2BA1G

Archaeal exosome core
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
258
structure length
247
Chain Sequence
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein CSL4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 73
structure length 247
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2ba1G01
1OYPA 4BA1A 5C0XE 1E3HA 1R6MA 3L7ZA 2C39B 2C37B 4AIMA 3M7NG 2BA1D 2BA0D 3CDIA 5C0XF 2NN6E 2PNZA 4OO1E 2WP8B 3DD6A 2WNRB 5K36A 5JEAA 3KRNA 1UDOA 3GMEA 5C0XB 4BA2A 1UDSA 2NN6F 2PO0A 4OO1F 3L7ZB 2NN6C 4OO1C 2JE6A 2JEBA 3U1KA 4IFDA 3M85D 2BR2A 2JEAA 1OYRA 2NN6B 3GLLA 1E3PA 4OO1B 5C0XC 4AM3A 4BA2B 5K36E 5JEAE 3M7ND 2PO0B 4BA1B 1OYSA 2JE6B 4NBQA 5C0XD 2PO2A 3HKMA 5K36F 2JEAB 5JEAF 4IFDE 5K36C 5JEAC 2PNZB 2WNRA 2PO1A 2BA1G 2BA0G 2C38A 3B4TA 2NN6D 5K36B 5JEAB 4OO1D 3H1CA 1UDNA 4IFDF 2C39A 4IFDC 2C37A 5K36D 5JEAD 2NN6A 2JEBB 2PO2B 4OO1A 4IFDB 2BR2B 3GCMA 1R6LA 4AIDA 1UDQA 3CDJA 2WP8A 3M85G 2PO1B 2C38B 4IFDD 5C0XA
chains in the Genus database with same CATH superfamily
3T1YI 1IBME 4WUCA 2HHHI 4GKJE 3Q6NA 1Z0WA 1MX0A 1USVA 3M6AA 4NXNE 1KKHA 1Z5BA 2ZM6I 2HFSA 2E5LI 4JI3E 2UXBI 1H72C 3M7NG 4DV0E 3CDIA 2NN6E 2PNZA 2F1DA 2VF3A 2O1WA 4WUDA 1XNRI 3DD6A 1FJGI 5ELWA 2WNRB 5C0XB 1PIEA 4BA2A 4KHPI 4GQUA 4MDTA 4DR3E 4B3SI 2NN6F 2PO0A 4JI6E 3J81Q 2NN6C 4IZJA 4DV4I 5IT9Q 3ZKBA 2BM0A 2ZBKB 3U1KA 4LFAE 2VESA 3LPSA 3M85D 4Z7CA 3GLLA 2A2DA 1E3PA 1RR9A 5DRQA 1DARA 3WU3A 4MQYA 2WW4A 4LF8I 1Y6ZA 3U1YA 3CWVA 1N33E 4JI1I 1I94E 2E1RA 3HJCA 4NXMI 5IWAI 4KQVA 2VQFI 2HK3A 4JI0E 1USUA 4LF5I 4GKKI 1HNXE 4BA1B 4DR5E 5C0XD 1RHYA 2LJPA 4PRXA 1ZM4A 3QT6A 1Y60A 1Z0CA 4DUYI 4K0KE 1XNQI 2WNRA 2UUBE 1NHJA 2O3ZA 2BA1G 2R42A 2C38A 2CZ9A 4JI7E 4DU7A 5A2QC 5K36B 5JEAB 3H1CA 5FLXC 4FW7A 1S4EA 2UXCE 4PRVA 4LF7I 4QNJA 2C37A 5LMUE 4XTJA 3T1YE 4DU8A 4LFBI 1J5EE 4DR6I 4IFDB 5EL9A 1Y5YA 2UXBE 1R6LA 2ZM6E 2E5LE 2Z5CA 2IERA 2O1TA 4X62I 4P7AA 4FN5A 4ZVIA 1VISA 