4BASA 4E2YA 3U5ZB 4XUGB 1TQ4A 3DLAA 3L02A 3S3TA 4UHFA 3C8DA 1E8DA 4XX0A 4CUKA 1N0IA 1ZP6A 1AVTA 2AWOA 3FW1A 4XI9A 1ZMOA 4NNPA 4DV5B 1JEQB 4NFHA 1Z29A 2HU2A 3BXFA 3LPNA 3OZGA 2R8PA 4YJ3B 2LD4A 2X86A 4NYIQ 1POWA 3MNFA 3CXRA 1F2TB 2IJGX 4G4IA 4WSOA 4ZVOA 1J0CA 1N2BA 3L40A 1PKXA 2FGJA 2GEUA 2QTGA 2XBLA 2XTZA 3HN6A 4HNGA 2I34A 4LC0A 3V1MA 2I03A 3AKEA 1YB1A 3VR6A 4C87A 4S1WA 2J4DA 3TUZC 3BFJA 3DB1A 1TCUA 3C15C 1JKMA 2VJOA 3MM4A 4FMCF 3JWHA 4CMIB 4MW7A 3KJQA 2ODWA 2W58A 5LXTB 2C5AA 3B5IA 1RYHA 1GZDA 5IP5A 2Q28A 2XQGA 2E37A 3H3XA 4UQPA 4FGSA 2PSEA 2YW9A 4KXLA 3F4BA 5F3RA 1IUOA 1CQIB 2BEJA 5KBYA 3SHFA 1FLAA 3NDJA 3DZCA 1EVQA 4HQNA 4OAQA 3N39C 1P60A 4JBNA 4B81A 1HI9A 1Y1PA 4ZVPA 2XZOA 4HD8A 3UB4A 5DYTA 1P7ZA 1XWWA 4D82A 1BG6A 5JAZA 2XGGA 4EA6A 5IZCA 1B43A 3PDHA 4I1PA 2OHFA 3PUYA 5D3MB 4ZREA 5CFOA 3AVVA 4L9WA 3KQYA 1EX6A 4NI5A 1BD3A 5L6MB 3DWEX 2RK6A 1YRLA 3ET4A 3OM8A 1IN1A 3VNBA 3FOBA 5IG2A 2O0JA 1N25A 4WNAB 1RYYA 4DCMA 2WF9A 3SJ7A 4ECAA 1BHO1 1W2WB 2JI4A 2NTEA 3EXHB 5CB0A 1QFXA 1UJMA 1X8LA 2X5NA 1XZNA 3OAAA 1DT3A 2D1QA 4QHYA 3SLGA 4MDHA 3W6UA 5FL7A 1NVDA 2XMZA 1C4WA 1OAOA 3UG7A 3OZDA 3R40A 3GRPA 1J0EA 3OZBA 5FADA 2X0NA 4DCJA 2GD2A 2BFCB 1FYVA 3KVYA 5JO9A 2JFFA 3CKLA 3UAWA 1XNGA 2PS0A 4B75A 2J3DA 2EC5A 5JY1A 2Z43A 4KXNA 4XCQA 4ZO4A 1C9MA 2F3UA 4I9FA 3OTWA 2R2AA 1VSQA 3CLSC 2F2TA 4RK7A 1F8YA 2J9RA 2YH2A 1XEXB 1CJVC 1FTQA 1U94A 5JUWA 1XFDA 2Z3WA 2PWZA 4FLFA 2GTIA 4JCOA 3K32A 1L8LA 1NQ5A 5D8DA 3UMJA 5HW0A 5JPCA 1NF8A 1QF7A 2R66A 3G2OA 5IABA 3ZDCA 3EJWA 3DNMA 4HDKA 1FP2A 3LT1A 4CDGA 2Q6KA 3UY4A 1TQDA 4ZVSA 3ZKWB 3UXEA 4CIBA 2ZKLA 2OFPA 2G09A 2G9UA 1IXYA 3F49S 2CY0A 2MMCA 2BM1A 3H0KA 4MVJA 4CF5A 1E3LA 4G5OA 1XNQB 5AKZA 2XYGA 4GBJA 4KBYA 1U1CA 1ZM4A 2ISCA 2J07A 5BOSB 2GILA 5JLJA 