2B9EA

Human nsun5 protein
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
293
structure length
275
Chain Sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human NSUN5 protein in complex with S-adenosyl-L-methionine
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NOL1/NOP2/Sun domain family, member 5 isoform 2
total genus 95
structure length 275
sequence length 293
ec nomenclature
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1170 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sun protein; domain 3 2b9eA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2b9eA02
3G88A 1RI4A 3KQOA 4NECA 5HIKA 4RVGA 4RTSA 1YF3A 3TFWA 4ER6A 3C6MA 3LHDA 4PCLA 3BGVA 3OU2A 4X63A 3FUTA 3NWBA 2PT6A 3B3JA 1G60A 3PFGA 5F2KA 3PFHA 2IBTA 3FPGA 3UJDA 1XXLA 3JWGA 1PRYA 1RI1A 3K0BA 3DXYA 1RJEA 5EMMA 3V8VA 2AVNA 4BLWA 3UBTA 3HCCA 9MHTA 2GH1A 2ZLBA 4ER5A 1X1DA 3GU3A 3KQQA 3EVBA 4C08A 2R6ZA 3THSA 3R24A 4F84A 1QAQA 4KW7A 1VIDA 3HCDA 5F2OA 4AUKA 3O7WA 1XTPA 3KPYA 2AOUA 2IBSA 2PJDA 3FPJA 3PT9A 1WZNA 3BXOA 1RJGA 3EVDA 2O57A 3CJQA 5E2AA 4MIKA 5HFJA 2ADMA 1SVUA 4CXMA 3BGIA 4HGYA 4RVDA 4HG2A 3HA3A 1IM8A 1BKYA 5DSXA 1QAMA 1VBFA 3PLAE 2H00A 1NBIA 4BLVA 3E8SA 5DX0A 2IIPA 4RWZA 1SG9A 5GOZA 3DLCA 5DM0A 5T67A 2C7OA 3THRA 5FA5A 1XJ5A 3SMQA 3SX0A 1QAOA 3UJBA 3KQSA 4DQ0A 3TM5A 4AZSA 3CCFA 5HIJA 5EMKA 2ONZA 3I5UA 3FUUA 1UIRA 1NW3A 3FPEA 3FRHA 1O9GA 2IPXA 3I53A 1D2HA 5EOVA 2ZFUA 2VDVE 2YXLA 3R0QA 4HH4A 3NMUF 3SGLA 4OQEA 5DX1A 3UJ7A 5K0BA 1I1NA 3BGDA 4GOND 4PYQA 1FP2A 1T43A 4R8RA 4YUZA 3Q7EA 5DT2A 5U4XA 3MHTA 2G1PA 5CIYA 2CMHA 1R74A 4CKCA 4Y30A 4AZWA 3IHTA 1AF7A 3M6UA 3MQ2A 4HRAA 3EEYA 4P7GA 4PYIA 1YZ3A 5GP1A 1G8AA 4Z2YA 4A6EA 3ER8A 1VP9A 3R3HA 2ZW9A 4YUWA 5KVAA 4RTRA 4GOMD 1YFJA 5K0JA 1RI5A 3Q87B 4OA8A 5DLYA 3GXOA 1V39A 2YR0A 4CKBA 5LR6A 1B42A 4FZVA 3A27A 4MTLA 3KR1A 5E1DA 2ZTHA 3HCFA 3UJ9A 4E2WA 1TW2A 2G70A 2P7HA 3ELUA 4MQ4A 4WVLA 3NDJA 3ERCA 4CTJA 2HMYB 2IP2A 2AN5A 3CGGA 3KPJA 4DMGA 3TLJA 2PY6A 3BWYA 5FADA 1VP3A 2AOTA 3OFKA 5HIIA 3BWMA 4QTTB 3REOA 4EMSA 2Y1XA 4C03A 4YV1A 5E8JA 1G8SA 1RI3A 5DPMA 2FK7A 3SR4A 5LQNA 4KDRA 3LBYA 3UFBA 1SUIA 1FPQA 1R18A 4IWNA 1SQFA 3G2QA 4YMHA 2H1RA 4MWZA 2UYCA 5EEGA 2PSSA 2JH8A 1RJFA 3B3FA 1EJ6A 5EVJA 2P3LA 4PYKA 4V0QA 5HILA 1BOOA 2JJQA 4KIFA 4EKIA 3I9FA 3TR6A 1BC5A 4POOA 3HCEA 4GOLD 3SXJA 3FTDA 3PB3A 2E5WA 3OFJA 3TQSA 3OE5A 4QQNA 3HM2A 4IV0A 5H02A 3VC2A 5DM4A 2YQZA 3HA5A 3MTIA 5CVVA 1VE3A 1JSZA 1XCJA 1AV6A 3V97A 4PYMA 2JG3A 3GRVA 3BWBA 1KIAA 3NDIA 4JXJA 5EGSA 4G56A 5LQJA 1KXZA 1NT2A 4E2YA 3FUVA 2PWYA 2AS0A 2C7QA 3PTAA 3GRUA 5DM2A 1RJDA 3VSEA 1NW5A 4PCAA 2WK1A 1UFKA 2FPOA 5CVUA 4GC9A 2XBMA 4RTJA 5DM1A 5ICEA 1JTEA 2PX5A 1INLA 2NXJA 2YTZA 3NWEA 4DM3A 4BP3A 3FPHA 3P9NA 3EEOA 3B3GA 2ONYA 3IV6A 4K6MA 2ZSUA 3KKZA 3LPMA 2I62A 4RYLA 5FTWA 3U81A 4GQBA 1NW8A 3LDGA 2OY0A 5EKXA 4AZVA 2BR4A 3NJRA 2F8LA 3MCZA 1QZZA 4PGGA 1MJFA 4XCXA 2C7PA 1Q0TA 1JQEA 3A7DA 5E8RA 4EK9A 4YUYA 3HVJA 3TPZA 5F2NA 1KHHA 2UYQA 2HWKA 4ATNA 1D2GA 1WS6A 2GA9A 3C3PA 4OBWA 4XUEA 4CWAA 3UJ6A 3RODA 1ORIA 4E32A 5LQUA 3T7TA 4B17A 1M6YA 2AR0A 1WXXA 4FP9A 2HTEA 3EVGA 5FCDA 3E23A 3PX3A 4E30A 5HZMA 4Y2HA 3EGIA 3KPVA 4GF5A 5ICFA 2JHCA 5E1MA 2AN3A 3KQVA 1VPTA 4GOOD 2K4MA 3MGGA 4QQKA 2OB2A 4ISCA 4PYNA 2I9KA 3CVOA 5B1SA 2Z6UA 2V7EA 5K03A 3VC1A 5CM2Z 2IDJA 5DTQA 3E05A 3F4KA 3GRZA 3LDUA 3GWZA 3NW9A 5K01A 1DL5A 5K0LA 5JUWA 2XYQA 2OBFA 3KPUA 4XUCA 5CVDA 2QY6A 5T6BA 3KHKA 3SSOA 2HR1A 3FZGA 1KPHA 2QRVB 5LQKA 5FHQA 4X61A 1R00A 4RTMA 2C7RA 3UZUA 1L3IA 1XCLA 2FYTA 3P9KA 5GM2A 2AOUB 3A26A 3G8AA 2PXXA 3TRKA 4OX9Y 4QDJA 5FWDA 5G02A 4RV9A 2UZ4A 3ID6C 2QRVA 3GIWA 3O4FA 4C4AA 4DKJA 1SKMA 3R6TA 5GINE 3LX6A 5JR3A 2IH5A 3FTFA 3EVEA 5KQRA 4P58A 5EHIA 4P7FA 1N2XA 1NKVA 5EEHA 1UWVA 5DX8A 1ZQ9A 2JHPA 2B25A 2ZZMA 1Q0SA 3B89A 4H0NA 1AQIA 2QYOA 1ZG3A 5K0NA 5CCXA 3KQWA 1YFLA 1HNNA 3EVFA 3FUWA 4PYLA 5C1IA 4F85A 2EG5A 4PWYA 3PS9A 1L9KA 4QDKA 2PVCA 1AQJA 4DA4A 3BZBA 3EPPA 5K05A 3OZTA 4BY9E 2NYUA 5DWQA 2ZZKA 4IKPA 2AVDA 2P3OA 3GRRA 2PT9A 3GRYA 2ZVJA 3UWPA 2YXDA 2AOWA 3BUSA 3KQTA 3M6VA 4PGHA 4FGZA 5FA8A 3CC8A 4YV2A 2HNKA 2B78A 3KQYA 4KIGA 3LSTA 2OYRA 5T64A 4RTLA 5DSTA 2EJTA 2WA2A 4KWCA 4R6WA 3ELYA 3I58A 5E2BA 4RTPA 2IGTA 1RI2A 5FWAA 1ZHFA 3LCCA 3P9IA 7MHTA 2NP7A 1WG8A 3FYCA 3HA7A 3EVCA 3IEIA 4HSGA 5DXAA 2Q41A 1G38A 1JTFA 3FYDA 5GWXA 2PGXA 2PXCA 3H2BA 3AJDA 4RVFA 3GDHA 5E9QA 2VZ9A 4RTKA 8MHTA 3GCZA 3FTEA 1P1BA 3CJSA 4EKGA 4QVKA 3RIEA 3OZRA 4AZTA 3DXXA 5BW5A 5EIWA 2BZGA 3LGAA 2JH9A 3L8DA 5FQOA 1JQ3A 4DZRA 4KRGA 2B2CA 4ER0A 1OR8A 4PIMA 3PX2A 4C07A 5HEKA 1JR4A 1NW6A 3R9XB 2PWPA 5K0FA 2UYHA 3KR0A 2G72A 1ZKDA 4P7JA 2P3QA 1SUSA 3ELWA 3T0IA 3DP7A 4DCGA 1X1CA 4GC5A 5EPEA 2OXTA 2O07A 5KS2A 10MHA 5D1HA 2O05A 5FUBA 1L1EA 2NNWB 1DCTA 3BKXA 3ER9A 2OB1A 3UA3A 3X0DA 4F86A 5K0GA 5FQNA 2OO3A 3VYWA 4RTQA 3DMHA 1X1AA 1SQGA 1NE2A 1IXKA 3LKDA 2AZTA 1QANA 2EFJA 2AOXA 4GBED 3EVZA 3JWHA 3C3YA 3I64A 3OZSA 3G2MA 4FR0A 1WXWA 2QE6A 3QOXA 4MHTA 4GUAA 3HP7A 3KPWA 2IH4A 3BWCA 4CTKA 3G7UA 3KQMA 3C6KA 2QM3A 4RX1A 2VDUE 3UJ8A 2B9EA 5EHGA 4RTNA 3LCVB 