2B95A

Solution nmr structure of protein dynein light chain 2a, cytoplasmic; northeast structural genomics consortium target hr2106
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 2A
publication title Solution NMR structure of protein dynein light chain 2A, cytoplasmic; Northeast structural genomics consortium TARGET HR2106
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2b95A00
1G5UA 2JKFA 1F2KA 3T1QB 1VETA 3T12B 3DAVA 3NULA 5FEFA 4FTXA 3CHWP 3UB5P 2JKGA 3T1XA 5EVEA 3U4LP 1AWIA 1SKOB 1CQAA 1VEUB 1J3WA 4X1MA 1Z09A 2PAVP 1HLUP 1CF0A 2BTFP 1FILA 2E8JA 2ZL1A 3CPTA 3LEQA 5EV0A 1CJFA 2V8CA 5FDSA 1PFLA 2VK3A 3T1RA 3D9YA 1VETB 3NECA 1A0KA 1D1JA 1SZVA 4X25A 2V8FA 1SKOA 5FEGA 1VEUA 4D60A 2PRFA 3L7HA 1FIKA 3LGOA 1PRQA 3MS6A 1Y4OA 2HZ5A 3KYEA 2PBDP 1YPRA 3T1SA 2B95A 1PNEA 5EM1A 2ACGA 4FUWA 4X1LA 3MSHA 1ACFA 4ESPA 5EM0A 3L9KA 2ZL1B 3CPTB 1K0KA 4QWOA
chains in the Genus database with same CATH superfamily
4ME4A 3IXBA 3NHQA 4JKTA 2QKPA 4XUXA 5I5LA 1WYBA 1YLYA 5FEFA 4FOFA 4S2IA 5FI7A 3ZVWA 4R70A 1AWIA 1XKZA 2PHYA 4OLDA 4R38A 2WKHA 2HDSA 4X1MA 1KE0A 1S66L 2H28A 4CLCA 1ES2A 2ZQCA 1D7EA 4IHQA 4R3JA 3O87A 3A3EA 3NOTC 3UNWA 5DTSA 2BTFP 2Y2QA 4HEFA 4OH0A 3G31A 3LIEA 3QP1A 3UY6A 2EXAA 2VK3A 2Z2LB 3S7OA 1EI5A 1YAXA 2L0WA 4I3IA 4OOYA 1GSXA 1ESUA 1YSQA 3ZNYA 5EVIA 5EVLA 5GLDA 3HJIA 1ZHHB 1GHMA 2WUQA 1PWGA 1L2SA 2ZQ8A 4HH3A 3OZHA 4PPRA 2HZ5A 4O7DA 1PYYA 4KENB 4XT2B 3WRZA 1IEMA 2M1CA 5CX7A 3O88A 5L10A 3F1OB 4OONA 1IKGA 3P01A 3T4TA 4E3LA 1K0KA 1BYWA 1PZPA 3HVFA 3QHYA 3T4SA 3WS2A 3C5AA 4KQOA 1N9LA 5AVFA 4BENA 3K3DA 1SCWA 3FWLA 3H9WA 1BLHA 2C6WB 2VGLM 4LCMA 5MC7A 3OPLA 5HFOA 3GTCA 3M6BA 2RCXA 3G4PA 5HL1A 2VLGA 3N6IA 4DMZA 3S22A 3BYDA 4C6YA 5GHYA 5TFQA 3TOIA 1Z09A 2FFYA 3B42A 3V67A 2EXBA 3F1OA 4EQIA 3ZHHA 4GHIB 5DFXA 3TRCA 1FR1A 4JXGA 3CZDA 3P09A 3C4PA 4DXBA 4X68A 2P74A 2PU2A 4EBNA 3DWKA 3AGFA 5FQIA 1XJ2A 4Q8IA 4M4XA 5A8BA 1MWRA 4N92A 4WEJA 4PHTA 4B4ZA 3IX3A 1XP4A 3PBNA 4D60A 4C75A 1PW1A 1FOFA 5EECA 4GD8A 1OT6A 1IYSA 1ZG6A 1PRQA 3Q07A 2P9VB 1F98A 3EEHA 3KYEA 2PDRA 4OQIA 2B95A 2OLUA 4MCWA 4JLFA 4GHIA 2ZC5B 5EM1A 5DVAA 1ACFA 5IU1A 2X02A 5F83A 3LIBA 5F6AA 3LI9A 1K56A 3MKEA 1RGYA 2PYPA 4QWOA 5FA7A 4HBUA 3H82B 5HARA 4EBLA 2V1AA 3W2ZA 1T1CA 3OBFA 5FATA 2BG1A 3A3JA 4B9OA 4LGWA 4WYYA 3HLCA 3BFDA 3F1PB 3UPNA 3DTKA 3V3RA 1H3QA 3W4PA 3V3SA 4OLGA 3NCKA 4N1HA 5HZHA 1PWDA 3G35A 1TDLA 4EW7A 3UO9A 4N9KA 1J3WA 2EFUA 3R4KA 2ZQAA 2P9VA 4GD6A 4OPYA 5IHVA 4RYEA 1OTBA 4KZAA 4X56A 4CLCC 1JTDA 1FILA 1K4FA 2Y2LA 4LPZA 1YM1A 3H82A 4JF4A 1UGUA 2HF6A 4JXWA 3UB7A 3LY3A 2D01A 1ONHA 2QPNA 3GDIA 4MBHA 2H0TA 3F1PA 4NXFA 5AQ7A 3M2KA 2V1ZA 3DTIA 4S2LA 1E3UA 2KX6A 1HZOA 1H8ZA 2O9AA 2O99A 4OPZA 2PRFA 3NY4A 4K91A 5EVIC 5FQ9A 2XEPA 2ZC6B 5FSRA 3ZG5A 3IX8A 3RH8B 4YFMA 1NZOA 3BRMA 3M6HA 1DJAA 4I5SA 2PBDP 1YPRA 2B5RA 3SS4A 3E2LA 3CUEA 4HBTA 3G2YA 3T4QA 1XJ3A 3VP3A 1VB6A 1XGIA 1E4DA 3WS5A 5LBRA 1XFQA 2DMWA 1HVBA 4GS9B 3H7WB 1IFQA 1K38A 3UDFA 2DNSA 3T1XA 5GLBA 1L0FA 4I38A 1NLZA 3BQAA 1G68A 2K7SA 4WELA 3VP0A 4ZDXA 3A3FA 4MN7A 2G7UA 1IYPA 4OOMA 4DE3A 4ZJ3A 5HPFA 2WZZA 2FZ0A 2PAVP 3N8LA 5HWWA 5CTNA 2IWDA 4R3AA 2WKPA 1T18A 5M18A 1N9BA 1LLBA 2WYXA 4QJGA 3KSFA 2Y55A 1PFLA 1IOUA 2ZC3B 5CHJA 4GKUA 2Y4AA 1OTIA 4GS9A 3H7WA 1O07A 4KQRA 4BBVA 5GLCA 3C38A 4WLAA 1A0KA 3KSGA 3U2AA 1SZVA 3T4OA 3PBSA 3KYZA 1YLPA 3VV4A 1KDWA 2JKRI 5FASA 1YLTA 2WGIA 2FFFB 4EV4A 3VMAA 5HAQA 5CGXA 2JKTI 1EW0A 2HPBA 3TSGA 2XFSA 4ZBEA 5EOOA 2EX2A 1DJBA 2XROA 2JBFA 4JGOA 4HJ3A 2O9BA 2A49A 2QHKA 