2B95A

Solution nmr structure of protein dynein light chain 2a, cytoplasmic; northeast structural genomics consortium target hr2106
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 2A
publication title Solution NMR structure of protein dynein light chain 2A, cytoplasmic; Northeast structural genomics consortium TARGET HR2106
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2b95A00
3CPTA 1SZVA 4FUWA 5EVEA 5FEFA 1A0KA 2E8JA 1VETA 1Z09A 3DAVA 3LGOA 4X1MA 3T1XA 3D9YA 3UB5P 3CHWP 1FILA 4D60A 1K0KA 3T1QB 3T1SA 4FTXA 3T1RA 2BTFP 2V8CA 2VK3A 4ESPA 3CPTB 1AWIA 2ZL1B 3U4LP 1YPRA 4X25A 1VETB 2JKFA 3L7HA 2JKGA 3MSHA 2B95A 5FEGA 3L9KA 3KYEA 1SKOA 3MS6A 1VEUB 1CJFA 4QWOA 1CF0A 5EM1A 1Y4OA 1HLUP 1ACFA 2PRFA 3NECA 3T12B 5EV0A 1FIKA 1G5UA 3LEQA 3NULA 2PAVP 1SKOB 2ACGA 1D1JA 2ZL1A 2V8FA 1PNEA 1PFLA 1F2KA 5FDSA 1VEUA 5EM0A 4X1LA 1J3WA 1PRQA 1CQAA 2HZ5A 2PBDP
chains in the Genus database with same CATH superfamily
4K08A 3BRMA 4EUVA 1YSPA 1WE4A 2E8JA 4EUZA 2IWCA 5FSRA 3IBJA 3UY6A 1SDEA 1NJ4A 3RJUA 1K54C 1OJ5A 3S4XA 2BTFP 3N8RA 5GHZA 2XD1A 2DRWA 4JKTA 2R9XA 2HJEA 3BLMA 2V9AA 1W79A 3IX4A 4PM5A 1DRMA 3BFDA 1K55A 2O9AA 4HJ3A 3R7WB 3EOIA 4DMZA 3KO6A 3WS5A 2JKRI 3A3FA 4G3WA 3HLFA 3G31A 2KDKA 1XJ4A 1JWZA 5J8XA 3EQVA 5L07A 3BWLA 2M1CA 4IUHA 2Y2IA 4MBHA 3VFHA 5EV0A 2JCHA 4IJGA 1M40A 2XFSA 1H0MA 4OOLA 3PBTA 1DP8A 4Q8IA 1NLZA 5FI6A 4R4SA 1XX2A 5AJGA 4UA9A 4R70A 4OQHA 4PMAA 1FCNA 4LCLA 5FQ9A 1N4OA 4S2NA 1LI9A 2A24B 3UDFA 4LGWA 1KVLA 2P9VA 3BECA 2XK1A 1CI9A 2OAP1 3SS5A 2WK0A 4DN0A 4FUWA 3PBOA 3UMEA 1PWCA 1YLYA 3LR5A 5E43A 1H5XA 2ZJ9A 3BFCA 3LICA 3ZFZA 5CRFA 3F1NB 4LV2A 1TS0A 3IXHA 2J7VA 1YLWA 4R4RA 4KQQA 4Q0IA 4UAAA 3G34A 4S2JA 3NOTC 3T1SA 2ZC6B 1KE3A 3GDIA 3QP8A 3UE3A 3CPTB 4O01A 3VE4A 5F82A 1ZTUA 3GSGA 2JKFA 2Q9MA 3SS4A 1PZOA 3SS3A 1OTBA 4GHIA 1SKOA 2J3TC 2QKPA 3UPPA 2W1TA 1I5QA 1ES2A 2XRNA 5CEDA 2B18A 3ZNTA 3O3VA 2OAQ1 3Q81A 4FCFA 4EETB 2Y55A 3M2KA 1G5UA 3JVUA 3Q7VA 2MJ6A 2P08A 4HJ6A 4DE3A 1C3BA 1S4SA 4X6TA 5EOEA 4MN6A 4WL9A 2OLUA 4HOIA 4WELA 2G2WA 4LENA 1EROA 2VGLS 3Q07A 3QNBA 4GZBA 4PKYA 2AVXA 4WZ5A 1AXBA 4WMCD 1KGFA 4GN2A 2V2FF 3K2NA 3KSGA 1RGYA 1W8YA 2EXBA 4P85A 1JVJA 2G2UA 4N1XA 2W0NA 3JYIA 2VGKA 4IHQA 3UB7A 1YLJA 4Z1WA 3UNWA 5AVFA 2ZM8A 2ZC4B 4R0QA 4Y0TA 3C5AA 4ARZB 5DJUA 3ZQ5A 3ZDJA 4FTXA 3ISGA 3PYPA 5M19A 4Q0JA 3KSHA 3ZHHA 1FCMA 1EW0A 4E3MA 4Y7PA 4R38A 3MSHA 2WKPA 3PAEA 3MKEA 4M4XA 3Q82A 2V1AA 4OQIA 3B42A 1JWPA 4BBVA 1T1AA 2ZQ9A 1K6SA 1YM1A 3JVVA 1RP5A 1OTDA 3TG9A 1BULA 1D06A 3VP3A 4I3AA 2J80A 5EECA 1W7FA 1OT9A 1P9RA 5F69A 4RX2A 3A0SA 3QP4A 3NI9A 4X56A 5F6AA 1K6RA 5DKKA 1PZPA 4R23A 4B9OA 2PU2A 5EPHA 4GCZA 4GD8A 1N9LA 5TJJA 5HWTA 2I9VA 1QMFA 3NDEA 5TBMB 1RCJA 4RQ9A 2HP9A 5FI2A 2G7UA 4OLDA 5F83A 3WRTA 1XFNA 4R3JA 5EVEA 5BOHA 2EX6A 1IFQA 3UDXA 3DAVA 2Y2NA 4G3KA 3QP1A 4CLCD 2EWWA 2L0WA 2WUQA 1GHPA 2J3TD 1YQSA 2GZAA 2KLIA 3HLBA 1OT6A 4K0WA 4OQ0A 5HW3A 4HP4A 4JXWA 4CLCA 1ERMA 2ZLYA 1W8QA 5F1GA 3PBRA 4X55A 4KZ3A 1O7EA 3WS4A 1YLTA 1XJ6A 5EE8A 4WYYA 3A0RA 4GDNA 3LUQA 1E25A 1GHMA 2Y4AA 1TVFA 5CX7A 4LV0A 4XXRA 4WM9A 1IYSA 5DTTA 3M6BA 1GSXA 4B4ZA 3HREA 4UEYA 2VV8A 4H6JA 1I2WA 4QB8A 1N9NA 1ACFA 3MFXA 2EXAA 3NBLA 3CZDA 2WGWA 4XUZA 1YLPA 3BY8A 3BW6A 1CI8A 4KG6A 4S2OA 1H8MA 1P0ZA 4KZ5A 1HD8A 3T4QA 2PAVP 3GQZA 1JWVA 1MBLA 3HJIA 3FYZA 4AFIA 3V67A 4GKUA 3FZCA 4CJNA 3DWKA 4I3IA 1ESUA 5AQ7A 2GJ3A 2QZ6A 1F2KA 2W3HA 2EX9A 4HQAA 1XGJA 3PHYA 4ZBEA 2PHYA 2H10A 4HH3A 3ZG7B 4M3KA 3ULFA 1GA9A 3Q1FA 1J9MA 1L0FA 1K55C 1V9YA 3IH8A 5K5BA 