4FNMA 3VR5A 1NJSA 3ASUA 1X6VA 2IP1A 2Q3JA 1MEOA 3EVGA 1LJ8A 1ULUA 4O8CA 3K05A 2GZHA 4HNHA 4ZT6A 3WMFA 4B3RB 1K68A 4IX9A 1U5BA 4U39A 5BSVA 1AKYA 1KYIA 3LBAA 1Y7HA 3GMTA 3Q3GE 4CQLB 5HYVA 3EY9A 4LJKA 3A6DA 5ALKA 1A98A 4PWZA 1QH1A 2EBWA 4P3NA 5EJEA 3OPNA 3UUWA 1YMUA 4Z4QA 4F84A 2B5OA 3DFIA 1B8OA 4MR7A 5ES3A 2E4XA 4CBVA 5CM2Z 1AV6A 2CLFB 1E5DA 1EFVB 1ZL2A 3TD9A 1CYEA 2CFCA 2DLDA 3ONVA 2M2IA 5GADl 2G6BA 1S8NA 5ILQA 3Q5DA 2F4VB 1E2DA 5CURA 1A8PA 2GM5A 3IE2A 2BGGA 5K0NA 2FOIA 3VO8A 4Z2AA 4O2BF 3GCZA 4WLEA 5I48A 3UJ9A 1Y34E 1J8DA 1FX0A 1G16A 3R0XA 2R0QC 1P5FA 1U8CB 2W9XA 1NQVA 2ZQ5A 2IWHA 4MDEA 1FFWA 3AVOA 2H63A 1AE1A 3T5DA 4D5EA 1M6VB 3OLYA 3N5KA 1T8YA 2W2PA 3HCRA 5EIWA 1O4WA 3W2HA 1I3LA 1ODKA 1KOLA 3OJLA 3WNDA 1UODA 3S99A 4LF5B 1HG0A 3AX6A 4IKPA 3HUFA 3MINA 4QUGA 5J4VA 1RRKA 4I50A 3FAZA 1FXUA 3AQIA 2QG6A 1O96B 2XCLA 4L1KA 3OFKA 2F1KA 4U2GA 1R4ZA 1LSJA 1KKUA 3E9MA 2L2QA 3WGMA 1U0LA 1ETHA 1F2VA 1MABA 3NFYA 1COWA 3NOXA 5FLYA 3W3AH 3HYRA 1FYXA 4BEWA 4V0MA 1TU4A 1KY5A 4G1EB 5TJ9A 3EXEA 1QORA 1QVRA 4RA6B 4OFWA 1ZJ5A 2BDEA 3W5IA 2Q62A 3QU9A 3NYRA 4HLCA 3DQQA 2CB9A 3R5XA 3QFFA 3ZHVA 2O1WA 3IT3A 1JLKA 3MTJA 1FA9A 2GN0A 5FYQA 3FNRA 1BJRE 2O2CA 2OCYC 1NJ6A 2RAVA 3FYUA 1L5NA 1T29A 1NHGA 2Z98A 3FDIA 2ALJA 3NPAA 4MB0A 1HE1C 1LTHR 3I4CA 5CJJA 5AICA 3Q1KA 3ZXYA 2XTMA 5JNTA 3JQ6A 3L7MA 4TM8A 2QLNA 1OZGA 3F6CA 3MUNA 5JSKA 3MLBA 4AKTA 2FN3A 3TXAA 1JL3A 3CNEA 2MSNA 3NHMA 3D4PA 3ROZA 4NJMA 1TCCA 4HGNA 2EX0A 1W9HA 1QM5A 3IOBA 3KE8A 3NM5A 4MKXA 1F9AA 3VNSA 3WR5A 4JP8A 1I7DA 4P82A 1T8PA 1FYWA 2JH3A 2JA2A 5IJZA 2F8TA 1XXHB 2QF7A 2WFMA 2PUBA 3VO2A 2AVDA 5FBQB 1NULA 1T4MA 2X22A 4PAGA 3NM6B 1GU1A 4Z9BA 4CV0A 2PPVA 2X77A 3A3YA 1I33A 3PITA 4I55B 4JL8A 4M6WA 4NATA 4ZQFA 5K3BA 1VFPA 3VTAA 5A3RA 