2B9UA

Crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from sulfolobus tokodaii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
176
structure length
176
Chain Sequence
b'MPFEFENLGMGIILIKPKVFPDKRGFFLEVFKSEDFTKMRIPNVIQTNMSFSRKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVIYFITHNEYSPPHERCISYSYIDWPIKEVIISDKDLQCPSLEKAEVFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
publication title Crystal structure of dTDP-4-dehydrorhamnose 3,5-epimerase from sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Isomerase
total genus 37
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b9uA00
3RNSA 4EROA 2QDRA 1ZZCA 4XFBA 1YWKA 1VR3A 1Y3TA 3HT1A 4HLTA 5KHGA 1YUDA 5F1RA 2QVSB 1WGPA 2Z69A 4BHPA 1UW8A 1CAUB 4Z07A 4F8AA 1CAXA 1HW5A 3LOIA 5JSPA 5FLJA 2XL7A 4E2SA 4BH9A 1WA4A 5D1IA 2K9ZA 5JAXA 1CAVA 1LR5A 3IDCB 4FBFA 2XKOA 3LA3A 3EHKA 3FFQA 3NSTA 2D40A 3CJXA 1Q3EA 1OFNA 3SHRA 1ZRFA 1CAXB 3NJZA 1ZX5A 4JVAA 3MPBA 4LULA 3FE5A 3SCHA 1CAVB 2ET1A 4IEVA 1H1MA 1QXJA 3H7YA 4KWLA 2EVXA 3LZZA 5KBFA 2K0GA 2QNKA 2BNOA 5FPXA 3DKWA 1CX4A 5LEKA 3BPZA 4DINB 4Q0SA 4IESA 4META 3FJSA 4LTAA 2B5HA 2CV6A 3WW2A 4H7LA 1CAWA 1RUOA 2QJVA 3WW4A 5K8SA 2PTMA 4AQ6A 4PIYA 1DZRA 4EWEA 1YFXA 3FWEA 5I0SA 2BNMA 2ZCWA 2B9UA 4MGKE 3SCGA 1O5LA 3IWZA 5J48A 2GC0A 5I91A 2FMYA 3UKNA 3GBFA 1VJ2A 5BY5A 1CAWB 4I01A 1J1LA 5I8YA 2IXCA 4XF0A 5C8WA 4OFGA 1J3RA 4Q0UA 5FDBA 1O4TA 1QXRA 3MZHA 5HI0A 4ONUA 4XFFA 4XF9A 3VHRA 4J1WA 5KHIA 4I3PA 2MNGA 1PMIA 3OCPA 1Y9QA 4HMZA 2XLGA 5LRRA 2C0ZA 2PQQA 5I0RA 3CL1A 3N4MA 3BALA 1XRUA 4XF1A 1L3JA 1ZZBA 4P9GA 4KL1A 2O1QA 3GYDA 1ZZ6A 3H3ZA 4QGNA 2IXKA 3B02A 2V09A 2XL9A 2HKXA 3CF6E 3E6BA 4MGIE 3E5QA 4YRDA 3PNAA 1ZZ8A 3DN7A 4X6QB 2PA7A 3NVCA 2PFWA 5CVRA 4BIFA 4KWKA 1CGPA 4UXAA 2GAUA 5AVPA 1YFUA 3EO6A 1O3RA 1GQGA 3OD0A 5E1RA 1X7NA 1XE8A 3E6DA 1JUHA 3CEWA 4LA2A 3TNQA 3H1WA 5FQ0B 3CO2A 5LRSA 2OA2A 3H9AA 5FLHA 4KWJA 4IERA 3G7DA 4Q0VA 5T3NA 1ZVFA 3L2HA 2BGCA 4X6RB 4UBHA 3M3IA 2D5HA 4WVZA 1J59A 5CU1A 2BNNA 1O3QA 5BPXA 1O7FA 3BB6A 1OI6A 3ES4A 4XF3A 4XFCA 3S7IA 4IEZA 4HVOA 4NVPA 2GZWA 3FX3A 1UIJA 4KU7A 4LEJA 3U11A 2OZJA 1SEFA 3H8UA 5BXXA 4FAGA 3OTFA 1Q5OA 5I8SA 4N9IA 1QWRA 3MYXA 4MUVA 3RYPA 3SMHA 4A2UA 2GH2A 3R6SA 3KMHA 1UCXA 2GU9A 1NYWA 3WW1A 4I0BA 1V70A 1FXZA 2UY8A 5EFUA 2ETEA 2CAVA 2VECA 2UYBA 4TLFA 3USSA 2XHKA 4HSLA 2XGXA 4QXKA 4HVQA 2XLFA 3EJKA 3ELNA 3IIAA 1PM7A 4LUKA 2Q0AA 4EWDA 2VPVA 3DL3A 2GC2A 1DZTA 2CGPA 2O8QA 1YFYA 2OPKA 4HN0A 4IEPA 4QMAA 4IEQA 3S0MA 1J3QA 3IBMA 1EPZA 2PAMA 2E9QA 4FAHA 3HIFA 1X8EA 2XLAA 4ZU4A 2PHDA 1TQ5A 3KSCA 1RL3A 2WC2A 4ZU5A 1X8MA 4J1XA 1ZRDA 4BYYA 4QM8A 5LEJA 1SFNA 2IXLA 4XFGA 4FT8A 3S7EA 4AVCA 2WFPA 2UYAA 2MPFA 4EWAA 3E97A 3IDBB 2GC1A 3H3UA 1UPIA 4Q0PA 3M70A 2BEOA 1GQHA 2Q4SA 4R52A 5E16A 1DGWA 5J7MA 2D93A 5KHKA 2P17A 4WBBA 5CADA 4QM9A 3SCFA 4XFHA 4JV4A 2B8MA 4XFAA 2D5FA 1DGRA 4HSJA 4MV2A 1LKNA 1OMIA 3OGJA 3KCCA 3DV8A 3HT2A 2OYZA 4F7ZA 5JSOA 1VP6A 3U10A 4HN1A 3UKVA 3QACA 4IEWA 2MHFA 1O5UA 3KGZA 4YYOA 3ACLA 1QY4A 3I59A 1ZZ7A 2PHLA 3OF1A 4IEOA 1YLLA 3ZDSA 4R8HA 2HJIA 3O14A 4UBGA 4MX3A 3H1MA 4AQ2A 2VQAA 1FT9A 2EAAA 2FQPA 4XFIA 4QGLA 4E2GA 1ZREA 2BYVE 4EV0A 2KXLA 3I59B 4I2OA 4D7SA 3ETQA 4LA3A 4PJYA 4E2QA 4GULA 4QGMA 4Q0QA 1OD5A 2Q30A 1O3TA 4AVBA 3WW3A 4D7TA 3FHIB 5EZWA 4QX5A 5KHHA 2ZKLA 4OLLA 3JZVA 3UKTA 4XETA 1RTVA 1RGSA 3H50A 4MH0E 4XF4A 4YARA 1I5ZA 2PAKA 3I7DA 3HQXA 3FZ3A 1WLTA 3RPQA 2I45A 4MGYE 4MZUA 2Z2SB 1ZNPA 4KU8A 5BUVA 3PLQA 1UIKA 4O9EA 1FI2A 3RYKA 1ZRCA 2ET7A 1YFWA 5JR7B 4IEXA 2H6CA 3ES1A 1H1IA 4IEYA 5FCCA 5BV6A 5I93A 3LA2A 2IXHA 2UY9A 4N9HA 2IXJA 4I09A 3RYRA 4I02A 5J3UA 4HZFA 2IXIA 3EQEA 3SXWA 3D82A 3LAGA 1EP0A 4MGZE 3E5XA 4O9GA 2XKPA 3NKTA 4AXOA 1NE6A 2ATFA 4L2NA 1NXMA 2CAUA 4IETA 4L11A 3E6CC 1IPKA 3BCWA 3U0ZA 4PIZA 1RUNA 3RDIA 5I8TA 1U12A 4PIXA 5FPZA 2Y0OA 3TNPB 2PAEA 4LUMA 1I6XA 4HBNA 1O3SA 3I54A 3D0JA 1EYBA 1XE7A 1ZZ9A 5KHJA 2EA7A 4LLOA 4YSFA 4YNIA 3LWCA 4CYDA 1UD1A 2IC1A 4B29A 2N7GA 2GC3A 4XEZA 3LA7A 1SQ4A 3NL1A 1Q43A 3ROUA 2Q1ZB 4RD7A 1X82A 2QCSB 3H1YA 1YHFA 4AVAA 3E5UA 4WZCA 2DCTA 3EBRA 4ORFA 3BU7A 3RZZA 3KGLA 1ZRRA 2H6BA 3QOPA 4Q29A 3PVBB 1NE4A 5I0TA 4ZU7A 5JCTA 1G6NA 2PYTA 5C6CA 4HVRA 3CLPA 4JTOA 4Z82A 5I0UA 2H0VA 1EY2A 2OZ6A 3MDPA 4JTNA 5FQ0A 3C3VA 4I0AA 1LRHA 1NZCA 2F4PA 1LB2A 1J3PA 5JSRA 1RC6A 3NW4A 3D0SA 4K8FA 1J58A 1IPJA 1CAUA 3H7JA 5FLIA 4IEUA 3ST7A
chains in the Genus database with same CATH superfamily
