2B9EA

Human nsun5 protein
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
293
structure length
275
Chain Sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human NSUN5 protein in complex with S-adenosyl-L-methionine
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NOL1/NOP2/Sun domain family, member 5 isoform 2
total genus 95
structure length 275
sequence length 293
ec nomenclature
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1170 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sun protein; domain 3 2b9eA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2b9eA02
1QYRA 2FYTA 4KWCA 3UJ6A 4P58A 4CXMA 4RTNA 2KW5A 2G71A 3LBYA 3LGAA 4KDRA 2CMHA 2P8JA 2PBFA 5LSAA 1NE2A 2YUIA 3UJ8A 4OA5A 2NXJA 2G70A 4X63A 4LECA 5FCDA 4OBWA 3BGDA 5HIMA 4RVGA 1VL5A 3PT9A 5IH3A 3B3FA 1BC5A 1G38A 3O31A 1VE3A 3SR4A 3A7EA 3REOA 2P7HA 1H1DA 2UYOA 3OU7A 4HSGA 1JQDA 5ICFA 3DMGA 4CTJA 5F2NA 3GU3A 1TW2A 1TPYA 1XCJA 2JH8A 4C04A 2EJTA 4ER0A 4PNEA 2ZFUA 2ZBPA 5CVUA 5CVVA 4CKEA 4XUDA 4AZVA 1X1BA 3E05A 1R74A 3EVEA 4E31A 3HTXA 4BP3A 4ER6A 5GINE 5DRTA 2PX4A 3KPWA 3MQ2A 5EC8A 4DCMA 5CM2Z 4DZRA 3FPHA 4XUCA 3B3JA 2Z6AA 3PFGA 1QAMA 5H02A 2AN4A 3G7UA 5KQSA 1ZG3A 3FTDA 2ZBRA 5FA8A 2GAFA 4HTFB 4R8SA 5DLYA 4R05A 1I1NA 4BY9E 2XYQA 4OQEA 2JG3A 3P97A 2XYRA 2UYQA 4F85A 3MAGA 4BP1A 3EVBA 3OZRA 4PYIA 3HA5A 3EGVA 3KQOA 5FQOA 1VBFA 2V7EA 2P35A 3JWIA 4KVZA 2ZLBA 5K03A 5LQUA 3SGLA 1NKVA 2ONZA 4G56A 1M0EA 3KQYA 4P7FA 2HNKA 4MWZA 3P9CA 4YUZA 5E9QA 1RJDA 3KU1A 3FPGA 2ONYA 2ZSUA 5DX1A 1XCLA 1Z3CA 2B2CA 3M4XA 2Z6UA 2PSSA 3HCFA 2YX1A 1R8XA 2EJUA 3P2EA 2NYUA 5F2KA 5JUWA 2ZIFA 4E2WA 2EFJA 3R6TA 4MHTA 4U7PB 3SXJA 4RTMA 3HA3A 3LCVB 3CJSA 4UOEA 1PJZA 5HOQA 2R6ZA 2AOXA 2BR4A 4ER7A 3CJQA 1L3BA 1WXWA 3DH0A 1O9GA 3P9IA 3TQSA 3FYDA 2B25A 3KKZA 1IM8A 5E1OA 3EPPA 3ORHA 1G8AA 1L1EA 5LQCA 2ERCA 3TMAA 3C3PA 4LWPA 3EVZA 4ER3A 5K0LA 4CKCA 2CWWA 2IDJA 2VDWA 4OA8A 2Y1XA 3A4TA 1SUSA 2AOUB 3LDUA 3TFWA 2PJDA 5E2AA 3DLCA 1X1DA 1BOOA 2GS9A 1M6YA 5DPMA 3V97A 1Q0SA 3G2MA 1SQGA 1X1CA 3MTEA 4PYMA 5CCBA 2YXDA 1D2GA 1VP3A 1HMYA 3PLAE 3EGIA 2ZULA 3EVCA 1XJ5A 2I6GA 2Q41A 4PCLA 1RJEA 3QOWA 2EX4A 1NW8A 1P1CA 4WVLA 1NBIA 3CBGA 3HCCA 2BZGA 5EZQA 3I5UA 4QTTB 1UWVA 2QM3A 4RSRA 5K01A 2GA9A 2NXNA 9MHTA 1NW3A 5FWAA 4V0QA 3O4FA 4RV9A 2AOTB 5DM1A 1F38A 4PWYA 5F2OA 5EMJA 2ADMA 3DR5A 3A26A 3GRVA 3GO4A 4FGZA 3TRKA 3LKZA 1WY7A 1TW3A 3KQTA 3SSOA 2ZZKA 3M70A 1VP9A 5ERGB 2OY0A 5E8RA 1ZGJA 2LD4A 1L3CA 4MTLA 4LWOA 5C0OE 4CTKA 2FCAA 3GGDA 4FSXA 5IKMA 4RTOA 1G6Q1 5DX8A 3KQSA 1DL5A 4DQ0A 5EQJB 3FYCA 2PWPA 2QY6A 2BR5A 2NNWB 3TKYA 5FWDA 3T7TA 3HVJA 4ATNA 1XDSA 1IY9A 1O54A 3BWYA 1AQJA 1ORHA 3BUSA 3ANXA 4XUEA 1JSXA 5GWXA 1L3IA 1KR5A 4M7RA 3BGVA 3C6KA 4OX9Y 3UA3A 3GRZA 5T6BA 3LDFA 3TOSA 4E30A 5LQAA 2YQZA 2ZZMA 1P1BA 1QAQA 3FUVA 4HC4A 3FPFA 4KRGA 5EIFA 4F86A 4YV2A 4LG1A 3IHTA 4U7TB 2OKCA 3FZGA 1RI3A 3PX2A 2B78A 4ISCA 5T64A 5K0JA 1HNNA 4QDKA 3HP7A 4YMGA 4RTJA 2DPMA 2ZZNA 3RW9A 3UZUA 4JXJA 5P8WA 1KXZA 1RI4A 5DTMA 3HVIA 3UJAA 4F84A 3OZTA 2E5WA 4KIGA 3GRUA 2UYHA 2HV9A 3TLJA 3VC2A 4FT4A 2OYRA 3E23A 3OPNA 2FPOA 2PX2A 5DSXA 3KR1A 1U2ZA 4AX8A 5FQNA 3LSTA 3FTFA 1NW5A 3PB3A 3JWGA 5B1SA 4QDJA 2FHPA 2P40A 4CWAA 3X0DA 2AN5A 5HEKA 3IEIA 4EKGA 5EKUA 1ZQ9A 1SQFA 2PV0A 2XVAA 4QQKA 4M37A 5CVJA 1PRYA 3A27A 4E2ZA 3AWIA 2I9KA 3G88A 2IH5A 2BR3A 4C07A 3M6UA 2PWYA 4QQNA 7MHTA 2QRVB 1JTEA 3UJCA 2A14A 1KP9A 3I64A 1P91A 4NECA 3TM4A 4P7GA 4PIPA 5DX0A 3AJDA 4OQDA 2XBMA 2IGTA 5GM2A 4E70A 3JWJA 4X41A 4OBXA 1KPHA 1SVUA 4XCXA 4R6WA 2P3QA 3G89A 3L8DA 4HGZA 3Q87B 4AZSA 1OR8A 5CD1A 4BLVA 5FHQA 5GM1A 5E1DA 5KQRA 3KPVA 1ZHFA 4KW7A 2O06A 2IPXA 3CJRA 5KYGA 1YFLA 3D2LA 2DULA 2P1DA 3OFJA 5CVEA 2IBTA 3B89A 2AOWA 2O07A 3PVCA 4FZVA 4HG2A 1RJFA 2WA1A 2PY6A 3BZBA 1EJ0A 4PYLA 2NP6A 3MB5A 5D1HA 5HFJA 3HCBA 5HIJA 1R8YA 2HR1A 1AF7A 2PGXA 5FUBA 3M6WA 3TR6A 1M6EX 3E8SA 4RTPA 4EQZA 2P41A 2YVLA 3P2KA 5BW4A 4DA4A 3B3GA 3VYWA 3DTNA 5K0FA 3NDIA 5EKXA 3RODA 5EG5A 2PXAA 5E2BA 3VSEA 5LQKA 2N47A 2AOUA 3A7DA 3GRYA 3ELWA 3ID6C 2PX5A 3G8AA 1WXXA 3R0QA 3SSNA 4X61A 4C4AA 4YUYA 3F4KA 5CCXA 3BWBA 2O05A 2JJQA 10MHA 2YXLA 3BKWA 1R18A 2ZTHA 1NW6A 3O7WA 5K0NA 5M5BA 3QOXA 5LR6A 3KR9A 5EPEA 1YF3A 3NDJA 1NT2A 3NMUF 1YZ3A 2H00A 2PKWA 3NWBA 4K6MA 5DM2A 3FUUA 2OXTA 1T43A 2ESRA 3UJDA 5K0BA 1V39A 3U81A 1RI1A 3G5LA 1NW7A 3CKKA 4EKIA 4FR0A 4RTLA 4RTKA 1XDZA 2H11A 4C03A 4PYJA 5BW5A 2C7QA 3MCZA 4POOA 4IWNA 3P9NA 4E2YA 1Y8CA 2GH1A 3ER8A 2OB2A 2PX8A 3NW9A 4GUAA 3OU2A 4DKJA 4YUVA 2UYCA 2PT9A 3G2QA 4RX1A 3LCUA 3FTEA 2FK8A 2OZVA 3TKAA 4DCGA 3HCEA 4IV8A 1N7IA 3R24A 5DT2A 3FRHA 2VDVE 3CGGA 1FJXA 2IP2A 4PGHA 3HCAA 5GOZA 2BH2A 1WZNA 4GOMD 2AZTA 3C3YA 3DXXA 1JQEA 1DUSA 2OPBA 4MIKA 3T7RA 3PTAA 1AQIA 4ER5A 4PCAA 5DSTA 5K8VA 2B3TA 5LQRA 3UBTA 3LHDA 2OO3A 3OE5A 4EMSA 1AV6A 3BWCA 3DXZA 3TM5A 1JR4A 3E7PA 4FS8A 3WSTA 5K09A 5EMKA 1O9HA 3KQMA 2ZIEA 2ZVJA 3T7SA 1RI2A 4PYNA 2WK1A 5GP1A 1N2XA 3OCJA 3CVOA 3GWZA 4O29A 1DCTA 1XXLA 3IV6A 3KQPA 4M36A 4BLWA 2GPYA 4HRAA 1MHTA 4E2XA 1QAOA 4GOOD 1KHHA 1XTPA 4IKPA 1YB2A 3KPJA 2UZ4A 1FP1D 2CMGA 5HIIA 