5DASA 4NMMA 1O89A 3V4FA 2G72A 3DLTA 1N5MA 2HNKA 1DKOA 1VGQA 1DEHA 1R0CA 1OTXA 5CNMA 4EKEA 2EVWX 4M89A 1SAYA 3HU3A 2MSCB 4ZRNA 2L18A 2X9LA 4GLFA 3ROXA 1Z6GA 3REQA 5DP1A 1T2VA 2WIJA 1BSVA 4F2HA 1PHRA 1QR2A 1Y9EA 3BUSA 2AZMA 3V4PB 2CVZA 1WG8A 1UC5B 4OK3A 3ZGNA 1RBQA 4B3IA 3ZHYA 4KE6A 3D64A 4MLDA 4UOZA 3QVXA 4M37A 1ZGBA 1RP7A 1L1RA 4DMFA 5F5LA 4G56A 5MN4A 2GCNA 4QQRA 3C39A 3RKRA 4MPPA 3VO9A 4YROA 2VR1A 1DMRA 2O8CA 4RELA 4ALIA 1TIPA 5IUNC 1T0IA 4AXBA 1PYOA 3TX2A 4ND8A 3ZHUA 1RQLA 4QJIA 5E38A 1NV8A 3C1UA 2R8YA 1LJLA 2F3TA 4P86A 2WUFA 2CYBA 4PR0A 3TLBA 3TB4A 2XCOA 4ANFA 4C1NA 4JXZA 1Y33E 5EZ5A 1WP4A 2JAWA 3HYLA 1K6MA 5D86A 4BVBA 4L0QA 2VHJA 1NM5A 1A97A 1NVFA 3QF4B 4OFXA 2NTJA 2Z2ZA 3KJFA 3LE8A 3VO1A 1ZK3A 2WHEA 1RD4A 4JEMA 4JQOA 4M46A 5FO1A 1XU4A 3JALA 3KUCA 2UYOA 1SOMA 1VHLA 3DKPA 3WLOA 1H65A 1YHZA 1UFRA 2IW1A 2ZBEA 4PY2A 5KAPA 3L06A 1RHQA 4GW3A 4OHRA 2II6A 4BO0A 1JXOA 3RFTA 1GT91 2LKDA 3FJOA 5KHLB 3JQEA 1P0FA 4URUR 3TMAA 3R3XA 3KKMA 4UHHA 5DKFA 4MV3A 1RYBA 1WRBA 1ZDMA 3SICE 1XK7A 1CLUA 1LY1A 3HBMA 1UBRS 3HJRA 3L8YA 1PG5A 2J45A 2PFSA 1JYEA 3QYPA 4A1FA 2DQYA 2HPAA 2PGXA 1VHDA 1GG9A 1LWNA 3CKYA 3EZFA 1NPTO 3F5SA 2FJUA 4UATA 2YBEA 4OYRA 1Y5RA 4K28A 4W1PA 1CIVA 1PZFA 1XXHE 2QMEA 2R96A 2Y1GA 5ELXA 2ICAA 3FOZA 4IDQA 1EQUA 1P5JA 2GETA 1NOJA 4F5EA 1BDMA 1CQJA 3BMQB 4DG9A 1JE0A 3C16C 3L4BA 4ER6A 2GK3A 4LY6A 3EFHA 3P4UA 4M83A 2H5EA 4P5DA 4YRRA 4J91A 4BQOA 4GC5A 1UQTA 1Z7YA 2AG8A 2ZRBA 3B1WA 3RFUA 3TKAA 3B52X 4IIJF 3KQHA 3ENNA 2P4EA 3KYBA 4UARA 5CT6A 4IH9A 3OQ6A 4OXRA 3DC2A 1XKTA 3C5EA 2VEOA 4PYLA 2HO5A 2FEPA 3MG9A 4N0MA 5FNVF 4ALJA 3FE2A 4PO8A 1TK2A 4WKGA 2OLJA 4B3SB 1NJ8A 1E92A 2YMQA 1L5ZA 4RM2A 3WRWA 1NI4B 2FSGA 3AI1A 4UUAA 5IYZA 1DP4A 1EYZA 4C6TB 5J2TF 4P83A 3JRNA 2ILVA 2YHIB 