1DP6A 1P0ZA 4QD4A 5KSHA 1KVMA 3EEAA 4XUZA 3O86A 5L8MA 4YINA 2Y8HA 3BM6A 1VHMA 1UWNX 4WMCA 3BY8A 2VV8A 3UN7A 3NIAA 1E25A 3VFFA 2HJEA 4S2JA 1S4RA 5HD5A 5AQAA 4BL3A 2VA0A 3IHAA 3SH8A 4NETA 2Q9MA 3LR5A 2Y2GA 2LB9A 3QNBA 2WGWB 3FPVA 4IUKA 5E43A 4N1XA 1RP5A 4OOLA 1F9IA 1VQQA 2JKRM 5DF9A 2W3EA 2HP6A 5M1AA 3LR4A 2WKEA 2XA7S 4JBFA 1AXBA 3ZFZA 2JKTM 4JPMA 2EX8A 4JF5A 3QP2A 1TDGA 3E4QA 3PAGA 4DXCA 1S6RA 5EUAA 3ITAA 1NYYA 1OJ5A 1XXMA 2VJWA 5FL3A 1TF1A 4HP4A 2VGKA 2D02A 3E0YA 3ZQ5A 1LL8A 3ITBA 3ZVTA 2WGWA 2VZWA 4GDBA 4WF0A 2G2WA 1LSXA 3MQ0A 5DTKA 4Y0OA 2HDQA 2JKFA 1SDNA 2J8YA 1XJ6A 3CUEC 4FH4A 3DAVA 2ZM0A 4BBUA 2VV7A 1VM1A 4MNRA 3UMEA 4GN2A 1VEUB 2XGNA 1ESIA 1UWPX 4L0LA 1W7FA 2GNXA 3HLWA 4OP8A 3W8KA 3ZG8B 4FCFA 4F3LB 5CHUA 5KSCA 1WE4A 2HP9A 2Y2KA 3UDXA 3SOIA 1MBLA 3BFCA 5EVIB 2V1BA 4RA7A 2WKQA 4E3OA 4PM5A 1V9YA 1N9NA 4EUVA 4KUKA 5KIZA 2Y2NA 3VOZA 3Q7ZA 4OQGA 5GL9A 3G6OA 4KG6A 2WK0A 3HLGA 5HW3A 1I2WA 1VEUA 1KGGA 4X53A 2LB5A 4R1GA 3Q1FA 2IA2A 2WAFA 1O7EA 4F3LA 1YLZA 3LGOA 5J3WA 3PBQA 3UDIA 1FCOA 4JGQA 3MXSA 4NXEA 2GDNA 3A0RA 4R6LA 3LR0A 1CI9A 4I3JA 5EM0A 3O3VA 4P6BA 1YKDA 2JE5A 1KDSA 1LSWA 3CPTB 1PW8A 1BLPA 2ZLYA 2J9OA 4LENA 4R0QA 3D3OA 3T12B 4Y7PA 3WRTA 3NULA 1YT4A 4EERA 2WKIA 3LIAA 2OWJA 1ES3A 4BL2A 2JKGA 1LI0A 2NUTC 4HOIA 4MBKA 2P7JA 3UMDA 3LY4A 4MN5A 1JWPA 4JGPA 3GSGA 3MR0A 3ZDJA 1EROA 4LCLA 1KGEA 4LV2A 2M7VA 4R4RA 1FCNA 3PXPA 4ZJ2A 2ZC4B 2JHEA 2XLNA 4LRXC 3LCEA 2QZ6A 3S7PA 2B18A 5HDCA 1GSWA 3CPTA 2XF3A 1OMEA 5L09A 1CJFA 3PBTA 1ODVA 5HAIA 2K2NA 4CQHA 3T1RA 4HQAA 3E4PA 4KG5A 3BECA 1FCMA 3IWIA 1ERQA 1YQSA 1C3BA 4L9GA 4P6ZS 2V8FA 4DRTA 3G34A 3L7HA 1GHIA 1JWVA 1XJ4A 3QP5A 1V9ZA 4HH2A 2H5SA 1Y4OA 5CECA 4DJ2A 1X0OA 1LL5A 1TS6A 4GZBA 4DDYA 1G28A 4PM6A 1WA9A 4NXBA 3LIDA 3ZG7B 4QY5A 1H8MA 2VKSA 1H0MA 4ESPA 4JXVA 3S7QA 2KLIA 4L9EA 1F2KA 3T1QB 3VOLA 4UQIS 4PM9A 2VGLS 1W79A 5F68A 2X71A 4RQ9A 1W63M 3I7JA 3CG5A 2J7VA 4LV3A 5DFYA 1ZKJA 5A90A 5A91A 3VP1A 4EBPA 3U4LP 1JNUA 2Z2MB 3VSLA 1K6RA 5FQMA 4GDNA 1NWZA 3S4XA 2G2UA 4MBFA 5EOEA 4DE1A 1TS0A 2M7UA 4U3TA 2DCFA 2EWWA 3RFBA 3NC8A 4Y13A 1I5QA 3CMZA 3HLBA 1MKIA 2QMIA 2PU4A 1ES5A 2KDKA 4CLCD 3W4QA 4BMWA 4I3AA 3GV9A 5JYPA 1ES4A 3WS4A 2KOIA 3LEZA 4CLCE 4E6WA 3MKFA 3IF6B 4PMAA 5BOHA 1XX2A 3BFFA 3ZGAB 3BJNA 2XK1A 2WZXA 3N8RA 3MQOA 3JVVA 1W63Q 2WGVA 1GA0A 3IHBA 1OTEA 2OWHA 3IWQA 4GNUA 4PM7A 1W8YA 3BFGA 1KOUA 2J80A 4KQDA 3BLMA 5EVID 5DF7A 3TG9A 4GLQA 3FKVA 1XA1A 1Q2QA 5I94A 1DJCA 3CWFA 3OLOA 1W5DA 2X01A 1JWZA 4OP5A 3T50A 2A24B 4LRYC 5FAPA 4P87A 4DE0A 5CGSA 3IF6A 3KX0X 3PBOA 4NXGA 1MWUA 3SH9A 2ZOIA 1MXOA 2Z6CA 3EWKA 4UAAA 4GCZA 5CEDA 4GB7A 2RL3A 3E98A 3E2KA 3IF5A 1K57A 3CAXA 1SDEA 3LYXA 3Q81A 2A3UA 1N9OA 5AJGA 3IX4A 3HUNA 5J7EA 3DWZA 3C4OA 5TR7A 5HAPA 2Y59A 2XFTA 4K0WA 2EWVA 3LI8A 4Y0UA 2R78A 3IH8A 3SW1A 2A24A 2JCHA 4KZ3A 3IQAA 3HUMA 1KE3A 3IT9A 5DKLA 4G3WA 3IBJA 3C8CA 5KMWA 4ZRRA 2H10A 4BBTA 4S2KA 2GX5A 4NEED 1K55A 2WKRA 4S2NA 1L3LA 5FQKA 4E04A 2JC7A 3GVBA 1JVJA 3IXHA 1BTLA 4KZ6A 3B3XA 5J8XA 1ERMA 4O0PA 3G30A 2V0WA 1NRFA 2XQZA 5G4ZA 1MC0A 5K5BA 4P85A 1GA9A 3RXWA 3UB8A 3UPOA 3V50A 2J9PA 1CEFA 3LIFA 3OCLA 4GOGA 3CI6A 4HNBA 5FAOA 1P97A 2YKHA 4FTXA 5F5YA 3HJKA 1FR6A 1XA7A 5CXWA 3UB5P 4LV0A 4ETZA 4WL9A 3WS0A 2PD7A 4X69A 1K56D 4IVKA 1XPBA 4ZAMA 4E3MA 1W8QA 1ONGA 1IELA 4Y0TA 3VOYA 1TS7A 3ISGA 3JYIA 2HP5A 4Y5FA 4LLOB 4S2MA 1BUEA 4QHCA 1TVFA 2ZC7A 4S2PA 1BT5A 1OPXA 1ZG4A 2ZM8A 2XA7M 3KO6A 3SZTA 3BY9A 3OCNA 1WYCA 3K3CA 1CI8A 1VETB 3BLSA 3ZNTA 2ZQDA 5HD3A 3HLDA 4GW9A 2W1TB 1T1BA 4X25A 4WZ4A 