2BA1G

Archaeal exosome core
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
258
structure length
247
Chain Sequence
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein CSL4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 73
structure length 247
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2ba1G01
2JE6B 5JEAD 2NN6F 3CDJA 4BA1B 5C0XA 5JEAF 4OO1A 3H1CA 5C0XB 2JEBA 3M7NG 3U1KA 2PNZA 4OO1B 2BA1D 2BR2A 2JEBB 2NN6E 1OYSA 2PNZB 2BR2B 5JEAE 5C0XC 1UDQA 1E3HA 4IFDA 4OO1C 1UDSA 5K36A 3B4TA 3M85G 4IFDB 4BA2A 5K36B 5C0XD 4BA2B 4OO1D 3HKMA 1E3PA 1UDNA 5C0XF 4IFDC 4OO1F 1R6LA 2WNRA 1OYRA 2BA0G 5K36C 2PO1A 2C39A 2WNRB 4AIMA 2NN6A 2PO1B 2C39B 5C0XE 4IFDD 5JEAA 3KRNA 4OO1E 2NN6B 5K36D 4IFDF 1R6MA 3M7ND 2NN6D 4NBQA 5JEAB 5K36F 4AM3A 2PO2A 3GCMA 2PO0A 2C37A 2NN6C 2JEAA 2PO2B 2BA0D 2BA1G 2PO0B 3L7ZA 5JEAC 2C37B 3GLLA 2WP8A 4IFDE 3CDIA 1UDOA 2JEAB 2C38A 3M85D 5K36E 3L7ZB 2WP8B 2JE6A 4BA1A 1OYPA 2C38B 3GMEA 3DD6A 4AIDA
chains in the Genus database with same CATH superfamily
5JEAD 4DR3E 2BM0A 1HR0I 4DV4E 4MU3A 4BA1B 1N36I 1Z5CA 2AJ4A 2BM1A 2OI2A 1H72C 4OO1A 3T1YI 2UU9E 1ZM3A 4JI7E 2VQEE 5LMNI 2HFSA 3U1KA 2UUCI 2PNZA 4FW3A 2DEJA 3J7AM 3ZKDA 2XEXA 1J5EE 1N33E 4JI6E 2F1DA 5DRQA 5LMUE 4JI3E 4MU1A 2VESA 4RPFA 1VI7A 1PVGA 2IERA 1IBLE 4DV6E 5JEAE 1XNRE 3NZKA 1UDQA 4LF9E 1USVA 5FLXC 1Y4UA 3PS2A 4YY3I 3T1HE 2HK3A 4USMA 5K36A 3Q6NA 3B4TA 3M85G 3V2UC 1MU5A 2CGEA 2PNLA 1FWLA 4B3ME 3F0NA 4U3BA 1Z0WA 4IZJB 2R3VA 1UEKA 4OO1D 4QNKA 2GO3A 2R42A 4JI8I 4OX9I 1NHJA 4USKA 2E5LI 4JI5I 1XNQI 1OJ4A 1P42A 1HNWI 1Y60A 4DR2I 4K0KI 2O1WA 5A2QQ 3QT5A 2PO1B 4DR4I 1HNZE 4IZKB 3KRNA 4GKJI 4DV2E 2GO4A 1I94E 2V34A 4OO1E 3PYDA 4DR7E 5K36D 4YHHI 4GQUA 2NN6D 1KKHA 1H7SA 4NBQA 4N3OA 3PRYA 2HFUA 2VQFE 4AM3A 4AQYE 2PO2A 3P76A 4X64E 3J80C 1N0VC 4JI2E 2HHHI 5BR8I 2BA0D 4JI4I 2X36A 2PO0B 2UUBE 3GLLA 2WP8A 3CDIA 2Z5EA 3K17A 2C38A 1XHKA 4JI1I 3M85D 4DV0I 5K36E 2JE6A 1FI4A 1NHHA 4MQYA 5IWAE 3V5RA 4JI4E 1K47A 4KHPI 4B3TI 1XMOE 1ZM2A 2O1TA 1BKNA 4AIDA 1MG7A 3CDJA 2ZM6I 1IBMI 3HULA 4X65E 5C0XA 5JEAF 4EMDA 4PU9A 4JI0I 4MDTA 4DR1E 2IOQA 4JYAI 1H73A 2UXDE 3P06A 5IT9Q 4DR3I 2ZITA 4DV4I 2BR2A 3ZM7A 