3T1XA 1W5DA 3CLOA 2HDUA 1KGGA 3ZGAB 3A3JA 2RL3A 1UWPX 2WKIA 1NZOA 4PPRA 3KYZA 1ZC2A 2K31A 4KG2A 4QY5A 5HD3A 4N9LA 1ODVA 1XA1A 5FA7A 3PBNA 3BYDA 1K57A 1VQQA 2B95A 5L2FA 3KYEA 3W8KA 4F3LB 1NYYA 4HBTA 1LSXA 1IKIA 1NRJA 2BG1A 1FCOA 4OPYA 4DF6A 3IQAA 4P6BA 4OONA 2ZD8A 3UB8A 3W4OA 1MWRA 3WS2A 2PRFA 2WADA 4HBUA 3VMAA 1SCWA 4JXVA 2XROA 3KX0X 2Y2QA 1XFQA 5GLAA 1L3LA 2EX8A 3FWLA 1FR6A 5F68A 2D02A 3PAGA 2HGVA 1H8YA 4QD4A 2FH5A 1DY6A 5MC7A 1G6AA 3W2ZA 4Z9QA 4E04A 1VEUA 2B5RA 1JNUA 3EGXC 3VSLA 1OTAA 2E8IA 3T4JA 1NWZA 3DWZA 3VP2A 4RVAA 4OOMA 1ZG6A 1SZVA 4LRXC 3LR4A 3TW8A 3O5YA 5KSHA 1D7EA 3MQQA 4GS9B 3CHWP 4PHTA 3S7QA 5L10A 3OZHA 4JF5A 4IBRA 1GSVA 1K0KA 2Y59A 3D4FA 5DVAA 3NJAA 3SW1A 4E3OA 4WEJA 1IEMA 1GA0A 2VA0A 4L9GA 1L2SA 3BJNA 2Y2HA 3BLSA 2OWJA 3IF5A 4LLOB 2PBYA 4DXBA 1Z6FA 3PTEA 1CJFA 4XUXA 4I3JA 2ZQ8A 2VV7A 1K56D 3BQ8A 3EQUA 4BLMA 3QNCA 4R1GA 1MWUA 3HUNA 3T12B 3IHAA 2PT7A 2JHEA 1K56A 2O9CA 1S0WA 1NY0A 5E2HA 4MDZA 3LCEA 3MZFA 1BT5A 2Q0OA 4HHDA 4ZTKA 4BQMA 1BTLA 2A49A 3E4PA 1PW8A 4MBKA 1V9ZA 1JTGA 1NRFA 3P7NA 4BD1A 4IEDA 4JGOA 2YKFA 4OPRA 3AGFA 3HUMA 2CMNA 3LI9A 3QHYA 2WGVA 2HZ5A 2EX2A 1IYOA 2HPBA 3DTEA 3IXDA 4CQHA 1T1BA 4O0PA 3PBSA 4X1MA 1BLPA 3FPVA 1SKFA 1FILA 2ZOIA 4D2OA 4KZ8A 4YINA 1ONHA 5LBRA 1TEMA 1FSYA 5E2EA 2RCXA 2V8CA 4N9KA 2BLSA 2OWHA 3V39A 4K0XA 5CECA 3MQ0A 3W4PA 4KG5A 2O99A 5HAQA 5CTMA 2VX8A 3BM6A 1YAXA 5EM1A 4Y15A 2J8YA 4R3BA 2LB5A 5EVIC 4UA7A 5KZHA 4E3KA 1G68A 2C5WB 2Y2JA 2XF3A 3VSKA 4GHIB 4PM8A 4JGPA 4F94A 2Z6DA 4U3TA 1SKOB 4YOFA 5J3WA 1MWTA 3F1PB 1N9OA 4YNRA 2W1TB 1LSVA 2KOIA 3MXQA 3MFDA 3IF6C 4IVIA 3MBZA 2C6WB 4Y17A 1O07A 3CWFA 3OC2A 4LFUA 1LSWA 4X1LA 4ZAMA 3MMHA 4KUOA 3H7WB 1KE0A 1K4EA 1JTDA 1YKDA 4P0MA 4N92A 2PD8A 1MKMA 3N8LA 4Y5FA 4KZ9A 2Z2MB 4OQGA 2HV1A 4MCWA 4D60A 4II7A 4HEFA 3UPNA 3WWXA 1T19A 3MXSA 2D01A 1K54A 5A93A 4NETA 1MWSA 3DBAA 3T4LA 4WMCA 3BQAA 4S2MA 3C7VA 1GSWA 3B3XA 2ZQAA 3V3RA 2OV5A 3NCKA 4GNUA 4QWOA 1YT4A 5G4YA 1TS7A 2QPNA 5CXWA 4PM7A 4H8RA 2I72A 3QP2A 4XT2A 1E3UD 4MLLA 1XKZA 5CHMA 2V0UA 2Y2GA 2ZM2A 3OPRA 4ARZA 2Q9NA 5KMWA 2HDQA 4I5SA 1ES5A 2Y79A 1FR1A 3AGEA 3HUOA 1KDWA 4Y13A 3UMDA 5KIZA 3DW0A 3SZTA 2K7SA 3HVFA 5CTNA 4KQDA 3E4OA 3V5MA 3A0VA 2UWXA 2W3EA 2WZZA 1F9IA 1ZKJA 3E2KA 3ZNYA 2VKSA 4UQIM 2PDRA 3K3CA 4Y3IA 5A92A 5DF7A 5AQAA 2ZC3B 3F1OB 1BLSA 5E2FA 5E2GA 3SH8A 1KE4A 2ZOHA 3VOZA 2WZXA 5FATA 1ERQA 2WYXA 1BZAA 2A3UA 4RYEA 5I94A 5FEFA 3N6IA 1K57C 3LGOA 4BD0A 5KSCA 3VFFA 3E0YA 5EVIB 5CGWA 4ZJ2A 1L0EA 1SHVA 3SH7A 3FV7A 5FQJA 1S4RA 2Z6CA 2EFUA 1OTIA 1IYQA 2PR6A 1OTEA 1WYBA 3CUEA 4HJ4A 3VOLA 5HAPA 5GLDA 5TBMA 2V1ZA 5JYPA 1RGZA 1F5MA 3IF6B 4GOGA 3ZVWA 4ETXA 4GD6A 1W63Q 4S2PA 1XA7A 3T50A 4LV1A 3UN7A 3VP1A 4R3AA 3Q7ZA 3HCYA 5CERA 4O8GA 3IS2A 2H0YA 5G18A 2P7JA 4MN7A 3P09A 4DDSA 2PYPA 4JPMA 2ACGA 3RXWA 1DP6A 4DE2A 1K25A 4EQIA 3GTCA 4H6JB 3ZG9B 1PNEA 1BYWA 1PFLA 4HP9A 1ESIA 5HAIA 1WA9A 2WGWB 5DFXA 3S7NA 1CQAA 3LR3A 2ZMAA 1LL8A 5CGSA 4G3VA 3IWOA 3FPWA 3BFGA 1T18A 3NC8A 4DDYA 5DFYA 2HP5A 2PU4A 1Z09A 4E3NA 3C2WA 1XP4A 2QJ5A 5FI7A 2Z2LB 3SOIA 2O0YA 1KGEA 2Y2PA 3IT9A 1P97A 3FG8A 3CAXA 1X0OA 2VK3A 4ESPA 3O86A 4MNRA 1BUEA 1PWDA 1UWNX 2VLGA 1DJBA 2ZL1B 5M18A 3IXBA 4BMWA 3C7UA 4OPZA 2JKGA 2UV0E 3KSIA 4GW9A 1NYMA 3LI8A 1TS8A 1ZHHB 2J9OA 2JKRM 1HZOA 3D72A 3S7PA 3UE0A 1GHIA 5DF8A 3OPHA 1HLUP 1NXYA 3HJKA 4LRZE 4FSFA 2XR0A 1IOUA 4C6YA 5FQMA 3RH8B 3C4OA 1FIKA 2DCFA 4JBFA 3LO7A 2Y2LA 3NOPC 3M2JA 3S1YA 4X53A 3HBRA 3SH9A 5L8MA 3ITBA 3RFBA 1TS6A 4S2NC 4X69A 5U47A 3G35A 3QP5A 3LFVA 2HJ9C 2A2LA 1DJCA 