3Q8CA 3NKGA 1W39A 3GALA 5JR2A 4GKYA 3HT1A 4HLTA 4L0PA 3USUA 5KHGA 5DAPA 3N9QA 1PO23 3OOXA 3H8XA 1OA4A 1HV0A 1UW8A 4BHPA 4W6WA 1UQXA 1F4AA 4PBOA 4QD2A 1HW5A 4XUPA 4CU8A 1AL0G 2E51A 1G7YA 1V6LA 1UZWA 2ILMA 1AVBA 3T4VA 4E2SA 1EV11 1RHI3 3NJVA 4EN8B 1C3HA 5FZEA 3USUB 3K77A 4XDOA 5M0TA 1JZ5A 3IDCB 3VKLA 4YZ5A 2ZGOA 3TEZA 2DCYA 1KRIA 1WCKA 2NYYA 5IJRA 3DUIA 2VTXJ 2WO1A 2XWBB 3CDZB 4K3UA 3ZYIB 4XJZA 1ZRFA 1KS5A 2RM22 4NHXA 1NCQA 4K1YA 4TTGA 3AYCA 2Y64A 4YLZA 2GMEA 2AACA 3AMPA 1ULGA 3VHPA 1MZ5A 1GOFA 2RS11 3ZXAC 1SZBA 4PLNA 5AVAA 5FMOL 2ET1A 3SNMA 1DGWX 3DGTA 5FPBA 4CUGA 2WZR2 1RIRA 3RQ0A 4PQ9A 4IDZA 4OUSA 4CCLA 1R1A2 4WM7A 5JXHA 5FZLA 1D4M1 2C5DA 3V56A 3LGRA 2PHTA 1NCQB 4O65A 1NCRB 4YM2A 4YW5A 2BW8A 2HYKA 2RVAA 3VBSC 1QOOA 4E4HA 4QPGA 5F32A 2D3RA 3WQ0A 2D44A 3DKWA 5FPXA 1CX4A 3A0NA 1VBC3 4DINB 1O4YA 1SLIA 3FJSA 3ACIA 3C7OA 1HXS3 4UFJA 4WM7B 1JZ4A 4IGPA 2ZEXA 1UNBA 3H0OA 3WW2A 2W0XA 1QJU2 3ZSMA 1CAWA 2C9AA 5LCWL 4B4PA 4Q4Y1 3CMGA 3PMSA 4LXLA 1RMU3 4XDPA 1FMD1 5FY1A 1SHWB 4BMBA 3ETPA 3PTYA 3ZFFC 2EICA 4PIYA 4P9LA 5AC92 2SLIA 4OYUA 1E5SA 1VPHA 2BJSA 2ZCWA 4N53C 4NMIA 3U78A 4KGGA 5J7MA 1YRZA 1SPPA 2GC0A 1JZ3A 3UKNA 1GU3A 2RR11 2A3YA 3T3YA 1CAWB 1LGCA 5A32B 1J1LA 3SH5A 3VKOA 3WF2A 2IXCA 2MEV3 4DFSA 1XU2A 3I2GA 4LT5A 1ENSA 3TBDA 4Q8LA 1K42A 4YGDA 5TSWA 1AXYA 4LIUA 1O91A 1R083 3ZVXA 1K3IA 4ONUA 4Q4W3 3POJA 3WF3A 4XUOA 1PGL1 3LCPA 4FO9A 1HQNA 4J1WA 1MZFA 3VHRA 4FI9A 3N9LA 4WV8A 3GZAA 1F31A 4CEYA 3Q9OA 3NJYA 2Y60A 3VHNA 5A7NA 3LEIA 5K9YA 1COV2 4HMZA 1RXFA 1C8M2 5LRRA 4Q26A 4CPBA 2DFBA 2C0ZA 4AI9A 5C4WA 2OUJA 4Q4V2 2XVLA 2WLPA 4Q4X1 1UL9A 1OSGA 3BALA 5L19A 2P34A 4P9GA 4KL1A 1H30A 3KV9A 2XH6A 3QH6A 3N7JA 5FZHA 1O4ZA 1NZIA 3K48A 3H3ZA 4QQOA 5ABJC 1XOYA 1PIV1 2IXKA 2XL9A 3GBGA 3IIIA 1DLLA 4AFCA 3D4KA 4MGIE 4ISQA 4R9CA 4W65A 4O7XA 4YRDA 4DXRA 3NNJA 1TG7A 2WNVA 5C4WB 3VUOA 1XSRA 3DN7A 3DYPA 2WKKA 2G9ZA 1HB2A 2E33A 1UMZA 2DV9A 5F3IA 1E5HA 1CGPA 1F5FA 5AVPA 3C7FA 2WIIB 2DCKA 3EO6A 1DDLA 3OD0A 3O1OA 4N90A 2YC0A 3O0VA 4ET7A 1A8DA 2VE1A 4K8RB 1XE8A 3E6DA 4QHBA 1REEA 2W68A 3H1WA 1BVP1 4Y26A 3AC0A 2B4KA 2DU0A 4KWJA 1V9U1 3WP3A 3G7DA 1DHKB 4R9BA 2XB6C 3KT4A 4FVVA 5A7WA 2VVEA 2RS52 5IVFA 3L2HA 4GAZA 4BLIA 4CXWA 1XBFA 1G9AA 3M3IA 1OKOA 1S0GA 2DWRA 2HWB1 5FPVA 4H2AA 3AKTA 4DXTA 4CUCA 1O3QA 4M00A 4LBQA 5JZGA 1WW5A 4LK6A 4XF3A 1UYXA 1IQDC 4JGZC 4CTEA 3M3QA 1HRV2 4FPKA 5BNPC 1DYPA 4HFSA 5A7WB 4FPHA 2GZWA 3FBMA 1ASJ2 4Q2FA 4XILA 3ZYHA 4YM0A 1JW6A 1W9TA 3U11A 4FQZA 1ZYBA 2XJUA 1R64A 2RMU1 3K3NA 5BXXA 4W6XA 4FAGA 3OTFA 2DBNA 1Y7BA 4LBQB 5GZDA 5JZGB 1H6XA 4Q1RA 4JGYA 4N9IA 3WDYA 1AYM1 1GNYA 1OOPC 1ZBA3 4QKBA 3C2UA 3MYXA 4MUVA 1UXZA 1VLNA 3SITA 2GH2A 1LHWA 4N43C 4Y33A 3UGHA 1DFQA 1FATA 4XOGA 3OYWA 1AR81 2VMIA 5CZKA 3LD8A 3AKSA 2QDNA 5FP4A 4MG2A 5FRAA 1UKRA 3CIHA 4KG0A 2ETEA 4CCCA 2WNUA 4JGYB 4BZ4A 4LORA 5BNNB 2VOTA 1OT5A 3AXDA 4HSLA 4HVQA 1DCSA 2CHHA 3ELNA 1PMHX 4EWDA 2R49A 1CIWA 3KD4A 4YW4A 1S0DA 3S6PA 2P4EA 1W8NA 3UJOA 1RUF3 1AR93 2ZS6B 2WNUB 1Q8QA 3NJXA 4IXLA 2Y8KA 3KF5A 1DU3D 1MS0A 2O8QA 4CCDA 3JD71 4QMAA 1DQ1A 1GSLA 3AYDA 3O7OA 1VBA3 2DURA 5F9TA 3MLLA 1WW6A 2E9QA 2D6KA 1W90A 4NPLA 3HIFA 4LO8A 1VMHA 2BGOA 4ZU4A 1TQ5A 5BYNA 4BXSV 2ZMLA 3ECQA 4ZU5A 2O8OA 1YI7A 1D0GA 2BOJA 3RZJA 4DPNA 2C9KA 3CHXA 1SACA 4QQHA 1SFNA 2GMMA 4OI4A 1QJFA 5LY2A 2YU2A 1OFSA 5FZ7A 2ZJCA 1W9WA 4D94A 1QJX3 4RHV3 1KXGA 1OLQA 2NQYA 4EWAA 4Q5OA 4DEVA 5A7SA 1POQA 3N9OA 5EIYB 1DQ2A 3M7AA 5GZCA 1CJDA 4QKDA 3JB8A 1IS4A 4YW1A 2WWJA 1UPIA 1OLMA 2D7FA 1ENXA 1TMF3 3A0KA 1QJZA 5FKBA 5E16A 3R4UA 1Q8VA 2HWD1 2ZGNA 4GB31 3I8TA 1POV1 3KS7A 1YQCA 1UPSA 2WQZC 1ULFA 2AZ5A 5HPOA 1OUXA 4E4SA 2ZGLA 1OQ1A 2ZEZA 3AMHA 4H7MA 4BXFA 4P08A 3VLBB 3RFRA 3BODA 3LKJA 5LATA 4HSJA 1SLCA 2Y6GA 3TWIA 2JDKA 2PELA 2VY0A 2VC9A 1EV12 1MR5A 3KCCA 3I97A 2DF7A 2OYZA 1Q8OA 1JI6A 3PURA 1R091 2PHRA 4IEWA 1WCDJ 2KA3A 1O5UA 1RUG3 2ID4A 2W92A 4EZ4A 3LOBA 1HN0A 3ACLA 1MS3A 3SLIA 3VD9A 4IE0A 2VNRA 4PF5A 3IAQA 3I59A 3OF1A 3ZDSA 1UU6A 2A5ZA 2VZVA 3RZGA 1WW4A 4LE3A 5CB7A 4R8HA 4AEDB 2RDRA 3WDXA 2RS12 3ILNA 3JQXA 4BA6A 5FZMA 2CGOA 3RRDA 4AQ2A 3VBOA 4C1XA 5A3LA 1FT9A 2XJTA 5C3SA 2YU1A 4CEWA 2K46A 1QNWA 2R071 3OGRA 1ZREA 1D4M2 2QQPA 2KXLA 3I59B 1KJLA 4I2OA 4QX8A 1URXA 3RI9A 2OT7A 4IV3A 4JZRA 4PT6A 1PX3A 4GULA 2BBAA 2YV8A 2Z5WA 4QAWA 4XJAA 2LRPA 2ZZJA 5BNOB 4CEWB 4MSVA 4LBOA 4DO0A 3WX5A 4D7TA 1QEXA 1JU3A 1RUC3 1Q56A 5EZWA 2P6CA 4Y22A 2E7TA 4GJZA 3KHBA 2F17A 3V0AB 2ZKLA 2VZOA 1NA1A 2PHUA 3UKTA 1VB4A 3I2JA 4JHTA 5FZDA 5CFDC 1B09A 4Q4Y2 4Q1PA 1Z7S1 2VR4A 4ATEA 3NV3A 4G9SB 2GN3A 4NN0A 1FMD2 3OB8A 3AYEA 1NX9A 1I5ZA 2WO2A 1O6UA 3B93A 5AFEA 1US2A 5E6HA 1ZA4A 5A3WA 2WA3A 4M3CF 3RPQA 2VMCA 3GM8A 4Y22B 3WEZA 3VKNA 2Z2SB 1NA1B 4FOQA 3MI8A 2RR12 2UWBA 2X10A 3ACFA 3P6BA 3PLQA 4KU8A 3LPFA 4K1ZA 3AB0A 3NAPC 4TLGA 3O5SA 3WDUA 5A3NA 2VNGA 5ERLA 4MGSA 2VUJA 2CU5A 3POYA 2Y6HA 2P3IA 4RS5A 1YFWA 1ZA7A 5FREA 5IHRA 2PHWA 3WG1A 2ZOEB 2A7AA 5FZ4A 5EJ1B 2H6CA 5DDJ1 4W8JA 3ES1A 3VD3A 1PGL2 5FMOS 3APBA 4IEYA 2AC1A 3HQUA 2VQTA 4BK4A 3IT8A 4CXYA 3WP5A 2R073 3WV6A 3KQ4B 4RS5B 2A6XA 1CONA 2PHXA 4I02A 1B35C 4Q4X2 5FWEA 4K21A 2VTFA 3AL5A 3ENRA 4MGZE 3DXUA 1SCSA 3E5XA 3K4ZA 4IE7A 4NPRA 3T0AA 3VD5A 3NNGA 4Y1VA 2ATFA 4AXOA 2ZGPA 1QXPA 1PIV2 5IVEA 1UZ0A 3MIDA 1IPKA 5D8AA 3WG3A 4IE4A 5EYYA 5JOXA 3UGGA 1U0AA 4V1PA 2JG8C 1W05A 4QKNA 4ITCA 5FYUA 4NO4A 1N3OA 4CCMA 1JH5A 3D8CA 4A3XA 2PAEA 1I6XA 1O3SA 4H55A 3I54A 3LE0A 4OMDA 3W20A 4AVTA 1V6JA 2YUEA 1AHSA 5FZ3A 4LKDA 4AHYA 4DIQA 2WS91 3GJAA 3K2OA 5D8AB 4N8MA 4D7YA 5KHJA 1H8TC 2Y6FA 4CDQC 4YSFA 4Y5TA 4KI5M 2EXJA 3OPTA 1PHMA 2C6SA 2DVBA 1UD1A 2IC1A 4R4ZA 4E27A 4AVVA 2OW4A 4KBZA 5FUIA 2VNVA 4AI3A 5DAVA 1V9U2 3NV2A 3R4DB 5FY8A 1W3XA 1UU5A 3M2MA 3ZMOA 1GZ9A 2JKBA 3MLJA 3T30A 