4G3VA 1QMEA 5EE8A 4MMNA 3PYPA 1BSGA 2J3TC 4LFUA 5A92A 3BWLA 4WM9A 4DE2A 3OPPA 1LSVA 1E3UD 3T1SA 1YLJA 2JN7A 4UA7A 5DJUA 3T4LA 3FPWA 1OTDA 1GCEA 2PR5A 3S7NA 4GJ4A 2ZL1B 4KZBA 1EWZA 1G5UA 3DBAA 3FYZA 1Q2PA 1K6SA 1VETA 4K08A 2I72A 1KE4A 5FAQA 3MMHA 4D2OA 2O9CA 5G18A 4CJNA 2W1TA 1ZTUA 3N8SA 4JF6A 3OC2A 4Z1WA 1MWTA 4PM8A 3VFHA 3RJUA 1H5XA 3IF6C 4UA6A 3BW6A 2E8IA 3ICYA 4QB8A 4Y15A 1LL9A 3C7VA 4E3JA 3UB9A 5CERA 4BD0A 4HIAA 1K57C 4YOFA 4H6JA 3WS1A 3UE6A 2NUPC 4R4SA 1RCJA 2ZL1A 2VV6A 4NK3A 4AFIA 4P0MA 4FH2A 1YMSA 4RX2A 2UV0E 2L1MA 4MDZA 1RGZA 4ARZB 1T19A 4O01A 2Q0OA 3ZG9B 5M19A 4O8GA 3PAEA 3V5MA 2Y2IA 3S1YA 1DP9A 3OPHA 1KGFA 1SKFA 4EEUA 1LT0A 4Y17A 4LV1A 5HL6A 2ZM2A 1K55C 3VE4A 4S2NC 1NRJA 4HESA 1FSYA 2OV5A 3BQ8A 5AQBA 3MJQA 2ACGA 3SH7A 4EQ1A 3Q7VA 5U47A 4ZTKA 3W4OA 2PYRA 1IKIA 1NYMA 4R23A 1FSWA 3IXDA 5FDHA 3C30A 4C3QA 3QNCA 4ARZA 5HWTA 3GECA 3P7NA 1MWSA 4II7A 3DTMA 2BLSA 2FH5A 2HV1A 3UE1A 4Q0JA 3JVUA 5FQQA 2VGJA 3K2NA 5DJTA 1T1AA 3G2ZA 1H8YA 1Z6FA 1U60A 3MFXA 1IYOA 3MZEA 3FKWA 1MPLA 2BASA 5GLAA 2Y91A 1HLUP 4UEYA 4KG2A 4PKYG 4WMCD 3VE3A 5CGWA 4WEKA 5AVEA 4U0TA 1LI9A 2R9WA 2PBYA 5CTMA 3O5YA 1YMXA 5IT5A 1FQGA 4DJ3A 4FD8A 4KZ9A 4YNRA 2P08A 4P6ZM 3MZDA 1OTAA 4Q0IA 3C7UA 2W1RA 3CJMA 2B02A 5FI6A 3EGDC 2PD8A 3EQVA 2L4RA 3MXRA 3AGDA 5FEGA 4BQMA 3D72A 5EPHA 4IBRA 2V2FF 2W3FA 5IS1A 4WBGA 1S4SA 3IXGA 2WADA 1HTZA 1M6KA 4UQIM 2XSSA 3RXXA 3FC7A 1OJGA 4NG2A 4WZ5A 4NKPA 2XH9A 4DN0A 3GQZA 4DDSA 1JTGA 1P9WA 4I39A 1SHVA 4XT2A 1NY0A 1K25A 3KSIA 5EVEA 4OKPA 3ZG0A 1PWCA 3UE0A 2CC1A 1TS8A 2V0UA 2ZBBA 4IJGA 5F69A 4B4XA 3MBZA 1CQAA 4E6XA 3LICA 2VEAA 5HDSA 3HLFA 1ZC2A 2OAQ1 3BFEA 5G4YA 4IEDA 4ETXA 1Y54A 3CLOA 5TJJA 4BJPA 2E8JA 3KYQA 2EX9A 3FZCA 3LUQA 5E2GA 2HDUA 2Y2MA 3MXQA 5E2EA 2V8CA 3UB6A 3IBRA 3F1NB 5HSQA 5J4EA 2K31A 1S0WA 4EESA 1YSPA 4ZJ1A 1NZUA 5KZHA 2W3GA 2XD5A 3D4FA 3VP2A 5HPIA 1BZAA 4MEZA 1OT9A 4HI4A 4IVIA 3HBRA 1CK3A 2XR0A 5AQ9A 5TBMB 1GSVA 4QPRA 1IYQA 2Y2HA 2AVXA 3ULFA 3MSHA 4JXSA 3MQQA 3LR3A 2ZMAA 1HD8A 2Z6DA 3F1NA 4IUHA 1DP8A 5HX9A 3R7WB 1I2SA 5FI2A 4BLMA 3MZFA 4U0XA 4UA9A 2ZJ9A 4S2OA 1S67L 2O0YA 3Q82A 4KZ8A 3B47A 4OQ0A 3IS2B 4EXOA 3HL9A 5TBMA 3OOVA 3RTYA 1L0GA 2ZMVA 1L0DA 1PZOA 4Q0HA 2IWCA 2A2LA 1CF0A 3EGXC 1TD5A 1NJ4A 2W27A 1QMFA 2HGVA 1DRMA 1BLSA 5DKKA 3BEBA 5L2FA 3R7WA 4OVDA 3NJAA 5FQJA 3GR2A 4EETB 4OQHA 3LO7A 4Y2FA 1NXYA 3TJZC 3MFDA 3MF0A 3DW0A 1P9RA 3T4KA 2EA9A 2EFXA 1ALQA 4HP9A 4HJ4A 4L9FA 1YLWA 3IS2A 3T4JA 2QJ5A 4E3KA 5GHXA 2P04A 3GMWA 3NOPC 4FSFA 5E2FA 3B33A 4DF6A 2HJ9C 1BLCA 1K54A 4DKIA 2GJ3A 2IWBA 2ZD8A 4CPKA 2QWSA 4OPRA 4E3IA 2PT7A 1XGJA 4XXRA 2Y79A 4B88A 2I9VA 1KVLA 2Y2JA 5EFWA 4MLLA 3TE8A 4WZ5C 3A0VA 3UPPA 4Y3IA 2QJ7A 2Q9NA 3P98A 3IH9A 4QU3A 3FV7A 4KZ7A 4LRZE 4X55A 1TEMA 2W3DA 4EUZA 3OPRA 4R3BA 4A5RA 2OOLA 3SS3A 1SKOB 3KSHA 1LHYA 4WN5A 3LFVA 3NOUC 2XRNA 2WAEA 3EQUA 3SS5A 4KUOA 1N4OA 3N7WA 4M3KA 1STZA 4B93A 4KQQA 4QY6A 3E4OA 3A0SA 2ZQ9A 5E2HA 2QYBA 2OLVA 3HCYA 3LEQA 3N4IA 1CEGA 5EV0A 5HWVA 1S1ZA 4X6TA 3FG8A 1PI5A 4KZ4A 2OSUA 4KZ5A 3NECA 3WWXA 4ID4A 2HDRA 1F5MA 3UE3A 2PR6A 3V39A 5TGFA 2ZOHA 5F1FA 1PI4A 2OAP1 4BWIA 3DTEA 1G6AA 2H0YA 2UWXA 3ZCZA 1SKOA 5CRFA 2J3WA 3HLEA 1MY8A 3GRJA 3A3DA 2XDMA 4E3NA 4F94A 4G3KA 3A3IA 2EX6A 3VSKA 2ZQ7A 1G6OA 3MS6A 2GZAA 4K0XA 5C5KA 2W3HA 3HUOA 2J3TD 1BULA 4OPQA 5CEBA 2VX8A 2V9AA 4X1LA 3PTEA 3QP6A 2C5WB 5F82A 5A93A 4JGRA 4PAUA 1S1YA 3G32A 3L9KA 4MN6A 4Z9QA 2MJ6A 4EU0A 2W0NA 5CHMA 5L07A 4EWFA 1NLYA 2INWA 2XD1A 3CHWP 2Y2OA 1Y28A 2R9XA 5F1GA 4H6JB 3QP4A 3ZYTA 4IBXA 1J9MA 1PIOA 1XFNA 3IWOA 4N9LA 3EOIA 4PKYA 5DTTA 3NDEA 3CITA 3NI9A 5GHZA 2CMNA 1GHPA 3QP8A 3NDGA 1L0EA 3JPUA 2V20A 5FDSA 5JYOA 3D9YA 3PR6A 5HDDA 3NBLA 4YWZA 3AGEA 1D06A 1D1JA 4HY8A 3C2WA 4EEPA 1M40A 4UHUA 4H8RA 3Q7VB 4HJ6A 3TW8A 3PBRA 1FIKA 1DY6A 4BD1A 5D3OA 1MKMA 4WUJA 2DRWA 1MZUA 4CLCB 3PHYA 3M2JA 5DF8A 3VP4A 1PNEA 4HHDA 1K54C 2YKFA 4FUWA 1K4EA 3HREA 4RVAA 2Y2PA 2ZMFA 4RX3A
