2BA1G

Archaeal exosome core
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
258
structure length
247
Chain Sequence
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Archaeal exosome RNA binding protein CSL4
total genus 73
structure length 247
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2ba1G01
1R6MA 5JEAC 2PNZA 2PO0A 2C37A 1UDQA 1R6LA 4OO1E 5C0XE 5K36D 3M85G 2BA0D 3DD6A 2NN6C 2BR2A 3U1KA 5K36F 3M7NG 4OO1F 4BA1A 2NN6F 3B4TA 2JEBB 2WP8B 2JEAA 4IFDF 2C37B 1UDOA 4OO1C 2BA1D 3L7ZA 2JEAB 2BA0G 1OYSA 2WNRB 2PO0B 3M85D 3HKMA 2PNZB 5C0XB 2C39A 2C38A 2JE6A 2PO2B 4IFDC 2C39B 5C0XD 4BA2A 4NBQA 1UDSA 5K36B 2BR2B 4AIDA 1E3PA 2WNRA 4OO1B 4AIMA 5JEAA 3CDJA 2JEBA 5C0XC 4IFDD 5JEAB 2PO2A 5C0XF 4OO1A 2NN6D 4BA2B 1OYPA 1UDNA 5C0XA 2C38B 3GMEA 4AM3A 5JEAE 1E3HA 3M7ND 2BA1G 5JEAD 3GCMA 4IFDA 3KRNA 4BA1B 5K36A 2WP8A 3CDIA 4IFDE 5JEAF 1OYRA 2PO1B 5K36E 2NN6E 3GLLA 5K36C 4OO1D 2NN6A 3H1CA 2PO1A 2NN6B 4IFDB 3L7ZB 2JE6B
chains in the Genus database with same CATH superfamily
5JEAC 2IESA 3P3GA 3CWVA 4JI3E 1H7UA 4MU4A 2UUAI 3LNUA 1FNMA 1R6LA 2O1VA 1KIJA 3M85G 2BA0D 3P06A 3LPSA 4UTGA 5DRQA 2BM0A 4JI1I 5DNLA 2F4VE 4JI6E 3QT8A 3B82A 4R1FA 4WUCA 2UXBE 2HKJA 1PKPA 2Z5CA 1N33I 2JEAB 3Q6MA 4PRVA 2WNRB 2HHHI 4DR7I 2PO0B 4IZKA 1USUA 1A6FA 3HKMA 4QNJA 4EMDA 5BR8E 4OX9I 2GO3A 1FJGI 3B8HA 1ZXMA 2X7IA 4JG4A 1UDSA 5K36B 1RREA 4AIDA 1E3PA 1RR9A 4UT4A 4USMA 2JEBA 5DRRA 3J7AG 1Z5CA 5EL9A 5C0XF 5LMUE 2PNLA 4DU8A 4HYMA 1ZXNA 3JAMC 4BA2B 4JI1E 4LCFA 4MU3A 5C0XA 2C38B 1HNZE 2ZM6I 2WW4A 4FW3A 2CGEA 4LF6I 4I3HA 4B3TI 4P52A 2Z5EA 2E5LI 4LF8E 2UUCI 1E3HA 2J7KA 2ZBKB 2BA1G 4JI8I 4DR4E 3PYDA 4X66E 3T1YE 4JI3I 4WUDA 4KHPI 2WP8A 4DUYI 5JEAF 4AQYI 2PO1B 4MQYA 2NN6E 4JI7I 5DRPA 4FWHA 1XNQI 2VQEI 4DV1E 3HJCA 1IBKE 4FW7A 4B3RI 4JI2E 4DU7A 4U3DA 4K0KE 1YHCA 1KKHA 1N36I 1FKAE 1MU5A 1ZM3A 2E5LE 2PO0A 4LF8I 2C37A 1Z0BA 1UDQA 4YHHI 4IS9A 4B3MI 4DPYA 1PVGA 4DV7I 2O1WA 2O3ZA 3DD6A 3ZZ0A 3PRYA 2BR2A 1ZM4A 2F4VI 1XNQE 5K36F 3M7NG 2Z5BB 2A2DA 4DV5E 4BA1A 2NN6F 4LF9I 3B4TA 5FLXQ 4PRXA 2JEAA 4JI6I 4DXLA 1Z0VA 2C37B 1UDOA 3GONA 4OZEA 4X66I 1Z59A 3T1YI 2BA1D 2UXDE 1OYSA 2BA0G 3D4JA 4GKKI 3M85D 2HFUA 