5T52A 4COZA 2B45X 4LLFA 1JYTA 4CCEA 3H1YA 3W58A 3AP4A 3CU7A 5DAQA 2HWB2 4AVAA 3B01A 3MIHA 1X50A 4AI1A 4DOUA 1H8VA 4BQYA 1S0JA 2VO5A 1SLBA 2XJPA 3VBUA 4XXPA 2IUWA 4AK3A 2XOMA 2WAAA 2Y38A 4Q29A 3UT0A 2ZABA 1XB9A 5FYHA 4ZU7A 5I0TA 2P1BA 1WLWA 4B7KA 4FPOB 4YM3A 1W2NA 4RYDA 2JDPA 5F6KA 2VL4A 5SV5A 1Y4WA 2V5YA 2RMU2 5FBZA 1UOBA 4CCNA 3VBFC 2XXZA 3M3CA 3GNEA 3VBUB 5T5OA 2VQ0A 1AYM2 2BV4A 5F39A 1JOPA 1I9RA 4PQQA 1Y9GA 3A23A 2NMOA 1HRI2 3ZN4A 5JSRA 5L9BA 2WABA 1Z0HA 4ZPIA 1AR82 3DPRC 3UL2A 1K5MC 2C1FA 3LB9A 4CUBA 1IPJA 3WNKA 3AP6A 1GNZA 5FLIA 5L9RA 1LNSA 4XJ9A 2JDHA 3ZKYA 5A3OA 5C71A 2CDOA 1BKZA 5CFCA 4XFBA 3S5QA 1EAH1 4OQ9A 1Y3TA 2FCUA 1HKDA 1VE0A 2JD9A 3M3OA 1LU2A 2DU1A 1RJ8A 4XTMA 5FYBA 1WGPA 2R7EB 4P9JA 3ZR6A 4Z07A 4F8AA 1CAXA 3VBSA 1GANA 2LALA 3LOIA 3MW4A 3PU3A 3VBRA 3W9AA 5CFCB 1AR63 1IPSA 1HJFA 1WA4A 1FOD1 3JD72 2K9ZA 5D1IA 3AJZA 4CXXA 3ZXJA 4FBFA 3MIEA 1RUI3 3CJIC 3EHKA 2ZX3A 3CJXA 3WSOA 1Q3EA 1QDCA 4XBQA 3SHRA 1CAXB 3NJZA 2JG9C 1AL21 1JHJA 4K7JA 4S2DA 1G9FA 3VBRB 4BQ1A 3RZLA 1V6NA 2JIJA 1L7RA 3ZN6A 1C1FA 2W1SA 3SCHA 1GP6A 2AGSA 4N53A 2XONA 4NWWA 3C7GA 5KXCA 4XACA 3BTXA 1LEMA 1PX4A 1DYOA 5H9RA 4KWLA 1FPN1 3BGAA 3I2IA 2FHRA 3MEPA 3BIEA 4XIKA 1V00A 3BOWA 5GALA 3TN91 4BQ5A 3NO8A 3G6JB 4EN6B 5DUUA 2BZDA 3ZN6B 4B1MA 2K0GA 1VBB3 2WQ8A 3LSDA 4JQRA 5IK4A 2XWJB 4N53B 2BU9A 2PLV3 1UF2C 3ME2A 4NPMA 4BLJA 3ITQA 4FPGA 4Q0SA 1H9PA 1W9SA 2J1TA 3ZFGA 4M3CB 1F4HA 1NXD1 3ZFEC 2YC4A 4GB32 2HWD2 2V5DA 3WUDA 1EAH3 5A6XA 4RFT0 3FUQA 1N1SA 3WNXA 4HK9A 5H9QA 4JKLA 2HWF3 3POEA 4AE2A 1XYPA 4LKFA 3HWJA 4TN7A 2HYXA 5A3PA 2PTMA 1GYKA 4AQ6A 4BQWA 2VAUA 4CDXC 1JXNA 3ZFGB 3N9MA 5JI7A 2BNMA 2VXRA 3FLTA 2B9UA 1O5LA 1FX5A 1RXGA 2FMYA 5ABJA 1R092 4CA9A 5B2GB 3WNLA 4ES9A 1RUH3 2E7AA 3GBFA 1VJ2A 4OZXA 4Y1YA 1AR73 3DECA 5DAXA 5FIXA 2C26A 1G9CA 4AW7A 4PI2A 1KFUL 3MO4A 4JC1A 4Q0UA 2B39A 2UWAA 1QXRA 1PO21 4CRQA 1S0IA 5DAWA 1GWLA 5HI0A 2F6BA 3MPPG 1OVPA 4GIQA 3AKQA 3IDAA 5F5QA 3NNMA 5EPAA 5FMCA 3TOJA 4OHZA 1OQDA 2LROA 2MNGA 2YBSA 1NQJA 1RHI1 2VG9A 5IVVA 5LBCA 1Y9QA 3AK0A 3PU8A 2XLGA 3S5AA 2VNOA 2CWSA 2GNDA 4QPYA 2PQQA 3R05A 3CL1A 3T2TA 4D0QA 4ZKTB 1BK1A 3AX4A 4OQ8A 5F6LB 5FY5A 1QU0A 4NROA 4XF1A 1UZYA 1L3JA 5A80A 3VKFC 1ZZBA 1W3VA 2YBKA 4Z2WA 4FTBA 2J1UA 4R4XA 1S0BA 1W8ZA 4CU6A 3AYAA 5FYIA 3VDAA 1E5RA 2BERA 2ZAAA 1YNAA 5DUWA 1YEWA 3POFA 4FCAA 3VBHC 1CJPA 3E6BA 1GOHA 3T0DA 2Z42A 1T2XA 2JB4A 1Z7S2 4U2AA 3H8RA 1BMV1 4XJ8A 1SFPA 1LOFC 2RS33 3O12A 5KXDA 3OUHA 2PFWA 5CVRA 4BIFA 4KWKA 4OCTA 1YCIA 5BNPA 2L9LA 2GAUA 1AYN3 1LCLA 5FYMA 4BIOA 4NJ4A 3HPNA 4SLIA 3VB9A 4MYEA 5A33A 1PNFA 1GQGA 1VBC1 4U36A 1GP4A 4EYUA 1TME3 4GH4C 4AZZA 3M4FA 5DUVA 1HXS1 2VZRA 3O0XA 4LA2A 1GUIA 2XBO3 4RL7A 5D21A 1YQ5A 4ISRA 4HOOA 5FQ0B 3J7LA 1OOPA 5A7QA 3B9IA 1G9DA 5LRSA 1CWPA 5L36A 5A3UA 5FYTA 3GJBA 4IERA 3A7QA 3LF7A 4FOWA 4N43A 1YI9A 4CPBD 1RMU1 5DDJ2 3MF6A 1NQDA 4PI0A 5T3NA 4X6RB 5DUXA 2VJXA 3WHTA 2XDVA 4UBHA 4AYUA 4F83A 2D5HA 3TEYA 5AFBA 1WWYA 5FZIA 2BNNA 1OOPB 1XNTA 5C5TA 3MFCA 3BB6A 1SFYA 3ES4A 3ZKUA 3RZHA 3O1MA 1BCXA 4N43B 2MEV1 1PK6C 4IEZA 3A21A 4K40A 2GNTA 2C4XA 4UWDA 4LEJA 1UYZA 2YROA 3B9CA 5JUVA 2H0BA 3ZSKA 1R081 2JDNA 4Q4W1 1X9PA 5E88A 2DDUA 2I07B 1CPNA 2AYHA 4IQPA 2JXAA 1XSQA 1Z78A 2JDMA 2W47A 5I8SA 3WDWA 2OS2A 5IATA 1W03A 4QB6A 3BPSA 1REFA 3B5LB 1QQP3 2R30A 4QB1A 4MLOA 2GP5A 4W50A 3VZNA 1MACA 1BQPA 3WD5A 3KMHA 1UCXA 4ZHNA 1D2SA 1RUD3 1W6QA 4I0BA 5IK7A 2FDGA 1FXZA 2UY8A 3S30A 1LHUA 3W5NA 2WS92 4TLFA 3ZYJB 2D43A 2XHKA 3MGUA 2XLFA 2R063 3EJKA 1N1VA 2VZSA 5GLTA 5JXIA 4FPFA 3VGIA 3RJ2X 3GGLA 1OVSA 1W6QB 1OH4A 2FDKA 4LBQD 4B8EA 4GMP3 4L99A 2HEVF 2KD7A 1UY1A 4QPGB 4P5YA 2TBVA 1DZTA 2FMDA 2LTNA 3JBG3 2VULA 5APAA 2QUOA 1A6CA 1GBGA 2OPKA 4HN0A 2QZ3A 5JXJA 2E26A 5LZ6A 1LGNA 3S0MA 2WUHA 3GHNA 2W5FA 3KV4A 1CZVA 2AENA 4B3NA 2J1EA 1ULCA 2EAKA 3K51A 4YFWA 4CCOA 3N7KA 3ZO0B 1ND3C 2ZEWA 5C9AC 4A6OA 2JD4A 3GZEA 2ZGUA 2BTVC 2PHDA 1CQ9A 5ACA3 4LKEA 1POV0 1APNA 1RL3A 4XMAA 4BDVB 4RQPC 4C8DA 4H3WA 4YZ1A 4HANA 3UV9A 3J8F3 3V65A 3KF3A 2J1SA 2LS6A 4BYYA 4QM8A 5LEJA 3MHZA 1SPPB 2IXLA 4FOVA 4XFGA 4WVMA 3S7EA 1VBE3 4LBJA 1C4RA 1LOAA 2A1XA 2UYAA 1ODMA 2MPFA 2R32A 4XQWA 4UF0A 3JXSA 5GLUA 5FO8B 5L7OC 3AZVA 4QXBA 2DVGA 2BRTA 3H3UA 5C8CC 1LOEA 3BVCA 3I3EA 3K75B 3RJRA 1OXCA 4V2VA 1KFXL 4CCKA 2IWGB 5FJKA 4QU1A 1OQEA 4WVMB 1JYVA 1PGSA 4M4RA 4QDRA 3VL9A 1LOBA 3HBZA 3UETA 1HB3A 1PGW1 4CEYB 3FUOA 1W99A 5FZ0A 1W6PA 4AWDA 2D93A 1WZXA 2P17A 4UF0B 4WBBA 3BUCA 1MS5A 1VMJA 2WYFA 1AX2A 5K7PA 1BJQA 2WO3A 3QLQA 5L9VA 5IYYA 1ZBA1 2B8MA 4Y24A 1I1EA 2RJKA 3P3NA 3MW3A 4V2WA 5ANQA 3DF0A 5LW9A 4PDWC 4D8MA 5FMBA 3C8XA 1CPMA 2VVDA 1C57A 3JQWA 3OGJA 4OZOA 1FOD2 4JKKA 1W6PB 1GV9A 1UYPA 2VMFA 2Q5TA 1KGYA 2FZ1A 4AQTA 5LK7B 2WNVB 1PZ9A 4NRQA 4XABA 2BFUS 4XAAA 1ZZ7A 1AL22 1MEC3 1K45A 4IEOA 1YLLA 5CBLA 3TEWA 5A70A 5FZ1A 3O14A 4UBGA 2JIGA 3H1MA 2VMGA 4TWTA 1RUF1 3M8LA 1AR91 5EP9A 4LOTA 1HV1A 4GXLA 5FXVA 2ZX2A 3VHOA 5LK5A 2FQPA 3TNQA 1STMA 2I74A 4XFIA 3GZTB 4KH9A 4QGLA 1FPN2 4QXCA 3T1LA 4INDA 3ZOIA 5HCAA 2PXJA 3AZXA 4EV0A 1F15A 1W0NA 4ZY9A 5FY0A 3NAPA 1VRH2 2FDJA 1EUUA 