4QVKA 1R00A 4RVHA 5EEHA 4GQBA 2GB4A 3UA4A 5EZSA 2P3OA 1FBNA 2Z6QA 2PVCA 3EEYA 4PYKA 3BT7A 4YV0A 5LQNA 1G60A 4V0RA 5DTRA 2ZWVA 5GIOE 3RIEA 2OB1A 4GC9A 4EK9A 3SX0A 1JG1A 2QYOA 1SUIA 3G5TA 3GJYA 1EAMA 3ELUA 1EG2A 3FUTA 3LDGA 3NWEA 4GF5A 4PGGA 5DTQA 5T67A 4RVFA 2C7OA 3JWHA 5DRYA 5HZMA 4DMGA 1F3LA 3MHTA 3FUWA 2VDUE 5EHGA 2AVDA 1XDUA 3HM2A 5DXAA 4HH4A 5DXJA 3EVGA 3MCTA 3EGEA 3UWPA 4C08A 2XYVA 2F8LA 5EGSA 3FPJA 3DMHA 2WA2A 2JHPA 4BLUA 2VP3A 3KR0A 5EOVA 3S68A 3AY0A 2YR0A 4PIMA 3SM3A 5K0EA 3LECA 5EVJA 5BP7A 5KVAA 4KDCA 3VC1A 4E32A 3SSMA 3DP7A 3A25A 3KQQA 5E8JA 4PYQA 5C9ZA 5HIKA 2I7CA 5KS2A 2BM9A 5JR3A 4HGYA 3TPZA 1SG9A 4Y2HA 4AZWA 3R9XB 2ORED 4FSDA 4A6DA 5ICGA 3LPMA 1KIAA 4PYOA 1D2CA 1XVAA 5FTWA 1I4WA 1L9KA 4L7VA 2R3SA 2PLWA 5EEGA 1JQ3A 3GNLA 3HNRA 1JG2A 5FADA 3V8VA 3EMDA 5MHTA 1WG8A 1IXKA 2O0LA 3LBFA 3G2PA 3P2IA 3P9KA 4R6XA 2QE6A 1SKMA 3B7PA 3HA7A 4GOND 4KIFA 4X1OA 2O57A 2NXCA 3UJ7A 4C05A 5GIPE 3MTIA 5EMMA 4X60A 4DF3A 3M6VA 3P8ZA 5EHIA 4PONA 3NTVA 2IH2A 2ZW9A 3P71T 1VIDA 4R8RA 2PT6A 4E33A 1VLMA 3FTCA 3C6MA 3I9FA 1VPTA 4H0NA 4RTRA 1ZKDA 3DXYA 3M6XA 1R6AA 1P39A 2NXEA 4HTFA 1KPGA 3LCCA 3FRIA 3SMQA 1BHJA 1JG3A 2IDKA 2XVMA 2OBFA 4FT2A 1ZGAA 2G1PA 1X19A 2B9EA 2FRXA 4AUKA 4B17A 5CIYA 4RTSA 1I9GA 2NP7A 4GBED 3PFHA 3ER9A 3PS9A 1UFKA 1G55A 2AOVA 3HVKA 3M33A 5BXYA 1EJ6A 1YUBA 2VZ9A 4QVGA 2ZCJA 3GXOA 5CUQA 1EIZA 3UJ9A 4QPNA 3ME5A 2GLUA 2PXXA 2HMYB 5FULA 5E9JA 3ERCA 2P3LA 3GCZA 3BXOA 4DM3A 3EVAA 3EEOA 4PINA 2C7RA 3MERA 8MHTA 4M38A 4YV1A 1QANA 2QRVA 4EVIA 5ICCA 1QZZA 3GDHA 5E1MA 5CVDA 3LKDA 1VQ1A 1X1AA 2CKDA 4RTQA 3ELDA 3DULA 4QTUB 1BKYA 3EMBA 2CL5A 2JHCA 3OFKA 4GC5A 2AOTA 3DLIA 3K6RA 1G8SA 5K0GA 1NV8A 2YXEA 2G72A 1FP2A 3CC8A 3T0IA 4CKBA 3G2OA 4MQ4A 2G8NA 3BWMA 1INLA 3AXSA 3PX3A 2AR0A 5HILA 3ELYA 3KPYA 4RVDA 4Z2YA 1YZHA 1RJGA 2FK7A 3BKXA 3CJTA 2K4MA 3I58A 3KPUA 3OU6A 2P7IA 2V74B 4RWZA 3GIWA 5EMLA 2AN3A 5D1NA 1Q0TA 4P7KA 3THRA 2AS0A 5LQJA 2EG5A 4IV0A 5K0CA 2AVNA 4GOLD 4P7JA 1FPQA 3KHKA 5U4XA 3UJBA 4AZTA 3Q7EA 5E9WA 1RI5A 2IIPA 3H2BA 1KPIA 3OZSA 1KYZA 1MJFA 2BM8A 1N7JA 3DUWA 3LX6A 2ZWAA 2JHAA 2JH9A 2PXCA 4YMHA 4YUWA 3KR2A 5C1IA 1B42A 3DMFA 3HEMA 4RYLA 3SVZA 1EQAA 5E1BA 5EIWA 5DWQA 2ZIGA 4A6EA 2I62A 4FP9A 2YTZA 3EVDA 1JG4A 5FA5A 2Y1WA 3DOUA 3EVFA 3NVMB 5G02A 3THSA 3K0BA 3GRRA 5DM0A 3MGGA 1JTFA 3QV2A 1KYWA 3KQVA 2VS1A 3C0KA 4GEKA 3LL7A 3HCDA 2IFTA 3AXTA 5DM4A 4YUXA 1UIRA 3IYLW 1JSZA 4C06A 3R3HA 3NVKI 3NJRA 1ORIA 3KQWA 3I53A 2C7PA 1D2HA 4WXHA 3G8BA 4Y30A 2IH4A 2HTEA 4QPPA 1NBHA 1YFJA 5K05A 3CCFA 2IBSA 4ZTBA 3UFBA 2ZBQA 1NV9A 3BGIA 2H1RA 3FUXA 3FPEA 3OE4A 5FHRA 3HVHA 1WS6A 3B5IA 5ICEA 2HWKA
chains in the Genus database with same CATH superfamily
3CUWA 2A9VA 2IX3A 1SBHA 2Q5FA 3TAHA 2R85A 4A16A 4IGKA 1XPJA 3HABA 2J0UA 4M3NA 3QPUA 5LJ3Y 3VA7A 1ZR2A 1GXUA 2VDWB 3QY0A 5HFAA 2C3YA 3BB5A 1VBFA 4FMDF 4ZRDA 4W82A 1V2GA 4MDHA 2CHFA 4MUMA 3V4ZA 1O08A 2QQGA 2G08A 1WEHA 2PSSA 4NYIR 3OM8A 4EGFA 1R8XA 4JI1B 1SCKA 4B3RB 5U47A 1HNXJ 3NGUA 5I9IA 1YBVA 4BQIA 2R7UA 4CYUA 1RTDA 2B7BA 5ITWA 1YIJS 2V50A 1S97A 3QVMA 3B36A 4CL0A 5CB4B 1WDDA 3DBRA 3LQVA 4ICLA 5E2AA 4FTWA 1Y4ZB 4AJPA 3K8WA 3LLMA 3IT1A 3WOHA 4DIUA 2NO1A 3L77A 1UPMB 3HB5X 4AK9A 2XUZA 3FVRA 3ML1A 2OZPA 3MOIA 1KMNA 1QHHA 4KQ9A 4Z54A 4UPEA 3HUEA 3JSMB 2E5GA 1SCDA 1V6CA 4QBTA 4XQGA 1JXVA 3RRHA 1KYXA 1TL3A 3QPCA 1K4YA 4Z1MA 3O4VA 2FLVA 4ACAA 3UMVA 1JILA 1UPCA 1SFRA 1HYGA 2GKOA 1V7QA 1Y1TA 2EKNA 2QUBA 3VYSB 5KQLA 3KYCB 3OQIB 5T6MA 1W9MA 3U39A 1M1HA 2O0JA 3KJEA 4JI4B 2WU1A 4ZOLB 4LCJA 4KGZB 3TLJA 3G23A 1DG9A 1NF8A 2PZAA 2OH2A 1LPPA 4KGVA 3UNXA 2QMHA 2JAOA 4DV7J 5JAPA 3QF4B 5C24A 5FFFA 4E4TA 3WZ2A 3O4GA 4BRSA 1I1HA 3GFFA 3U7QB 3L7IA 3GPLA 4PO1A 2AD5A 1HLFA 5J5AA 1J20A 1ZCZA 1F2UB 2FG7C 4OQJA 4MGZR 2W90A 3TLAA 5EFZA 5LUAA 5AXBA 1VYVA 1T5OA 4RJKA 1GQEA 1E0DA 1U2DC 1YVDA 2HR1A 1G7CB 3H4DA 4K6OA 5LZ9A 4JT8A 5IPFA 1IOLA 1BJKA 2X9VA 3JQ7B 5HQ3B 1IXRC 4DLKA 4Y2CA 2A0XA 1UVLA 1FSZA 1RT9A 5CU7A 4Q3EA 3GI1A 3W0LB 1KNZA 5IANA 4DR4F 2JJ1D 5DK6A 3Q3CA 4LJMA 4EFDA 5IM0A 3KOMA 1VLHA 4D0GA 3FOEC 2F4NA 4OYPA 3W6OA 1RWWA 5J1EA 3L6EA 2WTUA 4R9RA 5EMKA 3WKEA 3CX6A 1Y4SA 3L1VA 2RGAA 1WSBA 2L82A 5K6AC 2QV7A 1ZA2B 2IYIA 2OPRA 1TD1A 4Y6OA 1J1UA 4EHNA 2QLBA 1JDNA 4WE3A 3EIWA 4N8DA 1RKQA 1ZOOA 4PF1A 2BCJQ 3QZ8A 2P9TA 3KQLA 1PYDA 1FXLA 3K5PA 3Q7PA 5JJ5A 5BP7A 2HEKA 4IJ5A 2WMDA 3AUSA 4TMTA 5A4DA 2DJ5A 3ZV5A 3QMWA 3SF0A 1RAAB 2JEIA 1VQPS 1C29B 3BD6A 1SXJA 3KHRA 1H7WA 3LVRE 3ESCA 1V96A 1XHEA 2PC6A 4UT4A 2NXCA 4KKXB 4QIHA 1D8TA 1Q0UA 2EI5A 1FTQA 1WC0A 4HUTA 1RT4B 3I5CA 2HZAA 1RHUB 2J9CA 2NXEA 2OQRA 2DUWA 3B7WA 2V4QA 1UOOA 1I9GA 1UJMA 2UDPA 1UFKA 3W9YA 4GRAA 2XDYA 1T8SA 4ZCMA 3HFJA 2ZUTA 3B78A 1I5RA 3Q15C 4RPFA 3CX7A 4MPRA 3F74A 3OHSX 3PXDA 2Z8YM 3D7SA 2J4FA 2O59A 3CRW1 4CQ1A 2OXFA 2LEBA 5EPOA 3DC7A 1X2EA 3MGBA 5BNWA 1I2CA 2R6JA 2OD4A 2WV9A 2PN6A 2BUNA 2VPXB 1WF1A 1DBPA 2KU7A 2GQQA 4D0LB 3OJLA 5EDWA 1DAMA 5LM7E 4PG7A 1WORA 2D1QA 2V69A 1IOVA 3IYLW 3J81Y 4LAFA 3RBEA 1HV8A 1Z75A 2EJCA 4OUDB 4B09A 3CSUA 4DPWA 1P7ZA 3D6TB 3IO5A 2IMOA 3DF9A 3RYTC 4PFKA 2H29A 2NSYA 1XMQJ 