1O54A 2PX8A 1NV8A 4KVZA 3S68A 4FSDA 4DF3A 3TKYA 1P1CA 5E1OA 3KQPA 3HEMA 5HOQA 1JQDA 2H11A 2BM8A 1EIZA 1ZGJA 2ESRA 1EJ0A 1DUSA 3M6WA 2AOTB 2R3SA 1Y8CA 3LKZA 3CKKA 3AY0A 3PVCA 4HTFA 2YUIA 3HVKA 3M33A 3MERA 1ORHA 2XVMA 3D2LA 5FULA 4UOEA 1PJZA 3LBFA 3G5TA 3LDFA 4BP1A 1VQ1A 3FPFA 4E70A 2EX4A 4M38A 5IKMA 1L3BA 1XDUA 2ZWAA 5EG5A 1YB2A 5D1NA 4E2ZA 1F38A 5EMJA 1KP9A 2YXEA 4A6DA 5BXYA 3TOSA 2ZULA 2XVAA 3CJTA 2GPYA 3JWJA 5LQRA 2NP6A 4C04A 4EVIA 2PLWA 3P9CA 4E2XA 2KW5A 3ME5A 5C9ZA 4M7RA 2CMGA 2YX1A 4O29A 4QPNA 4IV8A 5LSAA 2ZZNA 1I4WA 5K8VA 2VS1A 4R6XA 3NVKI 1Z3CA 5EQJB 1EG2A 3LECA 4V0RA 1JG4A 4BLUA 5ICCA 3MB5A 3EGEA 2OZVA 1YUBA 4P7KA 1G6Q1 2P8JA 4PYOA 5LQCA 2NXEA 3B7PA 5ERGB 3HVHA 3DOUA 2NXNA 4XUDA 1XVAA 2XYRA 3HCBA 3P2EA 3OU7A 2ZBRA 3CBGA 1KYZA 3OE4A 5DTMA 1N7IA 5CD1A 3FRIA 3KR2A 5EC8A 3KU1A 3SM3A 1F3LA 1G55A 5DRTA 1TPYA 3M4XA 3MAGA 3FUXA 2YVLA 3ANXA 2A14A 2PX4A 4R8SA 2P1DA 5GIPE 3G8BA 4L7VA 5DTRA 3LL7A 1L3CA 5E1BA 4ER7A 2GB4A 4OQDA 4X41A 2P41A 5K0CA 5CVJA 1TW3A 2PXAA 4LG1A 1MHTA 2BM9A 2XYVA 3IYLW 3P71T 4ER3A 2CL5A 5KQSA 5KYGA 5GM1A 2O06A 2DULA 4OA5A 3K6RA 2HV9A 3A4TA 3P97A 3G5LA 4RSRA 3T7SA 2Z6AA 3TM4A 4AX8A 2WA1A 3LCUA 3QOWA 5E9WA 4C05A 1VLMA 3GGDA 5GIOE 3OCJA 3SVZA 3HNRA 1NV9A 4LWOA 1R8XA 2FRXA 4DCMA 2ERCA 3DMGA 1X1BA 4HGZA 4EQZA 1U2ZA 3DULA 2EJUA 4LECA 1X19A 3E7PA 4HC4A 4HTFB 1I9GA 3DTNA 1JG1A 4WXHA 1EQAA 5C0OE 4PYJA 4YUXA 2V74B 5EIFA 2O0LA 2DPMA 5ICGA 3C0KA 1P91A 4FS8A 4PONA 5CUQA 2CKDA 3DUWA 2G71A 3DH0A 4E31A 3DR5A 2GS9A 1NW7A 3AXTA 2OPBA 3KR9A 2P7IA 3WSTA 5LQAA 3ELDA 2OKCA 1EAMA 2AOVA 4QTUB 1XDZA 5EMLA 1R8YA 5BW4A 4PNEA 3EGVA 5EZQA 1FJXA 2GAFA 5BP7A 3DXZA 3EMBA 1O9HA 4X60A 2IFTA 3GO4A 4PIPA 4YMGA 1HMYA 2VDWA 4FT2A 1H1DA 5FHRA 2Y1WA 3HVIA 4C06A 4E33A 2BR5A 1KYWA 5HIMA 1BHJA 2PKWA 4CKEA 4RTOA 2ZIGA 3RW9A 1FP1D 3AXSA 2I6GA 3BT7A 3G89A 3G2OA 1KR5A 1ZGAA 3CJRA 3P2IA 3EVAA 3T7RA 1WY7A 2PV0A 2FCAA 2IDKA 3B5IA 4YV0A 3GJYA 2Z6QA 5K09A 5IH3A 2ZIFA 4M36A 1D2CA 3A7EA 2BR3A 2P35A 3BKWA 1XDSA 3NTVA 3P8ZA 1M6EX 1YZHA 4ZTBA 3UJAA 2BH2A 2IH2A 1IY9A 1KPGA 3FTCA 4PINA 2ZCJA 3HCAA 5DRYA 4FT4A 4M37A 3UA4A 3M6XA 3ORHA 3MCTA 5M5BA 2PX2A 5CVEA 5CCBA 2FK8A 3NVMB 3G2PA 1QYRA 3SSNA 3JWIA 3DLIA 2I7CA 5EZSA 4KDCA 1N7JA 3HTXA 4U7TB 2ZIEA 4YUVA 3EMDA 3OU6A 2NXCA 3P2KA 2JHAA 2VP3A 3A25A 2P40A 2PBFA 5P8WA 3UJCA 4GEKA 5E9JA 2ZBQA 1JG3A 3O31A 2ZBPA 2G8NA 5DXJA 4QVGA 1R6AA 3TKAA 1M0EA 1NBHA 5K0EA 2N47A 2CWWA 4OBXA 1VL5A 4RVHA 2FHPA 2B3TA 4QPPA 1P39A 3QV2A 1FBNA 1KPIA 3GNLA 3DMFA 2GLUA 4U7PB 4R05A 3OPNA 4X1OA 5EKUA 1JSXA 4FSXA 3M70A 2ZWVA 3SSMA 2UYOA 2LD4A 5MHTA 3AWIA 3MTEA 4LWPA 1JG2A 2ORED 3TMAA 2AN4A
chains in the Genus database with same CATH superfamily
2GYUA 2O0MA 2EG9A 5ARDA 5IF3A 2QS9A 4N6NA 1R0KA 2F3PA 4DILA 2IELA 1EGAA 4U9RA 3OIYA 1HEYA 1XMQF 1YB5A 2PFDA 4KJXA 4AP6A 4M0EA 3W8EA 2N4CA 4NPAA 1WZNA 3L77A 3A9CA 4B3FX 4EVRA 3TRHA 1F9FA 3UWMA 2XY5A 4WLFA 3ISNC 4HG2A 4UW9A 5BUCA 1H72C 1DEXA 3AL2A 2BFMA 3LC1O 8RUCA 5EFOA 4EMTA 3FCOA 2NQPA 2ZYTX 4MI9A 1GGNA 5JV5A 4ILLA 2EZUA 2WTFA 1KZ9A 3OY7A 4PAWA 5DLPA 2OI2A 2CLEB 3H3FA 1DC4A 1KSJA 4P7GA 1AZSC 4WKBA 3R27A 1BTOA 1UC5B 4OGGA 4X20A 3O8WA 1E2IA 1WMAA 3HCFA 4NZYA 1O0CA 2H51A 2I7TA 4BVGA 4MK4A 3LJKA 3OTQA 4ZI5A 4KXQA 3OL9A 1YRUA 5IC5A 1JLBB 3RJTA 2C8KA 4FFWA 2ZRNA 2YVUA 3HWWA 3DRYA 1BCRA 2PKEA 5T3UA 1E0KA 4I50B 3S4YA 4EPRA 3D43A 4AULA 4H3KB 3PB3A 2X19A 2X9NA 3D7MA 2ZVPX 2JEZA 4WZBA 1G6HA 2KHCA 1A2QA 5LD2B 2DIUA 3VSEA 1O6GA 3PFWO 2VHZA 5ICEA 4QXMA 4UNIA 3QLUA 1CY7A 4PCUA 3FPHA 3HB0A 3KJQB 5KYXB 5A9RA 2OY0A 4OKIA 3GQBA 2YQ4A 5DNYB 4A47A 2YYYA 3UKJA 1GQQA 4M7OA 4ZI3A 5HN0A 2XYPA 3ICCA 5H1SV 1JQBA 1SXJA 1E20A 2A4MA 2XO6A 4Y2MA 2CDRA 1OBHA 1U3FA 1LUAA 4CL8A 5JUWA 4LREA 1JHPA 1T24A 2BI8A 5K9ZA 1NQWA 4PHFA 1KEVA 4FGJA 3DYAB 1QFXA 2AG6A 3WSWA 1KEEA 3RGWS 5COAA 1F20A 5GINE 3H1BA 4I1SA 4OP3A 4CF4A 3NHUA 1ZZGA 3UWTA 1V11B 5JMTA 2H0RA 5M04A 4NLVA 2UZ1B 3AEUA 4R81A 2GUWA 2VC2B 2FZCA 5BVHB 1T29A 1R0WA 1A5SB 2NYUA 4R3NA 3S28A 1U0BB 4FBMA 1OXKB 3CC8A 4RDHA 1W9MA 1AZSA 1XVVA 1UT5A 4PQFA 3W9UA 1M5TA 1I0IA 3KQKA 2ODPA 4QVKA 1UFRA 3LH5A 4KE7A 2J0QD 4PIMA 4M5HA 3KR0A 2E4WA 4LSGA 1WZEA 1IUKA 3I0RA 4IF4A 3VYWA 3MMBA 4LFCJ 3Q8QB 4OFWA 5JXHA 5LDDC 1YWGO 3D3QA 3MUOA 2HF9A 1PGNA 4BJ6A 5KT7A 1EXNA 3HXPA 3JQBA 4MW9A 1LGYA 5E1OA 3ZWAA 2E4YA 1JDBB 1G5TA 2YH2A 4P2GA 4F06A 3G6KA 4FKZA 1KP9A 4UF4A 3OHPA 5HTOA 3QRRA 3LP1B 4R40A 1P1HA 3ZZYA 2NXWA 5C8ZA 2H5JB 1T5DX 3EGEA 5H5JA 3QX7A 5FO1A 4N77A 4L0QA 5ERGB 4MYDA 4AZ3A 3W6OA 4FQ8A 4MRMA 1UVJA 1HR0F 3RAJA 1OWNA 4JLBA 3KTDA 5AQEA 3CNLA 1KC3A 2PAAA 3Q3EA 1KZ1A 3Q3CA 4F92B 4DR5F 5LYJA 4WK2B 2DRIA 3M3PA 4NWBA 3RFXA 1ISIA 1B76A 4HPXB 4BNGA 1USKA 1L4GA 3GLVA 4EWTA 1HFWA 4KQGA 3MBOA 3U60B 2CL7X 5I4MA 3HB9A 1AT1B 3KR9A 2NO5A 3EDQB 4B7XA 2DR8A 5ETJA 1XU4A 4RTOA 5CM8B 2CNWA 3ABQB 1D4OA 3NAHA 1MFZA 1ZX1A 3JASA 4G0NA 3A7EA 3MMNA 3TOVA 4ENOA 2P2LA 1L6IA 1PT6A 4MT1A 1E2UA 3FH0A 2R8GA 3RVNA 1Z73A 5EIBC 5C8XA 4P5DA 3VR3D 2Z5FA 4K8OA 2M32A 4JGBA 2G4LA 4CEJB 3FAKA 5E3QA 3DDWA 1P17A 1N5YA 2IUSA 3ZGOA 2XQVA 3I8XA 3TAPA 2XBUA 1YF3A 3MMAA 