1XT6A 2GYWA 2WJ3A 3H9GA 1JHPA 4UUOA 5CT9A 2GHIA 2Q2WA 2HCRA 4JFAA 4YWJA 2JZNA 4ZMSA 3W77A 1W87A 2P1ZA 5DTMA 1I1QB 2QM0A 5F7ZA 3R3WA 3IX7A 2MU1A 4LZZA 4BFSA 5LQAA 1FYEA 1TZBA 2J5KA 2VJQA 2V4ZA 1ZO8A 2IWRA 1EWTA 4R69A 4UC0A 2RGNC 4BZPA 2K2WA 2X0KA 4DNPA 4FYHA 4ZN6A 3ITNA 3KOYA 3OM9A 4NECA 4C3OB 2JZCA 5K3EA 1FTNA 4ADSG 3PFWO 4B3XA 2QJFA 4DBLC 2WAOA 4N3BA 3RSQA 4J94A 4DLUA 1HMYA 4NOKA 5EN4A 2AQ8A 3BGOS 4ILKA 4ROSA 5IKMA 1GDTA 1BFDA 3NLLA 4NCKA 4YP7A 4I8XA 4LISA 1EXDA 1PJAA 4IO0A 1MBZA 2QR3A 1TTQB 3A2KA 4DDVA 2WSSD 3T9AA 4YAJA 3GQVA 4JBIA 4D9BA 4NCBA 1SG6A 4BFWA 3STWA 1JKXA 1HEYA 3EULA 4XGNA 4N8DA 4JP3A 2XDQA 4QT0A 4E2ZA 4BVHA 1NBOA 4DT1B 1U7TA 3KAQA 1BE6A 1NLYA 2YC2C 3U4QB 4FOTA 3WXMA 4G09A 5MN6A 5LOVB 1E2BA 4H3SA 4L8VA 2E6UX 3SM9A 2A1UB 2WJIA 3QOWA 1BQEA 1ADFA 3HR7A 4I3GA 4Q47A 4KGZA 4ZT5A 4LJ5A 1KRHA 1RRVA 3NHWA 4N5NA 3C6QA 1LRLA 1RZUA 4US0R 1PUXA 3FPSA 3R9XA 3IAHA 2EERA 2AB0A 2R65A 3DP7A 1PT7A 4G67A 3K1AA 2OO5C 3LDUA 3NEYA 5BW5A 3W9YA 3VKGA 3VNUA 2C5EA 5HKAA 3FUVA 3MZ0A 1AHNA 1NX9A 3L43A 1YXMA 4CEJA 4AKSA 2VN8A 3VHXB 3HEBA 1G17A 3OM1A 1GPWB 2R85A 2XTAA 4QTZA 5LA6A 1WETA 4F4UA 4F8EA 1EQAA 2PXCA 4H7DA 1YMVA 3JYQA 1E5VA 2RH4A 4KO8A 4QD3A 3FGOA 3P4XA 5KX5B 1TAHA 2CMKA 4J2TA 3VAYA 1RLJA 4MA5A 1WB6A 1ORWA 2WMDA 3TR6A 2AZXA 2ZKIA 3FJ1A 3S70A 4NRDA 4B4KA 3AUTA 3NIFB 3I83A 4KPGA 6REQA 5CLIA 2OV3A 1EE9A 1X2BA 4U9HS 4P3YA 3U44A 1NG1A 2ZCUA 3BE8A 3KSBC 2H92A 1ZK0A 4RSMA 3L49A 3GCWA 2QEQA 1L5VA 4YXFA 2IHUA 1J8YF 1H0KA 3I9MA 4EFLA 3A14A 3GRUA 1M7GA 3FNQA 2MYTA 5D1NA 3MELA 1QZ3A 2XMQA 1NHWA 2IOHA 5G53C 3QPDA 4C89A 1AG9A 2W2KB 2P7HA 3JQGA 5DBEX 2KYRA 1KDYA 4CMKA 1HR0B 4DY6A 3EIUA 4CGYA 1IATA 3IAUA 3E4CA 1XDUA 4X1OA 4GNRA 3RRXA 1DU4A 4DSZA 4IIEA 4OATA 4A8PA 2B30A 2FZCA 4BCBA 