1H7UA 2JEBB 2Z5CA 1PKPA 2UU9I 1OYSA 2IESA 4P7AA 5FWKA 4DPTA 2VQEI 4PRVA 5DRPA 1Z0CA 2V2QA 4DV7E 1J5EI 4OZEA 4WUCA 4IFDA 1N33I 4JI6I 3M6AA 5LMUI 3PS1A 3QT7A 4DV5E 4JI3I 2CZ9A 2O1UA 3Q6MA 1IBLI 4DV6I 1XNRI 3WU3A 4LF6E 4LF9I 4NXME 5C0XD 4MU4A 1Z0EA 4BA2B 1Y5YA 3K1JA 1MX0A 3T1HI 3CWVA 1RR9A 2AE8A 3ZZTA 4OO1F 1WUUA 4B3MI 3B82A 4NXNE 1OYRA 2BA0G 4DV3E 4B3RE 1Z0VA 4LCFA 4J3DA 4PRXA 1Z59A 2WNRB 1ZM9A 4FN5A 5A2QC 3WU4A 2NN6A 4XTJA 1EI1A 4DPUA 1FJGE 2C39B 3B8HA 5C0XE 4IFDD 4MYTA 3LNUA 3P3CA 4LPFA 1VISA 3J81Q 4FWDA 3Q1QA 5JEAB 1FWKA 4QNJA 5K36F 5ELWA 4LCGA 1IBKE 4HACB 4LFBE 1HNZI 1S16A 3QT6A 4DV2I 3QT8A 1I94I 1YHCA 2VF3A 4DR7I 1B63A 2A2CA 1Z5BA 5JEAC 2VQFI 2C37B 2O1VA 1S4EA 4IFDE 4LOMA 4AQYI 3U1YA 2JEAB 1ELOA 2Z5BA 3L7ZB 4X64I 1NZ0A 4JV5E 5DNXA 4JI2I 4U3DA 4FW4A 5DRRA 4BA1A 1H74A 1OYPA 3PYEA 3DD6A 2UUBI 4DV1E 2PNMA 1XXEA 1A6FA 4X66E 1Y6ZA 5IWAI 3H1CA 1FNMA 2UXCE 4HXZA 1XMOI 1Z5AA 4OO1B 3ZZUA 4ZVIA 4X62E 1HK7A 4Z7YA 5IT9C 4LFCE 4X65I 4UT4A 2NN6E 2PNZB 2ZBKB 2HKEA 4DR1I 5LL6R 4HYMA 4DUZE 2UXDI 4M1KA 4B3SE 1EA6A 4OO1C 4FW9A 1KVKA 3ZZ0A 2J7KA 4DPWA 1ZXMA 3JAMQ 4ED4A 3LTOA 1ZM4A 4IZJA 4FW6A 2LJPA 2NPFA 2Q2EB 4DPYA 2O3ZA 4LF8E 3H4LA 5K36B 4DV7I 4GKKE 4DPXA 1XMQE 1N34E 4LFAE 2BV3A 3HKMA 4DV5I 1UDNA 5C0XF 5EL9A 3P3GA 4DR6E 4LF6I 3ZKBA 4NXMI 4LF7E 5K36C 1KTVA 4DUYE 2PO1A 4MU0A 4DU8A 2UXBE 4WUDA 4IZKA 3PS3A 2CVEA 2E1RA 4DXLA 4DR5E 4NXNI 3HJCA 4DV3I 4B3RI 4HY1A 1B62A 2A2DA 5GMEA 1KIJA 4IZJD 4IFDF 4LCHA 3J81C 4LF4E 4LF5E 4R1FA 2EFGA 5L3JA 1FJGI 2PO0A 1QZRA 3OTOE 3K85A 4DU7A 2J65A 2GS8A 2WW4A 2PO2B 2F4VE 1Z0TA 1HNXE 1IBKI 4LFBI 1HR0E 1UDOA 1N36E 4WUBA 3GONA 2WP8B 3PYFA 3T1YE 1NHIA 1RREA 2C38B 3LPSA 5LMNE 4I3HA 2UUCE 2JE6B 1Z0BA 2NN6F 4JV5I 5EKWA 3J7AG 2V8PA 4MYUA 2V2ZA 3P3EA 5C0XB 2JEBA 4DV1I 3M7NG 3PYGA 4KQVA 2BA1D 4URLA 4X66I 1N32I 4YY3E 3UHMA 2IOPA 4Z7CA 2BR2B 2UXCI 1Y4SA 4UTGA 5FLXQ 5C0XC 1USUA 5DROA 2Z5CB 1E3HA 4X62I 4LFCI 1N0UA 1UDSA 1N32E 3JAMC 1RHYA 3B78A 4IFDB 4JI8E 4BA2A 4OX9E 4JG4A 3WU5A 4DUZI 2JT2A 2E5LE 4B3SI 4FWGA 4JI5E 1XNQE 4FW5A 1HNWE 4IS9A 4DR2E 4K0KE 2GQ0A 2HK2A 4ISAA 1E3PA 4FW7A 2UUAI 4IFDC 4LF8I 4DR4E 1R6LA 4OKGA 2WNRA 3D4JA 4GKKI 4GKJE 5DNLA 1XMQI 