2YJGA 4NECA 4I36A 2QIOA 1S1MA 3MD1A 1CJVC 4FFMA 4O1MA 4TTTS 5F2KA 4BFVA 1XXLA 4FQ7A 1PYDA 4KXMA 3NIBA 1M2FA 3GLTA 1MABA 5C35A 3RROA 2AR9A 1XMQB 4LJKA 4C0HA 2PIIA 2BYTA 4G1IA 2A5LA 1NPPA 5GGXA 5IEBA 4KFRA 4LDZA 2LDXA 1FRVA 2WTBA 1J2TA 3VMFA 2R7SA 4WADA 1P7CA 5JSZA 5CD9A 5TY0A 4DARA 1UVKA 2CXXA 1PS9A 3V1YA 4UHFA 3B70A 3H9QA 5K0BA 3IS9B 4Z4CA 5LOVB 2AT1B 4MX8A 4OLHA 3BYRA 4PQYA 1RT2B 4NONA 2DNNA 4PXSA 3GCWA 1MC5A 2XNJA 2ABYA 3LKVA 5BV1A 2ZH2A 4DDMA 2VPPA 1WCIB 3TQTA 3RIGA 2AA3A 3INYA 2IP2A 4CM0A 3DSRA 3R0JA 2E0IA 4EU0A 3HU3A 2Y1XA 4PXEA 3KTAA 3RABA 3AM1A 5B6JA 1JKMA 5DDIP 3EBOA 1PEYA 3H7IA 4II3A 2J3HA 1M2OB 2P3LA 2ET6A 4L4XA 1FFYA 2YN4A 3VC2A 5CVVA 3LFTA 2OD4A 4E4YA 1FP4B 4G25A 3Q8MA 3MTQA 3RYCA 2YBDA 3IA0A 1INLA 4UBMA 3IE1A 1LD3A 1K4KA 1XZMA 1GUBA 1GFWB 3WIUA 4OK3A 1WTCA 4YP9A 4IOKA 2DHEA 3I55S 2NACA 2O7NA 2CDBA 5BSUA 3H83A 1RLMA 3AU8A 1V1MB 4DV4F 1W44A 4JVLA 3HBAA 3T3PB 4EITA 1V4BA 3KOWA 1JZQA 3HJVA 2EDCA 4F4DA 3IL2A 2V0NA 3S2UA 1ZVVA 1JT9A 4WCVA 4TNOA 3SSOA 3GLFA 4Q8EA 1RWXB 3CSDA 1JI3A 2V4JA 4HH1A 4S12A 1A3CA 4WK1A 5IJZA 3AVVA 3HC7A 4O2BF 3KKFA 2Q3JA 1VQ5S 1V16B 1M5SA 4NMXB 2ZGVA 3O1HB 4JCCA 5BT9A 5LMNB 2C0CA 3AF1A 3P3DA 1YCFA 4O8ZA 4Y28C 1DJNA 2AFIB 2XMKA 1IATA 3M30A 4PWZA 1VRWA 1PU2A 5HUJA 4R8UA 1KAGA 3QG5A 3RHSA 1AZLA 3QLVA 2CA9A 2GXSA 2BP7B 3NIFB 4Q4HA 5D6OA 3OJUA 3W5CA 1U7OA 3TAHA 3AG6A 3LGAA 3RB6A 4G3XA 4F21A 1Y3CE 2A3RA 5B37A 3WL4A 1PGZA 4IJUA 4D9HA 5FQNA 1AROP 2HNYB 1QDEA 4OI1A 1L5UA 1QSSA 1Y48E 3HP7A 3G0BA 4YFYA 4MAFA 2DKNA 1YMQA 3LBAA 1DTTB 2BFCB 3QSYB 2M6SA 4P73A 1EJ0A 3TBFA 3PVCA 3IQDB 4OGKA 4GLJA 1YR7A 3ZC3A 2IRUA 4B9AA 1NQUA 4TUYB 2HZ7A 3A1NA 4EF5A 4KIAA 1CDZA 2V2ZA 4O29A 4QBUA 1CIPA 1EG2A 1FPMA 2FLOA 3QT5A 4PLFA 2WKWA 4G0UA 2C5LA 1XVAA 1ZC4A 3IOBA 1XAIA 4MV8A 2ZDHA 3IB3A 4JVOA 1KTIA 2QVCA 5JROA 4DC9A 2IS6A 1H2XA 4MROA 5C51B 4GC7A 4WTOA 2V9WA 3QE0A 1ZMRA 2REQB 1Q6YA 2CNOB 4GSKA 5KKCA 1UEIA 4HFRA 3IJPA 3NOOA 5FLEX 5JAHA 2ZQYA 4Y2KA 3OQVA 1GN8A 2WZQA 2X3FA 2W2NA 1H8HD 2QX8A 4OEHA 5KOXA 2IU4A 2OHOA 4CDGA 4IKOA 2B1QA 2RS8A 1ZAKA 2QVZX 2DETA 4OXKA 5TJ9A 2HFNA 2MSWA 2GAGC 1M6VA 2W9CB 2ZBUA 4MQLA 1YDGA 3PIPQ 1R0SA 1E3WB 3I0NA 4OI2A 1LF5A 1FX1A 2BJ9A 2ACYA 1EX8A 2FFJA 4EP1A 1JKFA 4X6UA 3WO1A 3T1HJ 3KSAC 3CUKA 3VR4A 5LMNF 3VR0A 5DXJA 1X0VA 3VYVA 2Q62A 4CUJA 2F1JA 1HR0J 3IAHA 1HSOA 3DMJB 4ZCPA 2HJVA 3P9SA 4HFNA 2WCXA 1MDFA 3MMJA 5IVKA 4KGDA 4HO1X 2F3JA 2Y1LB 4NMXA 3OJOA 1SC9A 2P6UA 3JQQA 4AMBA 1FFSB 4ND3A 2F8MA 1Y33E 2B1GA 4RJTA 4KQJA 3WC4A 5TVGA 2EWMA 3ROQA 2CLKB 4BLGA 3O38A 4MQFA 4MSUA 3GIDA 3MM6A 2C82A 1PX2A 4F3CA 1RYYA 3RUFA 1N77A 1HF3A 4NBVA 1OHHD 1BMFD 4NBLA 4PPNA 4PZAA 2WE7A 3MTAA 1VFNA 4C0SA 1NHWA 5DU2A 2WVFA 3AEKA 2RHJA 2IU3A 3MHTA 1R89A 1C9MA 3Q7RA 4UOCA 5F9FA 1JBEA 5J2UA 1LV7A 5K14A 1OIXA 2FV8A 5KU1A 4DMGA 2J30A 2AX0A 3K9HA 5GJWC 3S44A 1H6CA 2VD3A 2YMQA 3W8RA 4J3JA 5FPSA 3IBFB 2DXDA 2V98A 3H6KA 2JASA 3AUTA 4MTCA 3M1IA 1LWCB 1FD8A 4Z0TA 1C3EA 4E5YA 4LSZA 1V9LA 1NJYA 3K05A 5ARBA 4DSUA 1C1YA 1G19A 1NW9B 4Q15A 4F9GA 2HBZA 1ZU4A 4UM8B 4WLVA 1AO0A 2AYXA 1DO0A 3ND5A 2RB5A 3FPLA 5BYJA 2HU7A 4X2BA 5EKDA 2BFFB 4MPTA 4P2BA 3NWEA 4WY8A 2P79A 4LOLA 2CKMA 3BSOA 1YE8A 1A9TA 4RF4A 5BO5A 3NJRA 5FD8A 2PNJA 4LF6J 1GKLA 5K3OA 4ANCA 3IOEA 3NHKA 4LFCB 5JADA 4ZZ2A 1BX1A 1SZPA 3UQYS 2OVBA 3A2NA 5CG2A 2XGSA 1XP8A 3BPSA 3UG6A 2O2IA 1C4WA 3N39C 4YCBA 4YECA 3F4KA 3LDUA 4QEKA 1A0OB 1TUGB 1XMOF 3E9CA 2WHPB 1LVUA 1NFQA 1RE0A 3NQ41 4YP7A 3STTA 3GEGA 3EDRA 3SJBA 4DRZA 1JB0C 2HSEB 1MABB 3UKDA 1RWXA 1N32F 5J4YA 5JSUA 1OJ7A 4GLFA 3U44B 4KHPB 1CRLA 5KWEA 1NKCA 5EHIA 3LCRA 5AW2A 4BVFA 2ZJRQ 3B5EA 1NJIT 4YJ3B 3L1UA 3U9SA 5KSYA 1Z4QA 1YCHA 2BFDB 2BSQA 2MJNA 1JLAA 2E29A 4RZIA 4D6PA 1TTPB 2RBEA 2VJUA 2WA2A 4JI3B 2X4DA 3A6HA 2Z83A 3NX4A 1JEJA 2VBIA 2HD4A 4BCAA 2OHDA 2AW5A 1IWOA 5DCUA 2ZUSA 1W85A 4C29A 3T1QA 3DOCA 3A1CA 1F12A 2JFOA 3IXLA 5K6AC 1PT5A 1P1RA 1KLNA 2O3JA 3QUQA 1SHKA 1OA1A 4ODIA 1B93A 3IR7B 4PGFA 1YVPA 1OKKA 3L0IB 5ERXA 3VALA 1CFJA 3NM5A 1ZP6A 5AE2A 4I1VA 3ZZ1A 4XSHA 1MROB 1T9UA 4MJ3A 2ZYHA 3DZGA 3KSMA 3JWJA 1JYFA 3BRWA 2FP4B 3GVCA 2DAPA 1CEYA 4M0PA 1SUPA 5GMKa 3AHFA 4RVNA 3PW0A 4CLOB 5LXYA 1J2VA 1PUXA 5SUHA 1S6OA 1QBGA 4JIGA 2E9RX 2D2IA 3M5WA 3OLCX 4Q6WA 4P3KA 1JECA 4F2DA 2WBMA 1Q7GA 4LZJA 1JB9A 1CS0A 2JJ2D 2C3OA 1N5VA 2REBA 4H16A 1EE2A 4C5CA 2VIIA 1Z4PX 3DLBA 5JCXA 1OXXK 7ADHA 3L1VA 3RT7A 1QF7A 1ACMA 4PX2A 2XRYA 4Y6GB 2VAXA 4ZOEA 2PXHA 3EZOA 4ZKDA 1U6ZA 3OVMA 2VHVA 2E2WA 4EUVA 1FZQA 4TWZA 2H7VA 4H1TA 5JMNA 1PR1A 4NG5A 5SZTA 2WWWA 3PCRB 5ADUS 3L9ZA 3HJHA 3O8LA 2AG0A 3O2NA 2GKGA 1CULA 3UO8B 3GMTA 3KHUA 1NBHA 1IR0A 3AA8A 3OTWA 3WLNA 1P39A 4AF8A 3IGVA 3OP4A 3I9MA 3HCPA 2QLJB 2XF8A 3IUEA 4GOKA 3B3JA 1WXDA 2C0QA 5FV4A 1RPJA 1T9GR 3ZDZB 2PUGA 2ZJ6A 4HLUA 3QVKA 1QFZA 4HNAA 2HHTA 1GUDA 3FPJA 1Q0NA 2E82A 3PT9A 2ADCA 4PGMA 4X1YB 5EYPA 4TPKA 3JXEA 4KGZB 2IOHA 1NBIA 2Q9CA 2HUNA 3DLCA 3SFZA 2HYIC 1L7QA 3SHVA 1YJTA 4Z3OA 4XEUA 3VAIA 3PFCA 2ONZA 3I5UA 2IXAA 3Q8PB 3KG4A 2W9BB 4FBLA 3EGZA 4IM7A 2Z5GA 3LP1A 1YGPA 3MM5B 3AF3A 4C48A 3BTVA 5ER6A 4E2WA 1N4LA 4D9JA 5HZGA 