5FQKA 4BL3A 5HL6A 1J3WA 1OPXA 3IH9A 4NXEA 3G4PA 4EXOA 1L0DA 3TRCA 2W3FA 4DE1A 3ICYA 3I7JA 3N7WA 4ETZA 4WN5A 4BL2A 1Y54A 1VETA 3K3DA 3MKFA 2ZMFA 4UQIS 5IT5A 3HLDA 1CK3A 5JYOA 3D9YA 2WKQA 5CEBA 4JF6A 3OOVA 4OPQA 4RA7A 2EWVA 2XSSA 4KZBA 3OPLA 2JKTI 4KUKA 4E6XA 1I2SA 4GLQA 4JGRA 3H82A 2WAFA 4UA6A 5GLCA 3WS0A 4A5RA 5J7EA 4YFMA 2QYBA 1UGUA 3CG5A 4NKPA 1E4DA 3GRJA 4B88A 2XA7M 5TGFA 5HL1A 5DKLA 2X02A 2FZ0A 4WUJA 4GS9A 1U60A 3NECA 1TF1A 4L9FA 4ZJ1A 3W4QA 5FL3A 2WGIA 1FSWA 4X68A 1ONGA 3NHQA 3P01A 3DTMA 3LEQA 3A3IA 5HFOA 4DJ3A 1MY8A 2WKRA 3TJZC 2V8FA 3LY4A 3EWKA 3V3SA 4CPKA 2LB9A 4JXGA 4WZ5C 2JE5A 4Q0HA 4S2LA 1KDSA 1XGIA 4EESA 2GX5A 3FKWA 3IBRA 3T4TA 2VGJA 5AQBA 4MN5A 3LYXA 2ZQCA 2P74A 1NLYA 2R9WA 3IXGA 2GDNA 3BFEA 2ZQDA 3G30A 3G2ZA 5DF9A 4KENB 3ZG8B 3C30A 4OKPA 3GR2A 2XFTA 3MZEA 3MXRA 4OP5A 3R7WA 2ZMVA 2NUTC 3UDIA 3S22A 3ITAA 3UE6A 4NK3A 3LEZA 1IELA 2ZQ7A 5CGXA 2GNXA 3BY9A 4IUKA 3NY4A 4ZDXA 2PR5A 4L0LA 4OP8A 1PYYA 4LV3A 4RX3A 2J3WA 3GECA 4EBNA 3LIBA 3MR0A 2L1MA 4X25A 3FKVA 1S66L 4N1HA 4BBTA 3L9KA 1YMSA 4GJ4A 4C75A 1LHYA 1CF0A 2B02A 2P9VB 1FOFA 5HDCA 3BEBA 1VM1A 5EUAA 2M7UA 4EQ1A 5DTKA 2Y2KA 3E2LA 4OVDA 3NIAA 4JGQA 3DTKA 4WEKA 2A24A 3TOIA 3G32A 1K4FA 2W27A 3A3EA 4WLAA 1EWZA 3QP6A 2Y91A 3T4KA 3PXPA 1ES4A 1G6OA 3F1NA 5FASA 3OCNA 1HVBA 4FOFA 3NOUC 4L9EA 5GHXA 4PM6A 2XGNA 1PRQA 3U2AA 1KOUA 3CUEC 2NUPC 3E98A 5HSQA 3NDGA 3CPTA 4Y2FA 1G28A 5HDSA 4WBGA 2WKEA 3T4SA 2H0TA 4E6WA 4QY6A 3UB6A 1S1ZA 2Y2MA 4GDBA 4IVKA 3UB5P 3MZDA 4CLCC 2L4RA 5AVEA 1N9BA 4NXFA 2V0WA 3F1PA 2DMWA 3T1QB 2JBFA 4LCMA 1LLBA 3Q7VB 2XQZA 1MKIA 3U4LP 2VV6A 3HLCA 4B4XA 1YMXA 4OH0A 3C38A 3H7WA 3RXXA 5IS1A 4E3LA 4P87A 1PWGA 2PYRA 2VJWA 4UHUA 3GMWA 5TR7A 3E4QA 5HPFA 5CHUA 5J4EA 1PI4A 4DKIA 2OLVA 5IU1A 4S2KA 3VE3A 4BENA 3OCLA 4C3QA 2XA7S 3G6OA 3WS1A 2OOLA 2WAEA 3ZYTA 4BJPA 2KX6A 4JXSA 5CHJA 4YWZA 4I39A 3ZCZA 2XH9A 4XT2B 2EFXA 1H3QA 3N4IA 5HARA 1CEFA 1E3UA 1XPBA 2M7VA 5D3OA 1MXOA 3LR0A 1S1YA 4HH2A 1XJ2A 2W3DA 3VOYA 5F1FA 4K91A 4KZ4A 4P6ZM 1YLZA 5HDDA 1LT0A 4CLCE 5L09A 1KVMA 5F5YA 2WKHA 2INWA 2ZC7A 1T1CA 4I38A 4OOYA 4QPRA 3M6HA 5HZHA 3LIEA 1K38A 4S2IA 5FQQA 4MMNA 5EFWA 4NEED 3CJMA 3F1OA 3L7HA 3OBFA 2VZWA 5FAOA 3FC7A 4IBXA 4EWFA 4FD8A 2QWSA 5EVID 3UE1A 5FAPA 5EOOA 4DE0A 1WYCA 4NXGA 3B47A 4BWIA 1TDLA 5EVIA 1YSQA 5HX9A 4KZ7A 5FAQA 1L0GA 2HDSA 2EA9A 3C4PA 4E3IA 1TDGA 3ZG0A 4KZ6A 1S6RA 4EBLA 3P98A 4HIAA 5FDHA 3HLWA 4ID4A 1DJAA 3B33A 1ALQA 1MPLA 4CLCB 3MJQA 5FQIA 1OMEA 2QMIA 1MC0A 1VHMA 4LPZA 1PW1A 3H9WA 4PM9A 3IF6A 4WF0A 5FDSA 4DRTA 3ZVTA 2OSUA 5G4ZA 2JKTM 2K2NA 2CC1A 2W3GA 3IS2B 4EU0A 2IWDA 3LIAA 1OJGA 2XLNA 3LIDA 1CEGA 2W1RA 1M6KA 3IWIA 3IHBA 1A0KA 1XJ3A 4QU3A 4LRYC 5DTSA 3UO9A 3VP0A 2FFFB 5A91A 2IWBA 3O88A 2H28A 4FH2A 2O9BA 4WZ4A 5A90A 2DNSA 3EEAA 4EEUA 2QJ7A 5HWWA 1NZUA 4EEPA 1AWIA 1SDNA 4U0XA 2PD7A 1S67L 4FH4A 2J9PA 4E3JA 5FEGA 4Y0UA 3HLGA 4PAUA 3DTIA 3EGDC 4GB7A 3IX3A 4B93A 4Y0OA 2HP6A 1FQGA 3OPPA 4JF4A 3GV9A 3IX8A 1F98A 2Y2OA 1Y28A 4HESA 3C8CA 4KQOA 2QHKA 4O7DA 2ZC5B 3VV4A 3GVBA 1LL5A 3R4KA 5A8BA 3KSFA 3IWQA 2H5SA 3ZG5A 1MZUA 2JC7A 4PKYG 1D1JA 3HLEA 3TE8A 2ZL1A 2Y8HA 5HPIA 3WRZA 5HWVA 4KZAA 3G2YA 2JN7A 3EEHA 1BSGA 2R78A 3CMZA 2YKHA 3OLOA 3CI6A 1P9WA 5C5KA 4HY8A 2XDMA 2PBDP 4ME4A 5EVLA 5GHYA 1BLHA 3JPUA 2ZM0A 3LY3A 2X71A 3KYQA 3VP4A 4F3LA 3V50A 1STZA 3HL9A 4EV4A 3AGDA 2P04A 1LI0A 3PBQA 4QJGA 4EW7A 2XEPA 3T1RA 1ES3A 3UB9A 1HTZA 4P6ZS 4ZRRA 4QHCA 1PIOA 5HD5A 1PI5A 4NG2A 3MF0A 1YPRA 4OLGA 1VETB 5GL9A 5TFQA 4R6LA 3S7OA 2BASA 2HF6A 3MS6A 1VEUB 1W63M 4EBPA 2X01A 1EI5A 4DJ2A 4EERA 1Y4OA 1GCEA 3N8SA 4NXBA 3RTYA 4JLFA 5AQ9A 1XXMA 1VB6A 4U0TA 1Q2PA 1Q2QA 2IA2A 3H82B 2V1BA 2V20A 1BLCA 4MEZA 3TSGA 4HI4A 2VGLM 3NULA 4KQRA 1IKGA 3D3OA 3UPOA 3PR6A 2XD5A 3T4OA 1H8ZA 3LIFA 3CITA 1DP9A 4HNBA 3A3DA 4BBUA 1IYPA 1QMEA 2HDRA 1TD5A 4DXCA 5DJTA 2FFYA 1LL9A 3MQOA 5GLBA 5I5LA 5EM0A 4MBFA 1ZG4A 2ZBBA 3BFFA 5IHVA 3O87A 5M1AA 4ZJ3A 2VEAA