1N34I 4LFAI 1ZXNA 2DEIA 2CG9A 2C39A 4YHHE 1U2RA 4AIMA 2UUAE 4DR6I 5JEAA 5GMDA 4LF7I 2X7IA 1Z0GA 4DUYI 2NN6B 4HACA 2UXBI 2HHHE 1R6MA 3M7ND 1FKAE 4FWHA 5BR8E 2HKJA 1D6TA 4P52A 3GCMA 4DR5I 3J80Q 4JI1E 4DV0E 2C37A 2NN6C 2JEAA 2V2VA 1PIEA 1YH8A 4KHPE 4LF4I 2BA1G 4LF5I 3WU6A 3L7ZA 4B3TE 1DARA 2ZM6E 1IBME 3OTOI 4JI7I 4JI0E 2F4VI 3GMEA 4JYAE 2Z5BB 1HNXI
chains in the Genus database with same CATH topology
2JE6B 5JEAD 2NN6F 3CDJA 4BA1B 5C0XA 5JEAF 4OO1A 3H1CA 5C0XB 2JEBA 3M7NG 3U1KA 2PNZA 4OO1B 2BA1D 2BR2A 2JEBB 2NN6E 1OYSA 2PNZB 2BR2B 5JEAE 5C0XC 1UDQA 1E3HA 4IFDA 4OO1C 1UDSA 5K36A 3B4TA 3M85G 4IFDB 4BA2A 5K36B 5C0XD 4BA2B 4OO1D 3HKMA 1E3PA 1UDNA 5C0XF 4IFDC 4OO1F 1R6LA 2WNRA 1OYRA 2BA0G 5K36C 2PO1A 2C39A 2WNRB 4AIMA 2NN6A 2PO1B 2C39B 5C0XE 4IFDD 5JEAA 3KRNA 4OO1E 2NN6B 5K36D 4IFDF 1R6MA 3M7ND 2NN6D 4NBQA 5JEAB 5K36F 4AM3A 2PO2A 3GCMA 2PO0A 2C37A 2NN6C 2JEAA 2PO2B 2BA0D 2BA1G 2PO0B 3L7ZA 5JEAC 2C37B 3GLLA 2WP8A 4IFDE 3CDIA 1UDOA 2JEAB 2C38A 3M85D 5K36E 3L7ZB 2WP8B 2JE6A 4BA1A 1OYPA 2C38B 3GMEA 3DD6A 4AIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 B;  5JEA D;  2NN6 F;  3CDJ A;  4BA1 B;  5C0X A;  5JEA F;  4OO1 A;  3H1C A;  5C0X B;  2JEB A;  3M7N G;  3U1K A;  2PNZ A;  4OO1 B;  2BA1 D;  2BR2 A;  2JEB B;  2NN6 E;  1OYS A;  2PNZ B;  2BR2 B;  5JEA E;  5C0X C;  1UDQ A;  1E3H A;  4IFD A;  4OO1 C;  1UDS A;  5K36 A;  3B4T A;  3M85 G;  4IFD B;  4BA2 A;  5K36 B;  5C0X D;  4BA2 B;  4OO1 D;  3HKM A;  1E3P A;  1UDN A;  5C0X F;  4IFD C;  4OO1 F;  1R6L A;  2WNR A;  1OYR A;  2BA0 G;  5K36 C;  2PO1 A;  2C39 A;  2WNR B;  4AIM A;  2NN6 A;  2PO1 B;  2C39 B;  5C0X E;  4IFD D;  5JEA A;  3KRN A;  4OO1 E;  2NN6 B;  5K36 D;  4IFD F;  1R6M A;  3M7N D;  2NN6 D;  4NBQ A;  5JEA B;  5K36 F;  4AM3 A;  2PO2 A;  3GCM A;  2PO0 A;  2C37 A;  2NN6 C;  2JEA A;  2PO2 B;  2BA0 D;  2BA1 G;  2PO0 B;  3L7Z A;  5JEA C;  2C37 B;  3GLL A;  2WP8 A;  4IFD E;  3CDI A;  1UDO A;  2JEA B;  2C38 A;  3M85 D;  5K36 E;  3L7Z B;  2WP8 B;  2JE6 A;  4BA1 A;  1OYP A;  2C38 B;  3GME A;  3DD6 A;  4AID A; 
#chains in the Genus database with same CATH topology