chains in the Genus database with same CATH topology
1G5UA 2JKFA 1F2KA 3T1QB 1VETA 3T12B 3DAVA 3NULA 5FEFA 4FTXA 3CHWP 3UB5P 2JKGA 3T1XA 5EVEA 3U4LP 1AWIA 1SKOB 1CQAA 1VEUB 1J3WA 4X1MA 1Z09A 2PAVP 1HLUP 1CF0A 2BTFP 1FILA 2E8JA 2ZL1A 3CPTA 3LEQA 5EV0A 1CJFA 2V8CA 5FDSA 1PFLA 2VK3A 3T1RA 3D9YA 1VETB 3NECA 1A0KA 1D1JA 1SZVA 4X25A 2V8FA 1SKOA 5FEGA 1VEUA 4D60A 2PRFA 3L7HA 1FIKA 3LGOA 1PRQA 3MS6A 1Y4OA 2HZ5A 3KYEA 2PBDP 1YPRA 3T1SA 2B95A 1PNEA 5EM1A 2ACGA 4FUWA 4X1LA 3MSHA 1ACFA 4ESPA 5EM0A 3L9KA 2ZL1B 3CPTB 1K0KA 4QWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5U A;  2JKF A;  1F2K A;  3T1Q B;  1VET A;  3T12 B;  3DAV A;  3NUL A;  5FEF A;  4FTX A;  3CHW P;  3UB5 P;  2JKG A;  3T1X A;  5EVE A;  3U4L P;  1AWI A;  1SKO B;  1CQA A;  1VEU B;  1J3W A;  4X1M A;  1Z09 A;  2PAV P;  1HLU P;  1CF0 A;  2BTF P;  1FIL A;  2E8J A;  2ZL1 A;  3CPT A;  3LEQ A;  5EV0 A;  1CJF A;  2V8C A;  5FDS A;  1PFL A;  2VK3 A;  3T1R A;  3D9Y A;  1VET B;  3NEC A;  1A0K A;  1D1J A;  1SZV A;  4X25 A;  2V8F A;  1SKO A;  5FEG A;  1VEU A;  4D60 A;  2PRF A;  3L7H A;  1FIK A;  3LGO A;  1PRQ A;  3MS6 A;  1Y4O A;  2HZ5 A;  3KYE A;  2PBD P;  1YPR A;  3T1S A;  2B95 A;  1PNE A;  5EM1 A;  2ACG A;  4FUW A;  4X1L A;  3MSH A;  1ACF A;  4ESP A;  5EM0 A;  3L9K A;  2ZL1 B;  3CPT B;  1K0K A;  4QWO A; 
#chains in the Genus database with same CATH topology
 4ME4 A;  3IXB A;  3NHQ A;  4JKT A;  2QKP A;  4XUX A;  5I5L A;  1WYB A;  1YLY A;  5FEF A;  4FOF A;  4S2I A;  5FI7 A;  3ZVW A;  4R70 A;  1AWI A;  1XKZ A;  2PHY A;  4OLD A;  4R38 A;  2WKH A;  2HDS A;  4X1M A;  1KE0 A;  1S66 L;  2H28 A;  4CLC A;  1ES2 A;  2ZQC A;  1D7E A;  4IHQ A;  4R3J A;  3O87 A;  3A3E A;  3NOT C;  3UNW A;  5DTS A;  2BTF P;  2Y2Q A;  4HEF A;  4OH0 A;  3G31 A;  3LIE A;  3QP1 A;  3UY6 A;  2EXA A;  2VK3 A;  2Z2L B;  3S7O A;  1EI5 A;  1YAX A;  2L0W A;  4I3I A;  4OOY A;  1GSX A;  1ESU A;  1YSQ A;  3ZNY A;  5EVI A;  5EVL A;  5GLD A;  3HJI A;  1ZHH B;  1GHM A;  2WUQ A;  1PWG A;  1L2S A;  2ZQ8 A;  4HH3 A;  3OZH A;  4PPR A;  2HZ5 A;  4O7D A;  1PYY A;  4KEN B;  4XT2 B;  3WRZ A;  1IEM A;  2M1C A;  5CX7 A;  3O88 A;  5L10 A;  3F1O B;  4OON A;  1IKG A;  3P01 A;  3T4T A;  4E3L A;  1K0K A;  1BYW A;  1PZP A;  3HVF A;  3QHY A;  3T4S A;  3WS2 A;  3C5A A;  4KQO A;  1N9L A;  5AVF A;  4BEN A;  3K3D A;  1SCW A;  3FWL A;  3H9W A;  1BLH A;  2C6W B;  2VGL M;  4LCM A;  5MC7 A;  3OPL A;  5HFO A;  3GTC A;  3M6B A;  2RCX A;  3G4P A;  5HL1 A;  2VLG A;  3N6I A;  4DMZ A;  3S22 A;  3BYD A;  4C6Y A;  5GHY A;  5TFQ A;  3TOI A;  1Z09 A;  2FFY A;  3B42 A;  3V67 A;  2EXB A;  3F1O A;  4EQI A;  3ZHH A;  4GHI B;  5DFX A;  3TRC A;  1FR1 A;  4JXG A;  3CZD A;  3P09 A;  3C4P A;  4DXB A;  4X68 A;  2P74 A;  2PU2 A;  4EBN A;  3DWK A;  3AGF A;  5FQI A;  1XJ2 A;  4Q8I A;  4M4X A;  5A8B A;  1MWR A;  4N92 A;  4WEJ A;  4PHT A;  4B4Z A;  3IX3 A;  1XP4 A;  3PBN A;  4D60 A;  4C75 A;  1PW1 A;  1FOF A;  5EEC A;  4GD8 A;  1OT6 A;  1IYS A;  1ZG6 A;  1PRQ A;  3Q07 A;  2P9V B;  1F98 A;  3EEH A;  3KYE A;  2PDR A;  4OQI A;  2B95 A;  2OLU A;  4MCW A;  4JLF A;  4GHI A;  2ZC5 B;  5EM1 