3O5AA 4B2PA 1OPIA 2X7HA 1G7CA 1ZKMA 1LBQA 1UJCA 1JLMA 3PFFA 2E2WA 4A8KA 3AZPA 4MRMA 2R4FA 1YRQA 3HB1A 1FFBA 1CSEE 1GEEA 1SCAA 1IBKF 4QYXA 2FGJA 1KYQA 4TY8B 2JFVA 2JG3A 2ATLA 5MFZA 4TV8A 4QWBA 2IV2X 4DV4B 2RS8A 3HDTA 1WPXA 2ONZA 4D9NA 3R3UA 2B4YA 2JEZA 4W1QA 1OLUA 1P3DA 2VA9A 1LKZA 3RBDA 4DSIA 4JLAA 1KN6A 2A7QA 2ZH1A 1SC3B 2M9MA 5IWAF 1ND5A 2B98A 4ZU3A 1F4LA 1YJ7A 1SXJC 5KFFA 2AHOA 3F4LA 1CQJA 1VE6A 1MMDA 3PHLA 5KMGA 1H93A 4LJ8A 4CKCA 3CSSA 5THWA 4DDMA 2AJ8A 5HF8A 3DAFA 3RAJA 2ZULA 1XRQA 3EVCA 2LUOA 1WQ3A 4WXPA 1UBJS 4PQRA 1YZFA 2V5HG 3WV5A 4A4JA 1IVNA 3OY2A 1M2OA 4X8LA 3MM9B 4KPUA 4BC7A 4C4XA 2AOTB 4PWYA 3N5KA 4TKVB 5A4IS 3JYPA 2Y0SD 4M7OA 3CIOA 3M70A 4KWTA 4RTOA 4LDPA 3ZG6A 5KFIA 3RK4A 3ZGLA 1HBNB 5J2MB 5F73A 2L9WA 4Y6IA 5LQAA 1LFPA 1ONOA 3N2GB 2IKSA 3BJYA 1BHO1 4F3NA 3V8RA 2FY8A 1OGJA 1DDIA 4TUYF 4PWWA 3DNFA 2E5LF 3WLPA 3BMCA 5A8WB 1EFPB 2RJZA 2OPSA 2JL1A 1W581 3IS3A 1QHYA 4LCEA 3M2TA 2V03A 5MLCV 2WT4A 2ZCVA 1JSRA 3UJCA 4DUZF 2VC1A 3TM4A 4PIPA 4KBFA 4PZDA 2O2CA 4X97A 3ETGA 1YOVA 3G89A 2DNPA 4FLFA 3Q87B 3CZ9A 2P69A 5F98A 1DHRA 4ZGGA 5H81A 1Q95G 1KWKA 5CVEA 5G4KB 4RXMA 4P2SA 4FE7A 2NYHA 4DVGA 3EXEA 5CB8A 1TL4A 4L22A 3TOZA 3G5UA 1AKUA 1N2HA 1GT6A 3F90A 3ROQA 2JKYA 3PNLA 1UPPA 3LQRA 4J2OA 1XMVA 3ASVA 3KJHA 2V7GA 4IWNA 4D25A 2XKKA 1TL5A 3DVSX 3WNDA 4W7IA 2AQIA 3H2KA 1ADFA 3ETCA 4NASA 3LUCA 2BH2A 4F4IA 3P45A 4BVBA 4F38A 3W6NA 2PZGA 2NVOA 1LV8A 2IXAA 5TNXA 3U44A 4C2TA 1R4NA 4J07A 1FB5A 4P80A 4E3WA 2IHNA 1MWZA 3GJRA 4RL1A 3M8YA 4UUOA 5ALPA 1HNWJ 4DAOA 2VXBA 4JC4A 1YRTA 3B5EA 3L8MA 1WCWA 1EAMA 2GGPA 4R1QA 2DWOA 4J1TC 5D3QA 3CVXA 3EXHC 4M0UA 1Y9EA 4A10A 1RT5B 3FFIB 3Q0AA 1U1EA 1SIWB 2MEWA 1CY6A 3WIDA 4YMWA 2G9ZA 3DF7A 5DZ7A 3WBZA 3PRYA 2QXTA 3SHOA 4PZEA 3IBFB 4QLBA 5BWOA 4OX7A 2X0EA 2EP7A 4LBZA 1KYIA 1U99A 2JVOA 4ZVKA 3ACCA 4ZO8A 2LZ0A 2BFFA 1Y7TA 5A9SB 4CM7A 1H74A 1IZ0A 1M2EA 5EHIA 3SFVA 1N5YB 4HDQB 3C74A 3C6MA 4O3SA 3B9RA 2WRMA 2ZIXB 4Z7NB 3K4HA 4NFYA 4GP9A 3D1OA 2XMCA 2VSNA 5FV4A 5ALZA 5LMNJ 2HX1A 2C2MA 3VZDA 1Z56C 2XNKA 1BDBA 4FFPA 1EFLA 2CG8A 4L75A 2IOFA 5HBMA 4FBTA 1UAGA 3LRXA 3COYA 4X71A 4LFCJ 4EGCB 1M5UA 1F5BA 1TYZA 1M34A 1T8YA 1INLA 2CXNA 2F48A 4C7XA 5I3CA 3AKDA 5DSZA 1D9ZA 5C46F 2JLCA 3OZSA 4TXJA 2JHAA 2ZROA 5IFMA 2GNAA 1W0CA 4TTIA 4JI2J 3A0UA 1H38A 3N0TA 3GP5A 5AHWA 4ZARA 4NPOA 3NS5A 3C6TA 3RIYA 1GGFA 2J6CA 1E9SA 3FKBA 2R44A 4BKMA 1E89A 3ZI4A 2HTEA 1U24A 3DOJA 4H4DA 5AM0A 3R3SA 1COWD 1IWAA 3VI3B 4EJ2A 2H9AA 1UT8A 3I0SB 3HS3A 1UMKA 1KJ9A 5A2QU 4KDRA 1KYYA 4CV0A 1P31A 4B9MA 3DAGA 4GXQA 4F36A 3SR0A 1JQDA 2HURA 2ATCB 4KQCA 4LUCA 2P9GA 1PWZA 3OEYA 2J7WA 3M7IA 2DWCA 5BNZA 3A04A 4EYKA 2WSFC 3GJ3A 3LY5A 4QUAA 3PHTA 4IEIA 5DLYA 1CKEA 5D15A 1JLCA 2EHJA 1PG2A 4W5OA 3PQEA 5L3SA 4GI7A 3I83A 4RHEA 3OQMA 2PMCA 3U4DA 4ANCA 4WKYA 1F9HA 2TSYB 5A6VA 2AX0A 2UUWA 5LKRA 1V9LA 4ON9A 2ZU6A 4WKBA 2H2AA 3F6PA 1Y8RB 5TQ2A 3KTAA 3OZCA 1QYCA 1E62A 3RR2A 1ZAYA 5SZTA 5LQCA 2PSZA 2JGLA 2BFMA 1QGDA 4P3XA 4QGAA 5DLEA 2QV6A 1QD1A 2WSBA 2FPPB 1KZ9A 3S01A 4U2GA 4HQ0A 4CRWB 4HBZA 4J0KA 2ABYA 1A4UA 4PO9A 1GAEO 4FGZA 2PI5A 1Z0KA 5DGXA 3AL3A 2ZUVA 3CO9A 3A6DA 1XKQA 3TG8A 4LGVA 2FMFA 3TD9A 4ZI7F 2WKPA 3BGVA 1T6BY 4HWTA 2ZZMA 2HU5A 5EA2A 1QDEA 2MSDB 5BYBA 1LBHA 4NRDA 8ATCB 1IEWA 4MUIA 4OJ3A 3HP7A 3IQIX 4G5OA 3FYUA 1LS1A 4NZ7A 4TMWA 3QXJA 3OPNA 1S1UA 3NUGA 2HDWA 4D6PA 4RGVA 5BT9A 1H6DA 2FMHA 4ZO7A 2ZQ5A 3JZFA 2P6RA 1YJXA 1R43A 2ZBGA 1VI2A 4E5SA 2R8JA 1RS0A 1XD8A 4ZEVA 1TTHB 4OHCA 1T8WA 5IKEA 2WF7A 5HP4A 2Z98A 3C3EA 5T4HA 3CLUC 3KLFB 4F21A 4P6VF 3DEJA 4U7UK 2H52A 3O1JC 2AZ3A 5KOHB 5TIIA 4EHAA 1DQNA 3HEBA 4ZOQI 2LXFA 4KBYA 5AUNB 3SCLE 1NDQA 1Q1AA 5HUQA 1HWKA 4J7CA 2C7BA 1HFWA 4J9MA 3ESBA 3LPEA 5CD9A 5DM7Q 4ZP7A 4B6SA 4F6RB 1YB6A 2CB0A 4RX1A 4OYAA 3VHLB 4DCGA 2EEZA 3D7MA 4QLOA 1KEVA 2ALJA 4IUDS 2M8DB 1GZ7A 5LWHA 3KQMA 2GMLA 3MT8A 2HKIA 4NESA 1VECA 3K0CA 1ZESA 5DHFA 4F7VA 4AECA 1WXHA 3U60B 2WOMB 2CE7A 1C2TA 4JBHA 3DE5X 4JB2A 1EAYA 1P45A 4ZJPA 1SBCA 4OLOA 3KFLA 3QX3A 3RUDA 3M8ZA 2OB1A 4GNRA 2WJVA 5FUXA 3ZVLA 2ZRGA 5AK0A 3ELUA 1FP6A 5JAOA 1NYTA 3VPHA 4DPYA 4OO3A 4X95A 5A6SA 3X3HA 2WONB 1UZHA 3IEXA 4RCVA 4D9CA 1E3DA 1ULHA 4J94A 2MR6A 1TEVA 1GARA 2CD7A 3VC1A 4C4TA 2BEUA 5EJ4A 1VQ9S 4TS1A 4JUBA 2GO1A 2VL1A 3K32A 3ILLA 1DSSG 1VCHA 2FWNA 3VKUA 4D4MA 1OFGA 1GAJA 1YDWA 1VLYA 4IS2A 2ZP1A 2ZW9A 4H18A 1CEXA 1TMYA 3D7RA 1ZKDA 3M6XA 2OBFA 4HTJA 4RM3A 4KQIA 4B3HA 2X3UA 1YVEI 1ZAKA 4EFMA 2F3QA 4C7JA 3ZJTA 1HBNA 5J2MA 3QP9A 4H1VA 2BANA 3GEIA 1BDJA 5E6SB 1S8AA 4UOQA 3DN9A 5IDXA 4U5QA 1N6OA 1IY0A 3U31A 1YB4A 1S2OA 4RKFA 1EFRD 1TT5A 4PO8A 1VHJA 4C2AA 1NRKA 4GOLD 2WWXA 2YYYA 1IIRA 2HWWA 4LXIA 5C1IA 5BVGB 5D0EA 1HQUA 2IVZA 3LX8A 1G8MA 4HHJA 2MT9A 3O5TB 2NTYC 3MMAB 4XEHA 4D80A 4WBXC 2BELA 1XZKA 3IEUA 1N0IA 3NJRA 4HXYA 2EFDB 3ZX4A 2GD0A 2DECA 1DS6A 4TZTA 1UXOA 2VQEF 4WOJA 4ZP8A 4JGBA 2XNDA 2DGSA 4RKEA 3SBMA 5KREA 4G0VA 3NANA 3QOFA 3PO5A 4LBHA 2B82A 4IIGA 4R98A 2ZI9A 3GROA 3ICOA 3QLHA 3U3DA 5CVVA 2GMJA 2V8OA 1OIVA 3MQ2A 3FWPA 4YMVA 5IEJA 3EZ5A 2WUDA 4R8SA 3N9IA 2JBAA 3I6MA 1OJLA 2I4MA 3VX4A 1H23A 3KYIB 