3IBCB 3P9XA 4MUFA 4NCHA 5KWVA 2CPEA 5FJ4A 3EUFA 4A03A 1EFVB 1RTJA 3FJOA 4HNTA 3TRDA 3OIFA 4KSEB 5IVDA 3L05A 3GA5A 4Y0FA 1PR3A 3W4IA 1UT6A 4O2RA 3QIAA 3L3CA 4DM7A 2QD5A 4W90B 4B84A 2DH7A 4KLAA 3W5BA 3E7XA 3F5MA 4R1LA 2A1TR 4TLRA 5CT5A 1EHWA 2IVYA 4OQPA 4N0PA 5CVUA 4YROA 3K6SB 4DMFA 1JTEA 3A28A 1WSWA 4QL3A 1T34A 5AXCA 4AX4A 4FKMA 2M0GB 2ZXUA 5IDYA 3HSSA 1VL0A 3HVJA 1AGPA 2ZRDA 1W8DA 1QMGA 3RRBA 3QVMA 4ATNA 4ZVTA 4NARA 2OHHA 3TE6A 2WUDA 3KPVA 3RYFA 1I5EA 1KRPA 1W2IA 4GL4A 3WISA 4ECZA 2YY6A 3I2JA 3U44A 1HL7A 1DBPA 4F9TA 1P2VA 3I5BA 1ZN2A 2AJFE 2MMYA 5HBMB 2Z8YA 4RORA 1H2VZ 3R0XA 1CP3A 1HD0A 3PL5A 4ZO7A 4EGJA 3LWDA 3N2YA 3LUDA 2DK2A 1ZGGA 4D56A 3P5BA 2F8EX 1SXJB 5HK9A 3I9V1 2EG5A 3FYSA 4QDKA 121PA 1YIOA 2I4RA 3AFGA 2G2ZA 3W65A 2R8BA 4OFXA 1PVDA 1GNLA 5SY4A 5FI5A 1WHSB 4FK8A 2V7GA 4YH1A 3BSNA 3ZEAA 2WRZA 1W1WA 3GJQB 1Z0UA 3T3OA 4M9ZA 2ZPUA 4P8RA 4EAAA 3FTEA 1MWYA 1GILA 2C29D 4AURA 2VNIA 5JSHA 2WSEC 1JQ3A 4IMPA 4AKHA 1X7HA 3VRHA 5I7SA 4W7HA 1XAGA 4EIWA 2GZDA 2ECPA 2DBYA 1TLTA 5AO9A 3BYPA 3JAKB 3QOXA 2MSLA 3TZZA 4BCBA 3IP8A 2AI1A 2B9EA 2PSEA 1LJLA 3VR4H 1IEQA 1X5TA 2B94A 4NV1A 3TCNA 4IEIA 5COQA 3AJ1A 1OMOA 5FOUA 5JAUA 2H51B 2G88A 4U3JB 3TQRA 2HK7A 1GMWD 2YIJA 4RCVA 1XROA 3IG1B 2XJ9A 4JQOA 5J2UB 3KYDB 4M54A 3U0BA 4GO1A 3ME5A 3UMCA 1FDAA 4I4TB 1TYEB 4CM1A 1FE0A 4OGWA 1ESDA 1W25A 2DGVA 3RUBL 1QTRA 3GA7A 4D45A 3ZQKA 4YJ2B 1Z33A 2G0NA 4QBKA 3ANXA 2HQIA 3ZHUA 4DEZA 4DCOA 2GXAA 2I29A 1EIWA 2IJNA 5HUQA 1QVWA 2ANBA 5EZYA 5JATA 1VCIA 1FFSA 2GSDA 4PEOA 1FRXA 3LK6A 4XJXA 4GNKA 1L7RA 5M7EA 2Y1DA 4IJVA 2Q1YA 3NYWA 1NO8A 2OBMA 5GZ1A 3IXMA 1E3IA 3NBFA 4TRJA 2PUDA 3P8ZA 3QNUA 2OMKA 4PINA 3CE8A 4HZIA 1NBEB 3GP9A 2IODA 4DN9A 3LDHA 2QLBB 4F4XA 1BXGB 5IJ9B 1U8XX 2VATA 1L5SA 1MKYA 3T0GA 3A25A 4MWEA 2ZBQA 5CTJA 3CRNA 1D9DA 2AIRB 4NYJR 2C9MA 3GWGA 4OJNA 2XT9A 3EYWA 1LPNA 3EXEB 1TT5B 1EGQA 5HIKA 1NXPA 4FYVA 1JHAA 3HJBA 2EVWX 2VA3A 2A4KA 3GFRA 1V6HA 1BQNA 4ED5A 3AZPA 2O50A 4BO3A 1JXMA 1AF4A 3OL7A 5ALDA 4B81A 2I3BA 4M9XA 5GADI 2ECFA 1KSFX 3PW5A 2H9IA 1Y9EA 2R5WA 1RXUA 1RYSA 5JFTA 2PKYX 5K4GA 3DZBA 4F7VA 4CG3A 4IFIA 1SVIA 4KN8A 3F7MA 1U0FA 1C9YA 2ES4A 2Q6IA 3K70C 2DLDA 1QHFA 4LJ5A 3ONNA 2VPYA 1XE3A 4CJXA 3WG9A 1R0BA 1U28C 3BT7A 2X23A 3I6YA 1VMKA 1KSHA 4KXYA 4MVJH 4FTWA 3BGSA 1F0NA 3A31A 3SX2A 2V3VA 1USWA 4BNIA 2FEWB 4MMOA 1DAGA 3CMCO 2XHZA 2QG6A 3DJYA 3R7SA 4OU5A 3BJRA 3KQLA 4OOEA 3WHIA 2X9GA 2WK4A 1HI1A 2JEGA 5JYDA 3K5NA 2QUIA 4O02B 3I6MA 1RLJA 2OHIA 4CLUA 5FPHA 3GLGE 4DUPA 5AJHA 3TOZA 2AHOA 1IONA 4KR2A 1Q92A 3IP9A 4R0MA 1P4JA 3OZDA 3IBCA 3L40A 1UWCA 4Y8VA 2RKOA 1EKRA 1UPPA 5DYGA 3IXQA 3S29A 3I42A 4XSVA 4W9NC 4I7FA 1GXSA 1FNBA 3JQAD 2JEYA 1P2DA 3WMRA 1G21B 2XYHB 2BXJA 1X4CA 4M4SA 4BQSA 4JV1A 4OLOA 1BCSA 3LV8A 2HA4A 4MUBA 4JI8B 3OUZA 4H4MB 3KDAA 2I7VA 2O7SA 5DZSA 4FEAA 2UVPA 3VKUA 4MTPA 3CPHA 5FHQA 1ZBDA 3RDPA 1FT8A 4YCCA 3S2GA 3MHYA 3AI2A 1NBAA 5AKEA 4X7RA 1XZBA 1JAIA 1RCUA 4W6QA 3R3SA 4B74A 1RBLA 1E6WA 1P29A 2GDJA 2Z04A 4XIGS 1RZVA 4NYIR 3ETMA 1YR8A 4RE6A 4FGZA 3T9ZA 4G37A 3D7LA 5A4IS 3LY9A 1ESCA 4OSOA 4ZGGA 1P0CA 1ZA1A 2EIHA 3RZAA 3ORSA 3A8KA 4RA9B 1F5NA 4OG2A 3GK3A 2CYBA 1FFGA 1R8CA 3ONVA 2RB7A 1UMDA 2FN3A 3AY3A 1WPQA 1YR3A 1GZ7A 1WL8A 2AI2A 4DCGA 2J8ZA 4B3CA 4CLZA 4D9GA 1ZYUA 3KYJB 4HAVA 5JZBA 4RNCA 3KQMA 3UJ8A 5FBLB 3SIPB 3VPFA 4CETA 4FSDA 4YJ3F 4UAVA 1R4NB 2AYMA 4BO7A 5JAIA 1RE1B 4FFLA 2I66A 2VI5A 4JL5A 3CW8X 4B7AA 2XWJI 2NU6B 2A9VA 3KUKA 3DI6A 5LQRA 4WXYB 1CJUB 3L8EA 4HQ0A 2AT1A 1VL6A 5EQJB 2VDIA 2UU9F 3WR5A 1HDGO 3KG2A 2BE7D 4R9VA 1VJTA 1H7XA 2D00A 3FRIA 3KR2A 3EGOA 4YRMA 2O1SA 4KHMA 2W4QA 1T1JA 1MNEA 4HWRA 1LNQA 2Q9AA 1FRZA 4U6QA 4WT7A 2CXSA 1ULRA 3KUHA 4V39A 2HRUA 5JNWA 2MR5A 1S9HA 2J5XA 2LNDA 4DY6A 1H6DA 4RJIA 5E6RB 1PX0A 5G1OA 3VFDA 3FZBA 2WNSA 2KL8A 3F8TA 5KQLA 2I2YA 3MZ0A 2EFQA 4CCYA 3GB9A 4C7XA 4WY2A 5EMLA 4ND5A 2O2HA 3PW4A 4H77A 3ZWVA 5FHRA 5ADHA 4AD8A 1RAOA 1NOJA 3NEPX 1TL7A 4YY3J 5LP6A 1O89A 1ZBQA 2BRKA 3U56A 1T8WA 3AR5A 2VJLA 5LPNA 1FRKA 1Y3BE 3QLHB 4NBUA 4DV6B 1Y5NB 2QG9B 1UWLA 3CCRS 2Z8QA 1N2JA 4OIXA 1SUCA 3BQ9A 3TJZA 2PMZD 4BE9A 2QPLA 2PD1A 5JC8A 4A0FA 2WAAA 4RWWA 3TEHB 4X9XA 2G5CA 2BEVB 2QYTA 1ZRMA 3KQOA 4Z7OB 2BACA 3BGVA 2HJGA 2OILA 1WBBA 1V5IA 3U3DA 4H4CA 1S6UA 1NF8A 1NA5A 2AH5A 2HLPA 3HHKA 1GNVA 4QEZA 4J1QA 4FHDA 3PDWA 2I76A 3MM8B 1E1QA 2E7WA 3IELA 2JA2A 4LBPA 4B3JA 4RKYA 5HX7A 4MMYB 5BNIA 2B37A 3QX8A 3NASA 3ZZRA 3HYCA 3W64A 2JJ1D 1OHHA 5HHTA 2IH2A 4RA6A 1N88A 1SWWA 4PFSA 1Z6QA 4MINA 1S8FA 1YOVA 2HRDA 2VOPA 4S1PA 1PDWA 4Z86A 4LBVA 1ZMOA 4WFXA 1S72S 1RC8A 2ID4A 1YU9A 4WFQA 2KJQA 1T36B 5EE1A 2WHOA 1P9QC 2Y1GA 2AJ1A 4B9NA 2Z08A 2YNFB 5BSRA 4O1IA 1DBWA 3C1TA 5C8YB 3VSBA 3KQHA 1O58A 1QF9A 1PJLA 1VQOS 5HF6A 4IDNA 1Y3JA 4JXJA 4P53A 1VGQA 3IWXA 2VJQA 3NP7A 4O3FA 2VF8A 1OQ3A 3E3MA 1FA9A 1KVUA 2W9XA 3PSHA 2ORVA 3TUIC 3P9NA 4OYRA 4TS3A 3SHFA 2VNAA 4WZAB 1C29B 4L5BA 4INAA 2X8LA 3VVBA 1QHHA 2IYSA 4AQYF 1UEXC 2P2CA 4EK2A 4IZHA 3TTTA 2FX2A 1E79A 3QLUC 3R3XA 4PS1A 2H54A 2XY7A 5JRZA 2YWDA 2E85A 1D9ZA 1YB7A 3E5NA 3C2PA 3MEDA 1YI0A 3RYTC 3C7AA 3C7DB 1SH7A 1F8UA 