A;  5DVA A;  1ACF A;  5IU1 A;  2X02 A;  5F83 A;  3LIB A;  5F6A A;  3LI9 A;  1K56 A;  3MKE A;  1RGY A;  2PYP A;  4QWO A;  5FA7 A;  4HBU A;  3H82 B;  5HAR A;  4EBL A;  2V1A A;  3W2Z A;  1T1C A;  3OBF A;  5FAT A;  2BG1 A;  3A3J A;  4B9O A;  4LGW A;  4WYY A;  3HLC A;  3BFD A;  3F1P B;  3UPN A;  3DTK A;  3V3R A;  1H3Q A;  3W4P A;  3V3S A;  4OLG A;  3NCK A;  4N1H A;  5HZH A;  1PWD A;  3G35 A;  1TDL A;  4EW7 A;  3UO9 A;  4N9K A;  1J3W A;  2EFU A;  3R4K A;  2ZQA A;  2P9V A;  4GD6 A;  4OPY A;  5IHV A;  4RYE A;  1OTB A;  4KZA A;  4X56 A;  4CLC C;  1JTD A;  1FIL A;  1K4F A;  2Y2L A;  4LPZ A;  1YM1 A;  3H82 A;  4JF4 A;  1UGU A;  2HF6 A;  4JXW A;  3UB7 A;  3LY3 A;  2D01 A;  1ONH A;  2QPN A;  3GDI A;  4MBH A;  2H0T A;  3F1P A;  4NXF A;  5AQ7 A;  3M2K A;  2V1Z A;  3DTI A;  4S2L A;  1E3U A;  2KX6 A;  1HZO A;  1H8Z A;  2O9A A;  2O99 A;  4OPZ A;  2PRF A;  3NY4 A;  4K91 A;  5EVI C;  5FQ9 A;  2XEP A;  2ZC6 B;  5FSR A;  3ZG5 A;  3IX8 A;  3RH8 B;  4YFM A;  1NZO A;  3BRM A;  3M6H A;  1DJA A;  4I5S A;  2PBD P;  1YPR A;  2B5R A;  3SS4 A;  3E2L A;  3CUE A;  4HBT A;  3G2Y A;  3T4Q A;  1XJ3 A;  3VP3 A;  1VB6 A;  1XGI A;  1E4D A;  3WS5 A;  5LBR A;  1XFQ A;  2DMW A;  1HVB A;  4GS9 B;  3H7W B;  1IFQ A;  1K38 A;  3UDF A;  2DNS A;  3T1X A;  5GLB A;  1L0F A;  4I38 A;  1NLZ A;  3BQA A;  1G68 A;  2K7S A;  4WEL A;  3VP0 A;  4ZDX A;  3A3F A;  4MN7 A;  2G7U A;  1IYP A;  4OOM A;  4DE3 A;  4ZJ3 A;  5HPF A;  2WZZ A;  2FZ0 A;  2PAV P;  3N8L A;  5HWW A;  5CTN A;  2IWD A;  4R3A A;  2WKP A;  1T18 A;  5M18 A;  1N9B A;  1LLB A;  2WYX A;  4QJG A;  3KSF A;  2Y55 A;  1PFL A;  1IOU A;  2ZC3 B;  5CHJ A;  4GKU A;  2Y4A A;  1OTI A;  4GS9 A;  3H7W A;  1O07 A;  4KQR A;  4BBV A;  5GLC A;  3C38 A;  4WLA A;  1A0K A;  3KSG A;  3U2A A;  1SZV A;  3T4O A;  3PBS A;  3KYZ A;  1YLP A;  3VV4 A;  1KDW A;  2JKR I;  5FAS A;  1YLT A;  2WGI A;  2FFF B;  4EV4 A;  3VMA A;  5HAQ A;  5CGX A;  2JKT I;  1EW0 A;  2HPB A;  3TSG A;  2XFS A;  4ZBE A;  5EOO A;  2EX2 A;  1DJB A;  2XRO A;  2JBF A;  4JGO A;  4HJ3 A;  2O9B A;  2A49 A;  2QHK A;  1DP6 A;  1P0Z A;  4QD4 A;  5KSH A;  1KVM A;  3EEA A;  4XUZ A;  3O86 A;  5L8M A;  4YIN A;  2Y8H A;  3BM6 A;  1VHM A;  1UWN X;  4WMC A;  3BY8 A;  2VV8 A;  3UN7 A;  3NIA A;  1E25 A;  3VFF A;  2HJE A;  4S2J A;  1S4R A;  5HD5 A;  5AQA A;  4BL3 A;  2VA0 A;  3IHA A;  3SH8 A;  4NET A;  2Q9M A;  3LR5 A;  2Y2G A;  2LB9 A;  3QNB A;  2WGW B;  3FPV A;  4IUK A;  5E43 A;  4N1X A;  1RP5 A;  4OOL A;  1F9I A;  1VQQ A;  2JKR M;  5DF9 A;  2W3E A;  2HP6 A;  5M1A A;  3LR4 A;  2WKE A;  2XA7 S;  4JBF A;  1AXB A;  3ZFZ A;  2JKT M;  4JPM A;  2EX8 A;  4JF5 A;  3QP2 A;  1TDG A;  3E4Q A;  3PAG A;  4DXC A;  1S6R A;  5EUA A;  3ITA A;  1NYY A;  1OJ5 A;  1XXM A;  2VJW A;  5FL3 A;  1TF1 A;  4HP4 A;  2VGK A;  2D02 A;  3E0Y A;  3ZQ5 A;  1LL8 A;  3ITB A;  3ZVT A;  2WGW A;  2VZW A;  4GDB A;  4WF0 A;  2G2W A;  1LSX A;  3MQ0 A;  5DTK A;  4Y0O A;  2HDQ A;  2JKF A;  1SDN A;  2J8Y A;  1XJ6 A;  3CUE C;  4FH4 A;  3DAV A;  2ZM0 A;  4BBU A;  2VV7 A;  1VM1 A;  4MNR A;  3UME A;  4GN2 A;  1VEU B;  2XGN A;  1ESI A;  1UWP X;  4L0L A;  1W7F A;  2GNX A;  3HLW A;  4OP8 A;  3W8K A;  3ZG8 B;  4FCF A;  4F3L B;  5CHU A;  5KSC A;  1WE4 A;  2HP9 A;  2Y2K A;  3UDX A;  3SOI A;  1MBL A;  3BFC A;  5EVI B;  2V1B A;  4RA7 A;  2WKQ A;  4E3O A;  4PM5 A;  1V9Y A;  1N9N A;  4EUV A;  4KUK A;  5KIZ A;  2Y2N A;  3VOZ A;  3Q7Z A;  4OQG A;  5GL9 A;  3G6O A;  4KG6 A;  2WK0 A;  3HLG A;  5HW3 A;  1I2W A;  1VEU A;  