4ZAGA 3MMBA 4ANDA 3G8SA 1SJ1A 1J5PA 3K5IA 2VBIA 4QREA 2ZM6B 4EMTA 1HI9A 4V1Ak 2J5QA 1XC9A 3O8NA 3TPFA 1LQTA 3E22B 1GTMA 1N33J 2COLA 1CCWA 1F2TB 1X3LA 1A7JA 4XAQA 2EF1A 3R0ZA 1B6SA 2HOQA 3S0JA 5DTJA 1B6RA 4NEGA 2A84A 4R7GA 1JA0A 3OI7A 4PYAA 1NR7A 1AW0A 2HBRB 2VH1A 5B12A 1F4VA 1WHVA 4KFTA 2FEOA 4XFKA 1CJCA 1OWXA 2I6GA 1XAHA 3NP9A 4QW9A 4H15A 1CXZA 3PIIA 3VHXA 5IU6A 3ZTOA 3NAHA 1ATIA 2QSYA 4RV9A 4CIWA 2ZAGA 1OBFO 3FRJA 4KLRA 2Q4RA 2H7CA 1O58A 2FMTA 4M5NA 1FX0A 2O3QA 5T14A 4TTQA 4ZCQA 5JVGQ 3MD0A 2D74B 1BWVA 3BH0A 5AP9A 1SV5B 4FKXA 4M7RA 3WL4A 4HR2A 2EDAA 5DJ5A 2ILYA 5EIFA 4U7TB 4Q18A 4F4FA 3LUJA 3QU5A 1RA7A 2VCYA 3PDHA 2JLFA 3OSUA 1REQA 4AB1A 5J47A 1Z8NA 3AEKB 1KAOA 1DBSA 3NWGA 5I8PA 1YBAA 4RKYA 1PK7A 1U28A 4WFKA 2PFKA 1FQKA 3UPUA 3FWHA 3MUTP 1DQAA 3NGKA 3OPVA 4YB1P 4QDZA 3I9V6 5J43A 3BEDA 4TWZA 5DNDA 1FRFS 4CCYA 3KUEA 1WHXA 3A3OA 5SY4A 1XK6A 5FWXA 3OFJA 3ABIA 3IHWA 3C6UB 1OCEA 3KP1A 3A11A 3RRZA 3WSVA 4ALLA 4UE2A 1M6EX 5BW4A 5IYZA 5AKYA 4MKGA 3U19A 3LCMA 1Z4QA 5J4HA 1COWA 1KBQA 4K7JA 4JLPA 1PEDA 4GI3A 4ENTA 4JKIA 2D1TA 1W47A 4RSGA 4HLUC 3FUUA 3GA0A 3KLHA 2RHSB 1XDZA 5BW5A 4ZOEA 4M99A 3GJSB 2BBEA 4R0VA 5CDTA 2WKQA 1XCGB 4EG4A 4G9EA 2FJ0A 4MFBA 3TRDA 4OYIA 4AL6A 4ODIA 4NMXB 4PCVA 1R0BA 1U1LA 3QT6A 1TYEB 4ZRNA 5ECWA 4F0JA 1T2AA 4HRAA 1PU2A 4MR9B 4WTOA 2H0QA 4FBUA 4I0WB 4Q19A 5ICSA 3DMJA 2Z6QA 1VKRA 2YVQA 4EK9A 3V2UC 1DZ3A 1H0SA 4QFBA 4I1PA 3IBYA 4ZVGA 4QATA 3T19A 3R7LA 1YS7A 4TWJA 3MJSA 5CJPA 3SBOA 4G8BA 1FOEB 1I7PA 1SIOA 4EA7A 4RZSA 2JIMA 1FDTA 3B54A 4EG7A 4KLCA 3TEJA 3LECA 2R7LA 1GLGA 3SLRA 3RTEA 3PKYA 1KFBB 3TP2A 5E8JA 3JTPA 4AG6A 1ZM9A 2JAWA 5EEGA 4JV5B 5FADA 2AV5A 1YR9A 3CIFA 3ZCVA 4M22A 3VGSA 2V2QA 1Z2OX 1P1TA 3VPFA 4DJDC 1PG5A 3QWBA 1JG3A 4YDXA 3OZDA 2D4AA 2VI5A 4CW7A 4XVRA 1WA5A 3AF6A 1IJFA 4XPEA 2F8EX 1DTTA 3GLSA 4C30A 2M2IA 2M1XA 4GH5A 1E2UA 4Q3KA 4AYTA 4JI4F 5EWLB 3KJIA 4QBFA 1RAHB 1SHUX 1I3CA 1D1SA 2HBZA 3H8WA 4MPJA 1JKHA 2NO0A 1WU8A 1MJFA 1YVFA 4GM4A 5EVCA 4TZKA 4RIGA 1GZDA 2GEBA 4HNHA 1TVRA 3KMQA 2LMIA 4DG5A 2OFOA 1KQKA 1WC1A 3E3AA 2YJTD 4TN1A 5HROB 3SF8A 4GKJF 2GCEA 4FIDA 3EXG1 3H6GA 13PKA 1DOHA 3FLMA 5I9BA 4LXUA 4CXMA 5G1PA 1G20A 2VDJA 3AVOA 2DPYA 4TKUA 5F9NA 1ISJA 5B0CA 2CGEA 2XC9A 1M1YB 3AEQB 4G3XA 4URXR 3SQXA 3H2UB 1B4SA 4EMBA 2FZ4A 4KVAA 1DEOA 1R5JA 3E05A 4A8JB 1QYDA 2B5JB 1PS9A 1UC8A 1E6CA 2VA2A 1DJMA 3VKGA 2C31A 4YGYA 1IBCA 5LC1A 3T3OA 1HT0A 3G8DA 4QFMA 4Y0FA 4R5PB 4HLUA 3IKJA 1D09B 3B51X 3A9SA 4HEA6 4W5TA 3MM5A 4B79A 2J5AA 4MX8A 3MCUA 1QF6A 4MR8B 1QUEA 4Z9YA 3FEXB 3FBTA 1GH8A 3FETA 4L0DA 3VR5A 2CNWA 1EUZA 4MS4A 3G1UA 4UFOA 4CLDA 2B0GA 2ISQA 2AB0A 4FMDB 3GGPA 4HYQA 3GBPA 3FFWA 4YK7A 1DEHA 3ZKWB 3QOWA 3L0IB 3UAVA 1Y9OA 3K72B 1JH8A 3HR4A 2VJPA 2WJGA 1YQHA 1GG5A 1NY6A 1FDRA 4QCLA 3I6ZA 3OUYB 3C5WP 2O2HA 3P3DA 3NBAA 3SVTA 5CBKA 5IKMA 2J6UA 2ZJ5A 4L9RA 1I1OA 3VKWA 5HBRA 1P0IA 4Z99A 4G4SO 1ISSA 1UZLA 5DHUA 5LWQA 2NYVA 3TANA 3IRVA 4ZICA 4CM4A 4UBOA 3UZUA 1GU1A 4V1CI 3OZTA 2EBWA 1WXQA 4FYJA 4OXQA 2FUEA 3NH6A 3OCWA 4DUGD 5C1PA 3RC3A 5AI6A 3KNZA 1CB0A 3C3MA 4DV4J 2WIGA 1DO2A 2HHWA 1GRCA 4K2HA 2PH7A 5BV8A 3AB2B 2DXFA 3M5CA 4UHBA 3HB7A 3WADA 1E77A 4WFIA 4AJKA 3V46A 2CXTA 1TNDA 1E79D 9RUBA 3INTA 1QDUB 2HQBA 1ZI8A 5LLSA 2PMHA 2GA8A 3FSGD 1SUBA 4ILEA 1SKSA 4KGXA 3PIOQ 2A9QA 5K14A 4YLEA 4LZLA 2DY0A 2CPFA 2NZUG 3F9RA 1U5AA 2RHJA 1NX6A 1TP7A 2AQ8A 1G2IA 2OVFA 4Q9IA 4NJEA 1WB5A 1WOSA 1V8OA 2J46A 3EULA 1KONA 4PPDA 5FBLB 1IKVA 4QX6A 2ODPA 3SC6A 1TJPB 2AMJA 5DT2A 4E5YA 1GYPA 3WWYA 3U4MA 1YQTA 3GUCA 2EJBA 3IBFA 1G4HA 3QFTA 3DM5A 4UVHA 4AKGA 3TO8A 4USIA 5FUVA 3L7PA 3CVOA 3GWZA 3JQEA 5FL7A 1DTTB 1RZVA 3M9NB 4I50A 4Z49A 3USCS 4KE6A 4NBLA 2GF2A 5A0YA 1V8FA 2I2YA 4IINA 5AXNA 4PRZA 2HS4A 2H85A 4GF5A 2K87A 1HNVA 1SIUA 3FUWA 4AWBA 3FCHA 3JYNA 3EIEA 3DMHA 3AINA 4CJXA 3BKUA 1H9BA 1XQYA 3B9QA 5B7GA 3CB2A 1OY8A 1N5IA 1CJVA 2CQHA 2W2VA 1T2CA 4KSBA 5DISB 4IJUA 3A1CA 5LBIA 3G0OA 4L7VA 3HNRA 4JYAJ 5D51S 1A8UA 2HJSA 3RSFA 3AD7C 5CIWA 3H5AA 1FX1A 3PGMA 3UJHA 4G65A 1Q44A 1FFGB 1PO6A 1NYQA 3OPKA 2GZMA 5DCYA 5A5DA 2I3AA 4KUEA 4FFSA 4V0KA 1AUQA 4ZAYA 2XXAA 2FZCB 4IO1A 3KQNA 2B8NA 4JS0A 3HP6A 1G55A 4QRHA 3I28A 4QOTA 1CJUB 3IR7A 2HVIA 4JDUA 3NCRA 1JT2A 2JANA 3X1ZA 1E2GA 4QLAA 5ENZA 4JV5F 4LTDA 3RW6A 4Z1MD 4RTQA 5HQLA 4LOHA 4KGVB 1UXKA 3VOTA 1J23A 3HDVA 2AR0A 2EVWX 2PZEA 5D4NA 1F9EB 3GR0A 2LU1A 4U8YA 2E5FA 3QU9A 2G77B 4UBMA 4TL9A 1RAIB 4O1MA 3PXAA 4DX8H 4Y2PA 3UV7A 2V94A 5G02A 4EB3A 3JAWB 3RG2A 3P0FA 1HARA 4O2AB 2FSGA 1Q1KA 3V4PB 4EUEA 4DZTA 3F49S 2MSTA 4NKRA 2OMKA 5JAQA 1FFXB 3OCYA 3SQGA 3UJ6A 3KEQA 5IKPA 5AXMA 3ICWA 1XNQJ 4RVGA 4JUCA 4LV6A 2C4NA 5F64A 5ELMA 3EVTA 3DMGA 3TR0A 4ZJLA 3QVLA 4BQOA 1TKZB 1AHHA 2J3JA 3B3AA 3W04A 2EIXA 1U0OC 4YLGA 1ZAWA 3FTDA 5KNCA 3H6KA 4V39A 3KWJA 5DYYA 1KLMA 1P6TA 1B3RA 3U40A 1BMQB 1CYEA 3PICA 1ZN9A 1HL3A 4WFYA 4M5IA 3BGLA 2RIRA 1Z3CA 4HB2A 1LCIA 2GFIA 2PGLA 4M89A 4C0QC 1LW0A 2JHEA 4G1QA 4OH1A 1KVSA 3KKLA 4DCVA 4M83A 1G0NA 4WA8A 2H48A 1O0BA 3GTYX 2Y6VA 1ZH4A 3JQ8A 4WFJA 5HCNA 5J4LA 1PT7A 1KEZA 2ZRNA 4EELA 1Z7BA 2QYHA 4ARZB 3IWNC 2R68A 