chains in the Genus database with same CATH topology
3CPTA 1SZVA 4FUWA 5EVEA 5FEFA 1A0KA 2E8JA 1VETA 1Z09A 3DAVA 3LGOA 4X1MA 3T1XA 3D9YA 3UB5P 3CHWP 1FILA 4D60A 1K0KA 3T1QB 3T1SA 4FTXA 3T1RA 2BTFP 2V8CA 2VK3A 4ESPA 3CPTB 1AWIA 2ZL1B 3U4LP 1YPRA 4X25A 1VETB 2JKFA 3L7HA 2JKGA 3MSHA 2B95A 5FEGA 3L9KA 3KYEA 1SKOA 3MS6A 1VEUB 1CJFA 4QWOA 1CF0A 5EM1A 1Y4OA 1HLUP 1ACFA 2PRFA 3NECA 3T12B 5EV0A 1FIKA 1G5UA 3LEQA 3NULA 2PAVP 1SKOB 2ACGA 1D1JA 2ZL1A 2V8FA 1PNEA 1PFLA 1F2KA 5FDSA 1VEUA 5EM0A 4X1LA 1J3WA 1PRQA 1CQAA 2HZ5A 2PBDP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPT A;  1SZV A;  4FUW A;  5EVE A;  5FEF A;  1A0K A;  2E8J A;  1VET A;  1Z09 A;  3DAV A;  3LGO A;  4X1M A;  3T1X A;  3D9Y A;  3UB5 P;  3CHW P;  1FIL A;  4D60 A;  1K0K A;  3T1Q B;  3T1S A;  4FTX A;  3T1R A;  2BTF P;  2V8C A;  2VK3 A;  4ESP A;  3CPT B;  1AWI A;  2ZL1 B;  3U4L P;  1YPR A;  4X25 A;  1VET B;  2JKF A;  3L7H A;  2JKG A;  3MSH A;  2B95 A;  5FEG A;  3L9K A;  3KYE A;  1SKO A;  3MS6 A;  1VEU B;  1CJF A;  4QWO A;  1CF0 A;  5EM1 A;  1Y4O A;  1HLU P;  1ACF A;  2PRF A;  3NEC A;  3T12 B;  5EV0 A;  1FIK A;  1G5U A;  3LEQ A;  3NUL A;  2PAV P;  1SKO B;  2ACG A;  1D1J A;  2ZL1 A;  2V8F A;  1PNE A;  1PFL A;  1F2K A;  5FDS A;  1VEU A;  5EM0 A;  4X1L A;  1J3W A;  1PRQ A;  1CQA A;  2HZ5 A;  2PBD P; 
#chains in the Genus database with same CATH topology
 4K08 A;  3BRM A;  4EUV A;  1YSP A;  1WE4 A;  2E8J A;  4EUZ A;  2IWC A;  5FSR A;  3IBJ A;  3UY6 A;  1SDE A;  1NJ4 A;  3RJU A;  1K54 C;  1OJ5 A;  3S4X A;  2BTF P;  3N8R A;  5GHZ A;  2XD1 A;  2DRW A;  4JKT A;  2R9X A;  2HJE A;  3BLM A;  2V9A A;  1W79 A;  3IX4 A;  4PM5 A;  1DRM A;  3BFD A;  1K55 A;  2O9A A;  4HJ3 A;  3R7W B;  3EOI A;  4DMZ A;  3KO6 A;  3WS5 A;  2JKR I;  3A3F A;  4G3W A;  3HLF A;  3G31 A;  2KDK A;  1XJ4 A;  1JWZ A;  5J8X A;  3EQV A;  5L07 A;  3BWL A;  2M1C A;  4IUH A;  2Y2I A;  4MBH A;  3VFH A;  5EV0 A;  2JCH A;  4IJG A;  1M40 A;  2XFS A;  1H0M A;  4OOL A;  3PBT A;  1DP8 A;  4Q8I A;  1NLZ A;  5FI6 A;  4R4S A;  1XX2 A;  5AJG A;  4UA9 A;  4R70 A;  4OQH A;  4PMA A;  1FCN A;  4LCL A;  5FQ9 A;  1N4O A;  4S2N A;  1LI9 A;  2A24 B;  3UDF A;  4LGW A;  1KVL A;  2P9V A;  3BEC A;  2XK1 A;  1CI9 A;  2OAP 1;  3SS5 A;  2WK0 A;  4DN0 A;  4FUW A;  3PBO A;  3UME A;  1PWC A;  1YLY A;  3LR5 A;  5E43 A;  1H5X A;  2ZJ9 A;  3BFC A;  3LIC A;  3ZFZ A;  5CRF A;  3F1N B;  4LV2 A;  1TS0 A;  3IXH A;  2J7V A;  1YLW A;  4R4R A;  4KQQ A;  4Q0I A;  4UAA A;  3G34 A;  4S2J A;  3NOT C;  3T1S A;  2ZC6 B;  1KE3 A;  3GDI A;  3QP8 A;  3UE3 A;  3CPT B;  4O01 A;  3VE4 A;  5F82 A;  1ZTU A;  3GSG A;  2JKF A;  2Q9M A;  3SS4 A;  1PZO A;  3SS3 A;  1OTB A;  4GHI A;  1SKO A;  2J3T C;  2QKP A;  3UPP A;  2W1T A;  1I5Q A;  1ES2 A;  2XRN A;  5CED A;  2B18 A;  3ZNT A;  3O3V A;  2OAQ 1;  3Q81 A;  4FCF A;  4EET B;  2Y55 A;  3M2K A;  1G5U A;  3JVU A;  3Q7V A;  2MJ6 A;  2P08 A;  4HJ6 A;  4DE3 A;  1C3B A;  1S4S A;  4X6T A;  5EOE A;  4MN6 A;  4WL9 A;  2OLU A;  4HOI A;  4WEL A;  2G2W A;  4LEN A;  1ERO A;  2VGL S;  3Q07 A;  3QNB A;  4GZB A;  4PKY A;  2AVX A;  4WZ5 A;  1AXB A;  4WMC