1KGG A;  4X53 A;  2LB5 A;  4R1G A;  3Q1F A;  2IA2 A;  2WAF A;  1O7E A;  4F3L A;  1YLZ A;  3LGO A;  5J3W A;  3PBQ A;  3UDI A;  1FCO A;  4JGQ A;  3MXS A;  4NXE A;  2GDN A;  3A0R A;  4R6L A;  3LR0 A;  1CI9 A;  4I3J A;  5EM0 A;  3O3V A;  4P6B A;  1YKD A;  2JE5 A;  1KDS A;  1LSW A;  3CPT B;  1PW8 A;  1BLP A;  2ZLY A;  2J9O A;  4LEN A;  4R0Q A;  3D3O A;  3T12 B;  4Y7P A;  3WRT A;  3NUL A;  1YT4 A;  4EER A;  2WKI A;  3LIA A;  2OWJ A;  1ES3 A;  4BL2 A;  2JKG A;  1LI0 A;  2NUT C;  4HOI A;  4MBK A;  2P7J A;  3UMD A;  3LY4 A;  4MN5 A;  1JWP A;  4JGP A;  3GSG A;  3MR0 A;  3ZDJ A;  1ERO A;  4LCL A;  1KGE A;  4LV2 A;  2M7V A;  4R4R A;  1FCN A;  3PXP A;  4ZJ2 A;  2ZC4 B;  2JHE A;  2XLN A;  4LRX C;  3LCE A;  2QZ6 A;  3S7P A;  2B18 A;  5HDC A;  1GSW A;  3CPT A;  2XF3 A;  1OME A;  5L09 A;  1CJF A;  3PBT A;  1ODV A;  5HAI A;  2K2N A;  4CQH A;  3T1R A;  4HQA A;  3E4P A;  4KG5 A;  3BEC A;  1FCM A;  3IWI A;  1ERQ A;  1YQS A;  1C3B A;  4L9G A;  4P6Z S;  2V8F A;  4DRT A;  3G34 A;  3L7H A;  1GHI A;  1JWV A;  1XJ4 A;  3QP5 A;  1V9Z A;  4HH2 A;  2H5S A;  1Y4O A;  5CEC A;  4DJ2 A;  1X0O A;  1LL5 A;  1TS6 A;  4GZB A;  4DDY A;  1G28 A;  4PM6 A;  1WA9 A;  4NXB A;  3LID A;  3ZG7 B;  4QY5 A;  1H8M A;  2VKS A;  1H0M A;  4ESP A;  4JXV A;  3S7Q A;  2KLI A;  4L9E A;  1F2K A;  3T1Q B;  3VOL A;  4UQI S;  4PM9 A;  2VGL S;  1W79 A;  5F68 A;  2X71 A;  4RQ9 A;  1W63 M;  3I7J A;  3CG5 A;  2J7V A;  4LV3 A;  5DFY A;  1ZKJ A;  5A90 A;  5A91 A;  3VP1 A;  4EBP A;  3U4L P;  1JNU A;  2Z2M B;  3VSL A;  1K6R A;  5FQM A;  4GDN A;  1NWZ A;  3S4X A;  2G2U A;  4MBF A;  5EOE A;  4DE1 A;  1TS0 A;  2M7U A;  4U3T A;  2DCF A;  2EWW A;  3RFB A;  3NC8 A;  4Y13 A;  1I5Q A;  3CMZ A;  3HLB A;  1MKI A;  2QMI A;  2PU4 A;  1ES5 A;  2KDK A;  4CLC D;  3W4Q A;  4BMW A;  4I3A A;  3GV9 A;  5JYP A;  1ES4 A;  3WS4 A;  2KOI A;  3LEZ A;  4CLC E;  4E6W A;  3MKF A;  3IF6 B;  4PMA A;  5BOH A;  1XX2 A;  3BFF A;  3ZGA B;  3BJN A;  2XK1 A;  2WZX A;  3N8R A;  3MQO A;  3JVV A;  1W63 Q;  2WGV A;  1GA0 A;  3IHB A;  1OTE A;  2OWH A;  3IWQ A;  4GNU A;  4PM7 A;  1W8Y A;  3BFG A;  1KOU A;  2J80 A;  4KQD A;  3BLM A;  5EVI D;  5DF7 A;  3TG9 A;  4GLQ A;  3FKV A;  1XA1 A;  1Q2Q A;  5I94 A;  1DJC A;  3CWF A;  3OLO A;  1W5D A;  2X01 A;  1JWZ A;  4OP5 A;  3T50 A;  2A24 B;  4LRY C;  5FAP A;  4P87 A;  4DE0 A;  5CGS A;  3IF6 A;  3KX0 X;  3PBO A;  4NXG A;  1MWU A;  3SH9 A;  2ZOI A;  1MXO A;  2Z6C A;  3EWK A;  4UAA A;  4GCZ A;  5CED A;  4GB7 A;  2RL3 A;  3E98 A;  3E2K A;  3IF5 A;  1K57 A;  3CAX A;  1SDE A;  3LYX A;  3Q81 A;  2A3U A;  1N9O A;  5AJG A;  3IX4 A;  3HUN A;  5J7E A;  3DWZ A;  3C4O A;  5TR7 A;  5HAP A;  2Y59 A;  2XFT A;  4K0W A;  2EWV A;  3LI8 A;  4Y0U A;  2R78 A;  3IH8 A;  3SW1 A;  2A24 A;  2JCH A;  4KZ3 A;  3IQA A;  3HUM A;  1KE3 A;  3IT9 A;  5DKL A;  4G3W A;  3IBJ A;  3C8C A;  5KMW A;  4ZRR A;  2H10 A;  4BBT A;  4S2K A;  2GX5 A;  4NEE D;  1K55 A;  2WKR A;  4S2N A;  1L3L A;  5FQK A;  4E04 A;  2JC7 A;  3GVB A;  1JVJ A;  3IXH A;  1BTL A;  4KZ6 A;  3B3X A;  5J8X A;  1ERM A;  4O0P A;  3G30 A;  2V0W A;  1NRF A;  2XQZ A;  5G4Z A;  1MC0 A;  5K5B A;  4P85 A;  1GA9 A;  3RXW A;  3UB8 A;  3UPO A;  3V50 A;  2J9P A;  1CEF A;  3LIF A;  3OCL A;  4GOG A;  3CI6 A;  4HNB A;  5FAO A;  1P97 A;  2YKH A;  4FTX A;  5F5Y A;  3HJK A;  1FR6 A;  1XA7 A;  5CXW A;  3UB5 P;  4LV0 A;  4ETZ A;  4WL9 A;  3WS0 A;  2PD7 A;  4X69 A;  1K56 D;  4IVK A;  1XPB A;  4ZAM A;  4E3M A;  1W8Q A;  1ONG A;  1IEL A;  4Y0T A;  3VOY