3BREA 3AEUB 2XYPB 2GS9A 2JJ1A 4L7QA 2CQ3A 4MLCA 3G2MA 1RLCL 5ESXA 2E7ZA 3OO1A 1VHFA 1DLIA 4MXDA 3CDEA 2HPZA 4RSRA 5B09A 4YJ2F 1IUNA 4EG3A 4YP9A 3W9BA 3NGLA 2P90A 4IFEA 3OLQA 5L6MB 2DFNA 1GQSA 2YZNA 4QWMA 4NPAA 3C14C 4XK8C 3QVOA 2XCPA 3NS7A 2K7FA 1OSDA 5BWNA 2GBLC 1IAQA 4XUEA 5F76A 5IC5A 1HE8B 4BLPA 5C5CA 1DRVA 1QCCA 1NJ8A 2H1WA 4NLQA 2FV8A 1H2TZ 2PZKA 3A1FA 3HEAA 3JPWA 2QX6A 2QN1A 1ZJ5A 1P2GA 3TW4A 2W6NA 3D3CJ 1VI5A 3FJ1A 1TL7B 1V6AA 3S2ZA 4MVJA 1Q77A 3CPHA 2WG2A 5JY6A 2WF8A 2QBYA 1K4MA 4M6WA 4QJ4A 5FTLA 2CSUA 1EFUA 3X0DA 1UDXA 5BSVA 5FL3A 3JTNA 1SQFA 4Z3DA 1NNDA 4Y0AA 4WZ6A 1FLDA 3C15C 1J97A 4IIDA 4YAGA 5AW4A 2E7WA 4JC8A 2PU7A 5L46A 1PWEA 5LDGA 4Q3OA 2PM8A 2QT9A 3TI7A 4GR5A 1T10A 3CPWR 1VG8A 2BKXA 1F14A 2H16A 4WX2B 5C80A 4HHUA 1YRUA 3VAHA 1ZTWA 3FM9A 4E2FB 4I1SA 4TWAA 4R69A 5CCXA 2ZT5A 1FXWF 3T1HB 4UXIA 4B83A 4DMCA 1WV1A 3AY6A 1YQ9A 5FLXA 2CYYA 2QMUA 3NBZC 4Q9DA 1MDFA 1U0BB 3CXCR 5CP8A 5L51A 3S99A 5D3ZA 3OJWA 3P9NA 4DR7F 4FWIB 4BFYA 1TX4B 1AKNA 2HHLA 3UK6A 4TY8A 1GITA 2XZTA 4J0DA 2ZDGA 1N2ZA 5DBHX 2B6AB 3POTA 3V00A 3V6LA 3II6X 5B1YA 3OTEA 1VKHA 2AGVA 3UXMA 1JX6A 5JMOA 1H8HA 4H3SA 3ACDA 4CMIB 1QO0A 4C5BA 4NJOA 4M5HA 1LSSA 1BLUA 2XXBA 3PEWA 3KDPA 4F3YA 4FFDA 3N58A 1V2HE 4OVKA 3G5TA 3TL6A 1ZNWA 4K7QA 3T1YJ 4N7RA 1W4RA 2II6A 4BVHA 2BE2A 2WIBA 2JVIA 5AK3A 2IUFA 5DEOA 4Z4FA 1CJBA 1PE0A 4H54A 2VPYA 3KJXA 4DLUA 4TQ9A 2V3CC 1U2FA 1LOUA 4H35A 3M6VA 3DRPB 2ZAIA 4R8RA 5T4EA 3D8TA 1YI1A 1BHJA 2L9DA 2RIJA 2BMBA 4GBED 1HFKA 3OHPA 1XQVA 3GXOA 3H17A 1NVVR 2YH2A 4RK7A 1OAKA 4UHFA 1IKXB 2QTTA 4QFDA 1T91A 3V4LA 4EJ6A 1HT1E 4QT0A 4CGYA 3CLKA 2LQ9A 3H0PA 4LZNA 5FOSA 4E5PA 5IVKA 4QOIA 4HF7A 2ZE2A 3GJTA 2CJYB 3PRDA 4JUAA 1Y8QA 4UOCA 2B7CB 1PX0A 2Y1WA 2XBUA 4OB7A 4LF9F 4IICA 3DLLQ 4I55F 3VAAA 4AS2A 3HNOA 2AC4A 1NOIA 1TYBE 3UEOA 4YP7A 2CJWA 1IHXA 4RK4A 3WXMA 3N6LA 3RFXA 2YQ4A 3WYGA 7REQB 1CUIA 1H4TA 3CBQA 4AM8A 2GV1A 1PUIA 2QTRA 4CKWA 3AOEA 5U9CA 1VL2A 4BB5A 2EYQA 4PG8A 2NU7A 1M1UA 3N8KA 2F9JA 3DRRB 1RYFA 1J4AA 4ER0A 4JUFA 4C6TB 5JARA 4G9GA 2QY9A 1M7GA 2AI2A 2REXB 2GBPA 3KOZA 5SZHB 4KYZA 3LT2A 1QZXA 4F85A 1DJQA 2DLDA 3WYBA 3AU8A 3SGLA 4GOKA 2OPSB 1MR3F 2HNKA 3NRBA 1IJKA 2DM6A 2QP9X 2YVSA 3H2GA 2ZI5A 1ZY2A 5FOQA 2I4IA 4FQ7A 3AUXA 3P0RA 3QRWA 1FNSA 3CD5A 4MB0A 1CUSA 3EFOB 2Q27A 4YCNA 2JIRA 3GBSA 2ERCA 4W5JA 2Q66A 5IQQA 2JD0A 3IQHX 2PRIA 4M0CA 1IRXA 5E6RA 1DELA 3ZZYA 2BIFA 3MRXA 3SYRA 4MKZA 4AD8A 4CV2A 4N7JA 1DLOB 4PNZA 5A7FA 4TS9A 1U81A 3ZCQA 2ZRQA 5DFAA 2IYLD 1E3MA 5KFDA 1VG1A 3KO8A 5F2OA 1XJQA 2ECKA 5TGZA 3RBZA 3OOEA 1H0KA 3DDNA 1ZH2A 1R0SA 4X4NA 4GSYA 3LOQA 3BUSA 2ZYUX 3ZWWA 1TIKA 2A30A 4YUDA 4EUKA 1WE2A 1F12A 4HC4A 4GBGA 3JTOA 2IZ5A 4QDKA 1AMOA 1HMVB 1C3XA 4I67A 3AK4A 2H1SA 2D00A 1ODIA 3TVKA 1TYDE 1RM5A 4TMKA 2I4NA 1BU8A 1TTQB 4CDIA 3ICEA 3QTLA 7FDRA 4L3KA 4MW0A 3E58A 3W9IA 4IIUA 3RTVA 5A3SA 2WJ4A 5GQSA 2NSDA 1SVUA 5E7MA 3S1SA 1FNMA 4OYHA 3QPAA 1S0OA 3OLAA 4HG2A 3T7DA 2C07A 4KKOB 1NRWA 1MUUA 1KC1A 3HCBA 1ZD5A 1I6WA 2GZOA 1XEFA 4X64J 1RT1B 1I6KA 1PL7A 2H18A 2P41A 3JQCA 5JMWA 1ZK4A 5F8HA 2GCGA 1J2RA 2V5AA 1U09A 4LSNA 2IHKA 4YUYA 4MGHA 3JQAD 4D0NA 4E6PA 3L0SA 5LR6A 4BCBA 4DPMA 2NSBA 3OG9A 1LBEA 1CJMA 2FPGA 3RU7A 4DL0C 4BMDA 4KMSA 1G3OA 3ETLA 3A9TA 2FSHA 4NPHA 2JNWA 1GP2A 5HKOA 5FTMA 1GR1A 3IE2A 3BHIA 4LY6A 3A8EA 5EE3A 3OF5A 5A0VA 4GKKF 2PUJA 2Q9BA 5LSLA 1GRQA 4BZQA 3PFEA 2GZ2A 4ZDWA 5AI9A 4DQPA 4TLEA 3HN2A 5BYSA 3KK1A 4W5NA 4NATA 1SKQA 4CKCB 2GHRA 5CB0A 3SQLA 1XZFA 1KSGA 4K9KA 4L15A 2DHGA 1L5GB 1JV2B 2IXTA 3C1OA 2XNRA 3OQBA 1C9MA 2RGBA 3HH8A 4BNIA 3UPDA 4C21A 2IYSA 4P4SA 3JQGA 3UV3A 1PFUA 2X13A 1BAPA 2ERRA 2O0LA 2VKTA 1KI1A 4JI3F 1VZ2A 5AVZA 4NRUA 4DQRA 4P9SA 3P71T 2EW9A 1QJHA 2MY7A 4JBWA 1XTIA 4DLNA 1JLFA 1QAJA 2FZ5A 1QVWA 1ISGA 2QTLA 3SI8A 1Q21A 4OV1A 2XDQB 3WJ2A 2DRIA 2X1BA 4W8OA 2B4TO 3UK7A 4CLOA 1EDBA 4O4IA 4IQFA 4X6UA 2JCYA 1VXOA 2JSXA 3LQ4A 1HNZB 3AESA 4DCUA 3E01A 3G2OA 1U7PA 2KQUA 4P75A 1NDUA 1H9CA 4BNWA 1AKMA 2OFPA 3BK7A 1DRWA 3WQQA 4MGKR 2DQ4A 2B4QA 4YVFA 3SG0A 1KK2A 5C25A 3C87A 3CNBA 1RNLA 4USHA 3PNSA 1U7ZA 1X80A 2GZSA 3DZDA 4OIMA 2XWSA 4B6FA 2AHOB 3HHDA 5C8VA 4PHTA 4XFJA 3VO8A 5JDIC 1RHQA 5DPMA 2PD1A 2I3ZA 2KW5A 5EXSA 5HPYB 4OTZA 3TUJC 4X62J 4UZCA 1XTJA 2DEIA 5E4TA 3KETA 4NDNE 1XMOJ 3AQ4A 3X2FA 3IG1A 3JD3A 2VF4X 3MWEB 5BN3A 2BJEA 3HK2A 5T7BA 1YS9A 3FDFA 5IJWA 4TL6A 4LFBF 3LANA 3ESAA 4G5QA 3AF5A 1WZUA 3MMNA 2RGEA 3CNNA 5EQDA 1CJUC 3IJRA 1Y5NB 1NKVA 5KYUA 3SIWA 5E9QA 3ZWPA 1PYOB 1RABA 4DBQA 1UAAA 1XX6A 1VQSA 1KVJA 4CEIA 2SKCA 2YY3A 1Y3BE 1D3AA 2YNMC 4MQLA 3PDIA 3TWZA 5JDCC 4GO1A 2V2VA 3PYGA 3FDJA 1XZLA 3OTWA 4CCYB 1XTBA 4P35A 2Z1NA 3D0IE 2C1ZA 1QX3A 3RFCA 3C19A 4D4HA 3F47A 4QBKA 2ZH3A 3U5ZB 1U9IC 5B3JA 1DINA 3RAQA 2V7QD 3TMKA 2C2RA 4NULA 1XTSA 2WJ3A 2W2PA 4CIAA 3MCAA 3EFBA 3F6SA 3LKZA 1DRKA 3EQ8A 1S6QB 2DSTA 1PR2A 2WAAA 1FU7A 2YCBA 3EPHA 2ZJOA 2HHSA 2F7VA 1Q7YT 4FLEA 3R3TA 2GN4A 1P27B 4BO4A 3NHKA 1E4OA 1W5AA 2A5YB 8RUCA 2WK4A 2WT9A 5AKIA 3PM9A 1Z74A 3TW6A 2VIIA 3X1XA 2LP4A 5HXAA 5SUHA 4FYDA 4CF6A 2MQ8A 3LL4A 3VU3A 3FSGA 3G68A 2QX4A 1M6NA 3IQFA 4HI1A 3W62A 