4OX9E 1DARA 4J3DA 1H72C 2PNZB 4YHHE 4QNKA 5C0XB 1NHJA 2JE6A 4DV4E 1N32I 1BKNA 1KVKA 2V2VA 4JYAE 4KQVA 4K0KI 4DR3E 3ZKBA 4X65I 2BR2B 4X62E 4DR2I 4ISAA 4OO1B 4AIMA 5LMNI 4XTJA 5JEAA 2HHHE 4DR7E 4IZKB 5C0XC 4LFCE 3U1YA 3WU5A 4OKGA 2VF3A 4IFDD 2Z5CB 2IOQA 3F0NA 4JV5I 3PYGA 3QT5A 1FJGE 2F1DA 4LPFA 4USKA 4LF6E 1XMOI 1ZM9A 5GMDA 1H73A 1RHYA 1FI4A 4ED4A 5JEAE 3Q1QA 1N0VC 2E1RA 3M7ND 5JEAD 4LF5E 1B62A 3GCMA 3PS2A 1QZRA 4IFDA 1OJ4A 3M6AA 1D6TA 5K36A 1Z5AA 3CDIA 4IFDE 4MYUA 2IOPA 3J80Q 1OYRA 5K36C 2NN6A 4DR3I 2Z5BA 4FW9A 1S16A 4DR1I 4JI7E 3LTOA 1Y60A 1Y4UA 3K1JA 3H1CA 1J5EE 1HR0E 4LF4E 2NN6B 2IERA 2UUCE 3HULA 4LFBI 4JI4E 3L7ZB 2JE6B 1K47A 4JI0I 4JI8E 1KTVA 1PIEA 1XXEA 4FWGA 2PNZA 1MX0A 4PU9A 5DNXA 2UUBI 1IBLE 3T1HE 3WU4A 2UXCI 4DUZI 3J81Q 5C0XE 4IZJD 5K36D 4RPFA 2VQEE 4DV1I 4GKJE 1IBKI 2NN6C 5LMUI 3U1KA 2J65A 1FWKA 4DV3E 1ELOA 2AJ4A 4OO1F 1J5EI 1HR0I 2ZM6E 1EI1A 4X65E 2JEBB 2WP8B 2UU9E 4LCHA 4IFDF 1NZ0A 2CZ9A 2V8PA 4MU0A 4DR5E 3ZZTA 4NXNI 4X64E 4DV6E 3UHMA 4LF7E 1P42A 2O1UA 4ZVIA 5FLXC 5IWAE 4MDTA 4IFDC 1XNRE 4URLA 5C0XD 4BA2A 1HNXE 1MG7A 2HK3A 4B3RE 2WNRA 1I94E 2ZITA 1IBLI 1H7SA 4P7AA 1S4EA 4Z7YA 2GQ0A 2UXBI 3CDJA 5ELWA 4KHPE 2UXCE 3P3CA 4DPWA 2VESA 5JEAB 3V5RA 3OTOI 4B3ME 4LCGA 1N32E 2PO2A 1Y6ZA 4OO1A 5IT9Q 5BR8I 3ZZUA 4DV3I 4GQUA 4JI2I 1OYPA 1ZM2A 5DROA 3ZM7A 2DEIA 4DR2E 3GMEA 4DR6E 4B3SE 1HNXI 1XHKA 2EFGA 5LMNE 4FN5A 4JI5E 1N34I 2BM1A 4LF5I 4LF9E 1Z0TA 5EKWA 3JAMQ 1NHIA 2JT2A 3V2UC 3J80C 1IBMI 4MYTA 4BA1B 2V2ZA 4HACA 2DEJA 4OO1D 2GS8A 4DV5I 1I94I 3QT6A 4JI4I 1VI7A 4DV2I 4YY3I 4IFDB 2LJPA 4WUBA 4NXMI 1HNWE 1B63A 1R6MA 2AE8A 2CVEA 1U2RA 4HXZA 4DPTA 1N34E 4MU1A 4X64I 4DV6I 3T1HI 4NXNE 1Z0EA 1WUUA 5GMEA 4DV4I 4OO1E 2VQFI 4JYAI 4DUYE 1Y4SA 4FWDA 5IT9C 2Q2EB 1HNZI 5LL6R 1Y5YA 1YH8A 2O1TA 4B3TE 1XMQI 4LOMA 1Z0WA 3PS1A 1XMOE 4DV0I 3B78A 5L3JA 3K85A 4DR5I 1N0UA 1N33E 2V34A 3P76A 4OO1C 1H74A 3L7ZA 1Z0CA 3WU3A 3P3EA 4DPXA 4JV5E 4DPUA 2CG9A 2C39A 2C38A 3WU6A 3K17A 2PO2B 4DV7E 5IWAI 2C39B 4NBQA 4M1KA 2V2QA 1XNRI 3PYFA 4FW4A 4NXME 1HNWI 4LF4I 4U3BA 1NHHA 1XMQE 5A2QC 4LFBE 3PYEA 4IZJB 4JI0E 3H4LA 4HY1A 4LF7I 2HK2A 4N3OA 4FW6A 3QT7A 5A2QQ 2UXDI 2UUAE 1USVA 4GKKE 2NPFA 1FWLA 