 5JEA D;  4DR3 E;  2BM0 A;  1HR0 I;  4DV4 E;  4MU3 A;  4BA1 B;  1N36 I;  1Z5C A;  2AJ4 A;  2BM1 A;  2OI2 A;  1H72 C;  4OO1 A;  3T1Y I;  2UU9 E;  1ZM3 A;  4JI7 E;  2VQE E;  5LMN I;  2HFS A;  3U1K A;  2UUC I;  2PNZ A;  4FW3 A;  2DEJ A;  3J7A M;  3ZKD A;  2XEX A;  1J5E E;  1N33 E;  4JI6 E;  2F1D A;  5DRQ A;  5LMU E;  4JI3 E;  4MU1 A;  2VES A;  4RPF A;  1VI7 A;  1PVG A;  2IER A;  1IBL E;  4DV6 E;  5JEA E;  1XNR E;  3NZK A;  1UDQ A;  4LF9 E;  1USV A;  5FLX C;  1Y4U A;  3PS2 A;  4YY3 I;  3T1H E;  2HK3 A;  4USM A;  5K36 A;  3Q6N A;  3B4T A;  3M85 G;  3V2U C;  1MU5 A;  2CGE A;  2PNL A;  1FWL A;  4B3M E;  3F0N A;  4U3B A;  1Z0W A;  4IZJ B;  2R3V A;  1UEK A;  4OO1 D;  4QNK A;  2GO3 A;  2R42 A;  4JI8 I;  4OX9 I;  1NHJ A;  4USK A;  2E5L I;  4JI5 I;  1XNQ I;  1OJ4 A;  1P42 A;  1HNW I;  1Y60 A;  4DR2 I;  4K0K I;  2O1W A;  5A2Q Q;  3QT5 A;  2PO1 B;  4DR4 I;  1HNZ E;  4IZK B;  3KRN A;  4GKJ I;  4DV2 E;  2GO4 A;  1I94 E;  2V34 A;  4OO1 E;  3PYD A;  4DR7 E;  5K36 D;  4YHH I;  4GQU A;  2NN6 D;  1KKH A;  1H7S A;  4NBQ A;  4N3O A;  3PRY A;  2HFU A;  2VQF E;  4AM3 A;  4AQY E;  2PO2 A;  3P76 A;  4X64 E;  3J80 C;  1N0V C;  4JI2 E;  2HHH I;  5BR8 I;  2BA0 D;  4JI4 I;  2X36 A;  2PO0 B;  2UUB E;  3GLL A;  2WP8 A;  3CDI A;  2Z5E A;  3K17 A;  2C38 A;  1XHK A;  4JI1 I;  3M85 D;  4DV0 I;  5K36 E;  2JE6 A;  1FI4 A;  1NHH A;  4MQY A;  5IWA E;  3V5R A;  4JI4 E;  1K47 A;  4KHP I;  4B3T I;  1XMO E;  1ZM2 A;  2O1T A;  1BKN A;  4AID A;  1MG7 A;  3CDJ A;  2ZM6 I;  1IBM I;  3HUL A;  4X65 E;  5C0X A;  5JEA F;  4EMD A;  4PU9 A;  4JI0 I;  4MDT A;  4DR1 E;  2IOQ A;  4JYA I;  1H73 A;  2UXD E;  3P06 A;  5IT9 Q;  4DR3 I;  2ZIT A;  4DV4 I;  2BR2 A;  3ZM7 A;  1H7U A;  2JEB B;  2Z5C A;  1PKP A;  2UU9 I;  1OYS A;  2IES A;  4P7A A;  5FWK A;  4DPT A;  2VQE I;  4PRV A;  5DRP A;  1Z0C A;  2V2Q A;  4DV7 E;  1J5E I;  4OZE A;  4WUC A;  4IFD A;  1N33 I;  4JI6 I;  3M6A A;  5LMU I;  3PS1 A;  3QT7 A;  4DV5 E;  4JI3 I;  2CZ9 A;  2O1U A;  3Q6M A;  1IBL I;  4DV6 I;  1XNR I;  3WU3 A;  4LF6 E;  4LF9 I;  4NXM E;  5C0X D;  4MU4 A;  1Z0E A;  4BA2 B;  1Y5Y A;  3K1J A;  1MX0 A;  3T1H I;  3CWV A;  1RR9 A;  2AE8 A;  3ZZT A;  4OO1 F;  1WUU A;  4B3M I;  3B82 A;  4NXN E;  1OYR