D;  1KGF A;  4GN2 A;  2V2F F;  3K2N A;  3KSG A;  1RGY A;  1W8Y A;  2EXB A;  4P85 A;  1JVJ A;  2G2U A;  4N1X A;  2W0N A;  3JYI A;  2VGK A;  4IHQ A;  3UB7 A;  1YLJ A;  4Z1W A;  3UNW A;  5AVF A;  2ZM8 A;  2ZC4 B;  4R0Q A;  4Y0T A;  3C5A A;  4ARZ B;  5DJU A;  3ZQ5 A;  3ZDJ A;  4FTX A;  3ISG A;  3PYP A;  5M19 A;  4Q0J A;  3KSH A;  3ZHH A;  1FCM A;  1EW0 A;  4E3M A;  4Y7P A;  4R38 A;  3MSH A;  2WKP A;  3PAE A;  3MKE A;  4M4X A;  3Q82 A;  2V1A A;  4OQI A;  3B42 A;  1JWP A;  4BBV A;  1T1A A;  2ZQ9 A;  1K6S A;  1YM1 A;  3JVV A;  1RP5 A;  1OTD A;  3TG9 A;  1BUL A;  1D06 A;  3VP3 A;  4I3A A;  2J80 A;  5EEC A;  1W7F A;  1OT9 A;  1P9R A;  5F69 A;  4RX2 A;  3A0S A;  3QP4 A;  3NI9 A;  4X56 A;  5F6A A;  1K6R A;  5DKK A;  1PZP A;  4R23 A;  4B9O A;  2PU2 A;  5EPH A;  4GCZ A;  4GD8 A;  1N9L A;  5TJJ A;  5HWT A;  2I9V A;  1QMF A;  3NDE A;  5TBM B;  1RCJ A;  4RQ9 A;  2HP9 A;  5FI2 A;  2G7U A;  4OLD A;  5F83 A;  3WRT A;  1XFN A;  4R3J A;  5EVE A;  5BOH A;  2EX6 A;  1IFQ A;  3UDX A;  3DAV A;  2Y2N A;  4G3K A;  3QP1 A;  4CLC D;  2EWW A;  2L0W A;  2WUQ A;  1GHP A;  2J3T D;  1YQS A;  2GZA A;  2KLI A;  3HLB A;  1OT6 A;  4K0W A;  4OQ0 A;  5HW3 A;  4HP4 A;  4JXW A;  4CLC A;  1ERM A;  2ZLY A;  1W8Q A;  5F1G A;  3PBR A;  4X55 A;  4KZ3 A;  1O7E A;  3WS4 A;  1YLT A;  1XJ6 A;  5EE8 A;  4WYY A;  3A0R A;  4GDN A;  3LUQ A;  1E25 A;  1GHM A;  2Y4A A;  1TVF A;  5CX7 A;  4LV0 A;  4XXR A;  4WM9 A;  1IYS A;  5DTT A;  3M6B A;  1GSX A;  4B4Z A;  3HRE A;  4UEY A;  2VV8 A;  4H6J A;  1I2W A;  4QB8 A;  1N9N A;  1ACF A;  3MFX A;  2EXA A;  3NBL A;  3CZD A;  2WGW A;  4XUZ A;  1YLP A;  3BY8 A;  3BW6 A;  1CI8 A;  4KG6 A;  4S2O A;  1H8M A;  1P0Z A;  4KZ5 A;  1HD8 A;  3T4Q A;  2PAV P;  3GQZ A;  1JWV A;  1MBL A;  3HJI A;  3FYZ A;  4AFI A;  3V67 A;  4GKU A;  3FZC A;  4CJN A;  3DWK A;  4I3I A;  1ESU A;  5AQ7 A;  2GJ3 A;  2QZ6 A;  1F2K A;  2W3H A;  2EX9 A;  4HQA A;  1XGJ A;  3PHY A;  4ZBE A;  2PHY A;  2H10 A;  4HH3 A;  3ZG7 B;  4M3K A;  3ULF A;  1GA9 A;  3Q1F A;  1J9M A;  1L0F A;  1K55 C;  1V9Y A;  3IH8 A;  5K5B A;  3T1X A;  1W5D A;  3CLO A;  2HDU A;  1KGG A;  3ZGA B;  3A3J A;  2RL3 A;  1UWP X;  2WKI A;  1NZO A;  4PPR A;  3KYZ A;  1ZC2 A;  2K31 A;  4KG2 A;  4QY5 A;  5HD3 A;  4N9L A;  1ODV A;  1XA1 A;  5FA7 A;  3PBN A;  3BYD A;  1K57 A;  1VQQ A;  2B95 A;  5L2F A;  3KYE A;  3W8K A;  4F3L B;  1NYY A;  4HBT A;  1LSX A;  1IKI A;  1NRJ A;  2BG1 A;  1FCO A;  4OPY A;  4DF6 A;  3IQA A;  4P6B A;  4OON A;  2ZD8 A;  3UB8 A;  3W4O A;  1MWR A;  3WS2 A;  2PRF A;  2WAD A;  4HBU A;  3VMA A;  1SCW A;  4JXV A;  2XRO A;  3KX0 X;  2Y2Q A;  1XFQ A;  5GLA A;  1L3L A;  2EX8 A;  3FWL A;  1FR6 A;  5F68 A;  2D02 A;  3PAG A;  2HGV A;  1H8Y A;  4QD4 A;  2FH5 A;  1DY6 A;  5MC7 A;  1G6A A;  3W2Z A;  4Z9Q A;  4E04 A;  1VEU A;  2B5R A;  1JNU A;  3EGX C;  3VSL A;  1OTA A;  2E8I A;  3T4J A;  1NWZ A;  3DWZ A;  3VP2 A;  4RVA A;  4OOM A;  1ZG6 A;  1SZV A;  4LRX C;  3LR4 A;  3TW8 A;  3O5Y A;  5KSH A;  1D7E A;  3MQQ A;  4GS9 B;  3CHW P;  4PHT A;  3S7Q A;  5L10 A;  3OZH A;  4JF5 A;  4IBR A;  1GSV A;  1K0K A;  2Y59 A;  3D4F A;  5DVA A;  3NJA A;  3SW1 A;  4E3O A;  4WEJ A;  1IEM A;  1GA0 A;  2VA0 A;  4L9G A;  1L2S A;  3BJN A;  2Y2H A;  3BLS A;  2OWJ A;  3IF5 A;  4LLO B;  2PBY A;  4DXB A;  1Z6F A;  3PTE A;  1CJF A;  4XUX A;  4I3J A;  2ZQ8 A;  2VV7 A;  1K56 D;  3BQ8 A;  3EQU A;  4BLM A;  3QNC A;  4R1G A;  1MWU A;  3HUN A;  3T12 B;  3IHA A;  2PT7 A;  2JHE A;  1K56 A;  2O9C A;  1S0W A;  1NY0 A;  