3KVBA 2CYFA 3TN92 4R9DA 4LA3A 1VBA1 2GNBA 3FN9A 5FZ8A 2X5IA 3DCQA 3WR0A 2A70A 4QGMA 2X29A 5DG1A 5GKAC 2ZHKA 1OD5A 1S1AA 2Q30A 2ZA9A 5DPNA 4AVBA 1O3TA 2CL2A 3FHIB 4QX5A 1JYNA 1OPOA 4LQRA 5H9SA 3WG2A 1DQ5A 1N3QA 3WCRA 3NAPB 4P14A 4OLLA 2HWC3 1JYCA 1PO13 2X5IB 2YG0A 4JDOA 4QX3A 3H50A 1RGSA 1QJX1 4NIAA 4RHV1 3CKHA 4MH0E 1HIXA 2WO7A 3B7MA 5T5LA 2VCBA 1JOBA 3LSEA 3N35A 2G9FA 3AL6A 5FV3A 2WDBA 1T6BX 1YC61 1CN1A 1RITA 2WYSA 4O9EA 1TMF1 4AEKA 2PMWB 1WBLA 3RYKA 2JDYA 3FFZA 4PLMA 3RZKA 2WJSA 3AFGA 4FPCA 4XUTA 4AG4A 1NAEA 1PO22 3OBZA 2JG8A 2XMLA 4FP2A 2Q8EA 2EALA 3HR9A 5FY9A 3OYWB 1QKQA 2YGMA 2TNFA 1GLHA 2W95A 2ORZA 3FLRA 3ORJA 4MO3M 4D3WA 3SC7X 2RJLA 1QF3A 3AMMA 1H1IA 3Q8AA 4LBNA 3GHMA 3IN9A 4QX7A 1QH7A 1RHI2 4HKLA 4XHBA 2IFRA 2PQSA 3C7EA 1H8TA 1RUJ3 4CDQA 2UY9A 4N9HA 2P37A 4CP2A 1RUG1 5CKQA 2IXJA 4I09A 4PF1A 3UJQA 4HKOA 5J3UA 2J1VA 2Q8OA 4FPEA 3Q8BA 3SXWA 3E1F1 4O9GA 2XKPA 5GM0A 3O0WA 5JIAA 5T55A 1H8TB 1XNCA 2VOWA 4CDQB 4NIIA 4AVSA 2NM1A 4EN9B 1NCQC 2VW2A 4PIZA 1NCRC 4WVWA 3AMNA 3RDIA 4YVSA 1BMV2 2CNAA 2R043 5I8TA 3B3QE 3PUHA 3VV1A 5FPZA 1MQTA 2Y0OA 3TNPB 4LUMA 3PUIA 5EWSA 1TZOA 1EYBA 4DUXA 3U14A 4NR1A 4WM7C 4BOWA 2ARAA 1U5IA 1UWWA 4XVHA 1VBC2 1OUSA 4AF9A 2OKXA 2WFF3 3H3LA 4E4ZA 4UW5A 2WNEA 5HCFA 4YVSB 1HXS2 1RUC1 5FYCA 3OGSA 4JQTA 1GZTA 2N7GA 3ZSEA 1KJRA 1MQTB 1GZWA 2OX0A 1RUE3 1YQ8A 3LIGA 5E89A 4P9IA 4A7YA 1DF0A 3J7MA 3J9SA 1PZ7A 1RMU2 3NL1A 3EMRA 1WA6X 5F2WA 1Q43A 3R0RA 1K5MA 3KWVA 2J1RA 3EB7A 2NN8A 2Q1ZB 2IFWA 5F7UA 1X82A 2B42B 2JDUA 2XJRA 5JI9A 1I3HA 3W5MA 1HRI3 3VDDC 3VN4A 4XZUG 1AUYA 3ACHA 5CIRA 4WZCA 3EBRA 1J83A 2VZUA 3WZ1A 4KGQA 5CEHA 1GZWB 4CP0A 1DGRN 2PHFA 4QX2A 2MEV2 2WT1A 3POIA 3PVBB 3PDQA 1NE4A 2AH2A 1FYUA 3KVAA 1H0BA 4HG6B 1XNBA 5LY1A 1QJY3 3CLPA 1R082 4GQ7A 4Q4W2 4OUEA 4B7EA 2H0VA 1WMFA 5IFPA 1EY2A 2NP0A 1S0FA 2VBBA 2Y34A 3MDPA 1ND2C 4N7UA 4JTNA 3WUCA 5CG8A 2ADDA 2QQIA 1LRHA 1NZCA 2F4PA 3FHAA 3T1MA 4AGGA 3CJIA 2W1QA 4DRRA 4QDQA 1OHFA 3W59A 1W8FA 4BCUA 3UGFA 3URFA 1BBT3 3D0SA 2D6LX 1GMMA 3ZYPA 2JG9A 5A6YA 2Q1MA 3T2QA 2E53A 2RE9A 2WN3A 2GSYA 5GZEA 2XPJA 1OA3A 3RNSA 1PZ8A 4YW6A 2OXBA 4NAOA 1XJAA 1ZZCA 3VBOB 3U4XA 5KXBA 4Z92B 2Q8CA 1SLLA 2TUNA 3CBNA 4NUBA 5FPAA 1Y43B 4LBLA 4B4RA 1O8PA 2HWE3 2HLEA 1AF9A 1YUDA 4RR3C 5F1RA 4MXWA 1KD7A 2G9GA 2JG9B 3POSA 1JODA 4IV3B 2ZPXA 2XVGA 3IPVA 1V6KA 4M4PA 5JSPA 2XL7A 4ZS3A 2BUKA 4XCAA 1MVQA 1FV2A 3ZPYA 4DEQA 3BIWE 1VBD3 2WZEA 4WVVA 1UU4A 2EIEA 3HN1A 3ZFEA 1WMEA 2YZ4A 1D4VB 4MXWB 1U5XA 1W6MA 3LA3A 2WN2A 3NSTA 2A6VA 1N3PA 1JBCA 2D40A 2WT2A 3ZXEA 4FTEA 2QQVA 4Y4RA 5G05L 3KCYA 4CVUA 2VTXA 4JVAA 4LULA 2Z79A 4FQ4A 1NG0A 2RJ2A 3J4UH 5I0DA 1W0PA 4CDXA 2CSGA 5FZKA 2ZHLA 2G4IA 3QBQA 4IV1C 4LBMA 4OHVA 4IEVA 1O8SA 3WNOA 1JZ8A 1QXJA 1W6MB 3LDBA 4RA0A 3H7YA 4OHXA 2EVXA 3AVSA 3ZYRA 4AL9A 4YM1A 1WCUA 3IDEA 3C7HA 1GP5A 1PVC3 3PIJA 4CDXB 3F2ZA 2BNOA 1UN1A 3ZIXA 3THPA 4ZXEA 3BPZA 4P02B 2V72A 2D3PA 4META 4OI2A 4AFDA 1PGW2 3M1HA 2A73B 3ZLIA 2CV6A 1KITA 1JMUB 1A34A 1IG3A 3WF0A 2E32A 3WQ7A 5HXMA 3WF4A 1NKGA 4XTPA 3GBWA 5K0UA 4Y1XA 1ZBA2 2QJVA 1RUOA 4GD4A 4AQSA 1IKPA 1TEIA 2WINB 1DZRA 2D6NA 1YFXA 3W21A 1QHDA 3WQBA 1U5ZA 4WM8C 1AZDA 3THCA 4XC9A 5BNNC 2PN5A 1GOGA 1RVF3 4MGKE 5I0SA 3J26N 1JZ7A 1W2TA 2VCCA 4UAPA 2IZWA 2WR9A 1EUTA 5DMYA 2P3JA 2QQJA 3VBHA 1QIQA 5K0UB 1LAJA 3F95A 2JECA 4XF0A 4ZONA 3TYJA 1J3RA 1BEV3 1ZBE3 4LE4A 4BM8A 5FDBA 4FSJA 4G3YC 3AP5A 4OI1A 2A6WA 3WG4A 4Z8BA 1LOFA 3N9PA 4QQLA 4A44A 3SH3A 1KDMA 3AXEA 1CVNA 1SDDB 4KMQA 3O1SA 1ALYA 2HBTA 1RUF2 1AR92 3FBYA 4AOCA 5JMCA 5KHIA 4I3PA 3VBHB 2OQ7A 1WD4A 2DTWA 1AR61 4XE9A 2CGNA 1SLAA 2QQOA 3QCWA 1F2NA 4AHXA 5J1XA 2GMPA 3N4MA 1SG3A 3AJYA 1VBA2 3IZOA 1RUI1 4HKWA 1XRUA 4B4QA 3A4UA 2O1QA 5C5UA 1QDOA 2J7MA 1CR7A 1ZZ6A 4UT5A 5JVVA 3RVHA 5BUVA 2ZGQA 4QGNA 2V09A 4A7ZA 1LGBA 2WA4A 2HKXA 4YW7A 3ZXDA 3ZX7A 3U75A 2WZ8A 4FOYA 4JKMA 1KQRA 4EZHA 1UKGA 1ZZ8A 2NZ9A 1CD3G 3ILRA 2OUHA 4HXCA 2PA7A 4RN5A 2VZQA 3UK9A 1QJX2 4RHV2 1WW7A 1S4CA 5HXVA 5F3CA 3BTYA 1PK6A 4Y1UA 3HOBA 1PMJX 4JDMA 2AREA 4UXAA 5FP9A 4R9AA 1VBB1 1F35A 1YFUA 5B4NA 1O3RA 5E1RA 3HMYA 1X7NA 2PLV1 2WZPP 1TMF2 2WNOA 4Y5Z0 5LB6A 3DEMA 1OKQA 1JUHA 4P9WA 4LOSA 2QFEA 1IG0A 3ACGA 4BE3A 4XIOA 2HBUA 2BVBA 2RM23 1PK6B 2OA2A 1AXKA 1J84A 3OY8A 3H9AA 5FLHA 2Q8DA 4AEJA 4DNYA 2VQUA 2HWF1 2G19A 4IE6A 3T08A 3NNLA 5FBJA 3ZSJA 1SMVA 3GCXA 1F8VA 3OD4A 4DY3A 2WZR3 5F8PA 5C3OA 2YDEA 2BGCA 4GA9A 4NHKA 4WVZA 1J59A 2DTYA 1R1A3 2JE8A 5CU1A 5EJ3A 3SEEA 2A3XA 2O0OA 1O7FA 4RGKA 1RUH1 1RUG2 1X36A 3OY8B 4JHZA 4QX1A 3SKVA 2WRAA 3HNYM 1AR71 1QOTA 4CE8A 3I2OA 4M3CE 4XFCA 3S7IA 4BK5A 2D6PA 4AEDC 1L7LA 1W2UA 4HVOA 3KM5A 2ZZQA 4CUAA 1A8MA 5LA2A 4CDUA 4KU7A 3OGGA 4C1WA 2OZJA 3VBSB 1HJGA 1LOCA 3NRUA 4Y1ZA 5DZFA 3LDRA 4GKXA 2ERFA 3H8UA 2D6OX 3ZFFA 1RINA 3D6EA 1RB8G 2R0HA 4S2HA 1Q5OA 1SBFA 1QJU3 1W0OA 1G8WA 1DGLA 1LTEA 3SMHA 1WLDA 5A1FA 1YO8A 3K46A 3J7HA 4JCKA 4A2UA 3ZXGA 2GU9A 5IVYA 5IFTA 1ND3A 1NYWA 4ASLA 5AC93 5BNOC 3WW1A 4CEWC 5JWPA 1V70A 4IUGA 4AI0A 3ZFFB 4QPIC 1QOSA 4RQPA 5EFUA 3O1PA 2LM3A 3B69A 4XMIA 2UYBA 2YGLA 2YFUA 2F4LA 5GJ6A 3SISA 3USSA 5LBFA 2VBPA 2IVJA 