3ZKDA 4DUZE 2R42A 4DR1E 2XEXA 1HK7A 2NN6D 2HFSA 2HKEA 3PS3A 2PNMA 1VISA 1UDNA 4LFAE 2GO4A 4DV0E 5FWKA 1Z0GA 4AM3A 3NZKA 2UUBE 4B3SI 3J81C 2BV3A 4HACB 2UU9I 2X36A 2A2CA 1UEKA 3OTOE 4DR4I 2R3VA 3KRNA 4LFCI 1IBME 4IZJA 4GKJI 5K36E 3GLLA 2VQFE 3J7AM 4AQYE 4X62I 4DR6I 2PO1A 1Z5BA 1N36E 1EA6A 2OI2A 4FW5A 3Q6NA 4LFAI 4JI5I 4DV2E 4Z7CA 4YY3E
chains in the Genus database with same CATH topology
1R6MA 5JEAC 2PNZA 2PO0A 2C37A 1UDQA 1R6LA 4OO1E 5C0XE 5K36D 3M85G 2BA0D 3DD6A 2NN6C 2BR2A 3U1KA 5K36F 3M7NG 4OO1F 4BA1A 2NN6F 3B4TA 2JEBB 2WP8B 2JEAA 4IFDF 2C37B 1UDOA 4OO1C 2BA1D 3L7ZA 2JEAB 2BA0G 1OYSA 2WNRB 2PO0B 3M85D 3HKMA 2PNZB 5C0XB 2C39A 2C38A 2JE6A 2PO2B 4IFDC 2C39B 5C0XD 4BA2A 4NBQA 1UDSA 5K36B 2BR2B 4AIDA 1E3PA 2WNRA 4OO1B 4AIMA 5JEAA 3CDJA 2JEBA 5C0XC 4IFDD 5JEAB 2PO2A 5C0XF 4OO1A 2NN6D 4BA2B 1OYPA 1UDNA 5C0XA 2C38B 3GMEA 4AM3A 5JEAE 1E3HA 3M7ND 2BA1G 5JEAD 3GCMA 4IFDA 3KRNA 4BA1B 5K36A 2WP8A 3CDIA 4IFDE 5JEAF 1OYRA 2PO1B 5K36E 2NN6E 3GLLA 5K36C 4OO1D 2NN6A 3H1CA 2PO1A 2NN6B 4IFDB 3L7ZB 2JE6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6M A;  5JEA C;  2PNZ A;  2PO0 A;  2C37 A;  1UDQ A;  1R6L A;  4OO1 E;  5C0X E;  5K36 D;  3M85 G;  2BA0 D;  3DD6 A;  2NN6 C;  2BR2 A;  3U1K A;  5K36 F;  3M7N G;  4OO1 F;  4BA1 A;  2NN6 F;  3B4T A;  2JEB B;  2WP8 B;  2JEA A;  4IFD F;  2C37 B;  1UDO A;  4OO1 C;  2BA1 D;  3L7Z A;  2JEA B;  2BA0 G;  1OYS A;  2WNR B;  2PO0 B;  3M85 D;  3HKM A;  2PNZ B;  5C0X B;  2C39 A;  2C38 A;  2JE6 A;  2PO2 B;  4IFD C;  2C39 B;  5C0X D;  4BA2 A;  4NBQ A;  1UDS A;  5K36 B;  2BR2 B;  4AID A;  1E3P A;  2WNR A;  4OO1 B;  4AIM A;  5JEA A;  3CDJ A;  2JEB A;  5C0X C;  4IFD D;  5JEA B;  2PO2 A;  5C0X F;  4OO1 A;  2NN6 D;  4BA2 B;  1OYP A;  1UDN A;  5C0X A;  2C38 B;  3GME A;  4AM3 A;  5JEA E;  1E3H A;  3M7N D;  2BA1 G;  5JEA D;  3GCM A;  4IFD A;  3KRN A;  4BA1 B;  5K36 A;  2WP8 A;  3CDI A;  4IFD E;  5JEA F;  1OYR A;  2PO1 B;  5K36 E;  2NN6 E;  3GLL A;  5K36 C;  4OO1 D;  2NN6 A;  3H1C A;  2PO1 A;  2NN6 B;  4IFD B;  3L7Z B;  2JE6 B; 
#chains in the Genus database with same CATH topology