5E2H A;  4MDZ A;  3LCE A;  3MZF A;  1BT5 A;  2Q0O A;  4HHD A;  4ZTK A;  4BQM A;  1BTL A;  2A49 A;  3E4P A;  1PW8 A;  4MBK A;  1V9Z A;  1JTG A;  1NRF A;  3P7N A;  4BD1 A;  4IED A;  4JGO A;  2YKF A;  4OPR A;  3AGF A;  3HUM A;  2CMN A;  3LI9 A;  3QHY A;  2WGV A;  2HZ5 A;  2EX2 A;  1IYO A;  2HPB A;  3DTE A;  3IXD A;  4CQH A;  1T1B A;  4O0P A;  3PBS A;  4X1M A;  1BLP A;  3FPV A;  1SKF A;  1FIL A;  2ZOI A;  4D2O A;  4KZ8 A;  4YIN A;  1ONH A;  5LBR A;  1TEM A;  1FSY A;  5E2E A;  2RCX A;  2V8C A;  4N9K A;  2BLS A;  2OWH A;  3V39 A;  4K0X A;  5CEC A;  3MQ0 A;  3W4P A;  4KG5 A;  2O99 A;  5HAQ A;  5CTM A;  2VX8 A;  3BM6 A;  1YAX A;  5EM1 A;  4Y15 A;  2J8Y A;  4R3B A;  2LB5 A;  5EVI C;  4UA7 A;  5KZH A;  4E3K A;  1G68 A;  2C5W B;  2Y2J A;  2XF3 A;  3VSK A;  4GHI B;  4PM8 A;  4JGP A;  4F94 A;  2Z6D A;  4U3T A;  1SKO B;  4YOF A;  5J3W A;  1MWT A;  3F1P B;  1N9O A;  4YNR A;  2W1T B;  1LSV A;  2KOI A;  3MXQ A;  3MFD A;  3IF6 C;  4IVI A;  3MBZ A;  2C6W B;  4Y17 A;  1O07 A;  3CWF A;  3OC2 A;  4LFU A;  1LSW A;  4X1L A;  4ZAM A;  3MMH A;  4KUO A;  3H7W B;  1KE0 A;  1K4E A;  1JTD A;  1YKD A;  4P0M A;  4N92 A;  2PD8 A;  1MKM A;  3N8L A;  4Y5F A;  4KZ9 A;  2Z2M B;  4OQG A;  2HV1 A;  4MCW A;  4D60 A;  4II7 A;  4HEF A;  3UPN A;  3WWX A;  1T19 A;  3MXS A;  2D01 A;  1K54 A;  5A93 A;  4NET A;  1MWS A;  3DBA A;  3T4L A;  4WMC A;  3BQA A;  4S2M A;  3C7V A;  1GSW A;  3B3X A;  2ZQA A;  3V3R A;  2OV5 A;  3NCK A;  4GNU A;  4QWO A;  1YT4 A;  5G4Y A;  1TS7 A;  2QPN A;  5CXW A;  4PM7 A;  4H8R A;  2I72 A;  3QP2 A;  4XT2 A;  1E3U D;  4MLL A;  1XKZ A;  5CHM A;  2V0U A;  2Y2G A;  2ZM2 A;  3OPR A;  4ARZ A;  2Q9N A;  5KMW A;  2HDQ A;  4I5S A;  1ES5 A;  2Y79 A;  1FR1 A;  3AGE A;  3HUO A;  1KDW A;  4Y13 A;  3UMD A;  5KIZ A;  3DW0 A;  3SZT A;  2K7S A;  3HVF A;  5CTN A;  4KQD A;  3E4O A;  3V5M A;  3A0V A;  2UWX A;  2W3E A;  2WZZ A;  1F9I A;  1ZKJ A;  3E2K A;  3ZNY A;  2VKS A;  4UQI M;  2PDR A;  3K3C A;  4Y3I A;  5A92 A;  5DF7 A;  5AQA A;  2ZC3 B;  3F1O B;  1BLS A;  5E2F A;  5E2G A;  3SH8 A;  1KE4 A;  2ZOH A;  3VOZ A;  2WZX A;  5FAT A;  1ERQ A;  2WYX A;  1BZA A;  2A3U A;  4RYE A;  5I94 A;  5FEF A;  3N6I A;  1K57 C;  3LGO A;  4BD0 A;  5KSC A;  3VFF A;  3E0Y A;  5EVI B;  5CGW A;  4ZJ2 A;  1L0E A;  1SHV A;  3SH7 A;  3FV7 A;  5FQJ A;  1S4R A;  2Z6C A;  2EFU A;  1OTI A;  1IYQ A;  2PR6 A;  1OTE A;  1WYB A;  3CUE A;  4HJ4 A;  3VOL A;  5HAP A;  5GLD A;  5TBM A;  2V1Z A;  5JYP A;  1RGZ A;  1F5M A;  3IF6 B;  4GOG A;  3ZVW A;  4ETX A;  4GD6 A;  1W63 Q;  4S2P A;  1XA7 A;  3T50 A;  4LV1 A;  3UN7 A;  3VP1 A;  4R3A A;  3Q7Z A;  3HCY A;  5CER A;  4O8G A;  3IS2 A;  2H0Y A;  5G18 A;  2P7J A;  4MN7 A;  3P09 A;  4DDS A;  2PYP A;  4JPM A;  2ACG A;  3RXW A;  1DP6 A;  4DE2 A;  1K25 A;  4EQI A;  3GTC A;  4H6J B;  3ZG9 B;  1PNE A;  1BYW A;  1PFL A;  4HP9 A;  1ESI A;  5HAI A;  1WA9 A;  2WGW B;  5DFX A;  3S7N A;  1CQA A;  3LR3 A;  2ZMA A;  1LL8 A;  5CGS A;  4G3V A;  3IWO A;  3FPW A;  3BFG A;  1T18 A;  3NC8 A;  4DDY A;  5DFY A;  2HP5 A;  2PU4 A;  1Z09 A;  4E3N A;  3C2W A;  1XP4 A;  2QJ5 A;  5FI7 A;  2Z2L B;  3SOI A;  2O0Y A;  1KGE A;  2Y2P A;  3IT9 A;  1P97 A;  3FG8 A;  3CAX A;  1X0O A;  2VK3 A;  4ESP A;  3O86 A;  4MNR A;  1BUE A;  1PWD A;  1UWN X;  2VLG A;  1DJB A;  2ZL1 B;  5M18 A;  3IXB A;  4BMW A;  3C7U A;  4OPZ A;  2JKG A;  2UV0 E;  3KSI A;  4GW9 A;  1NYM A;  3LI8 A;  1TS8 A;  1ZHH B;  2J9O A;  2JKR M;  1HZO A;  3D72 A;  3S7P A;  3UE0 A;  1GHI A;  5DF8 A;  3OPH