4FD2A 4GYJA 1HLDA 1FY2A 4B8WA 4ZDJA 4ZHQB 1T3ZA 3ABOB 3AIKA 4CDRA 1E0KA 3D8SA 1RLIA 1SIBE 1EDZA 2W6ZA 3NLLA 4JI6J 3VU1A 2EJVA 3DBOB 4HNSA 4LC9A 3H9CA 1QKJA 4MW1A 3SX2A 2FKAA 4R8LA 2YJ3A 3B3QA 4CUJA 4HNVA 3STWA 3EVWA 3V34A 2FVRA 4JI4J 2NO6A 3FFIA 1WVGA 3BGFA 3FNBA 4G89A 2P9ZA 1UOEA 4EEXA 4JELA 3THOA 3HVWA 3PACA 1E6VA 2XOEA 1YVPA 3J7YI 4B7CA 4J7UA 1Y82A 1F2HA 4FN5A 2VDVE 5BSTA 3OWHA 1CS4B 4R1OA 4JV1A 2CXOA 4PCAA 2X7JA 2BEWA 4R84A 2R6R1 2IA5A 3HVUA 3M1YA 3OICA 2BBWA 3GLFB 1AZSB 2XZPA 1DG3A 3QNUA 4MARA 4O4HF 3QJGA 5K14B 5KTKA 5TGTA 2XECA 1SXIA 2FSPA 1CUEA 3LXRA 1JDBB 3HDYA 1D8YA 5LL6d 1CRWG 4OXRA 4EITA 2D1RA 2IOFK 4GUDA 4OAQA 4OK3A 3DOCA 3PEVA 4HACA 1QIFA 4O0NA 1QPZA 4LI3X 1RXEA 1JJFA 2ZK7A 5IJAA 3TB4A 2VJYA 3NXKA 2DNLA 1K92A 3WBBA 2Q46A 2AJLI 4OHKA 3MMCA 1IU9A 2GXQA 4YDRA 1KHWA 4LDZA 5DLGA 1PTJA 3WGOA 3PW2A 2B4OA 5LXTA 3AHFA 1Z35A 3PS9A 4YP6A 3LY7A 3F78A 3GQBB 1DJLA 4MHOA 1EFCA 3RWOA 1XN9A 4PCUA 2VHGA 3FROA 2VKQA 1MU2B 1S6PB 2C8LA 3D4IA 1KOOA 5CVDA 3NDBB 3LKDA 1X1TA 1D9DA 3EWSA 4RWWA 2E4ZA 1B14A 1BXGA 2CXXA 2DJIA 3PHJA 3M9MB 1BXKA 3A14A 5IQ6A 1S4QA 1NM2A 2H65B 4I2QA 3TXAA 1CDOA 3UICA 4V3BA 5EY5B 2FXVA 1XEAA 3TF5A 1WSWA 5AKZA 4U6QA 3REQB 1R10A 4X4OA 2VAPA 3GLFE 3JSYA 3RTGA 2UUBF 4P93A 4RKUC 3QYAA 2I8CA 2PRSA 1RHKB 3NHSA 1ZEMA 3QWIA 5A5GA 2ZBQA 2QMEA 1Z6TA 4LTMA 5G53C 1AGNA 2HLUA 1HYSA 1EK0A 5J4VA 4RD0A 1SCQA 2KPOA 4RA6B 2HLNA 4DQQA 4YRQA 3TZZA 2XGJA 1XZMA 1NPKA 3P8BB 1G1AA 3VKFA 2DHHA 4MK8A 1UCFA 5EUQB 4P7TA 1ORVA 1DQZA 2VK4A 4WERA 5KFMA 2ZHBA 2BGLA 3F5DA 2I8AA 2OHOA 3L0ZA 1QTIA 3GLVA 4WKCA 2RHLA 1ZH6A 2VTDA 4KC5A 5F3DA 4PFQA 5CJJA 4HADA 2G4VA 2ZKUA 1C7RA 3FPGA 1YQUA 3TUIC 2JZCA 1RADB 4RPIA 2QD4A 3HRKA 3EUAA 5FPYA 1CDZA 2NZ4A 1IQPA 1VJ0A 6AT1A 3GCXP 3ZTRA 4F5WA 3N2IA 1V11A 5L3SB 3NP7A 4PRFA 1KOJA 2CJBA 4Q2MA 2K06A 1GQFA 2B30A 3M32A 2X51A 2O8FA 4OYBA 4AF7A 1NURA 2GYUA 4ZCKA 1HMYA 1UW9A 1S96A 4O0IA 4US0R 4GPBA 3I6YA 3DKVA 3DVLA 5AJHA 5KOYA 2WYUA 4QT4A 4DV0F 1G8FA 4BJ1A 3ZH9B 5CBPA 1U2EA 1PJ4A 1QIJA 2ZR7A 2F62A 1NQXA 2CBGA 5J4YA 2NYIA 1EZ1A 3UT5B 2MHNA 4NONA 3KC2A 3UA3A 3UN3A 1KJWA 2BGMA 1L5UA 1II9A 3QLJA 4IZHA 3GFTA 1KNXA 4K2XA 1QCZA 1JB0C 1O2DA 3Q8UA 3N7UA 3AXMA 3KTDA 1U8XX 4FEAA 3HCNA 1BD3A 3VR5H 3WZLA 3I9LA 1PILA 3EMVA 4BB9A 1FRLA 1Y10A 4M37A 5H68A 3U13A 2HHHF 3I8OA 1WX1A 3G8TA 2DE0X 4LJ4A 1U28C 3CR8A 3SZGA 5K7SA 2XIJA 3E35A 1TU0B 2IY5B 2GM3A 3BXZA 1G3RA 4N03A 2B4KA 4R71A 3HADA 1S1XB 3VAFA 2FPIB 2H1HA 4DDHA 3BZBA 2VBYA 3X1WA 1SGWA 2O8CA 4O2BB 4RMJA 3WC4A 4MUAA 4NLVA 2IM3A 2QL5A 3T0FA 1ONPA 1P0QA 1US8A 1BC6A 1C4WA 3LH2S 3J81U 2JFWA 1CC1S 2GILA 3A3YA 1U3TA 1C0UB 2VFRA 1QH9A 1WG5A 3VPXA 1AT1A 3P9ZA 1Q82T 4ZAZA 4JJFA 4GYYA 3MYRA 1JNYA 4GE0A 5K8VA 4X66B 3SI7A 1PG0A 5K09A 1HWUA 3AHIA 4DRZA 3AC0A 2XMTA 2VR1A 2GPYA 3MAQA 1BWEA 1SRRA 3PEYA 3FSIA 1DEXA 2R1ZA 5SZJA 5LSOA 1X86B 1IULA 3FGPA 2HDHA 1RAJA 1FTGA 3E03A 5CHYA 4CT8A 2EGUA 3PFNA 8ABPA 4I2QB 2KX7A 4BLUA 3VH1A 1QCDA 4L5IA 5JE8A 4I56A 3H2YA 2Q21A 3M4ZA 2FW8A 3WMXA 4CTOA 1S72S 3R9XB 2XX3A 1J24A 4J7AA 2W4PA 1CUWA 4O59O 1HE3A 3FVQA 1Z22A 2SBTA 3QA9A 1LNZA 3TPCA 4N6OA 4GNKA 2J9RA 4I14A 1SKRA 1L7PA 4DRYA 5CTAA 1P2BA 3LUDA 1RWMA 2ONKA 1E8NA 3IAUA 2GPNA 4Y67A 4DMLA 1VJCA 4GX2A 4KYVA 4M2LA 5B1HA 1QANA 4HZGA 1U0JA 1MC5A 4P7BA 2BQRA 3WAJA 2G72A 3T0IA 1R6BX 1H4VB 3ONEA 4XVQA 3TJ8A 1KK1A 3H1AA 1ENZA 3UDEA 1GRNA 1D4ZA 4L95C 5FFMA 4YUWA 2FEKA 1K6JA 3I2HA 2GPTA 2YQ5A 5C7OO 2F67A 4K3VA 3DNPA 4X64F 2OHHA 4X8MA 5FD8A 2Y4NA 1IWGA 2DR9A 1TVKA 3LL7A 1TT5B 5FWYB 3WGHA 3BILA 5CNMA 3HXLA 4TQAA 4JGIA 1IYZA 2ZSJA 2V68A 3FWKA 5IBRA 2YY5A 2IAJA 3ANSA 4OMCA 1ZONA 3VU0A 1LDGA 5K3AA 3GNQA 2F00A 2XQIA 1Y6QA 3CMAS 5IZCA 2DFPA 4ZVHA 1VKJA 5HZHA 2YH0A 3BDVA 1OBCA 3N7TA 4L4UA 3FCYA 3EIFA 5JSYA 1UPXA 3PPXA 3QPBA 5EGYA 4F02A 2FMUA 1AKYA 1JPVA 2ZTSA 3THXB 1M66A 1O5TA 3UK2A 2B7CA 1OI3A 2OP5A 3IQEA 2VHWA 3UGJA 1N33F 3ENNA 3MXTA 1WUYA 1N2CE 4Q0MA 3D6UA 4IVPA 1GNQA 2JAHA 5EINA 2GN0A 2JIPA 3IJ5A 3FG9A 1K8QA 2ACWA 3S1AA 1U0NA 1EKXA 3LT1A 1B8PA 5IHXA 4FF2A 2NQTA 5EIEA 2WHOA 2VH5R 5AJ3F 1OD6A 1JECA 3KOWA 4UNQA 1XHFA 1R6VA 2ZRIA 3L82B 2M6KA 1MROA 2C97A 1E59A 4NZ0A 5C5IA 4IDBA 2RF2A 1VLLA 3VTZA 1NP3A 5EZYF 5ITZA 1FO1A 1R6YA 4M9ZA 4HY3A 3RS4A 1XYYA 3TYTA 3U7GA 2AR9A 3TARA 2YJZA 1FESA 1QLJA 1EKRA 1TW3A 2ZZKA 1PTKA 1ZOTA 3K94A 2QN8A 1L5FA 3FZBA 4IF4A 5JO9A 3IFEA 2HF7A 4YRMA 1F6BA 1E9VA 4QXQA 2IPLA 4GFDA 4HFJA 5EJIA 3HN7A 2BFOA 3LDFA 3QWPA 3MVEA 4BLGA 3AVVA 1FP4B 4LRWA 3BZQA 2X86A 1CUAA 1MF7A 4EARA 4ALIA 1FF9A 1UTAA 1RAHA 2GZ1A 4UD2A 1CJTA 2G8LA 2K3IA 3K2BA 1MAAA 4R01A 3SXLA 4H1HA 1P9LA 1WUKS 2QL9A 4PE5B 3KSZO 3A6EA 1RP1A 2VN8A 4F4KA 2UKDA 5F51A 1LC0A 3DXBA 4KGMA 4S1NA 2GZDA 4PS0A 2H0AA 4EJ0A 3NHBA 1ZK3A 2CV1A 2HLDD 5IUNC 3L8DA 2MSCB 1ISFA 2BI8A 4NLXA 5HVNA 5DLDA 3PD1A 1QQBA 2QZSA 3QKWA 5ADWA 1AUOA 1FK8A 4L57A 4NXNB 1RQLA 1U98A 2CUYA 4R8UA 1VDZA 2VYND 4IH6A 1FXWA 5AVUA 3I0RA 3CEMA 1Q86T 1CUZA 1MTOA 3UCEA 1LI4A 2ASVA 1ZAVA 3S1LA 1I2MA 4C5CA 4KVGA 2OIHA 2Z3ZA 2X7IA 2VSQA 1J1ZA 2ZYVX 3GG9A 1IUKA 2V65A 3EZXA 2CHGA 4KL8S 4AUEA 4M8LA 3GLHE 1JFRA 5BR1A 