1RUC2 3RWKX 1HB1A 5J98B 4YZ4A 5FYZA 5C3QA 1ND3B 2Q0AA 4LUKA 5FYVA 5FPUA 2ZMNA 3P5BA 1LULA 3DL3A 1S0CA 4GWIA 4CDUC 2R1DA 4ARXA 4HL0A 3VZKA 2XJQA 1GWKA 5FP3A 2RS31 2GC2A 1H2MA 1S2EA 3AVRA 4RQPB 5FOJB 2W39A 1DG6A 1DP0A 3Q8FA 2FDIA 1NA1C 5LA0A 1AYN1 4G4FA 4E8DA 1NOVA 1C1LA 4J6GA 4IEQA 1COV3 1M06G 3KHCA 5GLWA 1C8M3 1CIYA 2ZHNA 5F5CA 4ES8A 4Q4V3 3O1RA 1TME1 1EPZA 4MGTA 4DRVA 1SBEA 2OVUA 2W94A 2XBO1 2DUPA 1UY0A 1X8EA 2QQWA 1S55A 3MBWA 4ZZ8A 1AX1A 1ODNA 1H2KA 3KSCA 2WC2A 2ZKNA 4BQ3A 4C91A 1MS9A 4XJUA 3KV5A 1UO9A 4J1XA 4PDWA 1ZRDA 1TNFA 4NHMA 5LA9A 1N47A 3LEKA 4LHNA 4RS5C 5IWFA 1GNHA 1XXNA 1YQ6A 5ABJB 4K6BA 2WFPA 2R072 5A6ZA 4YGEA 3E97A 1MS4A 2X53S 4AEMA 3VD4A 2VW0A 2RDNA 2GC1A 1HQLA 2QQNA 2YMZA 3IDBB 4PDWB 1LJ7A 4Q0PA 4AHWA 1HQWA 2Y6LA 5LBBA 2D6MA 2XUMA 3ABZA 3WNPA 3M70A 1GQHA 5IUQA 4R52A 4FXGB 4FPLA 2J42A 3ZMNA 4YG0A 3I49A 2YXSA 2A75A 2VXJA 4BQXA 4QM9A 3SCFA 4XFHA 4JV4A 2LUWA 4LR4A 2EIDA 4JAAA 4XFAA 2D5FA 1XU1A 1QQP1 1IHMA 3WDTA 1W04A 1WMXA 3HVDA 1LKNA 2RS53 5D8AC 2ZGSA 2RDQA 3ON7A 1RUD1 4JGZA 5JXGA 3WT3A 4CDWC 1LU1A 1VP6A 4HN1A 3U10A 3UKVA 1WUVA 1OH3A 4RGGA 4YYOA 3ZXFA 1GICA 4ZS2A 1HRV3 3O1UA 2R061 4RSUA 1QY4A 1ASJ3 1KS4A 4P00B 2PHLA 4UW6A 1MPXA 5DG2A 5JMOA 4JGZB 5BNPB 3I3QA 4YGBA 4BMEA 1YYNA 4QKFA 2UU8A 2VW1A 4GMP1 2VQAA 1LEDA 3HNBM 1JU4A 5A33B 5CISA 3MIFA 2EAAA 3JBG1 3BTZA 5F5AA 1JYIA 1K5JA 1JYXA 4E2GA 5JPMB 4I3GA 2BYVE 2QZ2A 1PNGA 2UURA 2ZXQA 4KQ7A 4Y5SA 3OG2A 3AFKA 2DVAA 2P6HA 2WL1A 4E2QA 1JTZX 1W8HA 1UAIA 3HJRA 3MIBA 5SV8A 3T4HB 1DQ6A 4UI9L 1YXWA 5IT6A 5ACA1 5HV0A 3OBRA 3TRSB 4UFKA 3OBAA 3I2KA 3VBUC 1LHVA 3GCWA 3ZSLA 1GR3A 3CZJA 2BGPA 3J8F1 3N36A 5FY4A 5FZFA 5KHHA 2P3KA 2ARXA 5F3EA 3RG0A 3POBA 3SH4A 4D6RA 3JZVA 5KC6A 1V0AA 4XETA 2YHJA 1VBE1 1RTVA 3X29B 3N7MA 4YARA 2K2SA 3I4IA 2YBPA 4MHRA 2A71A 3HQXA 3EXUA 3N9NA 1SCRA 4IGOA 4COVA 1WLTA 2RDSA 4GWJA 4XQ4A 2OPWA 4OHYA 4OMCA 3GZUC 3WHUA 2ZGMA 3ZXKA 3T2OA 3FLPA 5E8AA 2CDPA 2Y26A 4PCRA 3OUIA 4YW2A 3VDBA 5LWBA 1H4HA 3WVJA 1ZRCA 1I5PA 1ZRIA 4COWA 4MXVA 1NCRA 2O14A 2ZTNA 4DXZA 2ET7A 3ZYGA 1Y9MA 1PVXA 3B00A 3JB4C 1FV3A 1D0HA 2VZPA 5CFCC 3OPWA 4IEXA 3RSJA 4UFIA 2E31A 1VALA 3I3MA 2XR4A 4XBLA 3T2PA 1SBDA 4TSVA 2JENA 5T5PA 3MV01 3OUJA 2RHPA 4X8PA 4YZ2A 5FCCA 4ASMB 2HEYF 4IL7A 3ZYBA 5BV6A 1AR62 1S2KA 4YWAA 3HBKA 2B9VA 2IXHA 4H14A 1OF3A 4BQ4A 4JRLA 2XHNA 1G9BA 1MVEA 3PIGA 4J25A 2GNMA 2RG4A 3VBRC 2JEMA 4HZFA 1RUI2 2DVDA 3PJQA 2IXIA 3EQEA 4FFGA 3T0BA 1EP0A 1GZCA 1MEC1 4S2FA 4A7KA 1YJLA 1GFF2 5JOZA 2P2KA 1NXMA 3KV6A 2BOIA 4IETA 3NQHA 3VZJA 5HBAA 4L11A 3ZPOA 4CSWA 4YVWC 5IK8A 1ONAA 3FC0A 3MF9A 5A32A 3PTRB 3VDDA 3BCWA 2DFCA 3U0ZA 4DMIA 3WNNA 2EF6A 1PM4A 1JOJA 3V0BA 1WCSA 2WSUA 3RMYA 3L9JT 1GQPA 4QPWA 1W8UA 5DN2A 1EV13 2UWCA 1FNYA 3BOPA 5EQUA 1VBB2 4UW3A 3BU0A 2CTVA 3MLKA 3ZR5A 1XE7A 1XYNA 1ZZ9A 3I2DA 2PLV2 3VDDB 4CCJA 3ZXLA 1U5YA 1BK0A 2EA7A 1UY3A 5LA1A 2WBKA 3V0BB 5C70A 3LWCA 5C33A 5K4LA 2EXIA 1EAH2 4OI0A 1HN1A 1BXHA 1ND2A 4Y4YA 4YZ3A 2HWC1 1PO11 3LA7A 2HWF2 1H1AA 4XYXA 3ZFGC 3DKQA 1SQ4A 4E9KA 5ISLA 4FTSA 2RS13 2YYOA 3AMQA 1FNZA 1ENRA 5KC5A 2WWUA 4XDQA 3ROUA 4RD7A 3WDVA 2QCSB 1QNYA 5EJZB 1YHFA 1TE1B 3AKRA 1D4M3 3U1XA 2DCTA 1ND2B 2YC2A 1RUH2 2A6YA 2B46X 3BU7A 4FFHA 4ORFA 4AFBA 1AR72 3D5OA 1WKYA 2H6BA 2ADEA 4RR3A 1L7QA 3OSDA 4DQAA 4LNVA 3L2YA 2KR2A 4YPJA 1G6NA 5CFDA 1F5JA 4HVRA 1TVGA 4JTOA 4Z82A 1X33A 3MV11 1JZ2A 1AXZA 4L92A 1EPWA 4OUMA 1RYYA 2W91A 3O1TA 4AGRA 4A42A 4Q4Y3 4TXWA 4D6QA 1FMD3 2VCMA 4RR3B 1RUJ1 1LB2A 1J3PA 1E57A 1N1TA 3HN3A 1RC6A 2VUAA 3NW4A 5CFDB 4DZGA 4UOJA 1W2AX 4A6SA 1J58A 2NMNA 1CAUA 3H7JA 1LECA 2GP3A 1SLTA 3PHMA 4IEUA 4SBVA 3ST7A 3WQ1A 3K4DA 3NMBA 2VMEA 2RR13 4EROA 2QDRA 3SQOA 1YWKA 4IV1A 1VR3A 4XXAA 4XUQA 4URAA 1DLCA 3GDBA 2VZTA 4NHLA 4AAPA 2NPIA 3ATGA 2ZGTA 3UYJA 4EJRA 2QVSB 3N3HA 2J1AA 2Z69A 1BZWA 5IK5A 3WP6A 1CAUB 4LO6B 2CY6A 2R041 2RS32 1JN2P 4XW3A 3AZWA 1OURA 2P5BA 2VBDA 4A4AA 5DZEA 2Q1FA 3POGA 5FLJA 1B35A 1QH6A 1AYN2 4IV1B 1DBNA 4BH9A 4NIGA 5IVBA 4E8CA 3LEGA 1CAVA 2X8KA 5JAXA 1LR5A 3WLUA 2WFF1 5DZGA 3BI3A 2VGDA 1TME2 2XKOA 2FCVA 1GWMA 4Q4X3 3FFQA 4XJWA 4CP9A 1KEXA 3N7LA 1OFNA 2XBO2 1ZX5A 2VUCA 1W28A 4NHYA 1B35B 2ZGRA 3MPBA 4S2GA 1RUE1 3RS6A 5FR3A 3HQRA 4CU9A 1PIV3 3FE5A 2ES3A 2R1BA 2Y0IA 3KT7A 2ZBJA 1CAVB 1XQNA 3J7NA 4WM8A 5BNNA 1OBNA 5GZFA 1H1MA 4C90A 4KG8A 2DVFA 4CP9B 2A3WA 3OEBA 5CKNA 4QHZA 5EYXA 1HRI1 1JYWA 5FO7B 4QX0A 5FZBA 2AR6A 5T54A 2W1UA 5C3PA 3DYMA 4O61A 2QTWB 2VD7A 3LZZA 4COYA 2FDHA 4XURA 2WQ4A 3AM2A 5KBFA 2JG8B 2SBAA 2QNKA 3IKWA 2W52A 3P1IA 5LEKA 3M3EA 4WM8B 4E4DX 1OC1A 5FYSA 1MZEA 2WWSA 4QWNA 5FXXA 1IS5A 1UYYA 3RGBA 3T09A 3WCSA 1S0EA 1QGLA 1QJY1 3MFAA 4IESA 5A6QA 2VMHA 4LTAA 2B5HA 3RMXA 3RWNA 1IQAA 4M0HA 4FXKB 1C5HA 2TEPA 4H7LA 5ANNA 1H6YA 3P3PA 1OLME 4EQVA 1ZM1A 1V9U3 4COUA 1E5IA 3WP4A 1QQP2 3PUQA 3WW4A 2Z4FA 3H42B 4NRMA 1VIWB 4RGAA 5K8SA 1CZSA 4EWEA 2BPA2 3FWEA 1BBT1 1RUD2 4M01A 3SCGA 2HWB3 2QQUA 3IWZA 3I3BA 5J48A 5I91A 3LDKA 4BISA 4AGVA 5BY5A 4I01A 5I8YA 5C8WA 2VM9A 3LIHA 1YJKA 4OFGA 1H4GA 2R062 2ZGKA 3VBFA 5FXZA 3JCIA 5JIUA 1O4TA 3IAPA 4MHUA 2HWE1 4QPGC 3MZHA 4TYSA 3FMGA 2RMU3 