 5JEA C;  2IES A;  3P3G A;  3CWV A;  4JI3 E;  1H7U A;  4MU4 A;  2UUA I;  3LNU A;  1FNM A;  1R6L A;  2O1V A;  1KIJ A;  3M85 G;  2BA0 D;  3P06 A;  3LPS A;  4UTG A;  5DRQ A;  2BM0 A;  4JI1 I;  5DNL A;  2F4V E;  4JI6 E;  3QT8 A;  3B82 A;  4R1F A;  4WUC A;  2UXB E;  2HKJ A;  1PKP A;  2Z5C A;  1N33 I;  2JEA B;  3Q6M A;  4PRV A;  2WNR B;  2HHH I;  4DR7 I;  2PO0 B;  4IZK A;  1USU A;  1A6F A;  3HKM A;  4QNJ A;  4EMD A;  5BR8 E;  4OX9 I;  2GO3 A;  1FJG I;  3B8H A;  1ZXM A;  2X7I A;  4JG4 A;  1UDS A;  5K36 B;  1RRE A;  4AID A;  1E3P A;  1RR9 A;  4UT4 A;  4USM A;  2JEB A;  5DRR A;  3J7A G;  1Z5C A;  5EL9 A;  5C0X F;  5LMU E;  2PNL A;  4DU8 A;  4HYM A;  1ZXN A;  3JAM C;  4BA2 B;  4JI1 E;  4LCF A;  4MU3 A;  5C0X A;  2C38 B;  1HNZ E;  2ZM6 I;  2WW4 A;  4FW3 A;  2CGE A;  4LF6 I;  4I3H A;  4B3T I;  4P52 A;  2Z5E A;  2E5L I;  4LF8 E;  2UUC I;  1E3H A;  2J7K A;  2ZBK B;  2BA1 G;  4JI8 I;  4DR4 E;  3PYD A;  4X66 E;  3T1Y E;  4JI3 I;  4WUD A;  4KHP I;  2WP8 A;  4DUY I;  5JEA F;  4AQY I;  2PO1 B;  4MQY A;  2NN6 E;  4JI7 I;  5DRP A;  4FWH A;  1XNQ I;  2VQE I;  4DV1 E;  3HJC A;  1IBK E;  4FW7 A;  4B3R I;  4JI2 E;  4DU7 A;  4U3D A;  4K0K E;  1YHC A;  1KKH A;  1N36 I;  1FKA E;  1MU5 A;  1ZM3 A;  2E5L E;  2PO0 A;  4LF8 I;  2C37 A;  1Z0B A;  1UDQ A;  4YHH I;  4IS9 A;  4B3M I;  4DPY A;  1PVG A;  4DV7 I;  2O1W A;  2O3Z A;  3DD6 A;  3ZZ0 A;  3PRY A;  2BR2 A;  1ZM4 A;  2F4V I;  1XNQ E;  5K36 F;  3M7N G;  2Z5B B;  2A2D A;  4DV5 E;  4BA1 A;  2NN6 F;  4LF9 I;  3B4T A;  5FLX Q;  4PRX A;  2JEA A;  4JI6 I;  4DXL A;  1Z0V A;  2C37 B;  1UDO A;  3GON A;  4OZE A;  4X66 I;  1Z59 A;  3T1Y I;  2BA1 D;  2UXD E;  1OYS A;  2BA0 G;  3D4J A;  4GKK I;  3M85 D;  2HFU A;  4OX9 E;  1DAR A;  4J3D A;  1H72 C;  2PNZ B;  4YHH E;  4QNK A;  5C0X B;  1NHJ A;  2JE6 A;  4DV4 E;  1N32 I;  1BKN A;  1KVK A;  2V2V A;  4JYA E;  4KQV A;  4K0K I;  4DR3 E;  3ZKB A;  4X65 I;  2BR2 B;  4X62 E;  4DR2 I;  4ISA A;  4OO1 B;  4AIM A;  5LMN I;  4XTJ A;  5JEA A;  2HHH E;  4DR7 E;  4IZK B;  5C0X C;  4LFC E;  3U1Y A;  3WU5 A;  4OKG A;  2VF3 A;  4IFD D;  2Z5C B;  2IOQ A;  3F0N A;  4JV5 I;  3PYG A;  3QT5 A;  1FJG E;  2F1D A;  4LPF A;  4USK A;  4LF6 E;  1XMO I;  1ZM9 A;  5GMD A;  1H73 A;  