3EH1A 3RK1A 4DR6B 3OQ6A 3DAOA 4P2MA 3SVLA 3QVKA 4O1HA 4BBJA 4YAEA 5KIAA 3MTKA 4EF4A 2BF7A 1T95A 4GLLA 2GCPA 1XBWA 2W01A 1IKXA 2F55A 4OLHA 3TVYA 1R88A 2DNRA 5KKAA 2Z04A 4XCQA 1PGQA 3OD1A 4RVHA 4JUIA 4FFMA 2HBQA 3IQZA 1ACMB 8LDHA 4QU7A 3KNAA 1KERA 1CY8A 3U6KA 4K4YA 3U49A 2GESA 3P26A 3C14B 5BSEA 1NAQA 3VPBA 1T36A 3I73A 2DEUA 4OYOA 3BE8A 4OEHA 5T8KA 4NTZA 3S68A 3FB1A 5G0RB 4AL5A 3TCNA 2ZM6J 4F3TA 3I87A 2I7CA 2UUCJ 4N6NA 3B8HA 4OJHA 3LPMA 5LZ2A 1YASA 3QXGA 3EPIA 2P9JA 2CDQA 2X8BA 2JHGA 3L8ZA 3GJ0A 4JAVC 3OT9A 1NXWA 1CZRA 1HL6A 1VE7A 3K1JA 3CVYA 2HM7A 4FPIA 2G1PA 1X19A 3P5BA 1NCLA 4Y2JA 4GZLA 1E1NA 4RA9A 1M2HA 1QS0B 2QMXA 1B99A 2JFUA 2GETA 2DNYA 1OZAA 3GVCA 4D8WA 1N78A 3DULA 3PFCA 1N36B 4P4NA 3PHHA 4BC0A 1U80A 2VUUA 4NZOA 4RJLA 2BFCB 5KFCA 5KFYA 1XKLA 5KNDH 2O1XA 2Q79A 1E60A 4ZMBA 4P7KA 2AS0A 2AZMA 3NAGA 3JQ8B 3MUFA 2FKNA 1K7CA 6LDHA 1O97C 1JIKA 5CT5A 4OJMX 1S1VB 1M74A 2D41A 1K8YB 1JLFB 4XR4A 4LC1A 2B4UA 3TLKA 2ZRDA 5ESWA 3ZNNA 4MMXB 3Q83A 2AYEA 5L9AA 3BDIA 1HEIA 4QAQA 1ABEA 1H2HA 1QV6A 3HFKA 1T4CB 4UF4A 4M5GA 4JH0A 2NXJA 2WVBA 3CEPB 4CM3A 1LDNA 2G0NA 3Q0TA 2NT4A 1N7HA 2D7DA 4MVJH 3NOOA 4II7A 7ADHA 4EI8A 4K9DA 4YDSA 4QM7A 5JASA 3A32A 1GSAA 4BIMA 1ULSA 2GNKA 3OCVA 5DRTA 4G37A 3TBFA 4NCIA 4XWAA 3NETA 1TJ3A 1NOJA 1RT3A 1XWLA 3M4NA 2HVZA 1P6XA 1T2UA 4IIJB 1BX0A 1FJHA 1KFJB 1UWAA 5D7NA 1Q91A 3SU8A 1M5HA 1P2SA 2WOOA 4L5CA 2H8KA 4JR2A 3T12A 3RBAA 4TYNA 2X4LA 2V8GA 4DYDA 2GI4A 1A04A 5HS4A 1NSTA 3EISA 5ALTA 3PL1A 5F5LA 1JEEA 3QNWA 1WB9A 4UBKA 5HF9A 3V6DB 2EX0A 4G07A 1CS0B 5DHPA 4GDFA 2YFYA 3JQ9A 4MYHA 5C3UA 1V95A 2GN9A 1ZGCA 3SCIE 5JWOA 5C1OA 2W7OA 4M1YA 1SH3A 4DB4A 1HSOA 1GGEA 2JFXA 1JLEB 2DTJA 3R3XA 4DRXB 2LDIA 3A2LA 4IH9A 3MLBA 1RW4A 5G0TA 4ZA2A 2JEGA 2NO7A 3UW1A 1D07A 3EWIA 2QTBA 3CPEA 5THKA 3JV7A 2C29D 2RGYA 1G18A 1NULA 3BGOS 2J3KA 4CKXA 1EJBA 3AYZB 5AVYA 1A9XA 4FSXA 2MZQA 4A92A 3ZTQA 4L8VA 1VCNA 1RAGB 2DGOA 5LNK6 2AT1B 2IJNA 1M0WA 2BZ2A 2G9NA 1V35A 4LVCA 1PFYA 5EKDA 5BQ3A 1M2NA 2DCUA 1DTSA 3T7KA 3RS3A 1QHGA 3G2HA 4JLKA 3IUJA 1W1WA 3HUUA 3WKCA 3L43A 1Z6AA 2XQGA 1FFYA 4TYBA 3JWGA 5DGTA 2IC5A 5J4KA 2BSQA 2DVIA 3SZOA 4HLCA 4RZHA 1XMQB 2I5PO 1N6QA 2X22A 2DHQA 2FMIA 4LFCF 3ZWOA 5CFMA 2O7RA 4CEHB 3V6HA 4GECA 3OFGA 3SC4A 5CVTA 4NU8X 4N0MA 2V7VA 1MO3A 4G0NA 4WK3A 1VCMA 2JLXA 1DFDA 1C9EA 2CJWB 3VPGA 4QD3A 3U7HB 4YT4A 2VODA 4ZZ2A 2BHTA 1X5PA 1JQLB 4M9QA 3P5SA 1E2LA 3L8EA 2IU0A 3PUIA 3QBEA 4UHKA 1SPXA 1L7MA 4X7BA 1UWLA 4RTLA 2DMRA 4E08A 4BOYA 2G0CA 2PT9A 2WE8A 4UUBA 2FJDB 3NU1A 5I42B 4A8FA 1IMOA 4JLNA 1RK8A 1S2MA 4YRDA 2AZTA 5FBQB 5JAZA 5LYJF 3VBCA 2GGSA 4ZVRA 2ZEJA 3DB2A 3K9GA 2QRKA 4GSKA 3M3DA 5JCOC 1XXLA 2QZJA 2EYUA 4MVJD 2BKAA 5BSUA 3MTAA 4B81A 2QRGA 5IN4A 2G7ZA 1WDLA 4WGFA 2CQDA 2D8MA 3CWQA 4FYXA 2WVFA 2IUSA 1Q17A 1DOAA 4LF2A 3PE4A 3ITHA 3RIHA 3TVTA 2AK2A 1K1EA 3PQ4A 1QO9A 3MUEA 3IRWP 1PZMA 2FUG9 2A3RA 1UEXC 4X7RA 1X31C 4W63A 1S3FA 1FQWA 3RYLA 1FSSA 1SG0A 4HNUA 3JXEA 3JZDA 3TPZA 1NVTA 4XGRA 3PC7A 4PYOA 1M1YE 1XVAA 1KJIA 2QQEA 4YCSA 2PZJA 3QBCA 3JYOA 3L6OO 1XZQA 1VL0A 4LYYA 4QODA 2UXDJ 1A9QA 1DQPA 1T13A 3NORA 1YRAA 2EJWA 3NV7A 4BFCA 1X5SA 1KPGA 3SX4A 1OKKA 1GTL1 4RAQA 2AEFA 1CFJA 3B52X 1HRDA 2WI8A 5CA0F 1QK3A 2PGDA 1HLWA 4MV1A 2R7KA 1J2VA 3KLEB 1EUDB 4UVGA 1TQ8A 5EJMA 1L5OA 4GX0A 3ZTWA 3UBMA 1TTHA 4TWRA 2R7QA 4MAMA 5I7OA 4KQXA 4AUNA 1C9KA 5ETVA 1JAXA 5KWSA 1RSZA 4R8VA 2Q45A 5AUPB 3CJTA 3I58A 4TS3A 4IO0A 5IARA 3O8WA 1GUAA 4ZV9A 1PZXA 4MRAA 3FKJA 3P20A 1T4MA 1XGKA 2RHBA 1FDSA 3GFHA 2QORA 4OFWA 5A6WA 1YU9A 3ZNUA 2KT3A 2CFXA 4MP3A 3WQRA 1QIEA 2Z0MA 5MAOA 1W2GA 3DGFC 3OLVA 4DSTA 4RIFA 2ZS8A 1HPZB 3IPRA 3FMBA 1ZVVA 5L1JA 5K8MA 3DCAA 1YTUA 4CHTA 3VGPA 1X0VA 1J5OA 3TECE 2GZAA 4J75A 3HT3A 1SV5A 3LC7O 3KELA 4OHUA 4OBWA 4EO4A 5DHAA 4M87A 4B3TJ 2O3DA 1NPYA 1WVIA 3IOYA 4WZQA 5A3VA 1XL0A 2EDCA 3MW8A 4I2PA 3IQXA 1V48A 2Z6AA 3PFGA 1ML4A 1UKVY 3BB4A 4J29A 4F72A 3N8NA 2P0AA 4TXNA 5DYTA 1RBMA 2CNOA 2CXRA 4F2PA 3H5VA 2NUAA 2YQ3A 3IIKA 4PFJA 5DO2A 2XQCA 2OC9A 4Y9UA 2IJFA 3HB9A 3LPDA 4CR8A 2I78A 3IAEA 4A0HA 5CLQA 1VFJA 1YZYA 4BUJA 3NIFB 2IDJA 2XWXA 3E53A 4F3CA 3BJEA 4UHCA 3C3WA 3PE6A 2CCKA 1JAZA 2IJGX 1Y1KE 2H1OA 3TL3A 1CUBA 4QGGA 4CZ2A 1NBIA 3MJVA 4GWLA 1YR3A 3MSCA 4ZVSA 4BGVA 2I54A 2VEOA 2ZXFA 4ZOSA 2DPJA 4RS3A 1EVLA 2FXIA 2Z57A 2IEYA 2ASYA 2CPHA 1G7SA 1WY7A 1PHPA 1ETUA 2X14A 1HBOA 2AYBA 5DLPA 3DI6B 1ZGJA 3CTMA 3I96A 1Z5GA 2R7SA 2HZ7A 3U1TA 2GT1A 2IRXA 2WJZB 4L4RA 3KQSA 5TV2A 1SBNE 2ONCA 2OQ2A 3URMA 3ND8A 2BFAA 3VNVA 4NYOA 2IITA 5DDIP 3R6WA 3HKWA 1HLGA 1UL3A 1WMBA 4N48A 1LPAB 1NVEA 1XK7A 2DPMA 3DKPA 5IC4B 4JQCA 4Q82A 4JV2A 1M1GA 3GEEA 1VQ5S 3LSTA 3OF3A 1EKSA 4LRXA 6ADHA 3CCQS 2QLBB 1JTEA 2KJQA 5D6OA 2J48A 3O8QB 4HXFB 3RUFA 1JJCB 2VONA 1UM8A 4EAQA 2ZVIA 4TNOA 4OZ0A 3V1MA 3IPAA 1DWPA 2HU8A 1MEEA 3AB8A 2CK3A 1TQHA 3WLNA 1CPZA 4DX7A 1DKMA 3N2KB 5T3UA 4ZK6A 3VGTA 5B1IA 1H4QA 2VYVD 2PXAA 2H6EA 3ZD6A 4ZITA 2DR2A 3GL9A 5IFKA 4JGGA 1GLVA 1R0WA 3KR9A 3KT8A 2AG0A 1ZU5A 3E5RA 3CCMS 4M1QA 4JLWA 3L8YA 1SOMA 1MXHA 4D8XA 1LA2A 4KH1B 4MI1A 5AOAA 2C7QA 4POOA 2F9LA 1E2DA 1TT7A 2Y8YA 4G0WA 