3PRKE 1Z7WA 4WV3A 2ZSAA 5J47A 5EJFA 4D57A 3PPYA 5ALMA 4AMGA 2BRUA 5BV8A 1JFRA 2ZJFA 4DWJA 3DBRA 1GKLA 1L4EA 4HMOA 2Q4DA 5KTSA 2WHRA 3BXZA 2W70A 3ID6C 1ZN7A 3UT5A 4WK0B 2JKYA 5CA0B 4OBEA 5AOVA 2JIMA 2JI8A 3GGJA 4C30A 1TM5E 2JA1A 2O6HA 3GLQA 3DZBA 1NBMA 3GU3A 1B93A 2RGDA 1GFWA 3FAKA 3IHTA 1X1RA 2C5LA 3IDQA 5HQJA 5HSGA 5EL0A 4E15A 5I7WA 2FMUA 3CN9A 3VZSA 1T9ZA 3P2IA 1KOGA 1FPMA 4C0SA 2H0AA 4NAUA 4YJFB 3RUDA 4MVXA 1B6GA 1W88B 1XZ8A 1G64A 2ET6A 3OLVA 1JR3A 1S5PA 5AI8A 1CZHA 4EPRA 3QBTA 2OM2A 3ZU3A 2CNDA 3R5KA 3I8SA 4PQEA 4YJGB 3AGPA 1UAAA 2GOYA 4Z2YA 1J23A 1PFWA 2QAIA 1TADA 5DI3B 3VGJA 1C2YA 4CU2A 3JSXA 2O5VA 2GARA 1SKUA 4MUGA 2GAOA 2WWRA 1GU7A 4LJLA 3ETGA 4BB9A 3VZQA 4CN9A 1K86A 4I2NA 2VJCA 3OJWA 3FZYA 4Q00A 4RY0A 2ID7A 4JU8A 2EGUA 2ZDGA 5G4LA 2JI7A 4BNLA 4RH3A 2P77A 4F3CA 2TECE 5EHNA 3MTDA 5K6RA 1T24A 2FWAA 2BUBA 5CXUA 5BNTA 5LN1A 2DPMA 4LXGA 1AKNA 2LP4Y 2C9ZA 3LRXA 4J0KA 2LCQA 1XPOA 2X40A 3GMDA 3O92A 1T5BA 4Z3KA 1N34B 4MWZA 4BFXA 1YAJA 1DKLA 2NAFA 2X8BA 3NWEA 5B3JC 2CNKA 1UMBA 3B1ZA 5KYYB 5FPKA 3FMFA 2NO4A 3DFMA 3GZJA 2BMVA 2P3OA 4PVCA 3OOYA 4EW2A 3R23A 3NEPX 4PANA 4DPMA 1MN6A 3AIOA 3RTCA 1JU3A 3GP8A 1RBYA 1K0FA 1JAYA 4EYSA 1K3FA 4NONA 4EQ6B 1YK0A 4WLOA 3RHFA 4RDXA 4L6AA 4UHEA 4WGGA 3PF9A 4O2AF 1G0NA 3L77A 5SICE 4S1VA 4D0LB 1A0OA 4NR0A 1N2CA 3EPHA 2XWPA 3L4EA 1QCYA 2P67A 4OLHA 4C4AA 3COZA 3GQBB 4GX2A 4J16A 5EA2A 2CHVA 5KU1A 4ZI3A 4IOLA 4RV4A 2XOEA 2XOXA 1U7OA 3DDWA 2PV0A 5IDXA 3AUKA 1L5FA 1GITA 4GGOA 4XWYA 3T9BA 5KIAA 1CSEE 2EKPA 4AKEA 3QXGA 3VU1A 1WCIA 1YZVA 2HADA 3ZIUA 1L7XA 4TMFA 1U0JA 5FOXA 1L4FA 1IEXA 1CRZA 1NNUA 2Y3IA 1JAHA 4G24A 1QNLA 4LDNA 3A6JA 5JQGF 3OZIA 3H4TA 4JJ4A 1IJBA 1E58A 1T5SA 1P77A 2CLEB 5J23A 5ALXA 1ZKDA 1I2BA 4I5FA 2GPBA 1RS0A 3GEGA 2I3GA 1M75A 