1RHY A;  1FI4 A;  4ED4 A;  5JEA E;  3Q1Q A;  1N0V C;  2E1R A;  3M7N D;  5JEA D;  4LF5 E;  1B62 A;  3GCM A;  3PS2 A;  1QZR A;  4IFD A;  1OJ4 A;  3M6A A;  1D6T A;  5K36 A;  1Z5A A;  3CDI A;  4IFD E;  4MYU A;  2IOP A;  3J80 Q;  1OYR A;  5K36 C;  2NN6 A;  4DR3 I;  2Z5B A;  4FW9 A;  1S16 A;  4DR1 I;  4JI7 E;  3LTO A;  1Y60 A;  1Y4U A;  3K1J A;  3H1C A;  1J5E E;  1HR0 E;  4LF4 E;  2NN6 B;  2IER A;  2UUC E;  3HUL A;  4LFB I;  4JI4 E;  3L7Z B;  2JE6 B;  1K47 A;  4JI0 I;  4JI8 E;  1KTV A;  1PIE A;  1XXE A;  4FWG A;  2PNZ A;  1MX0 A;  4PU9 A;  5DNX A;  2UUB I;  1IBL E;  3T1H E;  3WU4 A;  2UXC I;  4DUZ I;  3J81 Q;  5C0X E;  4IZJ D;  5K36 D;  4RPF A;  2VQE E;  4DV1 I;  4GKJ E;  1IBK I;  2NN6 C;  5LMU I;  3U1K A;  2J65 A;  1FWK A;  4DV3 E;  1ELO A;  2AJ4 A;  4OO1 F;  1J5E I;  1HR0 I;  2ZM6 E;  1EI1 A;  4X65 E;  2JEB B;  2WP8 B;  2UU9 E;  4LCH A;  4IFD F;  1NZ0 A;  2CZ9 A;  2V8P A;  4MU0 A;  4DR5 E;  3ZZT A;  4NXN I;  4X64 E;  4DV6 E;  3UHM A;  4LF7 E;  1P42 A;  2O1U A;  4ZVI A;  5FLX C;  5IWA E;  4MDT A;  4IFD C;  1XNR E;  4URL A;  5C0X D;  4BA2 A;  1HNX E;  1MG7 A;  2HK3 A;  4B3R E;  2WNR A;  1I94 E;  2ZIT A;  1IBL I;  1H7S A;  4P7A A;  1S4E A;  4Z7Y A;  2GQ0 A;  2UXB I;  3CDJ A;  5ELW A;  4KHP E;  2UXC E;  3P3C A;  4DPW A;  2VES A;  5JEA B;  3V5R A;  3OTO I;  4B3M E;  4LCG A;  1N32 E;  2PO2 A;  1Y6Z A;  4OO1 A;  5IT9 Q;  5BR8 I;  3ZZU A;  4DV3 I;  4GQU A;  4JI2 I;  1OYP A;  1ZM2 A;  5DRO A;  3ZM7 A;  2DEI A;  4DR2 E;  3GME A;  4DR6 E;  4B3S E;  1HNX I;  1XHK A;  2EFG A;  5LMN E;  4FN5 A;  4JI5 E;  1N34 I;  2BM1 A;  4LF5 I;  4LF9 E;  1Z0T A;  5EKW A;  3JAM Q;  1NHI A;  2JT2 A;  3V2U C;  3J80 C;  1IBM I;  4MYT A;  4BA1 B;  2V2Z A;  4HAC A;  2DEJ A;  4OO1 D;  2GS8 A;  4DV5 I;  1I94 I;  3QT6 A;  4JI4 I;  1VI7 A;  4DV2 I;  4YY3 I;  4IFD B;  2LJP A;  4WUB A;  4NXM I;  1HNW E;  1B63 A;  1R6M A;  2AE8 A;  2CVE A;  1U2R A;  4HXZ A;  4DPT A;  1N34 E;  4MU1 A;  4X64 I;  4DV6 I;  3T1H I;  4NXN E;  1Z0E A;  1WUU A;  5GME A;  4DV4 I;  4OO1 E;  2VQF I;  4JYA I;  4DUY E;  1Y4S A;  4FWD A;  5IT9 C;  2Q2E B;  1HNZ I;  5LL6 R;  1Y5Y A;  1YH8 A;  2O1T A;  4B3T E;  1XMQ I;  4LOM