3KG0A 3RBVA 4BE7B 1MIOB 3DYAA 3I3OA 3WBZA 3ID6C 2VQ6A 4EYOA 3HUTA 3R6WA 4D82A 1PQPA 2AJ2A 2RBKA 3BCHA 2B25A 1QUFA 2A30A 3KALA 5DE3A 1KFCB 3H2KA 1L5QA 1JQLB 1L7AA 3DEAA 4ND2A 5AHRA 4EKDA 1CY1A 4NFLA 1H22A 4NK4A 3CCUS 2WWVD 4JI6B 3OMWA 4I1OA 2FHOB 5C2CA 3EGWB 4C97A 1YVDA 3V1LA 4KXFB 2EX1A 3ZH9B 3OEED 3GDFA 1B6SA 2XSZD 4OYYA 3OZSA 3OZEA 2GVDC 4TTJA 2W4PA 4WKOA 1Z82A 1WXGA 1C1DA 4G1BA 4F1WA 1XZNA 4MKBA 2X0IA 1RU1A 1C2PA 2YV1A 2XVMA 3VZIA 4I19A 2H1LA 1X1TA 3VDQA 2LBPA 1DIHA 5LBIA 5ALVA 3MJTA 3LAKA 1ZD8A 3H86A 3RUDA 4YVFA 3K71B 2WJ4A 1ZLYA 3MJ4A 4FF3A 4R6XA 1DJLA 1OV4A 1MB4A 3W78A 4LJAA 1MQSA 1RUSA 2XB2D 1HMPA 1XT6A 4J0KA 2OTJS 3IHWA 4CIVA 1P4HA 2DBVO 1H0SA 3HY4A 1M5RA 2XOXA 1Z2DA 1UWBB 4KLCA 5LNK1 3UVJB 1R16A 3BZQA 3I04A 1Z17A 5KFAA 1SWVA 1Q0HA 3BH7B 3SZUA 3AB2B 2W8ZA 4AJHA 2C84A 2BOPA 4RPJA 3UHAA 4WXHA 2QMOA 1XQ1A 3SXUB 2B7CB 5EJ5A 5B64A 4U7CA 1KYYA 1OLXA 4RLFA 4ZQFA 4GC6A 4NDNE 2B99A 4YB7A 2K6GA 5EVCA 1UZDA 2LLZA 1JMYA 4PAGA 1Q3TA 4RPKA 4FXDA 4Q9AA 2I4MA 3DZHA 4FSHA 2WU1A 4DA0A 1NJ2A 1R8PA 4TV9A 4R9SA 3TBHA 2PH3A 5EPUA 1YDFA 3DOOA 2ZJYA 3O92A 2I1RA 1OOEA 1EDZA 2Q43A 5COBA 2HMVA 3RRGA 4K6GA 3L0SA 4IH6A 1VG9B 4ECVA 4EYSA 2C7BA 1J8DA 5JAQA 3KK1A 5GV8A 4LCJA 2FVSA 3SSMA 3H4VA 3JALB 4U6NA 3TMAA 3G88A 3THXB 5KFCA 3JQ9A 2DTDA 2ASLA 2KTQA 1JEAA 3BBPA 1M73E 1TUBA 4OYOA 4RF5A 1E63A 1D2MA 3T1AA 5TC4A 2WU8A 1M6WA 1V4NA 4Q3DA 1SIWB 4G5FA 4DV2J 3SLRA 4I4IA 3FDFA 1G8FA 2JIZD 4X1IA 2BF4A 4NZNA 3GYNA 3GLFB 5A76A 1S8NA 2QT1A 3L7IA 2HREA 4Z0HO 4P4GA 4WOPA 3S70A 3H4BA 2IEIA 1BKYA 2XUAA 1FHTA 2C7OA 4D8WA 1S9DA 1HBNA 1KMCA 4PRFA 4N01A 1D2HA 2Z56A 1RP1A 5JZ9A 3IBGA 5E4YA 3G6VA 5FIUA 1U1NA 5A4AA 2C2YA 4P5PA 2JZNA 2QXTA 4OJKA 2E3JA 2HIQA 5KFHA 5F41A 1KGDA 2FJ0A 4NLPA 2HLDD 4GI7A 5CBPB 4FB4A 3BFVA 4WNIA 4ZEVA 1LRKA 1BE0A 2FJWA 1QS0B 2Z3ZA 1SBRA 3TLJA 4FBGA 1QR2A 5IF9A 3H87A 4M5NA 4AMGA 2OKQA 4OYMA 2MEWA 1Z5WA 4UEWA 2BTEA 5ETSA 2ACKA 3FOAA 4X64F 1JF8A 4C1BA 1SIZA 3VNQA 2WJ3A 5EVJA 1M2GA 3K20A 3HCWA 3PHGA 5BURA 1VCMA 1QGUB 4GNRA 2JCVA 3HRHA 1E5QA 2XQIA 1NAIA 4RHXA 1NT2A 1VQ9S 3FUVA 4BUZA 2Q3PA 2WIGA 4FZJA 4XJSA 3NHWA 4PSKA 1WM1A 2XNRA 4QGSA 2ONYA 3EHDA 4Q05A 4DKXA 1HX7A 2VXCA 3CSUA 2KFYA 4NTZA 1C9JA 3SV4A 2M52A 4PX3A 1ZK1A 3C3PA 3NP5A 1YB4A 5L6LB 4GPEA 1WG1A 3NBYC 1KOGA 5DSZA 5AM0A 4NBRA 2V7EA 4UM9D 4ALJA 4OD0A 4P75A 1ETUA 1O77A 5EJ2A 4N9QA 3P9KA 4GDMA 4QD3A 4BOYA 3AB4B 2QXUA 2OXIA 2CMKA 4A8TA 5C1DA 2JRCA 3WL7A 3HDJA 4N7JA 3ZU4A 3W1YC 1N2XA 2JIPA 2V7XA 3AA9A 3EFEA 1G8MA 2VBGA 3OTIA 4I1IA 2WUEA 3P9ZA 2QE7A 5IS2A 1NU4A 2OCLA 3G2JA 1G0NA 3UWPA 5J4VA 1JL3A 3X1WA 3USES 1VRVA 1R5OA 5JXWA 1ZHFA 1KE1A 3HHLA 5C32A 1S9EB 1JTFA 2XS2A 3TLCA 3JZFA 3JQ6A 2MHCA 3O8OB 4HDMA 3ZIDA 2RQMA 2WIBA 3A6GA 3V5NA 2G17A 2WONB 1JZSA 5IN5A 3EY4A 3ONQA 4EJ6A 2CFSA 4D8XA 1VE5A 4TVOA 5BN5A 1ZSNA 2PA3A 1PKXA 2DUMA 4KRWA 3CCMS 4ED6A 4GKVA 2JD2A 2I4IA 3LIPA 4AFFA 3QTTA 4PQAA 1TYAE 4DLVA 5AVQA 1CG6A 2B5JB 1LY1A 3UV7A 1S2NA 4L3NA 3FPFA 2QBYB 3R6GB 2WIKA 3OTBA 2AMYA 1ITPA 3OX1A 5JISA 3ZDEA 3KL4A 2Q6LA 1YC5A 1YQDA 3TXYA 4ENPA 1H2WA 2ECOA 4LVNP 3HHLC 3FUXA 4CLXA 4C6TB 1B0PA 3KCQA 3VJRA 2JAUA 3EUEA 3FNBA 1L5RA 1MHTA 5KQSA 1E1RD 4IIJB 2CXUA 3UK1A 2IVMA 2RU9A 1EGVB 3LXRA 4TKZA 5FYDA 4DYHA 2CF6A 2VCYA 3ICVA 3N6VA 3DPIA 2C88A 2NVUA 1OY1A 1XR7A 3VAFA 4F4WA 2AV5A 1Q82T 4CF6A 4PNEA 5IT9A 4UU0A 2X5JO 2GAFA 3IO5A 5T8KA 1C1XB 1Y81A 1ZIPA 1ISSA 4ZMRA 3GWCA 3WRWA 3O3LA 4C4OA 3EZ6A 1XRSB 1TQ4A 4B87A 2ZJ3A 3COYA 3EDCA 1LQ9A 4BZQA 5KTNA 2RAQA 4ZI7B 4UZBA 2WKSA 3HHDA 3TEFA 4V19X 4ZDWA 1XMJA 3MT0A 1RAIB 5EWMB 5M29A 2ZWIA 3F3YA 3ZHZA 1XUOA 1YDEA 2ZWOA 2XMDA 3CONA 3OQBA 1OS5A 2OEMA 3DOIA 2WVHA 2NAPA 4B43A 4EFKA 1E7SA 1K5DA 3HKEB 4DPLA 2GJKA 2UUAF 3ROGA 2GK3A 1C4KA 1JLQB 1LSJA 3IRUA 4KE5A 4YB6A 4OK6A 3R9IA 3U02A 1ONOA 4JI5J 1AY0A 2E9SA 4DOMA 4FGLA 4RW4B 1DBDA 2NO9A 1CC7A 2V45A 2XE6A 3PLAE 4HR7A 3U4DA 3KJNA 3OZCA 3SQOP 1Q8LA 3CVUA 5I4KA 1NRIA 2WOMA 3VNUA 1FKPA 1H42A 3WICA 4M1QA 5GP1A 3N05A 3K0HA 5IUKC 5C7YA 5EX0A 3IWNC 2YR0A 4B4WA 3KK2B 1CUEA 1R5NA 2XXAB 1ZR4A 1BH2A 1FVXA 2J59A 3PVZA 1GZHB 5K9FA 3WMXA 2NQ2C 3M1VA 4EMSA 2GD2A 5IQ6A 3HSJA 1SUIA 5DYNA 5D3ZA 1WO8A 3A13A 2UYCA 3AK4A 4PBRA 5LJ3Y 1I4EB 2QTBA 2XCLA 2QMYA 3PGJA 3HM2A 3BMOA 1UFVA 3JQFA 3WE7A 3OF3A 1RYNA 2ASEA 4V0SA 5EGSA 2EZ8A 2OG2A 2PWYA 1NW5A 3WZ2A 3FEXB 5AVWA 1EGHA 1YL7A 2HPZA 2GILA 4KITB 4AJOA 1C3LA 2FG6C 3UHJA 3K35A 3J81A 3KJIA 4AP5A 2PG3A 1H93A 4MYRA 4M87A 2AEJA 4E30A 4UOHA 4B3RF 3K9GA 2WSBA 2TMDA 1RU3A 4X7MA 2A1IA 2R9VA 3HDTA 3WQPA 4GYJA 4YEAA 2C57A 1BQ4A 1JJBA 4O4JA 1F2UB 4S2EA 2QRVA 2BFEA 2NU7A 3FTFA 4WJBA 3ADOA 1KVSA 3PXCX 2Q29A 3NBXX 1XNGA 3EPLA 1E77A 1KZGB 2CD9A 1L7OA 2Q3LA 4MS4B 3OUUA 4QYWA 2DB3A 4OX9B 5DWQA 4HNSA 3PO4A 5L4NA 3LSTA 3TXXA 4PYAA 4G1FA 3GUVA 1PSDA 4Q16A 2JA1A 3HA7A 5KG7A 4CLWA 1N0HA 1P2BA 4UHBA 4CP5A 3COPA 1TQHA 1WP4A 1T4MA 2OH2A 1E1DA 1NM5C 2J4FA 1E3WA 5DJ5A 2V94A 2BRUA 2UYHA 4QWEA 1E1KA 3KLVA 4WBSA 2ZIWB 1Z7BA 1X1AA 2XB8A 2M8HA 1HTWA 1WPXA 3QGGA 1MIHA 1LW7A 3T6JA 2H7XA 5AOBA 3K58A 5DYWA 3BGOP 2QSWA 4L76A 3NDPA 5FX2A 4RYDA 4IGKA 1L1FA 2KLBA 1LQTA 