3HJHA 3BX1A 1I7NA 4QL3A 3TB6A 4D8TA 5HZHA 2IOQA 3H8VA 3GT4A 4BBJA 5KVVA 1C7JA 1XZAA 3H5VA 2YQ5A 1E1CB 3KKQA 1DC6A 4FR2A 1KVUA 3K20A 1VL1A 4X60A 1GZ6A 1M2NA 4CM5A 2PZMA 1CERA 3EBPA 4DUGA 1GADO 2CCJA 1LPPA 3K2QA 1UT8A 3KU1A 4ER5A 2H16A 2WTAA 1J07A 1P73A 3WWCA 3ZIDA 5BSEA 2UZ0A 3G89A 3CVVA 4JNKA 4P4TA 3IEVA 2WD7A 1E1MA 3AR7A 3QEMA 1V37A 2X4LA 3H1EA 1SVSA 4FWIB 4RX1A 2J7KA 1YJ5A 2X2FA 2GJSA 1AMUA 4LYDA 1T0UA 2AJBA 3QITA 3KQPA 4L3WA 4M99A 5EC8A 3Q12A 5FPQA 2J0QA 2J0VA 5BUCA 3JARA 1UWVA 4R2KA 2HIGA 1U5CA 4MGIR 3K1TA 5DN9A 1GLNA 4K03A 1LC0A 1GKYA 3DMGA 4AF7A 3SLRA 4DIDA 4BMDA 2WAMA 3EOBI 4YRSA 1NQWA 1KMCA 2HDNB 4YRGA 3JWPA 3FCCA 3A2MA 3PEUA 5ERGB 4L08A 1QF6A 4ITRC 5B55A 1QYRA 1R50A 3P9SA 3RVLA 3W4JA 1YB7A 3UH0A 4DR5B 3ZZ0A 2YASA 1YQUA 5AK5A 2QZJA 3V4OA 1JFTA 1WF6A 4OHFA 3BB3A 4Q9AA 1AT1A 2W4IA 3JZDA 2PT7A 1OFUX 4Q3EA 4X20B 3C8MA 1YVUA 3QLVA 1XD2B 2W43A 1PQWA 1SCNE 5AHOA 2VS1A 5JTTA 3OPQA 1GGEA 3FCUB 3NJ4A 2WSLA 6ADHA 1GNPA 1UMCB 2WFZA 2QTTA 3DMTA 3FSEA 4TYMA 4UU0A 4AJ4A 5CA1F 4NX2A 1OIXA 4DXAA 2DG2A 2EHDA 2H2AA 3IJPA 3JW8A 3SZGA 4HZIA 4XWTA 4YT8A 2QB5A 4F92B 3L7JA 4TTQA 3ER8A 3DLCA 2WG2A 1NN3A 1PR1A 1VRWA 2CFSA 3OM0A 4GRIA 3G2MA 4H1HA 5AKXA 5T5QA 3A3NA 4DLTA 1PYGA 3PFKA 3GUYA 1R9GA 3D6TB 5KYTA 4BZWA 2MSKA 3H3FA 1ZVMA 1XPRA 4B33A 1KI6B 1U2DC 3D6HA 4PFKA 2H5IA 2E21A 3D31A 3DR3A 2I87A 1E9FA 2ZWMA 1NLMA 2GBLA 4HJRA 3TLZA 3WGYA 2V7UA 3WLRA 5A6SA 3M4YA 2BDUA 3GHYA 2WEKA 4ALMA 3R6LA 1SK8A 1BYIA 4BVGA 3FYSA 2QT1A 1RYZA 1XQ6A 1UPUA 2HUPA 1JB1A 4OKSA 3TSCA 1EAMA 4G84A 4V2UA 3UG6A 2H0RA 2P0YA 3OJCA 2LDBA 1L6RA 5AXCA 3UV6A 5CLJA 1Q3HA 4N40A 4K9LA 3V8MA 4AZ3B 4MUXA 2DEUA 3M6XA 2QAJA 3W06A 4AJNA 3DGFC 2QX4A 3EWAA 1T6YA 5IHPA 4Q4HB 1OV4A 1V16A 5ANRB 3SD7A 2SBTA 4AYWA 1A82A 2QI9C 2QA5A 