A;  2BA0 G;  4DV3 E;  4B3R E;  1Z0V A;  4LCF A;  4J3D A;  4PRX A;  1Z59 A;  2WNR B;  1ZM9 A;  4FN5 A;  5A2Q C;  3WU4 A;  2NN6 A;  4XTJ A;  1EI1 A;  4DPU A;  1FJG E;  2C39 B;  3B8H A;  5C0X E;  4IFD D;  4MYT A;  3LNU A;  3P3C A;  4LPF A;  1VIS A;  3J81 Q;  4FWD A;  3Q1Q A;  5JEA B;  1FWK A;  4QNJ A;  5K36 F;  5ELW A;  4LCG A;  1IBK E;  4HAC B;  4LFB E;  1HNZ I;  1S16 A;  3QT6 A;  4DV2 I;  3QT8 A;  1I94 I;  1YHC A;  2VF3 A;  4DR7 I;  1B63 A;  2A2C A;  1Z5B A;  5JEA C;  2VQF I;  2C37 B;  2O1V A;  1S4E A;  4IFD E;  4LOM A;  4AQY I;  3U1Y A;  2JEA B;  1ELO A;  2Z5B A;  3L7Z B;  4X64 I;  1NZ0 A;  4JV5 E;  5DNX A;  4JI2 I;  4U3D A;  4FW4 A;  5DRR A;  4BA1 A;  1H74 A;  1OYP A;  3PYE A;  3DD6 A;  2UUB I;  4DV1 E;  2PNM A;  1XXE A;  1A6F A;  4X66 E;  1Y6Z A;  5IWA I;  3H1C A;  1FNM A;  2UXC E;  4HXZ A;  1XMO I;  1Z5A A;  4OO1 B;  3ZZU A;  4ZVI A;  4X62 E;  1HK7 A;  4Z7Y A;  5IT9 C;  4LFC E;  4X65 I;  4UT4 A;  2NN6 E;  2PNZ B;  2ZBK B;  2HKE A;  4DR1 I;  5LL6 R;  4HYM A;  4DUZ E;  2UXD I;  4M1K A;  4B3S E;  1EA6 A;  4OO1 C;  4FW9 A;  1KVK A;  3ZZ0 A;  2J7K A;  4DPW A;  1ZXM A;  3JAM Q;  4ED4 A;  3LTO A;  1ZM4 A;  4IZJ A;  4FW6 A;  2LJP A;  2NPF A;  2Q2E B;  4DPY A;  2O3Z A;  4LF8 E;  3H4L A;  5K36 B;  4DV7 I;  4GKK E;  4DPX A;  1XMQ E;  1N34 E;  4LFA E;  2BV3 A;  3HKM A;  4DV5 I;  1UDN A;  5C0X F;  5EL9 A;  3P3G A;  4DR6 E;  4LF6 I;  3ZKB A;  4NXM I;  4LF7 E;  5K36 C;  1KTV A;  4DUY E;  2PO1 A;  4MU0 A;  4DU8 A;  2UXB E;  4WUD A;  4IZK A;  3PS3 A;  2CVE A;  2E1R A;  4DXL A;  4DR5 E;  4NXN I;  3HJC A;  4DV3 I;  4B3R I;  4HY1 A;  1B62 A;  2A2D A;  5GME A;  1KIJ A;  4IZJ D;  4IFD F;  4LCH A;  3J81 C;  4LF4 E;  4LF5 E;  4R1F A;  2EFG A;  5L3J A;  1FJG I;  2PO0 A;  1QZR A;  3OTO E;  3K85 A;  4DU7 A;  2J65 A;  2GS8 A;  2WW4 A;  2PO2 B;  2F4V E;  1Z0T A;  1HNX E;  1IBK I;  4LFB I;  1HR0 E;  1UDO A;  1N36 E;  4WUB A;  3GON A;  2WP8 B;  3PYF A;  3T1Y E;  1NHI A;  1RRE A;  2C38 B;  3LPS A;  5LMN E;  4I3H A;  2UUC E;  2JE6 B;  1Z0B A;  2NN6 F;  4JV5 I;  5EKW A;  3J7A G;  2V8P A;  4MYU A;  2V2Z A;  3P3E A;  5C0X B;  2JEB A;  4DV1 I;  3M7N G;  3PYG A;  4KQV A;  2BA1 D;  