A;  1Z0W A;  3PS1 A;  1XMO E;  4DV0 I;  3B78 A;  5L3J A;  3K85 A;  4DR5 I;  1N0U A;  1N33 E;  2V34 A;  3P76 A;  4OO1 C;  1H74 A;  3L7Z A;  1Z0C A;  3WU3 A;  3P3E A;  4DPX A;  4JV5 E;  4DPU A;  2CG9 A;  2C39 A;  2C38 A;  3WU6 A;  3K17 A;  2PO2 B;  4DV7 E;  5IWA I;  2C39 B;  4NBQ A;  4M1K A;  2V2Q A;  1XNR I;  3PYF A;  4FW4 A;  4NXM E;  1HNW I;  4LF4 I;  4U3B A;  1NHH A;  1XMQ E;  5A2Q C;  4LFB E;  3PYE A;  4IZJ B;  4JI0 E;  3H4L A;  4HY1 A;  4LF7 I;  2HK2 A;  4N3O A;  4FW6 A;  3QT7 A;  5A2Q Q;  2UXD I;  2UUA E;  1USV A;  4GKK E;  2NPF A;  1FWL A;  3ZKD A;  4DUZ E;  2R42 A;  4DR1 E;  2XEX A;  1HK7 A;  2NN6 D;  2HFS A;  2HKE A;  3PS3 A;  2PNM A;  1VIS A;  1UDN A;  4LFA E;  2GO4 A;  4DV0 E;  5FWK A;  1Z0G A;  4AM3 A;  3NZK A;  2UUB E;  4B3S I;  3J81 C;  2BV3 A;  4HAC B;  2UU9 I;  2X36 A;  2A2C A;  1UEK A;  3OTO E;  4DR4 I;  2R3V A;  3KRN A;  4LFC I;  1IBM E;  4IZJ A;  4GKJ I;  5K36 E;  3GLL A;  2VQF E;  3J7A M;  4AQY E;  4X62 I;  4DR6 I;  2PO1 A;  1Z5B A;  1N36 E;  1EA6 A;  2OI2 A;  4FW5 A;  3Q6N A;  4LFA I;  4JI5 I;  4DV2 E;  4Z7C A;  4YY3 E; 
#chains in the Genus database with same CATH homology
 1R6M A;  5JEA C;  2PNZ A;  2PO0 A;  2C37 A;  1UDQ A;  1R6L A;  4OO1 E;  5C0X E;  5K36 D;  3M85 G;  2BA0 D;  3DD6 A;  2NN6 C;  2BR2 A;  3U1K A;  5K36 F;  3M7N G;  4OO1 F;  4BA1 A;  2NN6 F;  3B4T A;  2JEB B;  2WP8 B;  2JEA A;  4IFD F;  2C37 B;  1UDO A;  4OO1 C;  2BA1 D;  3L7Z A;  2JEA B;  2BA0 G;  1OYS A;  2WNR B;  2PO0 B;  3M85 D;  3HKM A;  2PNZ B;  5C0X B;  2C39 A;  2C38 A;  2JE6 A;  2PO2 B;  4IFD C;  2C39 B;  5C0X D;  4BA2 A;  4NBQ A;  1UDS A;  5K36 B;  2BR2 B;  4AID A;  1E3P A;  2WNR A;  4OO1 B;  4AIM A;  5JEA A;  3CDJ A;  2JEB A;  5C0X C;  4IFD D;  5JEA B;  2PO2 A;  5C0X F;  4OO1 A;  2NN6 D;  4BA2 B;  1OYP A;  1UDN A;  5C0X A;  2C38 B;  3GME A;  4AM3 A;  5JEA E;  1E3H A;  3M7N D;  2BA1 G;  5JEA D;  3GCM A;  4IFD A;  3KRN A;  4BA1 B;  5K36 A;  2WP8 A;  3CDI A;  4IFD E;  5JEA F;  1OYR A;  2PO1 B;  5K36 E;  2NN6 E;  3GLL A;  5K36 C;  4OO1 D;  2NN6 A;  3H1C A;  2PO1 A;  2NN6 B;  4IFD B;  3L7Z B;  2JE6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...