4OBEA 2REQA 3JR7A 1ZH5A 2VT3A 2PUDA 1GA4A 2VT7A 1NC1A 3CQ9A 2O1SA 2DGWA 4H4CA 4LF4F 1JLSA 1MU2A 3MEQA 4RVNA 1XMSA 1EP9A 4X3OA 2OG1A 1TKXB 1S1XA 4CDNA 4AFNA 5HIIA 1R00A 2PN1A 5BUCA 3A6ZA 2OAP1 3EHEA 2GPSA 3DE1X 4IFVA 2O67A 3WBKA 3UMRA 5CTJA 1NHUA 4OHRA 1OLOA 1Z73A 5DMHA 1J0EA 3A2MA 1FRIA 4FFWA 5DB4A 1APSA 4YXWA 4YB7A 1P81A 3OSNA 1NVGA 3G1WA 3UWSA 3DMTC 3V9PA 4B85A 1ZSNA 3SD7A 4YACA 1L9KA 2R3SA 3RC1A 4CLKA 4N3AA 1WW8A 2EW8A 4L4YA 4I8DA 2ZJPQ 3N76A 3QT5A 4RZ2A 4BO2A 4DG1B 2V6FA 4YO7A 4I55A 1KQOA 2C2XA 4B2IA 1EQUA 2ID4A 2GMWA 3ZWAA 3M33A 1E4VA 4WAUA 5SZIA 4EG6A 2ZD1A 4KK4A 1DMRA 1YJ5A 1XLWA 5LP6A 2X5XA 4DANA 2BVZA 4WYWA 3PSHA 1S9EA 3K58A 2W2QP 3CC7S 2AUMA 1YZHA 4MVYA 4TLBA 4LF9J 4LQCA 1G0OA 2BM8A 4RNOA 3DMFA 3G7SA 3IMEA 5TPZD 5HQTA 4DJ5X 3E1SA 4QICA 4Y2UA 1U1DA 4HQOA 3R5SA 5B37A 3HGMA 1RWMB 3WKDA 5K6AA 1D1UA 3UNGC 4R2HA 1Y00A 1Z0FA 1QP8A 2D7SA 1EZZB 3BE6A 1YJQA 1UKBA 4WJKB 2F17A 1GMWD 4FGUA 1U2PA 3LNCA 2X0RA 1H69A 1PD1A 2NQ2C 1X74A 2Z83A 1XD2A 1B16A 2O2SA 2P67A 2WVDA 5DQIA 2VP9A 5CB4F 1UFWA 1B74A 2PX4A 2DOKA 2OGTA 5EC8A 2JLUA 4U7FA 1WC5A 4EP1A 4P2XA 4V2UA 3ZVMA 2HDOA 4RNFA 4XQCA 2HXGA 2DBBA 1NNI1 4KODA 1K63A 1FDNA 2GQCA 4ZYXA 4BQQA 3VHQA 5AVXA 2Y1GA 4RJ2A 2Q2WA 3UENA 2QFJA 4P2GA 1T0PA 1JHZA 1X4GA 5ARDA 1T5IA 2LDXA 4AKTA 4LJ5A 3G3EA 5JLAA 2PMDA 1FMFA 5JAHA 4ALMA 2AXQA 2BI7A 3X1MA 4LY9A 2HLTA 3WRWA 5M2UA 4IRMA 4MINA 1M3SA 3VDRA 4IQMA 5IMSA 3D7NA 4JI5B 4TVOA 4A8YA 4EATA 3KDAA 3UANA 2B2NA 1ODKA 2YV1A 3AONB 4XVCA 4ICLB 1S9HA 2QG9A 4MFBB 1R6DA 3KMSA 5TMPA 1XZPA 4BXOB 1CRLA 4B74A 3KBOA 5IV4A 2Q3MA 2C3MA 3T9DA 4XTTA 1A71A 3MAAB 1C0EA 3PNIA 2GBGA 2VG7A 5TQVA 4TYMA 2Q3LA 4UBJA 4DL4A 4XM0A 4N0PA 4F45A 6GPBA 3SICE 3RT1A 3CJ5A 4XWGA 1KQPA 3BKTA 2P68A 4Q5VA 2XYGB 1U48A 4M95A 5CD4H 4D92A 4HMQA 1S4MA 2MINB 3GFBA 3W5UA 2PV0A 2Y1KA 4GXRA 1ENOA 5GAHU 2DBYA 2YN4A 4D9FA 4LZJA 3C4JA 3FCWA 2Q8PA 4DADA 1VYHA 2IXFA 3AJDA 4Q8FA 5AKLA 5HRAA 4QELA 4USKA 3SEAA 4RXUA 1S7CA 2XULA 3GYNA 4HWPA 3R5AA 4RL4A 4EENA 5TPZA 3AR2A 1JXEA 5C24B 5FUBA 1VQOS 2DWUA 4ZPXA 1F51E 3OAAD 4KMMA 4FUTA 2VQ3A 4P7VA 1ZA1A 2XEDA 1N2IA 4Y2VA 1E2HA 4LHVA 3D2WA 4GZ3A 3BXFA 1QSYA 2QYTA 2JHFA 4A1FA 1ADCA 1RAAA 1ZUNA 3M9OB 3ABZA 4HNTA 5K8UA 2PMFA 4RZXA 3KVVA 2OE2A 2P65A 3OY7A 3MEDA 5DSTA 3RUHA 3OE5A 2XMKA 3KT0A 1T0TV 1NBEA 3W6PA 4IH4A 1WHTA 2AGQA 1P7VA 3KLBA 3HCWA 3WB9A 2JCGA 1N2XA 4KN6A 1LLUA 4W98A 5I9NA 4R2MA 2RE8A 4ZPCA 4BO5A 1LF5A 4URQU 1FP1D 3M34A 2ZUFA 4L5JA 2A0WA 4I9NA 4C2UA 4NBVA 1IKVB 2JL9A 2QYOA 1UJNA 3PQDA 1OTXA 2DKOA 1G41A 4PPZA 4K8OA 4GWGA 3HUDA 1Y3KA 2NACA 2WA2A 1FUKA 1FJ2A 1G20B 2O0HA 2DT8A 4Y2HA 1DC5A 2J76E 2KM8B 2QX7A 2GMHA 2B0CA 3EMTA 1G5TA 4MP6A 1CY7A 1B1CA 1UM9A 2BC9A 4NLOA 2FP3A 4CM4B 1Y37A 1IN0A 4A8WA 2IDKA 2C2KA 1U1GA 3AJ2A 5A0TA 4IHQA 2C61A 3EZYA 1MSWD 3EVNA 1HX7A 4BBYA 2EBEA 1XNQF 2IWRA 3FDIA 2R1TA 3TGWA 2W4DA 2A3JA 4YS2A 3GCZA 3RTCA 2BEFA 5FLXU 4KXNA 1Y9JA 1ZHHA 4WXYB 3FSRA 3V1LA 5K5EA 2I6UA 3RRGA 5CH3A 3CEDA 4RWXA 4PU0A 2PYDA 1W4AA 5TQ0B 4TZ6A 4MCJA 1S1MA 3Q3JB 1JMYA 1YMQA 3Q40A 4L4ZA 1UDAA 1X7WA 1LLQA 3THRA 5C51B 1LLFA 3WWZA 3E22A 4CM8B 1KMMA 2J3MA 3U62A 1F2TA 5I8WA 3S8YA 1E6LA 1BE6A 1RXUA 4MYRA 3MCNA 3O93A 1KDTA 1UA1A 1SH7A 2PZ8A 4JFAA 2WTEA 3C0KA 2WBLC 2PNFA 3IAXA 4DWJA 4DV6J 3FMOB 1ZYQA 4DCSA 1T2DA 1D2HA 1DHTA 1AC5A 2XMUA 3KXDA 2GJ8A 4PXBA 1GGJA 1CULA 3BBFA 2WBRA 1SUCA 2GN8A 1DKNA 1ZO8A 4NAUA 1GOTA 2JLGA 3KM0A 3ANYB 1HDIA 1WAMA 3L0DA 4WESA 3WR5A 1JA1A 1VLVA 1HIYA 1GA1A 5HKKA 5TE9A 1PJ6A 3O8LA 2I67A 1SRQA 4KVZA 3EG9B 2BT4A 2IXGA 2VAVA 4WK6A 4YH1A 1IUJA 3M5WA 1SB8A 4WLOA 1IY8A 3ND5A 4C4ZA 4NZPA 1MN9A 3PXBA 2D4HA 1IHUA 2XQFA 2YKMB 3D7LA 4WUVA 4BMVA 4OYXA 2B25A 3U26A 2VHQA 3JQJA 3CJ0A 3FPAA 4UUQA 4FZRA 1U2DA 1VPVA 4JJEA 4CG1A 3PRJA 1OQAA 2Z6VA 4E11A 2XTAA 1S0UA 4PCLA 4R8UB 2YNMD 1P1CA 2X2OA 5GAGU 3R6GB 3OHMA 3PFIA 1UETA 4KJXA 2XUOA 1RZRA 5CGZA 3TUZC 2Q7DA 2IEZA 4FYMA 2XUHA 2B99A 4KO8A 4QDXA 2EERA 5KOXA 1EDEA 3BBPA 4ZPBA 1UKUA 4UBIA 1PJSA 4PLGA 4QWWA 1R37A 3I0ZA 2R7OA 3U7FB 3PSAA 3NNAA 4TU8A 1P1BA 3EK2A 1SJ3P 3THTA 4LNUB 2HEIA 2G2YA 3V6JA 2OUKA 3BC1A 1IOWA 1KJQA 3FGNA 1RRFA 1XR6A 4Z8YA 3Q3HA 2L41A 4X4VA 2XOKD 4KQFA 3WGTA 3NBUA 1BIFA 3IEIA 2R7AA 4ZT7A 4A36A 2YBVA 4LJKA 4B4VA 3HJVA 4PICA 2RH4A 5AHXA 2IYYA 3GUYA 1VI6A 1F2UA 3FMPB 2JIOA 2CHEA 3BRWA 2D0IA 4JNKA 4QXRA 1BXNA 4WZBA 3R7BB 2Q6TA 1V4NA 1XP5A 3K5MA 2Q0HA 1XP8A 4F0KA 3KB1A 1EFKA 2FETA 2RGDA 4FS2A 5JH7F 1Y1LA 2BUAA 5CH5A 5CYFA 4IKEA 1WMFA 1W4CA 2OJ3A 1RIIA 3DBLA 5DN6A 2AV6A 2VDRB 4KKVA 4JBIA 3DNMA 1SC3A 1BMQA 4LHXA 1NB2A 3W78A 3CKLA 3IP3A 2BRUA 3SC3A 3G2QA 3GFQA 3EF3A 3WK8A 4I81A 4DJTA 5AVOA 3ITKA 1X8JA 2G82A 3H5OA 2OGZA 1IN4A 4EMSA 5L9NA 5EHHA 1M76A 4M8KA 2A86A 1Z6ZA 1RKIA 1VJQA 4ECVA 4M0PA 4CLOB 3ZDAA 4HFMA 1KHHA 1Y5IB 1BD6A 1CS4A 1YA8A 3C46A 4OZJA 2WZCA 2XTZA 2PT0A 1P17A 4LNAA 1WZEA 4Y6QA 2H2HA 1J9EA 4HUQA 1AMNA 2KHCA 3GV0A 4O2AF 2GHWA 1PEYA 3UD5A 1T5SA 1LUAA 1E5XA 1T26A 3I23A 4LHEA 2G04A 4MK7A 5DETA 3T7IA 3ENWA 3L8HA 1R8PA 1URNA 5J2UF 5HDBB 4R68A 1WSAA 4DFKA 1TFRA 4NABA 1RRMA 4XDCA 4QYIA 3LW7A 4KO3S 1RTTA 4AICA 2QRMA 1N48A