A;  1HLU P;  1NXY A;  3HJK A;  4LRZ E;  4FSF A;  2XR0 A;  1IOU A;  4C6Y A;  5FQM A;  3RH8 B;  3C4O A;  1FIK A;  2DCF A;  4JBF A;  3LO7 A;  2Y2L A;  3NOP C;  3M2J A;  3S1Y A;  4X53 A;  3HBR A;  3SH9 A;  5L8M A;  3ITB A;  3RFB A;  1TS6 A;  4S2N C;  4X69 A;  5U47 A;  3G35 A;  3QP5 A;  3LFV A;  2HJ9 C;  2A2L A;  1DJC A;  5FQK A;  4BL3 A;  5HL6 A;  1J3W A;  1OPX A;  3IH9 A;  4NXE A;  3G4P A;  4EXO A;  1L0D A;  3TRC A;  2W3F A;  4DE1 A;  3ICY A;  3I7J A;  3N7W A;  4ETZ A;  4WN5 A;  4BL2 A;  1Y54 A;  1VET A;  3K3D A;  3MKF A;  2ZMF A;  4UQI S;  5IT5 A;  3HLD A;  1CK3 A;  5JYO A;  3D9Y A;  2WKQ A;  5CEB A;  4JF6 A;  3OOV A;  4OPQ A;  4RA7 A;  2EWV A;  2XSS A;  4KZB A;  3OPL A;  2JKT I;  4KUK A;  4E6X A;  1I2S A;  4GLQ A;  4JGR A;  3H82 A;  2WAF A;  4UA6 A;  5GLC A;  3WS0 A;  4A5R A;  5J7E A;  4YFM A;  2QYB A;  1UGU A;  3CG5 A;  4NKP A;  1E4D A;  3GRJ A;  4B88 A;  2XA7 M;  5TGF A;  5HL1 A;  5DKL A;  2X02 A;  2FZ0 A;  4WUJ A;  4GS9 A;  1U60 A;  3NEC A;  1TF1 A;  4L9F A;  4ZJ1 A;  3W4Q A;  5FL3 A;  2WGI A;  1FSW A;  4X68 A;  1ONG A;  3NHQ A;  3P01 A;  3DTM A;  3LEQ A;  3A3I A;  5HFO A;  4DJ3 A;  1MY8 A;  2WKR A;  3TJZ C;  2V8F A;  3LY4 A;  3EWK A;  3V3S A;  4CPK A;  2LB9 A;  4JXG A;  4WZ5 C;  2JE5 A;  4Q0H A;  4S2L A;  1KDS A;  1XGI A;  4EES A;  2GX5 A;  3FKW A;  3IBR A;  3T4T A;  2VGJ A;  5AQB A;  4MN5 A;  3LYX A;  2ZQC A;  2P74 A;  1NLY A;  2R9W A;  3IXG A;  2GDN A;  3BFE A;  2ZQD A;  3G30 A;  3G2Z A;  5DF9 A;  4KEN B;  3ZG8 B;  3C30 A;  4OKP A;  3GR2 A;  2XFT A;  3MZE A;  3MXR A;  4OP5 A;  3R7W A;  2ZMV A;  2NUT C;  3UDI A;  3S22 A;  3ITA A;  3UE6 A;  4NK3 A;  3LEZ A;  1IEL A;  2ZQ7 A;  5CGX A;  2GNX A;  3BY9 A;  4IUK A;  3NY4 A;  4ZDX A;  2PR5 A;  4L0L A;  4OP8 A;  1PYY A;  4LV3 A;  4RX3 A;  2J3W A;  3GEC A;  4EBN A;  3LIB A;  3MR0 A;  2L1M A;  4X25 A;  3FKV A;  1S66 L;  4N1H A;  4BBT A;  3L9K A;  1YMS A;  4GJ4 A;  4C75 A;  1LHY A;  1CF0 A;  2B02 A;  2P9V B;  1FOF A;  5HDC A;  3BEB A;  1VM1 A;  5EUA A;  2M7U A;  4EQ1 A;  5DTK A;  2Y2K A;  3E2L A;  4OVD A;  3NIA A;  4JGQ A;  3DTK A;  4WEK A;  2A24 A;  3TOI A;  3G32 A;  1K4F A;  2W27 A;  3A3E A;  4WLA A;  1EWZ A;  3QP6 A;  2Y91 A;  3T4K A;  3PXP A;  1ES4 A;  1G6O A;  3F1N A;  5FAS A;  3OCN A;  1HVB A;  4FOF A;  3NOU C;  4L9E A;  5GHX A;  4PM6 A;  2XGN A;  1PRQ A;  3U2A A;  1KOU A;  3CUE C;  2NUP C;  3E98 A;  5HSQ A;  3NDG A;  3CPT A;  4Y2F A;  1G28 A;  5HDS A;  4WBG A;  2WKE A;  3T4S A;  2H0T A;  4E6W A;  4QY6 A;  3UB6 A;  1S1Z A;  2Y2M A;  4GDB A;  4IVK A;  3UB5 P;  3MZD A;  4CLC C;  2L4R A;  5AVE A;  1N9B A;  4NXF A;  2V0W A;  3F1P A;  2DMW A;  3T1Q B;  2JBF A;  4LCM A;  1LLB A;  3Q7V B;  2XQZ A;  1MKI A;  3U4L P;  2VV6 A;  3HLC A;  4B4X A;  1YMX A;  4OH0 A;  3C38 A;  3H7W A;  3RXX A;  5IS1 A;  4E3L A;  4P87 A;  1PWG A;  2PYR A;  2VJW A;  4UHU A;  3GMW A;  5TR7 A;  3E4Q A;  5HPF A;  5CHU A;  5J4E A;  1PI4 A;  4DKI A;  2OLV A;  5IU1 A;  4S2K A;  3VE3 A;  4BEN A;  3OCL A;  4C3Q A;  2XA7 S;  3G6O A;  3WS1 A;  2OOL A;  2WAE A;  3ZYT A;  4BJP A;  2KX6 A;  4JXS A;  5CHJ A;  4YWZ A;  4I39 A;  3ZCZ A;  2XH9 A;  4XT2 B;  2EFX A;  1H3Q A;  3N4I A;  5HAR A;  1CEF A;  1E3U A;  1XPB A;  2M7V A;  5D3O A;  1MXO A;  3LR0 A;  1S1Y A;  4HH2 A;  1XJ2 A;  2W3D A;  3VOY A;  5F1F A;  4K91 A;  4KZ4 A;  4P6Z M;  1YLZ A;  5HDD A;  1LT0 A;  4CLC E;  5L09 A;  1KVM A;  5F5Y A;  2WKH A;  2INW A;  2ZC7 A;  1T1C A;  4I38 A;  4OOY A;  4QPR A;  3M6H A;  5HZH A;  3LIE A;  1K38 A;  4S2I