3HVRA 4DV0B 2WKPA 1E7RA 3HCFA 2IUUA 1PT8A 2ERYA 4DLNA 1YIAA 4RVFA 1DFHA 3WTCA 2M6SA 1NUAA 3CX6A 1GA4A 3LYAA 4K6OA 2WAAA 2PKYX 2P9FA 5KPDA 4DJJA 1W5FA 5AKYA 4QYIA 3IEMA 5K4GA 1XAHA 2HN9A 5FWYA 1J8MF 3B3QA 3INTA 3KZKA 3C6KA 5JZOA 5I01A 3AHIA 5M29A 4QVIA 4HG2A 4ZC8A 2KS6A 1JG6A 3T7EA 4EX7A 5BQOA 4YJ2B 1L8OA 1O03A 1HK7A 4Q4DA 5EZ6B 5BV7A 4F3YA 2V5VA 2ZE7A 1KGSA 4J90A 3OOEA 4ROTA 5FPHA 4FFWA 1C9KA 2VCEA 3LTEA 1XBTA 3CY6A 1T3HA 1VCIA 2JCBA 4BLTA 2V7XA 4E11A 3AWIA 2ZK7A 2WJHA 4E07A 4X94A 3IT1A 2HJ9A 5DE3A 4BIMA 4MW5A 1V9LA 5AXAA 4REMA 4CMBA 4GEKA 4IXTA 4J4BA 3QKSA 2G9RA 3MWLA 3EQZA 1I4EB 1IM8A 4D45A 5BT8A 2PEZA 2PMEA 5KTPA 3CGWA 5C37A 1A9YA 1M0EA 1K5PA 4Q7MB 1O8CA 5L3SA 3E05A 1NOIA 1BMQA 1ORVA 4EPXA 1BHSA 4KUGA 3HBJA 4YDHB 5B2ZA 4IJ5A 1OJLA 3IPAA 3ZV3A 3K6SA 3LCMA 2IIPA 2YIMA 4WD3A 2Z3VA 1NNSA 1V8OA 3L8CA 4FEEA 4ZT2A 3C8ZA 1PBNA 3X1MA 2YW2A 1P0CA 2BEWA 5JLAA 3QZUA 1IZ8A 4LW8A 1NJ1A 4MVJM 3AOEC 1OA0A 4CQMA 4ZYZA 1H2BA 1XZKA 2DBRA 1XDGA 2HBQA 3BXXA 4NU6A 1HYBA 1X74A 2C9OA 2RI1A 3ZHQA 1GPNA 1KAOA 1OILA 1CZUA 1YL5A 1W52X 2GN8A 2QRHA 3GVPA 4HF7A 4PF1A 4RGYA 5F2EA 3WRYC 4RD6A 3PX7A 4JN6B 4L0CA 4QNMA 4JIGA 2XMGA 3IXLA 2WK1A 3D0OA 1Z7EA 3WLPA 3NG1A 4H08A 3BZBA 3D7MA 3F6EX 4AQ7A 3NTOA 1CEEA 1KK1A 2VCHA 1Q44A 2YWEA 4ETIA 1FVXA 1W5AA 1BOOA 1PJ4A 1Q0SA 2ISSD 2JFYA 2O07A 2RHGB 4O25A 5HE9A 1O3YA 3L18A 4NENA 4P3OA 4E3ZA 5KNDD 2NO5A 3OEYA 1XHFA 4UAUA 4JI6B 2XVMA 3WNZA 1EEHA 1FFAA 1RFLA 2VH1A 4LE1A 1MOZA 4XUEA 4RACA 3B5EA 4G4SP 3WHLA 5F23A 4Z0TA 4B9EA 2N42A 3MS7A 5DBGA 3C6ZA 2VWPA 4OV6B 4YONB 3ZLVA 5E1MA 1O9GA 1PEKE 4O4HA 5IULC 4W1QA 4OHWA 3OFJA 2AJ8A 3GVXA 3RS5A 1U1DA 4HOYA 5CH5A 3QVTA 1VG1A 3HCEA 5EIHA 1G5IA 1U7DA 3ECAA 1EJ0A 2RH5A 3O95A 3ONFA 4HRAA 5EKUA 2G3YA 3UAOA 1JIVA 4BYGA 