2ENRA 4XFFA 4Q8KA 4XF9A 2W1WA 5T50A 3A22A 5IAXA 2W3JA 4MGQA 3JBG2 3DPRA 2AEZA 1PMIA 3OCPA 1AYM3 4YG6A 1BVVA 3FL7A 3VBFB 5LASA 1VBD1 4URTA 4MADA 3U07A 5I0RA 1AR83 3KLSA 1IKQA 2BP6A 5FPLA 1NY71 4EE2A 1LESA 5ACA2 2VU9A 3GYDA 3DPRB 3H8OA 1DIWA 1K5MB 1W2OA 4DUVA 5F3GA 3PUSA 3B02A 4OHWA 5DABA 2R16A 2RV9A 3J8F2 3NNFA 4QB2A 2Y6JA 1H2NA 3VL8A 1OA2A 1IS6A 3CF6E 3VZMA 3E5QA 4UFHA 1XNDA 3Q8EA 3PNAA 5CYYA 4AFMA 2NLRA 5F2SA 2Y6KA 4X6QB 2DUOA 1FAYA 1VBE2 3NV4A 4L8QA 4AI8A 3NVCA 3K4AA 2ZX4A 2D3SA 2VZ3A 2XVKA 3WY6A 4EN7B 5A3MA 4AEDA 5GZGA 3DYOA 1PVC1 3JD73 5FXWA 5FZ9A 4CEYC 1XE0A 4QXHA 1WMDA 3BN6A 4I0WB 3VD7A 4XZPA 4GALA 4UYBA 5A7PA 5IW0A 5C4WC 3CEWA 4A41A 4AI2A 2FCTA 3CO2A 4HT1T 4LHKA 5FKCA 1VAMA 3OBTA 1J1TA 1C28A 2ORXA 1LOGA 1SDWA 3CJIB 1UOGA 5EHDA 5FK7A 4YGCA 1VB2A 2CWMA 2VUDA 4Q0VA 4YG3A 5BNOA 3DXTA 1GKBA 1O59A 2XQXA 4IW3A 4XCBA 1ZVFA 2JE9A 4QPIA 5IAVA 1UZVA 3CNAA 3JUUA 1REDA 1RVF1 2WNVC 3PL0A 2D98A 3BYWA 4JX0A 3V0AA 3R4SA 5BPXA 5DXDA 4ZXKA 1OI6A 2YFZA 2VOKA 2FBEA 1T6GC 3OPZA 1CX1A 1BEV1 1H9WA 1ZBE1 2BVVA 4GJYA 4NVPA 3FX3A 1D2QA 1MEC2 2JWPA 1UIJA 4HONA 4UW4A 3IPVB 4NIHA 4QPIB 3TAYA 1DYKA 2VVFA 3MW2A 4LHSA 4IGQA 1SEFA 4GZ9A 4GB33 2HWD3 1US3A 4KBBA 1POV3 1ULPA 2WAOA 3WOGA 2W08A 3LEMA 4P9YA 2EXHA 3IB3A 3THTA 3BKZA 1QWRA 3ZFEB 3S57A 2EIBA 5FFOC 4M0NA 5D2AA 3RYPA 4D6SA 4TZDA 2XG3A 4CDUB 3R6SA 1BLZA 3PVOA 2YB7A 2FZ2A 5FWJA 3CZUA 4HK8A 2I2SA 5J96B 4OVEA 5A3TA 1UX7A 1R093 2CAVA 1JZ6A 5KWRA 2VECA 4FFIA 4LHLA 3KCXA 4XAEA 2OQ6A 5KR7A 4Y20A 4QXKA 2XGXA 4C0BA 5JZGC 2EXKA 2X5IC 3GXUA 3OJBA 3ZDVA 2X09A 1WLCA 1CESA 3IIAA 1PM7A 3FHQA 3D3AA 4K9SA 2HWC2 5FJHA 1PO12 2VPVA 1JS9A 3QH7A 5FYYA 4ASKA 4A3ZA 3PUAA 4KWUA 4BB3A 5CKMA 1W9FA 1W8TA 4L97A 2CGPA 1WD3A 2GH8A 4NAMA 4Y20B 2JE7A 1YFYA 2KM2A 2P3YA 4IEPA 1VMFA 4JGYC 5C3RA 4LJHA 1J3QA 3IBMA 4YW3A 2PAMA 4GWMA 1HDKA 3U37A 2DCZA 4FAHA 1QMJA 2RM21 2XLAA 5JOYA 4IE5A 1NLSA 1NUKA 3LQCA 4P9XA 5IVJA 2JDAA 1X8MA 2VZ1A 2WNUC 5EXOA 5J37A 3RI8A 2HH9A 3KT1A 5FZGA 3POWA 4DUWA 2WZR1 4CDWA 5F37A 3V64A 4FT8A 5GLZA 1DZQA 1Z7S3 1UOJA 3NV1A 3UESA 5C7GA 1R1A1 2W9XA 4AVCA 1Q8PA 1RUJ2 2C24A 3IMMA 4NOTA 1ULOA 1JHNA 2DCJA 3JU9A 1F9KA 4GH4A 4LO4B 1HB4A 3I2HA 4LPLA 2QBXA 3OEAA 2GALA 2IVIB 4LITA 4CDWB 2BEOA 2Q4SA 4C0HA 3VKMA 4Q27A 1CZTA 1AJKA 1DGWA 1IGOA 3IM0A 4W4ZA 5KHKA 3B94A 5CADA 2EIGA 1C5IA 1ULEA 4GH4B 4GMP0 1QJU1 4PLOA 3WF1A 1ACCA 1Q8SA 2JICA 5G04L 2BWAA 2R042 3KB5A 5DDJ3 1DGRA 3ZYFA 3IMNA 4MV2A 1OMIA 3LFMA 4CU7A 4BQ2A 1VAKA 3OGVA 5AC91 2BBVA 4LIVA 5CA6A 3DV8A 1XYOA 4FPYA 3HT2A 4I30A 4YVSC 1IS3A 5FMDA 4LO5B 5HCBA 4F7ZA 5JSOA 2W2IA 3QACA 2MHFA 2FD8A 2WFF2 2BFUL 3KGZA 1MQTC 3SKJE 2Y33A 1XNAA 1RJ7A 5CAZA 2ZHMA 1YIPA 4LK7A 5A7OA 4AFAA 2J22A 3AZZA 4N7IA 1WCQA 2YPJA 5FOBB 1UOFA 3HEIA 4UFLA 5FZ6A 1RUE2 1ENQA 2HJIA 4NE9A 5F5IA 4NRPA 4MX3A 3HD8B 1S2BA 4QQPA 5A1AA 1UY4A 4YFZA 2V73A 2VH9A 5IVCA 4CP1A 1A3KA 4PHZA 5FZCA 2YY1A 1W06A 4XBNA 1COV1 2W46A 5FP8A 1C8M1 1C8NA 2WSVA 3ETQA 4Q4V1 5FUPA 4D7SA 3K3OA 4PJYA 3AP7A 2BDRA 1KDKA 2E6VA 4Q0QA 2WS93 4ARYA 3TEXA 3PVNA 1QJY2 2JB8A 3QD6A 3VZOA 3WW3A 2XJSA 4GWNA 4PBPA 1ST8A 5CNAA 3I2FA 1YQ2A 5LBEA 3LFIA 1NLRA 2R0FA 4WZFA 3ILFA 2QKDA 3HNMA 1YIFA 1HX6A 4KNCA 4UFMA 4XF4A 4BPZA 5BNQA 3MIGA 4X8NA 4BJ0A 2PAKA 1JUIA 1MS1A 3I7DA 4MOAA 3FZ3A 1BBT2 1VAVA 3BTAA 3MUZ1 3VBOC 4BU2A 1V6MA 5C9AA 2GN7A 5J36A 1D7PM 2FDFA 2I45A 4MGYE 4MZUA 3KQRA 1ZNPA 3UNPA 3PVEA 4XPVA 1UIKA 1FI2A 2G1MA 4YVWA 4Z1VA 4ZZ5A 5FP7A 1AJOA 2R6QA 4IV3C 4JDNA 2E7QA 3PMEA 1N1YA 2HWE2 3MICA 5A1LA 5JOWA 4D69A 5JR7B 2DBIA 2VCAA 4EN0A 2XUEA 5C9AB 4NWVA 2WLQA 3AKPA 4ATFA 5J09A 1IOAA 1UMHA 2YPDA 2BQPA 2X05A 2DUQA 1G86A 4M3CA 3O1VA 2RS51 4Y3OA 5L7OA 1DQ0A 2ARCA 4AAXA 1H2LA 4YVWB 4Z2AA 5B4XA 4RFRB 1MZ6A 5C8CA 5I93A 3LA2A 2AUYA 2W87A 4B1LA 1VRH1 5FO9B 4FFFA 2GDFA 1VBD2 1OLRA 3GF6A 4QU2A 5EV7A 4P5HA 1BHGA 1LHOA 2VMDA 4LMFA 3RYRA 4LBKA 2OIIA 5HV4A 1ULDA 4JRAA 3KZ4C 1HRV1 4NIDA 3CQOA 4L9BA 2QQLA 3D82A 1NY72 1ASJ1 3LAGA 3AP9A 5L7OB 1UZZA 3NKTA 1NE6A 2E63A 4L2NA 4OULA 1UXXX 1V6IA 2CAUA 5C8CB 1W6NA 4DS0A 1UMIA 1XPWA 5FTTC 3E6CC 1K12A 2VOXA 4F3JA 1RUNA 2JJ6A 4FPJA 3SEPA 3VDCA 3ZM8A 2XQRA 1NT0A 1U12A 4PIXA 5FZOA 4HPKA 1HLCA 4QT6A 1OF4A 3ASIA 4HBNA 1AX0A 2JX9A 1W6NB 1PVC2 1FOD3 1R1ZA 3D0JA 2B7YA 4A45A 5T5JA 2D97A 1X9TA 1DQ4A 1XC6A 3WNMA 3NWKA 4K20A 4QDSA 3MUY1 4LLOA 4HETA 4YNIA 1W9YA 2LW8A 3EYPA 3WINE 4CYDA 2V4AA 4DB5A 5FZAA 5FZOB 4B29A 1AL23 1V6OA 4DY5A 2GC3A 5L73A 4HPKB 1W6OA 4LKSA 4XEZA 3HAGA 1UX6A 2HEWF 1M4WA 1BYHA 3U4SA 2ZAHA 5FK8A 2QQMA 3ZIWA 1LHNA 5JLVA 4FP3A 2ARBA 1NLQA 2JKXA 3INAA 4LO7A 4W6YA 5K0UC 5FY7A 1FPN3 1RVF2 3VZLA 3E5UA 1VRBA 2JDZA 1UY2A 1VRH3 2A6ZA 3TN93 4CZSA 1W6OB 2ZX1A 3AZYA 2BWCA 3ALQA 5FUNA 3RZZA 3KGLA 1TNRA 3THDA 4DXSA 5JDBA 1ZRRA 4XHXA 1OPMA 3QOPA 1MS8A 1BEV2 1ZBE2 4QQ2A 4BWOA 2ZACA 3I3DA 1W8WA 5KXEA 1OD3A 5JCTA 2QE3A 2PYTA 5C6CA 2ZX0A 3ZN5A 1IZ3A 2V4VA 2WT0A 5I0UA 4AR2A 4AHZA 4XUNA 3TB0A 2AEYA 4XQDA 1W8OA 5CG9A 2OZ6A 3PJYA 1QJEA 5FAXA 3WXPA 5HCHA 1P8JA 2ZMKA 5JPNB 5FQ0A 3C3VA 4I0AA 2QQKA 4MVTA 1A78A 1WBFA 2DYCA 3LPGA 4QHOA 2VOVA 5GLVA 1XNKA 1LENA 2ZEYA 3RZMA 4K8FA 2XJVA 5H9PA 1LODA 5DQ0A