3BH7A 3IUYA 2BV3A 1PW7A 3DP9A 1TECE 3JYTB 4QPNA 3M8KA 1PJ7A 4F4YA 1H0HA 4NMMA 4JLJA 4P4SA 3UD5A 1RZMA 2PI4A 5LJLA 1K2VN 4U2CA 4BFYA 3RG6A 3GV7B 2J3KA 3D7SA 4U00A 1EFPB 1UKEA 3QLVC 4DLZA 1X1SA 3HU5A 5MF6A 1K8AT 1SULA 1DNPA 3FNFA 4PXAA 2DCLA 1YE5A 4QGBA 5HSPA 3N6LA 4DMKA 4HAUA 2P68A 5FO0A 2ZJAA 1W29A 4USKA 1NMZA 3K0FA 5PNTA 1JG1A 3KLOA 3G5UA 1RXWA 5KFPA 4OGLA 5K0SA 2VF2A 4W9MC 3D8UA 3RSGA 1C0UA 2C2KA 3OOJA 4MP3A 5DDRC 4F4UA 1LPOA 3KUUA 1RBZA 5L1JA 2Q1UA 4G9GA 2ZSJA 4S1VA 3CG4A 4YMEA 3H1TA 4CKEA 2WVAA 2DH9A 2K1RB 4J9SA 4OB8A 3TAXA 1UANA 3O95A 1YZHA 1WPGA 2HCRA 4GZ6A 1WIWA 1RXCA 1YWXA 4QBTA 4HPJB 2JAOA 2ZIEA 1BU8A 4RKUC 2P40A 4D99A 3MRSA 4A2WA 4R8UB 1FLVA 2V2KA 3ZR4B 4OZ3A 3B1FA 3RHTA 2IXFA 2PMWB 4NYIQ 3I9KA 2LD4A 3ZWQA 2B4RO 3IV9A 1JLGB 2QSYA 3QHAA 4E7PA 3C1OA 2CWDA 4HDCA 1XDWA 2J9RA 2H85A 3FPGA 2M88A 3V8VA 2V1UA 4C9BA 2NXUA 4B9MA 4HVTA 3T34A 2IEBA 4QYTA 1HBUB 4I4CA 1ZS9A 1M5OC 1Q84A 1JH9A 4WK3A 4RZ2A 2DBBA 2EZTA 5FPPA 3AI1A 1TO1E 3BX1A 4HQ6A 2HNBA 5KMGA 4QYIA 2AJ4A 4RD3A 2C5AA 3A8JA 3MJEA 4KU4A 4GBGA 2ALJA 4S0XA 4PZVA 3JVVA 3M2RA 2YFHA 4WZAA 1RQPA 3AETA 2F3UA 1CUXA 3GMIA 1UBCA 2NYRA 4GX1A 1H1TA 4N9WA 1FSSA 3SLKA 4NLLA 4LNUB 5HCNA 1M34B 2QW1A 2JI8A 2H4YB 1U8YA 2JFZA 2FJVA 3BXEA 4ARAA 1WVMA 4JGIA 5KOHB 3FMPB 3IBSA 3TA1A 3D6MA 1Z08A 4BEJA 2NCKL 7FDRA 2VJAA 1T3OA 3INGA 3L7AA 2JEOA 2HNYA 4XTTA 1GG8A 2IDEA 5ALJA 3D5QA 4P92A 1JIQA 4JSYA 2XLJA 3V97A 4J9LA 2MKJA 4ZYXA 5ALKA 2WK1A 4HDNA 3ZE1B 1WNFA 1SCNE 4IG4A 5AKLA 2QAGA 1V26A 5EE3A 1E92A 2Q3EA 3FHOA 5CLHA 1QM9A 3G3EA 4WOBA 1MEOA 3LBNA 1JQEA 1DPFA 2PZ8A 5E8RA 2GC8A 1KK3A 3MFHA 3U7GA 1Y5MA 3PK0A 5I3ZA 4LF4B 2P8SA 2Z6UA 1WDWB 3E53A 4BO4A 4EX7A 4DFDA 4LF7F 3NAGA 4DV0J 4INPA 1JLRA 1DBIA 4U67Q 1WSRA 1ECLA 3UXYA 3DMRA 1EWQA 3A1YG 3HDQA 4C43A 3GIWA 3IS3A 2ZUTA 3V5RA 5C25B 3QWAA 1NKVA 1JDUA 1AURA 1V5IB 1P8AA 3JYNA 2CXPA 2Q07A 4KZKA 1U8ZA 4B7ZA 2LCQA 4K6KA 3RAMA 1XWFA 1P2SA 1EHIA 4QZVB 1I51A 5I7WA 2O8DB 2B78A 1TL1B 1Z0SA 3ZTPA 3RJ9A 1KZ7B 3I39X 5TQ0B 1NCLA 1QYWA 2IHJA 1HQUB 2E89A 2MYUA 1HNWB 1ZL2A 1XZJA 1VYAA 3Q72A 2GMJA 1PBAA 3BFXA 1NPTO 1U5CA 3V55A 4L8LA 2JSXA 2NT4A 2C78A 4HQNA 4GXRA 1B8UA 4MJXA 2ZBIA 1XMOJ 3LBIA 4BO6A 4KVZA 3UK2A 4A0HA 3H2HA 2JDID 3CC4S 3UBMA 3EIXA 3TLGB 2IYTA 3UD4P 4ILEA 2HBYB 4U96A 3D6FA 1VSTA 3AOAA 1VG8A 4ZANA 2DFLA 4IG0A 1IKVA 2G1UA 1PWHA 4WZQA 2ZRJA 5C4IA 1Z6TA 4JHXA 2YNIB 1NUAA 2A67A 3PX7A 1CEZA 5B0GA 1GNTA 5ETMA 2OQIA 3KLBA 3W8NA 4JP5A 4YMLA 1ESMA 5DTMA 4DT1B 5I9SA 1X15A 3BDVA 5DB4A 4ZGWA 1P74A 4LF4F 1IZ7A 1CJUA 1TUWA 2QVXX 1AJEA 1XTKA 2VFAA 2XCUA 4P80A 2Z4TA 3I2FA 3TXAA 2F8HA 5LQSA 1Z4OA 1OF1A 1XRMA 3A2MA 3A8TA 5H4HA 5A71A 2OM2A 3A3YA 5K0ZA 2CJWA 3IALA 4NMWA 4CFZA 3CX6A 1U2QA 1U9ZA 1FJXA 1O9HA 5HATA 1N5YB 2PA8D 1K3TA 2X8BA 3P26A 4BTEA 4PPDA 1S3SA 4CEJA 3BGUA 3B5IA 4DUGD 4DA6A 4PEVA 3RADC 5GMDA 4DV1B 3L0ZA 1EDDA 1AGRA 1JIXA 3ENNA 1O5TA 5AI8A 4FYXA 2QE5A 1G20B 3DHEA 1FTCA 2R87A 1Y6ZA 4KDCA 3SC4A 3GLHB 2NXCA 3QKUA 1HDXA 5JSFA 1AZSB 3VBEA 1Y4SA 1LPSA 4WE1B 3CUYA 1W4AA 2CIMA 5KOJB 5JVDF 1U1CA 3UFCX 3FMBA 1RI4A 4MVJP 4R8KA 5IOLA 2WFMA 1WACA 1HR0B 2VPZA 4J91A 2R7AA 2GWRA 4LKOA 4QFCA 1E0AA 3USZA 4Y6PA 3I82A 1EFHA 3JZDA 5I7UA 1M2VB 7AT1B 1F9AA 2BD0A 1FWLA 3I28A 3C16A 4PUOB 4D0LB 1MO4A 3KOYA 2ZUFA 1IBKB 4KR0A 1M67A 1ABFA 3HHNB 3JW8A 3Q8RB 1DX6A 5CNJA 1KDTA 4IJ6A 4JH0A 2O8BA 2HSWA 1LV8A 4NOKA 2FKAA 3ZDAA 1XNJA 1WI6A 4C11A 4O4HF 1M7HA 3FTPA 3AF4A 5L7WA 4WOJA 4TWBA 3TDNA 4OJ3A 3PT5A 1OJLA 5DCWA 2AHOB 3EZFA 3O3NB 4ENQA 1CZHA 5KFRA 1NATA 4KWTA 1NHVA 1JAZA 3J81j 5KX5B 2E66A 3B3FA 1DEAA 2FE1A 3OJWA 3LFUA 3BFPA 4UTZA 1YKWA 2VDRB 5CA0A 1R43A 1N8SA 1JLBA 3RRFA 2C95A 4K6FA 3W5IA 4ID3A 2XTZA 6FD1A 3HDHA 1WF2A 3IUPA 2IUFA 1P2FA 2AFIE 3DZCA 1M7BA 1BS2A 1VKNA 3NGLA 4BEWA 3KTQA 3VAKA 3WAKA 3FCHA 2NGRA 1HLFA 2DLCX 4OHFA 2TYSB 3BTUA 2GCFA 2UU9J 3EUAA 2QD4A 3QE3A 1AB8A 4I9GA 3M8PA 1NVWQ 3M2VA 3ACBA 4CEHA 3K4HA 3UF0A 1MO6A 5BYQA 1XYVA 1FJGJ 3OOEA 5GADl 1IHOA 1V11A 5B1SA 2FC8A 5GVQA 1BMTA 2HV8A 2PMCA 3HR8A 1O94C 3C6QA 3BCSA 1RHQB 3UJNA 3CPJB 1NW4A 2ZI3A 2WVJA 3RRJA 3PUVA 3A3OA 1I6LA 5A3RA 5KQRA 3EDOA 5DX8A 2Y27A 2EFGA 4W63A 3OQ2A 3SQNA 3NBAA 1HTBA 2ZAYA 2FUKA 4ZYWA 3EJMA 2IZ1A 1OVGA 1IPFA 3Q24A 3A9RA 2F63A 4RHYA 3MEEA 2ZSFA 2IDZA 1RI2A 3TZCA 3P9IA 2NP7A 1K1EA 4U95A 4EY3A 3C5CA 5CFZA 2QTMA 2VRBA 2QO3A 3A9SA 4RU9A 2A1BA 1ODKA 4LUBA 1C8VB 3OETA 2VHGA 1TQ2A 2VHJA 5JWRA 1K8RA 2HPUA 1JALA 2MKKA 5HP1B 2JFNA 4BECA 4UTNA 1E4EB 3EMTA 4JEUA 4NLTA 1MGPA 4ES3A 2XKJE 3RVKA 3CD0A 1GV1A 2VXOA 2VQFF 3F46A 3EPKA 4XQCA 4ZV9A 3GRAA 3LKZA 2G7MC 3MERA 3C14C 2ZE5A 2X8WA 5EMJA 1XLUA 5L40A 4Q00A 2QB5A 3NV7A 2NXEA 3PHBE 3Q2IA 2VDJA 3ETDA 2JCXA 1KQOA 3PNVA 3AZQA 3HSDA 2E18A 2P1DA 3M32B 4G67A 4RD1A 1NIPA 3BE6A 1TKZA 1IHPA 1GZ4A 4YRCA 4LKRA 2ODWA 4JBLA 1RB0A 5KJCA 3ZY6A 2ERCA 1ZNWA 3E7PA 1WF1A 5JIBA 3IUJA 5EGNA 3FN4A 5CB0A 3W6UA 1TVKB 3K0SA 2UUCF 3K5IA 2Y1CA 1QPBA 1U1KA 4Q4DA 4YS2A 4GI2A 2PFFB 3DLEA 2HLNA 3BFKA 4QUBA 2ZE6A 5TMDA 3R6LB 2J5AA 3M9WA 4GHWA 1GCGA 5I7EA 2B56A 2R7NA 3VVLA 3EXG1 4K9PA 3WO0A 4JJEA 2FSFA 5IDWA 3TANA 2IOQA 1Q7TA 