A;  1TS7 A;  3ISG A;  3JYI A;  2HP5 A;  4Y5F A;  4LLO B;  4S2M A;  1BUE A;  4QHC A;  1TVF A;  2ZC7 A;  4S2P A;  1BT5 A;  1OPX A;  1ZG4 A;  2ZM8 A;  2XA7 M;  3KO6 A;  3SZT A;  3BY9 A;  3OCN A;  1WYC A;  3K3C A;  1CI8 A;  1VET B;  3BLS A;  3ZNT A;  2ZQD A;  5HD3 A;  3HLD A;  4GW9 A;  2W1T B;  1T1B A;  4X25 A;  4WZ4 A;  4G3V A;  1QME A;  5EE8 A;  4MMN A;  3PYP A;  1BSG A;  2J3T C;  4LFU A;  5A92 A;  3BWL A;  4WM9 A;  4DE2 A;  3OPP A;  1LSV A;  1E3U D;  3T1S A;  1YLJ A;  2JN7 A;  4UA7 A;  5DJU A;  3T4L A;  3FPW A;  1OTD A;  1GCE A;  2PR5 A;  3S7N A;  4GJ4 A;  2ZL1 B;  4KZB A;  1EWZ A;  1G5U A;  3DBA A;  3FYZ A;  1Q2P A;  1K6S A;  1VET A;  4K08 A;  2I72 A;  1KE4 A;  5FAQ A;  3MMH A;  4D2O A;  2O9C A;  5G18 A;  4CJN A;  2W1T A;  1ZTU A;  3N8S A;  4JF6 A;  3OC2 A;  4Z1W A;  1MWT A;  4PM8 A;  3VFH A;  3RJU A;  1H5X A;  3IF6 C;  4UA6 A;  3BW6 A;  2E8I A;  3ICY A;  4QB8 A;  4Y15 A;  1LL9 A;  3C7V A;  4E3J A;  3UB9 A;  5CER A;  4BD0 A;  4HIA A;  1K57 C;  4YOF A;  4H6J A;  3WS1 A;  3UE6 A;  2NUP C;  4R4S A;  1RCJ A;  2ZL1 A;  2VV6 A;  4NK3 A;  4AFI A;  4P0M A;  4FH2 A;  1YMS A;  4RX2 A;  2UV0 E;  2L1M A;  4MDZ A;  1RGZ A;  4ARZ B;  1T19 A;  4O01 A;  2Q0O A;  3ZG9 B;  5M19 A;  4O8G A;  3PAE A;  3V5M A;  2Y2I A;  3S1Y A;  1DP9 A;  3OPH A;  1KGF A;  1SKF A;  4EEU A;  1LT0 A;  4Y17 A;  4LV1 A;  5HL6 A;  2ZM2 A;  1K55 C;  3VE4 A;  4S2N C;  1NRJ A;  4HES A;  1FSY A;  2OV5 A;  3BQ8 A;  5AQB A;  3MJQ A;  2ACG A;  3SH7 A;  4EQ1 A;  3Q7V A;  5U47 A;  4ZTK A;  3W4O A;  2PYR A;  1IKI A;  1NYM A;  4R23 A;  1FSW A;  3IXD A;  5FDH A;  3C30 A;  4C3Q A;  3QNC A;  4ARZ A;  5HWT A;  3GEC A;  3P7N A;  1MWS A;  4II7 A;  3DTM A;  2BLS A;  2FH5 A;  2HV1 A;  3UE1 A;  4Q0J A;  3JVU A;  5FQQ A;  2VGJ A;  3K2N A;  5DJT A;  1T1A A;  3G2Z A;  1H8Y A;  1Z6F A;  1U60 A;  3MFX A;  1IYO A;  3MZE A;  3FKW A;  1MPL A;  2BAS A;  5GLA A;  2Y91 A;  1HLU P;  4UEY A;  4KG2 A;  4PKY G;  4WMC D;  3VE3 A;  5CGW A;  4WEK A;  5AVE A;  4U0T A;  1LI9 A;  2R9W A;  2PBY A;  5CTM A;  3O5Y A;  1YMX A;  5IT5 A;  1FQG A;  4DJ3 A;  4FD8 A;  4KZ9 A;  4YNR A;  2P08 A;  4P6Z M;  3MZD A;  1OTA A;  4Q0I A;  3C7U A;  2W1R A;  3CJM A;  2B02 A;  5FI6 A;  3EGD C;  2PD8 A;  3EQV A;  2L4R A;  3MXR A;  3AGD A;  5FEG A;  4BQM A;  3D72 A;  5EPH A;  4IBR A;  2V2F F;  2W3F A;  5IS1 A;  4WBG A;  1S4S A;  3IXG A;  2WAD A;  1HTZ A;  1M6K A;  4UQI M;  2XSS A;  3RXX A;  3FC7 A;  1OJG A;  4NG2 A;  4WZ5 A;  4NKP A;  2XH9 A;  4DN0 A;  3GQZ A;  4DDS A;  1JTG A;  1P9W A;  4I39 A;  1SHV A;  4XT2 A;  1NY0 A;  1K25 A;  3KSI A;  5EVE A;  4OKP A;  3ZG0 A;  1PWC A;  3UE0 A;  2CC1 A;  1TS8 A;  2V0U A;  2ZBB A;  4IJG A;  5F69 A;  4B4X A;  3MBZ A;  1CQA A;  4E6X A;  3LIC A;  2VEA A;  5HDS A;  3HLF A;  1ZC2 A;  2OAQ 1;  3BFE A;  5G4Y A;  4IED A;  4ETX A;  1Y54 A;  3CLO A;  5TJJ A;  4BJP A;  2E8J A;  3KYQ A;  2EX9 A;  3FZC A;  3LUQ A;  5E2G A;  2HDU A;  2Y2M A;  3MXQ A;  5E2E A;  2V8C A;  3UB6 A;  3IBR A;  3F1N B;  5HSQ A;  5J4E A;  2K31 A;  1S0W A;  4EES A;  1YSP A;  4ZJ1 A;  1NZU A;  5KZH A;  2W3G A;  2XD5 A;  3D4F A;  3VP2 A;  5HPI A;  1BZA A;  4MEZ A;  1OT9 A;  4HI4 A;  4IVI A;  3HBR A;  1CK3 A;  2XR0 A;  5AQ9 A;  5TBM B;  1GSV A;  4QPR A;  1IYQ A;  2Y2H A;  2AVX A;  3ULF A;  3MSH A;  4JXS A;  3MQQ A;  3LR3 A;  2ZMA A;  1HD8 A;  2Z6D A;  3F1N A;  4IUH A;  1DP8 A;  5HX9 A;  3R7W B;  1I2S A;  5FI2 A;  4BLM A;  3MZF A;  4U0X A;  4UA9 A;  2ZJ9 A;  4S2O A;  1S67 L;  2O0Y A;  3Q82 A;  4KZ8 A;  