chains in the Genus database with same CATH topology
3NKGA 1W39A 3GALA 4GKYA 3HT1A 4HLTA 3USUA 5KHGA 1PO23 1OA4A 1HV0A 1UW8A 4BHPA 4W6WA 4QD2A 4PBOA 1HW5A 1AL0G 2E51A 1G7YA 1V6LA 2ILMA 1AVBA 4E2SA 1EV11 1RHI3 4EN8B 1C3HA 3USUB 3IDCB 3VKLA 4YZ5A 2ZGOA 1KRIA 2DCYA 1WCKA 2NYYA 3DUIA 2XWBB 4K3UA 3ZYIB 4XJZA 1ZRFA 1KS5A 2RM22 1NCQA 4K1YA 3AYCA 4YLZA 2GMEA 3AMPA 3VHPA 1ULGA 1MZ5A 3ZXAC 2RS11 3SNMA 4PLNA 5AVAA 5FMOL 2ET1A 1DGWX 3DGTA 2WZR2 1RIRA 3RQ0A 4PQ9A 4OUSA 1R1A2 4WM7A 1D4M1 2C5DA 3V56A 3LGRA 2PHTA 1NCQB 1NCRB 4YM2A 4YW5A 2BW8A 2HYKA 3VBSC 1QOOA 4QPGA 2D3RA 3WQ0A 2D44A 3DKWA 5FPXA 1CX4A 3A0NA 1VBC3 4DINB 1O4YA 1SLIA 3FJSA 1HXS3 4WM7B 3H0OA 3WW2A 2W0XA 1QJU2 3ZSMA 1CAWA 2C9AA 4B4PA 4Q4Y1 3PMSA 1RMU3 4BMBA 1FMD1 3PTYA 3ZFFC 4PIYA 4P9LA 5AC92 2SLIA 4N53C 2ZCWA 4KGGA 1YRZA 2GC0A 3UKNA 2RR11 2A3YA 1CAWB 1LGCA 5A32B 1J1LA 3SH5A 3VKOA 2IXCA 2MEV3 4DFSA 1XU2A 4LT5A 1ENSA 3TBDA 4Q8LA 4YGDA 5TSWA 1AXYA 1O91A 1R083 3ZVXA 4Q4W3 4ONUA 1PGL1 3LCPA 4FO9A 1HQNA 4J1WA 1MZFA 3VHRA 4WV8A 3GZAA 1F31A 4CEYA 3Q9OA 3VHNA 5K9YA 1COV2 4HMZA 1C8M2 5LRRA 4Q26A 2DFBA 2C0ZA 5C4WA 2OUJA 4Q4V2 2XVLA 2WLPA 4Q4X1 1UL9A 1OSGA 3BALA 5L19A 2P34A 4P9GA 4KL1A 1H30A 2XH6A 3QH6A 3N7JA 1O4ZA 4QQOA 3K48A 3H3ZA 5ABJC 2IXKA 1PIV1 3GBGA 2XL9A 1DLLA 4AFCA 3D4KA 4MGIE 4ISQA 4R9CA 4W65A 4YRDA 5C4WB 2WNVA 3VUOA 3DN7A 2WKKA 1UMZA 2DV9A 1CGPA 1F5FA 5AVPA 2WIIB 2DCKA 3EO6A 1DDLA 3OD0A 4N90A 2YC0A 3O0VA 1A8DA 1XE8A 3E6DA 4QHBA 1REEA 2W68A 3H1WA 1BVP1 4Y26A 2DU0A 4KWJA 1V9U1 3WP3A 3G7DA 1DHKB 4R9BA 2XB6C 3KT4A 4FVVA 2VVEA 2RS52 3L2HA 4BLIA 1G9AA 3M3IA 1S0GA 2DWRA 2HWB1 3AKTA 1O3QA 4M00A 4LBQA 5JZGA 1WW5A 4XF3A 4JGZC 4CTEA 3M3QA 1HRV2 4FPKA 5BNPC 1DYPA 4HFSA 4FPHA 2GZWA 3FBMA 1ASJ2 4Q2FA 4XILA 4YM0A 1JW6A 3U11A 4FQZA 1ZYBA 2XJUA 2RMU1 5BXXA 4W6XA 4FAGA 3OTFA 1Y7BA 4LBQB 5GZDA 5JZGB 4Q1RA 4JGYA 4N9IA 3WDYA 1AYM1 1OOPC 1ZBA3 3C2UA 3MYXA 4MUVA 1VLNA 3SITA 2GH2A 1LHWA 4N43C 1DFQA 1FATA 4XOGA 3OYWA 1AR81 2VMIA 3AKSA 2QDNA 5FRAA 1UKRA 4KG0A 2ETEA 2WNUA 4JGYB 4BZ4A 5BNNB 3AXDA 4HSLA 4HVQA 3ELNA 4EWDA 2R49A 1CIWA 3KD4A 4YW4A 1S0DA 3S6PA 3UJOA 1RUF3 1AR93 2ZS6B 2WNUB 1Q8QA 4IXLA 1DU3D 1MS0A 2O8QA 3JD71 4QMAA 1DQ1A 1GSLA 3AYDA 3O7OA 1VBA3 2DURA 5F9TA 3MLLA 1WW6A 2E9QA 2D6KA 3HIFA 4LO8A 4ZU4A 1TQ5A 5BYNA 2ZMLA 3ECQA 4ZU5A 2O8OA 1YI7A 1D0GA 4QQHA 1SACA 1SFNA 2GMMA 4OI4A 1OFSA 2ZJCA 4D94A 1QJX3 4RHV3 1KXGA 1OLQA 2NQYA 4EWAA 1DQ2A 3M7AA 5GZCA 1CJDA 3JB8A 1IS4A 4YW1A 1UPIA 2D7FA 1ENXA 1TMF3 3A0KA 1QJZA 5E16A 3R4UA 1Q8VA 2HWD1 2ZGNA 4GB31 3I8TA 1POV1 3KS7A 1UPSA 2WQZC 1ULFA 2AZ5A 4E4SA 2ZGLA 1OQ1A 4H7MA 3AMHA 3VLBB 3BODA 3LKJA 4HSJA 1SLCA 3TWIA 2PELA 2VY0A 1EV12 1MR5A 3KCCA 2DF7A 2OYZA 1Q8OA 1R091 2PHRA 4IEWA 1WCDJ 2KA3A 1O5UA 1RUG3 3LOBA 3SLIA 3ACLA 1MS3A 2VNRA 4PF5A 3I59A 3OF1A 3ZDSA 1UU6A 2A5ZA 1WW4A 4LE3A 5CB7A 4R8HA 4AEDB 3WDXA 2RS12 3ILNA 3JQXA 4BA6A 3RRDA 2CGOA 4AQ2A 4C1XA 3VBOA 5A3LA 1FT9A 2XJTA 4CEWA 1QNWA 2R071 1ZREA 1D4M2 2QQPA 2KXLA 3I59B 1KJLA 4I2OA 1URXA 3RI9A 4IV3A 4GULA 2YV8A 2Z5WA 4XJAA 2ZZJA 5BNOB 4CEWB 4MSVA 4LBOA 3WX5A 4D7TA 1RUC3 1Q56A 5EZWA 4Y22A 2E7TA 3V0AB 2ZKLA 1NA1A 2PHUA 3UKTA 1VB4A 5CFDC 1B09A 4Q4Y2 4Q1PA 1Z7S1 4ATEA 3NV3A 4G9SB 2GN3A 4NN0A 1FMD2 3AYEA 1I5ZA 5AFEA 3B93A 1ZA4A 2WA3A 4M3CF 3RPQA 4Y22B 3VKNA 2Z2SB 1NA1B 4FOQA 3MI8A 2RR12 2UWBA 3PLQA 4KU8A 5BUVA 4K1ZA 3WDUA 3AB0A 3NAPC 3O5SA 2VNGA 2VUJA 3POYA 2P3IA 4RS5A 1YFWA 5FREA 2PHWA 3WG1A 2ZOEB 2A7AA 2H6CA 5DDJ1 3ES1A 1PGL2 5FMOS 3APBA 4IEYA 3IT8A 3WP5A 2R073 3WV6A 4RS5B 2A6XA 1CONA 2PHXA 4I02A 1B35C 4Q4X2 4K21A 3ENRA 4MGZE 1SCSA 3E5XA 4NPRA 4AXOA 4Y1VA 2ATFA 2ZGPA 1QXPA 1PIV2 3MIDA 1IPKA 5D8AA 3WG3A 5EYYA 5JOXA 1U0AA 4V1PA 2JG8C 4ITCA 4NO4A 1N3OA 1JH5A 3D8CA 4A3XA 2PAEA 1I6XA 1O3SA 4H55A 3I54A 4AVTA 1V6JA 2YUEA 1AHSA 4AHYA 2WS91 5D8AB 5KHJA 1H8TC 4CDQC 4YSFA 2EXJA 1PHMA 2DVBA 1UD1A 2IC1A 4R4ZA 4E27A 4AVVA 2OW4A 4AI3A 1V9U2 3NV2A 3R4DB 1UU5A 3M2MA 3ZMOA 1GZ9A 2JKBA 3MLJA 4COZA 5T52A 2B45X 4LLFA 3H1YA 3W58A 3AP4A 3CU7A 2HWB2 4AVAA 3B01A 3MIHA 1X50A 4AI1A 4DOUA 1H8VA 1S0JA 1SLBA 2XJPA 3VBUA 4XXPA 4AK3A 2Y38A 4Q29A 2ZABA 4ZU7A 5I0TA 1WLWA 4B7KA 4FPOB 4YM3A 5F6KA 5SV5A 2V5YA 2RMU2 5FBZA 3VBFC 3M3CA 3GNEA 3VBUB 5T5OA 2VQ0A 1AYM2 1I9RA 2NMOA 1HRI2 3ZN4A 5JSRA 1Z0HA 1AR82 3DPRC 3UL2A 1K5MC 2C1FA 3LB9A 1IPJA 3AP6A 1GNZA 5FLIA 4XJ9A 1BKZA 5CFCA 4XFBA 1EAH1 1Y3TA 1HKDA 3M3OA 1LU2A 2DU1A 1RJ8A 4XTMA 1WGPA 4P9JA 4Z07A 4F8AA 1CAXA 3VBSA 1GANA 2LALA 3LOIA 3MW4A 3VBRA 3W9AA 5CFCB 1AR63 1WA4A 1FOD1 3JD72 2K9ZA 5D1IA 3AJZA 3ZXJA 4FBFA 3MIEA 1RUI3 3CJIC 3EHKA 2ZX3A 3CJXA 1Q3EA 1QDCA 4XBQA 3SHRA 1CAXB 3NJZA 2JG9C 1AL21 4S2DA 4K7JA 3VBRB 1G9FA 4BQ1A 1V6NA 3ZN6A 1C1FA 3SCHA 2AGSA 4N53A 4NWWA 5KXCA 1LEMA 5H9RA 4KWLA 1FPN1 2FHRA 3MEPA 4XIKA 1V00A 3BOWA 5GALA 3TN91 3NO8A 3G6JB 4EN6B 5DUUA 3ZN6B 2K0GA 1VBB3 3LSDA 4JQRA 5IK4A 2XWJB 4N53B 2PLV3 1UF2C 3ME2A 4BLJA 4FPGA 4Q0SA 1H9PA 3ZFGA 4M3CB 1NXD1 3ZFEC 3WUDA 4GB32 2HWD2 1EAH3 4RFT0 3FUQA 1N1SA 3WNXA 4HK9A 5H9QA 2HWF3 4AE2A 1XYPA 3HWJA 2PTMA 1GYKA 4AQ6A 4CDXC 1JXNA 3ZFGB 5JI7A 