3U7EB 1W2HA 4W9NC 4MIKA 3A32A 3L0BA 2XB2A 2JLQA 1W0KD 3S7ZA 1SBZA 2I2XB 1D2NA 1K75A 1Z8HA 1Q16A 1O77A 2ZP1A 4Q9IA 3TVDA 1YC5A 821PA 3QBDA 3AILA 1HKHA 1M2WA 1YHNA 3B6MA 4CF4A 2OV6A 5ITZA 4G36A 1E61A 3DBLB 3W1VA 4RIEA 3IAXA 2DTXA 2PIAA 4YRMA 1SBYA 3PLRA 4XPZA 4KB5A 5E1DA 1D6JA 3AU9A 1KDVA 3FUUA 4F1WA 4PQYA 2HO4A 1GP2A 1ZGJA 1FRFS 3KD2A 3BWVA 3MTAA 3JQFC 3PDIA 1R6TA 2H6EA 2M6RA 3GD7A 4FCVA 3W5DA 2QW1A 4FDTA 3GNQA 5IVKA 2ZUFA 2FEKA 2PANA 2WTEA 3PGVA 2X8WA 3H7AA 1LVUA 3N07A 3RVDA 5JD4A 4MKRA 3U80A 2XEDA 4TV9F 2FP4B 5D3KA 4LYFA 3W4IA 4EB6B 4L5BA 3TD2A 4PYRA 1VYUA 5ENDA 4FFBB 5CEEA 3BE5A 1KQGA 2E4AA 2JB9A 2ZFUA 1K5GA 3HHPA 2CBXA 2JNWA 3KELA 4RVSA 4ZAWA 1CZLA 3GLGB 1IYZA 1QYXA 1AK1A 4X91A 4CKWA 2AMLA 5GJBA 3RKSA 4ND7A 3PQFA 5C9ZA 1J2TA 4J1TA 3NNDA 4KVGA 2E18A 2GASA 3BREA 4OOEA 3RQIA 3SR3A 3WISA 2G5CA 3OPMA 2CYAA 1M2OB 1NXPA 3L7OA 2J30A 5JSUA 1VYVA 2WM2A 4MW4A 3OHPA 1L7MA 4QQFA 3TM4A 3HKDA 2BFMA 4IICA 1LBHA 3PPVA 1ESMA 1MX3A 5LLDA 5KQGA 2Y1DA 1OVGA 3MOGA 4OB7A 5KYWA 1A2BA 3OEHA 1K7EB 4EMBA 3RVPA 3KQNA 2V9ZA 4GGPA 5IVIA 1R0XA 4E3WA 3CSUA 5HRCA 4HFNA 3R7BA 4L15A 2M1XA 4XD7A 4FDUA 4LPKA 1U4NA 1SNYA 5EE3A 1E2EA 2HJVA 3DMRA 5BVGB 1XKXA 1F6WA 2OFFA 3A6PC 1MIOA 4EYKA 5B5SA 1P17A 2X5OA 5HIMA 2BKUA 4O29A 1Q21A 1XQ9A 4DEVA 1GD1O 2V3WA 5HJ7A 1JMVA 1P9NA 1A9SA 1S01A 2D2XA 3B5JA 1RPTA 4BEJA 5IDQA 1Z28A 2QTFA 2J59A 1BKYA 3EOAI 2ZT5A 3T38A 3GJ0A 4A91A 5DYWA 4KXYA 5JEEA 1SHLA 4FZRA 3NR2A 2IZ7A 4LV8B 1ND5A 3ANLA 3JQAA 1ZSYA 1F2UA 3EDCA 3PUWA 2CL6X 2I5PO 3PD1A 2P9TA 3M5PA 4XM2A 4N47A 5A2QA 1U8YA 2V7TA 2WJWA 2XDWA 1GPYA 3U31A 4EUNA 1YR7A 2PS1A 1QJ4A 2KLBA 4D74A 1YOBA 4WNCA 2CVPA 5DEOA 2A0XA 3K8QA 4EYQA 1QOZA 3AR3A 4UNSA 1R1DA 2AX4A 4G5RA 2MCFA 2PH3A 1N2SA 4DBLE 4EG5A 4PN3A 5TB5A 2OHOA 3KAJA