4URL A;  4X66 I;  1N32 I;  4YY3 E;  3UHM A;  2IOP A;  4Z7C A;  2BR2 B;  2UXC I;  1Y4S A;  4UTG A;  5FLX Q;  5C0X C;  1USU A;  5DRO A;  2Z5C B;  1E3H A;  4X62 I;  4LFC I;  1N0U A;  1UDS A;  1N32 E;  3JAM C;  1RHY A;  3B78 A;  4IFD B;  4JI8 E;  4BA2 A;  4OX9 E;  4JG4 A;  3WU5 A;  4DUZ I;  2JT2 A;  2E5L E;  4B3S I;  4FWG A;  4JI5 E;  1XNQ E;  4FW5 A;  1HNW E;  4IS9 A;  4DR2 E;  4K0K E;  2GQ0 A;  2HK2 A;  4ISA A;  1E3P A;  4FW7 A;  2UUA I;  4IFD C;  4LF8 I;  4DR4 E;  1R6L A;  4OKG A;  2WNR A;  3D4J A;  4GKK I;  4GKJ E;  5DNL A;  1XMQ I;  1N34 I;  4LFA I;  1ZXN A;  2DEI A;  2CG9 A;  2C39 A;  4YHH E;  1U2R A;  4AIM A;  2UUA E;  4DR6 I;  5JEA A;  5GMD A;  4LF7 I;  2X7I A;  1Z0G A;  4DUY I;  2NN6 B;  4HAC A;  2UXB I;  2HHH E;  1R6M A;  3M7N D;  1FKA E;  4FWH A;  5BR8 E;  2HKJ A;  1D6T A;  4P52 A;  3GCM A;  4DR5 I;  3J80 Q;  4JI1 E;  4DV0 E;  2C37 A;  2NN6 C;  2JEA A;  2V2V A;  1PIE A;  1YH8 A;  4KHP E;  4LF4 I;  2BA1 G;  4LF5 I;  3WU6 A;  3L7Z A;  4B3T E;  1DAR A;  2ZM6 E;  1IBM E;  3OTO I;  4JI7 I;  4JI0 E;  2F4V I;  3GME A;  4JYA E;  2Z5B B;  1HNX I; 
#chains in the Genus database with same CATH homology
 2JE6 B;  5JEA D;  2NN6 F;  3CDJ A;  4BA1 B;  5C0X A;  5JEA F;  4OO1 A;  3H1C A;  5C0X B;  2JEB A;  3M7N G;  3U1K A;  2PNZ A;  4OO1 B;  2BA1 D;  2BR2 A;  2JEB B;  2NN6 E;  1OYS A;  2PNZ B;  2BR2 B;  5JEA E;  5C0X C;  1UDQ A;  1E3H A;  4IFD A;  4OO1 C;  1UDS A;  5K36 A;  3B4T A;  3M85 G;  4IFD B;  4BA2 A;  5K36 B;  5C0X D;  4BA2 B;  4OO1 D;  3HKM A;  1E3P A;  1UDN A;  5C0X F;  4IFD C;  4OO1 F;  1R6L A;  2WNR A;  1OYR A;  2BA0 G;  5K36 C;  2PO1 A;  2C39 A;  2WNR B;  4AIM A;  2NN6 A;  2PO1 B;  2C39 B;  5C0X E;  4IFD D;  5JEA A;  3KRN A;  4OO1 E;  2NN6 B;  5K36 D;  4IFD F;  1R6M A;  3M7N D;  2NN6 D;  4NBQ A;  5JEA B;  5K36 F;  4AM3 A;  2PO2 A;  3GCM A;  2PO0 A;  2C37 A;  2NN6 C;  2JEA A;  2PO2 B;  2BA0 D;  2BA1 G;  2PO0 B;  3L7Z A;  5JEA C;  2C37 B;  3GLL A;  2WP8 A;  4IFD E;  3CDI A;  1UDO A;  2JEA B;  2C38 A;  3M85 D;  5K36 E;  3L7Z B;  2WP8 B;  2JE6 A;  4BA1 A;  1OYP A;  2C38 B;  3GME A;  3DD6 A;  4AID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...