2BNMA 2VXRA 3FLTA 2B9UA 1O5LA 1FX5A 2FMYA 5ABJA 1R092 5B2GB 4ES9A 1RUH3 2E7AA 3GBFA 1VJ2A 4OZXA 4Y1YA 1AR73 1G9CA 4AW7A 1KFUL 4JC1A 4Q0UA 2B39A 2UWAA 1QXRA 1PO21 4CRQA 1S0IA 5HI0A 2F6BA 3MPPG 4GIQA 3AKQA 5F5QA 3TOJA 4OHZA 1OQDA 2MNGA 1NQJA 1RHI1 2VG9A 1Y9QA 3AK0A 2XLGA 2VNOA 2CWSA 2GNDA 4QPYA 2PQQA 3R05A 3CL1A 3T2TA 4ZKTB 1BK1A 3AX4A 5F6LB 1QU0A 4DPNA 4XF1A 1UZYA 1L3JA 3VKFC 4Z2WA 1ZZBA 4FTBA 4R4XA 1S0BA 3AYAA 2ZAAA 1YNAA 5DUWA 3VBHC 4FCAA 1CJPA 3E6BA 2Z42A 1Z7S2 4U2AA 1BMV1 4XJ8A 1LOFC 2RS33 3O12A 5KXDA 2PFWA 5CVRA 4BIFA 4KWKA 1YCIA 5BNPA 2GAUA 1AYN3 1LCLA 4BIOA 4SLIA 4MYEA 5A33A 1PNFA 1GQGA 1VBC1 4U36A 1TME3 4GH4C 3M4FA 5DUVA 1HXS1 3O0XA 4LA2A 2XBO3 4RL7A 3TNQA 4ISRA 5FQ0B 5LRSA 1G9DA 1OOPA 3B9IA 5L36A 4IERA 4FOWA 4N43A 1YI9A 1RMU1 5DDJ2 3MF6A 1NQDA 5T3NA 4X6RB 5DUXA 3WHTA 4AYUA 4UBHA 4F83A 2D5HA 5AFBA 2BNNA 1OOPB 3MFCA 3BB6A 1SFYA 3ES4A 1BCXA 4N43B 2MEV1 1PK6C 4IEZA 4K40A 2GNTA 4LEJA 2YROA 3B9CA 2H0BA 3ZSKA 1R081 4Q4W1 5E88A 2I07B 1CPNA 2AYHA 4IQPA 2JXAA 1Z78A 5I8SA 3WDWA 1REFA 3B5LB 1QQP3 2R30A 4MLOA 3VZNA 1MACA 1BQPA 3WD5A 3KMHA 1UCXA 1D2SA 1RUD3 1W6QA 4I0BA 5IK7A 1FXZA 2UY8A 3S30A 1LHUA 2WS92 4TLFA 3ZYJB 2D43A 2XHKA 3MGUA 2XLFA 2R063 3EJKA 1N1VA 5GLTA 4FPFA 3VGIA 3RJ2X 1W6QB 4LBQD 4B8EA 4GMP3 4L99A 2HEVF 4QPGB 2TBVA 1DZTA 2FMDA 2LTNA 3JBG3 2VULA 2QUOA 1A6CA 1GBGA 2OPKA 4HN0A 2QZ3A 1LGNA 3S0MA 3GHNA 2AENA 4B3NA 3K51A 1ULCA 2EAKA 4YFWA 3N7KA 3ZO0B 1ND3C 5C9AC 2JD4A 2ZGUA 2BTVC 2PHDA 1CQ9A 5ACA3 5CA6A 1POV0 1APNA 1RL3A 4XMAA 4YZ1A 4RQPC 4H3WA 4HANA 3UV9A 3J8F3 3V65A 4BYYA 4QM8A 5LEJA 2IXLA 4FOVA 4XFGA 4WVMA 3S7EA 1VBE3 4LBJA 1C4RA 1LOAA 2UYAA 2MPFA 2R32A 4XQWA 5GLUA 5FO8B 5L7OC 3AZVA 2DVGA 3H3UA 5C8CC 1LOEA 3RJRA 1KFXL 2IWGB 1OQEA 4WVMB 1PGSA 3VL9A 1LOBA 3HBZA 1PGW1 4CEYB 5J7MA 3FUOA 4AWDA 1W6PA 2D93A 2P17A 4WBBA 1MS5A 5K7PA 1AX2A 1BJQA 3QLQA 1ZBA1 2B8MA 4Y24A 1I1EA 2RJKA 3P3NA 3MW3A 3DF0A 4PDWC 1CPMA 2VVDA 1C57A 3JQWA 3OGJA 1FOD2 1W6PB 1GV9A 2Q5TA 2FZ1A 4AQTA 5LK7B 2WNVB 1PZ9A 2BFUS 1ZZ7A 1AL22 1MEC3 4IEOA 1YLLA 5CBLA 3O14A 4UBGA 3H1MA 2VMGA 4TWTA 1RUF1 3M8LA 1AR91 1HV1A 4GXLA 3VHOA 2ZX2A 5LK5A 2FQPA 2I74A 4XFIA 3GZTB 4KH9A 4QGLA 1FPN2 3T1LA 5HCAA 4INDA 3AZXA 4EV0A 3NAPA 1VRH2 3TN92 2CYFA 4R9DA 4LA3A 1VBA1 2GNBA 2X5IA 3WR0A 2A70A 4QGMA 2X29A 5DG1A 5GKAC 2ZHKA 1OD5A 1S1AA 2Q30A 2ZA9A 1O3TA 4AVBA 2CL2A 3FHIB 4QX5A 1OPOA 5H9SA 1DQ5A 1N3QA 3WCRA 3NAPB 4P14A 4OLLA 2HWC3 1JYCA 1PO13 2X5IB 4JDOA 3H50A 1RGSA 1QJX1 4RHV1 4MH0E 1HIXA 3B7MA 5T5LA 3LSEA 3N35A 2G9FA 1CN1A 1RITA 4O9EA 1TMF1 4AEKA 1WBLA 3RYKA 3FFZA 4PLMA 2WJSA 3AFGA 4FPCA 4AG4A 1PO22 2JG8A 4FP2A 2EALA 3HR9A 3OYWB 1QKQA 2YGMA 2TNFA 1GLHA 3FLRA 4D3WA 2RJLA 1QF3A 3AMMA 1H1IA 4LBNA 3GHMA 3IN9A 1QH7A 1RHI2 4HKLA 4XHBA 2IFRA 1H8TA 1RUJ3 4CDQA 2UY9A 4N9HA 2P37A 4CP2A 1RUG1 2IXJA 4I09A 3UJQA 5J3UA 4HKOA 2Q8OA 4FPEA 3SXWA 4O9GA 2XKPA 5GM0A 3O0WA 5JIAA 5T55A 1H8TB 1XNCA 2VOWA 4CDQB 4AVSA 2NM1A 4EN9B 1NCQC 2VW2A 4PIZA 1NCRC 4WVWA 3AMNA 3RDIA 4YVSA 1BMV2 2CNAA 2R043 5I8TA 3B3QE 3VV1A 5FPZA 1MQTA 2Y0OA 3TNPB 4LUMA 5EWSA 1EYBA 4NR1A 4WM7C 4BOWA 1U5IA 1VBC2 4AF9A 2WFF3 4E4ZA 4UW5A 2WNEA 5HCFA 4YVSB 1HXS2 1RUC1 2N7GA 3ZSEA 1KJRA 1MQTB 1GZWA 1RUE3 5E89A 4P9IA 4A7YA 1DF0A 3J9SA 3NL1A 1PZ7A 1RMU2 1Q43A 3R0RA 1K5MA 2NN8A 2Q1ZB 2IFWA 5JI9A 1X82A 2B42B 2XJRA 1I3HA 1HRI3 3VDDC 3VN4A 1AUYA 5CIRA 4WZCA 3EBRA 3WZ1A 4KGQA 1GZWB 4CP0A 1DGRN 2PHFA 2MEV2 2WT1A 3PVBB 1NE4A 2AH2A 1FYUA 1H0BA 1XNBA 1QJY3 3CLPA 1R082 4GQ7A 4Q4W2 4B7EA 2H0VA 1WMFA 1EY2A 2NP0A 1S0FA 3MDPA 1ND2C 4N7UA 4JTNA 3WUCA 5CG8A 1LRHA 1NZCA 2F4PA 4AGGA 3T1MA 4DRRA 3CJIA 1OHFA 3W59A 4BCUA 3URFA 1BBT3 3D0SA 2D6LX 3ZYPA 2JG9A 2Q1MA 2E53A 2RE9A 2GSYA 5GZEA 2XPJA 1OA3A 3RNSA 1PZ8A 3VBOB 1ZZCA 3U4XA 5KXBA 4Z92B 1SLLA 2TUNA 1Y43B 4LBLA 4B4RA 2HWE3 1AF9A 1YUDA 4RR3C 5F1RA 4MXWA 1KD7A 2G9GA 2JG9B 3POSA 4IV3B 2ZPXA 2XVGA 3IPVA 1V6KA 5JSPA 2XL7A 2BUKA 1MVQA 1FV2A 3ZPYA 3BIWE 1VBD3 4WVVA 1UU4A 3HN1A 3ZFEA 1WMEA 2YZ4A 1D4VB 4MXWB 1U5XA 1W6MA 3LA3A 3NSTA 2A6VA 1N3PA 1JBCA 2D40A 2WT2A 3ZXEA 4FTEA 3KCYA 4JVAA 4LULA 2Z79A 4FQ4A 1NG0A 3J4UH 1W0PA 4CDXA 2ZHLA 2G4IA 3QBQA 4IV1C 4LBMA 4OHVA 4IEVA 1QXJA 1W6MB 4RA0A 3H7YA 4OHXA 2EVXA 3ZYRA 4YM1A 3IDEA 1PVC3 4CDXB 2BNOA 1UN1A 3ZIXA 3THPA 3BPZA 2D3PA 4META 4OI2A 4AFDA 1PGW2 3M1HA 2A73B 2CV6A 1KITA 3WQ7A 4XTPA 3GBWA 5K0UA 4Y1XA 1ZBA2 2QJVA 1RUOA 4AQSA 1IKPA 1TEIA 2WINB 1DZRA 2D6NA 1YFXA 1QHDA 1U5ZA 4WM8C 1AZDA 5BNNC 5I0SA 2PN5A 1RVF3 4MGKE 3J26N 2IZWA 2P3JA 3VBHA 5K0UB 3TYJA 2JECA 4XF0A 1J3RA 1BEV3 1ZBE3 4LE4A 4BM8A 5FDBA 4FSJA 4G3YC 3AP5A 4OI1A 2A6WA 3WG4A 4Z8BA 1LOFA 4QQLA 3SH3A 1KDMA 3AXEA 1CVNA 1ALYA 1RUF2 1AR92 3FBYA 5JMCA 5KHIA 4I3PA 3VBHB 1WD4A 2DTWA 1AR61 4XE9A 2CGNA 1SLAA 3QCWA 1F2NA 4AHXA 2GMPA 3N4MA 3AJYA 1VBA2 1RUI1 4HKWA 1XRUA 4B4QA 3A4UA 2O1QA 1QDOA 5JVVA 1CR7A 1ZZ6A 2ZGQA 4QGNA 2V09A 4A7ZA 1LGBA 2WA4A 2HKXA 3ZXDA 3ZX7A 4FOYA 1KQRA 1UKGA 1ZZ8A 2NZ9A 1CD3G 3ILRA 2OUHA 2PA7A 3UK9A 1QJX2 4RHV2 1WW7A 5HXVA 1PK6A 4Y1UA 4JDMA 2AREA 4UXAA 4R9AA 1VBB1 1YFUA 1O3RA 5E1RA 3HMYA 1X7NA 2PLV1 2WZPP 1TMF2 4Y5Z0 1OKQA 1JUHA 4P9WA