3IR6A 1I6MA 1NZDA 1AXEA 4ED0A 2ZYGA 3RRNA 1CBKA 2P9FA 4BMPB 5IT9Y 4GX2A 2A5FA 3SSNA 2R8OA 2YHAA 3JWIA 1KAOA 5TR9A 4H6PA 4OZNA 4CM4B 5H3CA 4G2TA 1M74A 3EPIA 3RVOA 3A6ZA 4TV9B 1K3FA 3N2NA 2I3ZA 2RHWA 2C31A 1ZNYA 5REQA 4EQ6B 3R7BB 5G53C 4PYRA 1JU4A 2BE7A 4JI7J 4RK6A 1XC7A 1XPJA 2F1FA 2X9QA 3GQCA 3CHYA 3NTXA 1QYIA 2V6MA 2C99A 3V4OA 1Z7GA 3PXEA 1GKKA 3QUBA 4G0MA 4EG1A 4UC0A 3MBKA 5ABPA 2EV9A 5E2AA 1QH8A 4FHGA 3ZX4A 2R8KA 4WKRA 3WL3A 1L7MA 1NQXA 5BNZA 2A18A 3R3TA 4XIYA 5F9NA 3CCFA 4TLAA 1NNLA 3QXHA 2VU5A 4HGQA 1RAAB 4CEHB 4IVPA 4YPOA 2W2LD 2LCIA 4HS9A 1MEJA 4B2PA 2I2DA 2DE0X 4PYIA 3SZ2A 3KVYA 1ZZEA 2I1VB 1XWLA 4IJMA 5BJRA 3B54A 3QAUA 5MN6A 1D6SA 4FFDA 4NLDA 4ZPVR 3ZHCA 3CLRD 5FUVA 2DTJA 2ZU0C 2VG7B 4Q3BA 5H3LA 4FXVA 4DIDA 2MMCA 2M2IA 2VG6A 1XEWX 3DRRB 5JXJA 5MN5A 4H7EA 4GLLA 2DM6A 5ENZA 3KE8A 5H9EJ 3ESYA 1YHNA 3ADAC 1AS2A 1YH3A 4JLSA 1OT3A 3GE9A 2Q6CA 5IX8A 4RW6A 5B7QA 3JD1A 4PBTA 4NQRA 1Z29A 2SICE 4USMA 2GJ8A 2O2EA 4QG7A 1QIKA 3T5MA 1L3TA 1IDOA 4QNRA 4QBIA 4QGHA 2C2RA 3PRKE 1TVCA 2QN9A 4MLPA 3PRBA 4G0OA 1VI7A 1NVAA 1U28A 1R88A 4CLDA 1ULZA 2E6UX 5AE1A 3NEJA 4LXTA 4DL5A 2JX2A 5FPYA 5I7VA 4C7JA 1FXDA 2W2TA 2PN1A 5DDOC 5GJCA 3ND7A 3MOIA 2R42A 4KVFA 3T5LA 1QAJA 4BFUA 1XQWA 4DKJA 3NOGA 5JR3A 1QZXA 4FE7A 5DHUA 2IMWP 3VH2A 3KAKA 1JLKA 1YR2A 2QLJA 1JK9B 3TLEA 3ZOKA 1GQSA 3HB5X 2PVCA 1HMVA 1VYTA 2X6QA 2ZG6A 4G1QB 1DURA 4Q4AA 2CDAA 4D3FA 3KQYA 1ILEA 1CC8A 4W4TA 1QK4A 3DM5A 2J0UA 3E6AA 1DTQB 3FCEA 2PT0A 4LJ7A 4WP9A 1FZTA 2VIHA 4K5QA 1NPDA 5CA1F 4DQRA 1PZHA 5EJAA 2DBZA 3C45A 4RTQA 4P86A 1SQGA 4WGFA 4YQWA 5AXBA 3CR8A 1QE3A 4F0MA 2IUEA 2IOFA 1YC2A 1NUEA 4NPHA 2W58A 1E2EA 1RWQA 3TTSA 4KPGA 3DC7A 2QU8A 2MTLA 4DN6A 4E2ZA 3F4LA 4X6LA 3B9PA 1N33B 3P49B 3NVAA 1U2DC 3S01A 1T8EA 2YWRA 3DDOA 1F17A 2XO7A 1T0TV 5CNMA 3HVHA 5CRIA 2PZJA 4HAZA 4DT1A 4LHWA 1M10A 2Z8YM 1NMYA 1NVMB 2BDEA 3AP3A 4MR8B 2DNYA 4GPAA 3PKJA 1YGYA 2QGZA 2A14A 4UU7A 5JSQA 1E64A 3Q7SA 4OQDA 2Q21A 3PXDA 1NRJB 4EJ2A 2CK3A 4PUOA 4WUVA 5J40A 3UCXA 5LLTA 3MECB 3AY7A 4IIJF 4M1MA 3MD9A 1H2ZA 5CFOA 3I2KA 2Q3BA 2CQ1A 3OOWA 3ML1A 5A4FS 2CPYA 2ZH6A 2B8QA 1ZD9A 5CYQA 5BV8A 2C2ZB 3F78A 2IP1A 3WL5A 1DY3A 1U0NA 1P1TA 3FJ1A 4W92B 4K8RA 2PWBA 1HO3A 1Z45A 4C3OB 1KXJA 3RAGA 1TKXB 3R9XA 1Z4UA 3T35A 1P5JA 1Y1TA 3C41J 2A1TS 3WTCA 4M1EA 4CU2A 2JLXA 3D31A 1KBZA 1M2EA 3CEJA 3C8UA 3OT4A 4WKPA 1TMOA 5J4LA 5L3SA 3S1TA 3U1LA 4LV8B 1E6VA 5L3QA 4EFNA 3RYIB 4DV1F 1UKUA 1B7GO 4E22A 3PG5A 4OMFG 2J76E 3VO8A 3HP1A 1XFAA 1YE3A 3K72B 2XD4A 4M6WB 3FUTA 3C6TA 2RHBA 3EVWA 3PO5A 1VCOA 2PEZA 3V2IA 2I4OA 2QRMA 4DLSA 4BZZA 2JWNA 2IBSA 4AO7A 4E6PA 1UUFA 2DYKA 3W5ZA 4EG0A 4ZCQA 3DO8A 3PHEA 3B38A 4LPSA 4I2PB 2WHQA 2YKNA 1LLUA 2AXEA 1PCAA 2GZHA 5DX1A 4BLPA 2G3YA 2HK3A 4Q7QA 1KDNA 3N74A 4Y30A 3MQ2A 4TL6A 1J9GA 5TQJA 1GADO 4GM4A 1D09B 1PHPA 4H7KA 5KVAA 1D9FA 3U9TA 3W3SA 1U1OA 5CEEA 3VBCA 4OJMX 3IR5B 3ILSA 1JKXA 1BN6A 1JA0A 4OYBA 2WF8A 2IYPA 1F2TA 1MXFA 2J1LA 5JDCC 2HTFA 4QWCA 3SF0A 4KIFA 3UAGA 3PD7A 5KOHA 4POOA 3HCEA 3LWLA 1XL0A 3RRKA 3R41A 2HUPA 1RGVA 1JKHB 2P4HX 4KI0A 3CT4A 4W9RA 2GD6A 3DAPA 4DBVO 3FNGA 3M2UA 4DR4F 5K5MA 4YACA 3U4IA 1UDRA 4ACAA 4XCQA 5AW6A 1A8UA 3HBLA 1DBSA 4N5MA 2V5VA 3ZV7A 2ZIXB 2GI4A 3HJAA 4WIQA 5JO0A 2XE8A 5ARCA 2WM2A 3R4CA 5T7LB 4NLSA 3NBPA 4FS3A 3P27A 3KQVA 4J0IA 4HL6A 4YONB 3U3ZA 3UXEA 3B5JA 2F48A 5JTTA 1NDQA 4DBLC 1HW9A 3JPYA 3KKKA 4ECXA 4XARA 3BGWA 1NVTA 4RADA 1SQEA 3CN9A 3Q85A 3HKBB 1JAYA 1UC4B 1ESEA 4M7WA 1ZQ9A 3IOCA 1I24A 4EYKA 3FUWA 1JLGA 2E9ZA 1TM2A 1UODA 1NR7A 1M2WA 5EE5B 3QATA 5CJ2A 4IQXA 2VOEA 1HNZF 5KHOC 1U6FA 4R6WA 3UJPA 4DI6A 1J90A 3O21A 2FEAA 5KG6A 3GFVA 4HNHA 4QECA 3DTTA 2CPJA 1E69A 1TJ3A 2ZROA 4URGA 3PW2A 5LA6A 1TZBA 3Q6IA 3B2EA 4RQTA 3L0PA 3QLJA 3BG5A 3H5UA 3NC0C 1OXMA 1IFXA 3H17A 2MKCA 2Y92A 4KG7A 4NR0A 4W5HA 2V9ZA 3T3GA 3C6XA 3QRPA 2P3SA 5CTAA 2QIFA 2VF3A 3OT1A 2MZQA 1TDJA 3DRRA 3OOHA 3QE2A 3V6MA 3OVBA 3TKYA 1P1CA 3H98A 3P5SA 2I4LA 3HFZB 3VR1A 4UHKA 1DRZA 3MYYA 4CE6A 1T9GS 1GAOA 3LI2A 2RKWA 4A6DA 1HDZA 3U1NA 2Z5LA 1D2AA 1SKYB 2RF2B 2YX1A 4LYAA 4IV8A 3G8CA 1LW6E 3IO3A 1BH6A 1VB3A 3X2FA 3L49A 4UKDA 1JW9B 3GPBA 4Z4HA 2MKYA 3AEZA 3E1GA 2CCJA 2ZJOA 4RDIA 1T0PA 1P8JA 3T7SA 5FOQA 1E6YA 4GECA 1EGMB 4C05A 2R86A 1JEQA 4ZC8A 4NBSA 2ZJ0A 3H2VE 1N5IA 1EQAA 1Y3AA 2JJ2A 3KHHA 2DF8A 3OE1A 1P73A 2XQJA 1DTTA 3O4HA 4Z3KA 1BXZA 1IBRA 2PX6A 2UKDA 3TNFA 2P7IA 1HC7A 3ULKA 3OEYA 4YXWD 3FBGA 3PC2A 2WWGA 4PNPA 3H1EA 3LQRA 2B9VA 4F3QA 1Z5ZA 1FXSA 2ODQA 4ALMA 2CN1A 2HADA 4I5EA 3H9GA 3IEUA 3JR3A 1NF2A 2NU8A 5A5GA 4C30A 3NTVA 4FNHA 3EGDB 1ONNA 2ZSKA 4CMJA 1I4OA 4B6EA 1S8OA 5CLQA 4TKTA 1M0WA 3LGSA 4NRDA 2G4CA 2HGMA 2HMTA 2X9VA 4TOIA 4QNMA 4UMFA 3R5CA 2OGTA 1L5GB 2W9AA 3ORRA 1JG3A 2ZBPA 4Z6KA 2J0EA 5BSTA 2R7XA 4XB1A 4ZN1A 3CVKA 4K3VA 3DLEB 1DT3A 4S3MA 4LWPA 5KNBD 1G4HA 1G8JA 1UDXA 2DHRA 3SR3A 3V1MA 4DMUB 3KT0A 3H0KA 2OHGA 3I05A 5F5XA 2RHTA 2AVNA 3NAQA 4BGEA 3RC9A 1ZD3A 3CVXA 5JYBA 2GF2A 5EZYB 2RHOA 2J6SA 2RUGA 3FMGA 4PSDA 4OM8A 4DBQA 3C14B 3LC7O 2YNMD 4JQSA 1T9HA 4MUYA 6LDHA 1Y10A 3UJBA 3L8HA 3G6ES 4HXGA 3FFBA 1GA4A 4OQEA 4CH1A 2PWAA 