3B47 A;  4OQ0 A;  3IS2 B;  4EXO A;  3HL9 A;  5TBM A;  3OOV A;  3RTY A;  1L0G A;  2ZMV A;  1L0D A;  1PZO A;  4Q0H A;  2IWC A;  2A2L A;  1CF0 A;  3EGX C;  1TD5 A;  1NJ4 A;  2W27 A;  1QMF A;  2HGV A;  1DRM A;  1BLS A;  5DKK A;  3BEB A;  5L2F A;  3R7W A;  4OVD A;  3NJA A;  5FQJ A;  3GR2 A;  4EET B;  4OQH A;  3LO7 A;  4Y2F A;  1NXY A;  3TJZ C;  3MFD A;  3MF0 A;  3DW0 A;  1P9R A;  3T4K A;  2EA9 A;  2EFX A;  1ALQ A;  4HP9 A;  4HJ4 A;  4L9F A;  1YLW A;  3IS2 A;  3T4J A;  2QJ5 A;  4E3K A;  5GHX A;  2P04 A;  3GMW A;  3NOP C;  4FSF A;  5E2F A;  3B33 A;  4DF6 A;  2HJ9 C;  1BLC A;  1K54 A;  4DKI A;  2GJ3 A;  2IWB A;  2ZD8 A;  4CPK A;  2QWS A;  4OPR A;  4E3I A;  2PT7 A;  1XGJ A;  4XXR A;  2Y79 A;  4B88 A;  2I9V A;  1KVL A;  2Y2J A;  5EFW A;  4MLL A;  3TE8 A;  4WZ5 C;  3A0V A;  3UPP A;  4Y3I A;  2QJ7 A;  2Q9N A;  3P98 A;  3IH9 A;  4QU3 A;  3FV7 A;  4KZ7 A;  4LRZ E;  4X55 A;  1TEM A;  2W3D A;  4EUZ A;  3OPR A;  4R3B A;  4A5R A;  2OOL A;  3SS3 A;  1SKO B;  3KSH A;  1LHY A;  4WN5 A;  3LFV A;  3NOU C;  2XRN A;  2WAE A;  3EQU A;  3SS5 A;  4KUO A;  1N4O A;  3N7W A;  4M3K A;  1STZ A;  4B93 A;  4KQQ A;  4QY6 A;  3E4O A;  3A0S A;  2ZQ9 A;  5E2H A;  2QYB A;  2OLV A;  3HCY A;  3LEQ A;  3N4I A;  1CEG A;  5EV0 A;  5HWV A;  1S1Z A;  4X6T A;  3FG8 A;  1PI5 A;  4KZ4 A;  2OSU A;  4KZ5 A;  3NEC A;  3WWX A;  4ID4 A;  2HDR A;  1F5M A;  3UE3 A;  2PR6 A;  3V39 A;  5TGF A;  2ZOH A;  5F1F A;  1PI4 A;  2OAP 1;  4BWI A;  3DTE A;  1G6A A;  2H0Y A;  2UWX A;  3ZCZ A;  1SKO A;  5CRF A;  2J3W A;  3HLE A;  1MY8 A;  3GRJ A;  3A3D A;  2XDM A;  4E3N A;  4F94 A;  4G3K A;  3A3I A;  2EX6 A;  3VSK A;  2ZQ7 A;  1G6O A;  3MS6 A;  2GZA A;  4K0X A;  5C5K A;  2W3H A;  3HUO A;  2J3T D;  1BUL A;  4OPQ A;  5CEB A;  2VX8 A;  2V9A A;  4X1L A;  3PTE A;  3QP6 A;  2C5W B;  5F82 A;  5A93 A;  4JGR A;  4PAU A;  1S1Y A;  3G32 A;  3L9K A;  4MN6 A;  4Z9Q A;  2MJ6 A;  4EU0 A;  2W0N A;  5CHM A;  5L07 A;  4EWF A;  1NLY A;  2INW A;  2XD1 A;  3CHW P;  2Y2O A;  1Y28 A;  2R9X A;  5F1G A;  4H6J B;  3QP4 A;  3ZYT A;  4IBX A;  1J9M A;  1PIO A;  1XFN A;  3IWO A;  4N9L A;  3EOI A;  4PKY A;  5DTT A;  3NDE A;  3CIT A;  3NI9 A;  5GHZ A;  2CMN A;  1GHP A;  3QP8 A;  3NDG A;  1L0E A;  3JPU A;  2V20 A;  5FDS A;  5JYO A;  3D9Y A;  3PR6 A;  5HDD A;  3NBL A;  4YWZ A;  3AGE A;  1D06 A;  1D1J A;  4HY8 A;  3C2W A;  4EEP A;  1M40 A;  4UHU A;  4H8R A;  3Q7V B;  4HJ6 A;  3TW8 A;  3PBR A;  1FIK A;  1DY6 A;  4BD1 A;  5D3O A;  1MKM A;  4WUJ A;  2DRW A;  1MZU A;  4CLC B;  3PHY A;  3M2J A;  5DF8 A;  3VP4 A;  1PNE A;  4HHD A;  1K54 C;  2YKF A;  4FUW A;  1K4E A;  3HRE A;  4RVA A;  2Y2P A;  2ZMF A;  4RX3 A; 
#chains in the Genus database with same CATH homology
 1G5U A;  2JKF A;  1F2K A;  3T1Q B;  1VET A;  3T12 B;  3DAV A;  3NUL A;  5FEF A;  4FTX A;  3CHW P;  3UB5 P;  2JKG A;  3T1X A;  5EVE A;  3U4L P;  1AWI A;  1SKO B;  1CQA A;  1VEU B;  1J3W A;  4X1M A;  1Z09 A;  2PAV P;  1HLU P;  1CF0 A;  2BTF P;  1FIL A;  2E8J A;  2ZL1 A;  3CPT A;  3LEQ A;  5EV0 A;  1CJF A;  2V8C A;  5FDS A;  1PFL A;  2VK3 A;  3T1R A;  3D9Y A;  1VET B;  3NEC A;  1A0K A;  1D1J A;  1SZV A;  4X25 A;  2V8F A;  1SKO A;  5FEG A;  1VEU A;  4D60 A;  2PRF A;  3L7H A;  1FIK A;  3LGO A;  1PRQ A;  3MS6 A;  1Y4O A;  2HZ5 A;  3KYE A;  2PBD P;  1YPR A;  3T1S A;  2B95 A;  1PNE A;  5EM1 A;  2ACG A;  4FUW A;  4X1L A;  3MSH A;  1ACF A;  4ESP A;  5EM0 A;  3L9K A;  2ZL1 B;  3CPT B;  1K0K A;  4QWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...