A;  5FQQ A;  4MMN A;  5EFW A;  4NEE D;  3CJM A;  3F1O A;  3L7H A;  3OBF A;  2VZW A;  5FAO A;  3FC7 A;  4IBX A;  4EWF A;  4FD8 A;  2QWS A;  5EVI D;  3UE1 A;  5FAP A;  5EOO A;  4DE0 A;  1WYC A;  4NXG A;  3B47 A;  4BWI A;  1TDL A;  5EVI A;  1YSQ A;  5HX9 A;  4KZ7 A;  5FAQ A;  1L0G A;  2HDS A;  2EA9 A;  3C4P A;  4E3I A;  1TDG A;  3ZG0 A;  4KZ6 A;  1S6R A;  4EBL A;  3P98 A;  4HIA A;  5FDH A;  3HLW A;  4ID4 A;  1DJA A;  3B33 A;  1ALQ A;  1MPL A;  4CLC B;  3MJQ A;  5FQI A;  1OME A;  2QMI A;  1MC0 A;  1VHM A;  4LPZ A;  1PW1 A;  3H9W A;  4PM9 A;  3IF6 A;  4WF0 A;  5FDS A;  4DRT A;  3ZVT A;  2OSU A;  5G4Z A;  2JKT M;  2K2N A;  2CC1 A;  2W3G A;  3IS2 B;  4EU0 A;  2IWD A;  3LIA A;  1OJG A;  2XLN A;  3LID A;  1CEG A;  2W1R A;  1M6K A;  3IWI A;  3IHB A;  1A0K A;  1XJ3 A;  4QU3 A;  4LRY C;  5DTS A;  3UO9 A;  3VP0 A;  2FFF B;  5A91 A;  2IWB A;  3O88 A;  2H28 A;  4FH2 A;  2O9B A;  4WZ4 A;  5A90 A;  2DNS A;  3EEA A;  4EEU A;  2QJ7 A;  5HWW A;  1NZU A;  4EEP A;  1AWI A;  1SDN A;  4U0X A;  2PD7 A;  1S67 L;  4FH4 A;  2J9P A;  4E3J A;  5FEG A;  4Y0U A;  3HLG A;  4PAU A;  3DTI A;  3EGD C;  4GB7 A;  3IX3 A;  4B93 A;  4Y0O A;  2HP6 A;  1FQG A;  3OPP A;  4JF4 A;  3GV9 A;  3IX8 A;  1F98 A;  2Y2O A;  1Y28 A;  4HES A;  3C8C A;  4KQO A;  2QHK A;  4O7D A;  2ZC5 B;  3VV4 A;  3GVB A;  1LL5 A;  3R4K A;  5A8B A;  3KSF A;  3IWQ A;  2H5S A;  3ZG5 A;  1MZU A;  2JC7 A;  4PKY G;  1D1J A;  3HLE A;  3TE8 A;  2ZL1 A;  2Y8H A;  5HPI A;  3WRZ A;  5HWV A;  4KZA A;  3G2Y A;  2JN7 A;  3EEH A;  1BSG A;  2R78 A;  3CMZ A;  2YKH A;  3OLO A;  3CI6 A;  1P9W A;  5C5K A;  4HY8 A;  2XDM A;  2PBD P;  4ME4 A;  5EVL A;  5GHY A;  1BLH A;  3JPU A;  2ZM0 A;  3LY3 A;  2X71 A;  3KYQ A;  3VP4 A;  4F3L A;  3V50 A;  1STZ A;  3HL9 A;  4EV4 A;  3AGD A;  2P04 A;  1LI0 A;  3PBQ A;  4QJG A;  4EW7 A;  2XEP A;  3T1R A;  1ES3 A;  3UB9 A;  1HTZ A;  4P6Z S;  4ZRR A;  4QHC A;  1PIO A;  5HD5 A;  1PI5 A;  4NG2 A;  3MF0 A;  1YPR A;  4OLG A;  1VET B;  5GL9 A;  5TFQ A;  4R6L A;  3S7O A;  2BAS A;  2HF6 A;  3MS6 A;  1VEU B;  1W63 M;  4EBP A;  2X01 A;  1EI5 A;  4DJ2 A;  4EER A;  1Y4O A;  1GCE A;  3N8S A;  4NXB A;  3RTY A;  4JLF A;  5AQ9 A;  1XXM A;  1VB6 A;  4U0T A;  1Q2P A;  1Q2Q A;  2IA2 A;  3H82 B;  2V1B A;  2V20 A;  1BLC A;  4MEZ A;  3TSG A;  4HI4 A;  2VGL M;  3NUL A;  4KQR A;  1IKG A;  3D3O A;  3UPO A;  3PR6 A;  2XD5 A;  3T4O A;  1H8Z A;  3LIF A;  3CIT A;  1DP9 A;  4HNB A;  3A3D A;  4BBU A;  1IYP A;  1QME A;  2HDR A;  1TD5 A;  4DXC A;  5DJT A;  2FFY A;  1LL9 A;  3MQO A;  5GLB A;  5I5L A;  5EM0 A;  4MBF A;  1ZG4 A;  2ZBB A;  3BFF A;  5IHV A;  3O87 A;  5M1A A;  4ZJ3 A;  2VEA A; 
#chains in the Genus database with same CATH homology
 3CPT A;  1SZV A;  4FUW A;  5EVE A;  5FEF A;  1A0K A;  2E8J A;  1VET A;  1Z09 A;  3DAV A;  3LGO A;  4X1M A;  3T1X A;  3D9Y A;  3UB5 P;  3CHW P;  1FIL A;  4D60 A;  1K0K A;  3T1Q B;  3T1S A;  4FTX A;  3T1R A;  2BTF P;  2V8C A;  2VK3 A;  4ESP A;  3CPT B;  1AWI A;  2ZL1 B;  3U4L P;  1YPR A;  4X25 A;  1VET B;  2JKF A;  3L7H A;  2JKG A;  3MSH A;  2B95 A;  5FEG A;  3L9K A;  3KYE A;  1SKO A;  3MS6 A;  1VEU B;  1CJF A;  4QWO A;  1CF0 A;  5EM1 A;  1Y4O A;  1HLU P;  1ACF A;  2PRF A;  3NEC A;  3T12 B;  5EV0 A;  1FIK A;  1G5U A;  3LEQ A;  3NUL A;  2PAV P;  1SKO B;  2ACG A;  1D1J A;  2ZL1 A;  2V8F A;  1PNE A;  1PFL A;  1F2K A;  5FDS A;  1VEU A;  5EM0 A;  4X1L A;  1J3W A;  1PRQ A;  1CQA A;  2HZ5 A;  2PBD P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...