1EUZA 3CW2A 4M1KA 4WLEA 3M9XA 3M4JA 4MW5A 2NPFA 4Q1BA 4AXXA 1UAYA 2JI9A 1LF0A 5FRDA 2H2FA 2VJKA 2G9RA 3W4JA 4HY3A 3FRYA 5HIAA 2E7XA 2QIPA 4EJ0A 4MARA 2AZ3A 2PGLA 1ZHOA 1JKHA 1B14A 2SNIE 1H2HA 2GQCA 4ES2A 4PZDA 2GYYA 3QEKA 4LAFA 1NX9A 3IIMA 3QPUA 1REQB 2BZSA 2NUTA 2ASDA 2PU7A 2ZUDA 3HVAA 3Q2OA 3U7HB 3DDSA 3OEHA 3H9JA 1KIAA 2VJNA 1SVWA 2RRAA 1BJTA 4C2UA 1NJZA 3E9EA 2QA2A 4HDKA 2AKYA 1E3DA 3J7AC 3MAAB 1RWOB 5TX7A 1FKPB 1WHSA 2VT7A 2DYAA 4PWUA 3KKNA 5L3RA 4CQLB 4U5XA 3RK4A 1U0HB 1FK9A 3GCDA 3TE7A 5HTKA 1D2GA 4TYNA 4KE6A 4PV7A 3T7TA 4KMOA 3H99A 1WXXA 4BIMA 1TCVA 1OZ0A 3VNSA 4JBIA 4TMXA 4DIUA 1DWQA 4RXMA 2MY8A 4ECUA 3K5PA 2J48A 3I8SA 2RDJA 1Y3IA 3L0DA 5JH7F 3WLAA 4EPVA 2OBXA 1XCLA 3Q98A 3R1HA 1GGKA 2DKOA 4MYUA 3GCWP 1I7LA 5FLYA 3SZLA 1EP4A 4PG4A 1QYXA 3ROPA 2BFBB 2VPQA 4HDOB 2ZR8A 5FOVA 3QE4A 3IKTA 4YIHA 1S49A 2GHPA 3EWGA 1Q7EA 4JD5A 1ZESA 1WUHS 1ZFNA 2BGGA 1CTQA 2C2WA 5L3QB 3ZX5A 2AFHB 3IVXA 4W7IA 1N75A 2XBLA 2QTLA 4FGKA 4NMHA 3C15C 4AO6A 1EA7A 4PO1A 4Y6OA 1N6HA 4Y2AA 2DPYA 3FSGD 2HW8A 3WVNA 4LFAF 3JYQA 2OE2A 1XKLA 2WSYB 4ZVSA 4JJKA 1QOZA 4IRKA 3LW7A 5G3ZA 3SKVA 3LL4A 3H7HB 1O6FA 2OB1A 1L2TA 5DGAA 4AVYA 1ZMBA 3PEUA 1IWAA 3MEGA 2H1HA 4CTKA 3D7NA 2DFPA 2OZPA 1ZXBA 2EFVA 5KC9A 2IZ7A 5C81A 2BKLA 5F7ZA 4MFBA 1W4LA 3KYBA 1ARZA 3HQ4O 2O2JA 1W0CA 5G0TA 1LDBA 3BR9A 2YXEA 2IX9A 2BMDA 2DQZA 3OHAA 2YJ4A 4ZXFA 4ZRDA 2W9BA 3VPDA 4K0RA 4AZ3B 2XWYA 1JN0A 3V4IB 4DR1F 3K92A 2IHTA 5K4HA 1G2QA 5KB3A 3VMMA 3UK0A 3T5CA 4GO5X 4A8QA 3AEQA 4UUXA 2JVKA 4KSCA 1DQZA 4NZ7A 5CYPA 4HNUA 3WQSB 4EATA 3F7NA 1HWYA 2A2ZA 2FZGA 1Z12A 5CUQA 1OTYA 2NPOA 5AK6A 4LF8F 4Q4JB 3E9MA 4ANEA 4UFPA 4F60A 1YJ9S 1N1GA 2HJRA 5JPDA 3GFBA 4CKYA 1QCZA 4E33A 3CKMA 3AH6A 3FNRA 1TM3E 1ECFA 4RF3A 3ZTSA 1Q21A 4KCGA 1KBRA 4M88A 1XMVA 2PS1A 1JIIA 5EHQA 2WONA 2KHZA 1DC6A 3ZZUA 1ZAWA 4ZVSB 3O8RA 1MFPA 3G5AA 3O8OA 2FQQB 3QUTA 4DQXA 5LZ5A 2W98A 2QTWA 1C9NA 3UGQA 2P4UA 2ID7A 3RUAA 1L5OA 3VC7A 2C3YA 2CQBA 1MP0A 2PD3A 4E4TA 2X58A 3L7KA 5J23A 1Z22A 4RVGA 4F2PA 5KWSA 4NYJQ 3VUEA 1H5QA 1FKOA 1VYVA 2FZKB 4XOUA 2P9QA 3KT8A 2J33A 2IK8A 3FCYA 4N49A 4H1VA 4CKWA 4F91B 4R2HA 3DRSB 2L2QA 2H2HA 1WG5A 5DSXA 1VC0A 1IM2A 2ATCA 2CDRB 4C6TA 4IOCQ 1F4LA 1SBZA 3IQXA 4R7TA 2BZ0A 1Z26A 4K40A 4JSTA 5HQJA 5F7OA 2ZFUA 1JJ4A 2VDVE 2F3QA 1FK9B 3PFBA 1VE7A 4LYFA 4KTVE 2YNIA 5LSLA 3B48A 4OJTA 5F8GA 4A6EA 3CXUA 5G0RB 4BRUA 2V8PA 3R3HA 1IPHA 1IKVB 2X3YA 3HB4X 5E9AA 4IH7A 4KUEA 1BOFA 1ZI9A 5JTUA 1S4QA 1TEXA 1RTTA 2GEJA 3OZFA 4IRCA 1OWMA 3PE6A 4RW6B 2W6CX 4R69A 1U1FA 4PBSA 4URXR 4QWWA 5DZ6A 4JMLA 2OLKA 1MQAA 1KP6A 4U7JA 1OREA 1CUGA 1REVB 1FPQA 3JD4A 4MI3A 3U3XA 3DHYA 4Y2PA 3CO9A 1EINA 4G4SP 3D9BA 2E5IA 1FS4A 1VHJA 3TZEA 1IXRC 3HB1A 3ZVMA 1U7LA 3D5MA 1GZUA 2HWYA 1C50A 1U0EA 4MKFA 2HNZB 4NJOA 2PQMA 5IKEA 3W5DA 3CMQA 4XDDA 2E1PA 4O2AF 1L9XA 4MAAA 3DOFA 1U2GA 4F12A 2VSNA 3MM7A 1CJBA 1PZFA 1F9HA 3VJMA 1VR6A 5AVRA 1RWPB 1FTYA 1IN8A 1Y8QA 4K59A 4JI0B 4CGYA 3CNOA 3KMQA 3KTOA 3CWJA 2ZDGA 2X22A 2F17A 2FUNB 4MV0A 3L7JA 4AICA 1UBFA 3GJ4A 4OJYA 3HSGA 4C78A 4KR7A 1OE0A 5HMZA 4PAMA 2QLNA 2PL9A 4MV6A 4FCCA 4EKNB 2PEHA 3T9DA 2G0JA 3MJRA 3RSZA 4NLRA 3T9BA 4DDKA 1OU4A 1JXVA 4M60A 1QJCA 2X0JA 1UA1A 3TN7A 4BVBA 3C8HA 1UWVA 3A32A 5CBKA 3LZDA 5K6RA 3FB4A 2A8YA 2DWOA 3I4PA 2IYWA 3K1AB 5L51A 4L5CA 1HKAA 4IKPA 1QYVA 4USTA 3ICEA 4DDHA 4RJJA 3KK1B 2J9GA 3K53A 2QEXS 2EJTA 5SZKB 5F33A 1CSJA 4LSLB 2B4YA 5ERYA 1RCFA 4GP6A 1WZIA 5HYVA 3U3RA 1ADCA 1K66A 3ETHA 4BZXA 1PJ3A 1NU8A 3EISA 3MSCA 1W0JD 1BWPA 2AZ1A 2XE4A 1EZZA 4NOMA 2FW9A 1N6QB 3PTLA 4CO4A 2ZUEA 4MWDA 1RKUA 5LIPA 4LT6A 1X42A 4BQRA 2M8DB 1LWCA 3HH8A 2N9UA 2YC4C 2W11A 3HCXA 1UK8A 1HQEA 1W88A 2PGOA 1BDHA 2GO9A 1IG0A 1K7FB 3D3WA 2JFKA 1RKQA 4LY0A 3RU9A 4D9BA 3OM8A 3TO8A 4YAOA 1GYPA 1TCCA 2QAIA 4MWBA 4C98A 1MWQA 4MJ7A 4BO8A 2F7SA 4R9RA 4MVCA 2IW1A 4AAYA 3OFEA 4BAZA 1IJBA 1KRXA 4C3ZA 4AG6A 1I4LD 3S99A 1N9KA 4G5YA 1OXBB 3CLVA 4IF6A 2NPIA 4PRYA 4HUJA 2BZ1A 4MQFB 4Y9TA 1J39A 1J00A 2LXNA 4UVGA 3HK2A 4ZAYA 5CA0F 5C3UA 3WWPA 2DEUA 1NPRA 2AEMA 1QDUB 1VKZA 4Q8FA 2QM8A 1KARA 2ZT7A 4R2JA 1KOOA 4ZT6A 1LWNA 1IUJA 5D78A 4Y2TA 5FLKA 2WJZB 2A0KA 3ILVA 3DMNA 3N75A 3UK7A 4V0LA 1DAOA 5IP5A 2VYFA 3QMWA 1E3MA 4LXQA 2QLTA 1QHYA 4PXBA 2BKUA 5H70A 1RYEA 2R7VA 4BASA 1UFWA 1K8ZB 4DNPA 5HQTA 4P33A 2XGJA 1O9BA 2GM9A 1ZN7A 2JATA 4UDOA 3NC4A 1M0EA 3ZLJA 1OASA 4OH1A 1JPVA 1ZVQA 3SS8A 1KDRA 1BQEA 3NUQA 1JPJA 3HB7A 3CD5A 4GMFA 1C1BA 1RXIA 1Q50A 3H2YA 2J9ZB 5FJJA 1X7XB 2V55B 4NABA 4TZTA 1PZMA 2EFNA 3HCCA 4B82A 3WZ0A 3OZUA 4EX6A 1WA5A 3R7AA 1CY8A 3MBIA 2J0QA 4K4UA 4YMVA 4E0DA 1ORRA 1RHQA 1MLDA 3MAAC 3WJAA 3DCNA 2LCFA 2NADA 5C7OO 4Z7CA 4RWZA 1GGEA 1VQYA 2V67A 2JJ1A 3IRXA 4RHTA 2AGQA 1PUJA 5T4EA 1SXPA 3FNQA 3K1JA 1Z4IA 3FRHA 2J6TA 2CJYA 4IYRA 2ZKUA 4YY3F 3FWZA 3UJ3X 1GNRA 1MUUA 1RHJB 4FLFA 1M90T 3SSSA 1UWKA 3M83A 4XVRA 4ELUA 3OA2A 3TVDA 2LUOA 2XT6A 2HFSA 4D0RA 4IICA 4M1YA 1TW2A 1Z6PA 1ZD1A 2QV0A 3OA0A 3VU1A 3R3UA 3OFKA 3MPYA 4I9HA 3WAJA 1OFUX 2BVZA 1I0LA 1BOOA 4WERA 2OO5A 1I4DD 3EN0A 3M6LA 1Z74A 2HBRA 5I51A 3Q10A 1JVBA 3DFIA 3LC2O 4N40A 1LW2A 5H02A 3QEOA 1U4SA