1ZM2A 1OYPA 2UU9I 1XNRE 4BA1A 5DRPA 1FJGE 4FW3A 1E3HA 1KIJA 3QT8A 2IESA 3B78A 1RREA 4KHPE 1XMQE 4OX9I 1H7UA 1K47A 4N3OA 4JI5I 5DROA 4DV4E 3ZZTA 4B3RI 4LF9I 2AE8A 2UXDI 1Y4SA 4OO1E 3J80Q 1H74A 2WP8B 4I3HA 3K85A 1FI4A 5K36A 3B82A 5JEAA 3QT5A 4DR4I 4DPTA 2VQEI 5EKWA 4FWHA 4LF8E 2Q2EB 4JI1E 4OO1F 3L7ZB 4NXME 4FWDA 5IWAE 4OO1C 2JE6A 1P42A 2VQFE 1ZM9A 2UUCI 4IFDA 4GKKE 4LF5E 1D6TA 2Z5BB 1ELOA 3J7AG 2HKEA 4USMA 4MU0A 3JAMC 2V2QA 4AM3A 4JI8I 4DV7I 2GO3A 5LMNI 4HXZA 1XNQE 4MU4A 1FWLA 2PNLA 2V8PA 4DV5I 4JI4I 4LF7E 3H4LA 3HKMA 4DR7I 2JEAB 3PYGA 2F4VI 3PRYA 4LOMA 4LFBE 4X66I 2PO1A 2V34A 4DR6E 3B4TA 1HNWI 2O1UA 4OKGA 4U3DA 4DV6E 3NZKA 3V2UC 3J81C 4X62E 5IT9C 2V2VA 2IOQA 1H7SA 1XHKA 1FWKA 1HNZI 4JG4A 2UU9E 4OZEA 4LFCE 2JEBB 3PS1A 4JV5I 2PO2B 3GCMA 1N32I 4DV6I 2NPFA 5LL6R 1Z59A 4OX9E 1ZXNA 3T1HI 3M85G 1NHHA 1EA6A 4JI5E 4QNKA 4HACB 4URLA 4FW9A 4B3RE 1N0UA 4DV1I 2UXDE 5C0XA 2HFUA 1IBLE 4LF4I 2R3VA 4MYUA 4MU1A 5C0XE 3K17A 2C39B 4DR4E 4DV0I 5BR8I 4B3MI 2PNMA 2VQEE 4DV3I 3Q6MA 1IBKI 3OTOI 1Z5CA 2HHHE 2BA0D 3WU5A 2GS8A 4X64I 3P3CA 5C0XF 4DPWA 4DR3I 2UUCE 4FWGA 1PKPA 1HR0I 5L3JA 3LTOA 4LF6I 2JT2A 3KRNA 2DEIA 4DR1I 1UDOA 3GMEA 4JI2I 1UDSA 3GONA 2A2CA 1B62A 3P06A 4WUBA 4JI8E 4DPXA 4DV7E 2BV3A 5LMNE 2JEBA 4B3SE 2ZITA 4EMDA 1OYRA 2NN6B 4UTGA 3HULA 3Q1QA 2OI2A 3PYDA 4YY3I 4DV5E 4YHHI 4MYTA 4JI4E 3P3EA 4X65I 1N0VC 4DR7E 2GQ0A 2F4VE 2GO4A 2J7KA 3P76A 4BA2B 5K36E 4J3DA 5JEAE 4R1FA 1HNWE 3ZZ0A 3M7ND 2PO0B 5DRRA 1OYSA 4JYAI 1ZXMA 4FW4A 1N34I 3F0NA 1HK7A 2O1VA 1EI1A 5DNXA 5K36F 5JEAF 3J80C 4IS9A 4JI7I 4IFDE 1HNZE 5K36C 5JEAC 4LPFA 1Z0BA 3LNUA 1UEKA 4JV5E 4DR2I 4UT4A 1H73A 4DXLA 3PYEA 4IZKB 2NN6D 1N32E 3V5RA 4DUYE 3T1HE 3ZZUA 1J5EI 4IFDF 1N36I 2J65A 4DV1E 4IFDC 2BM1A 4LF4E 3PYFA 2UUAI 2NN6A 5BR8E 2CG9A 2X36A 4B3ME 2BR2B 1XMOI 2X7IA 4AIDA 4IZJD 4DV3E 3ZKDA 3OTOE 1UDQA 4MU3A 1IBKE 3CDJA 2WP8A 4AQYI 2C38B 4X64E 4LCHA 3K1JA 2CVEA 4LCFA 5FWKA 3WU6A 1HR0E 1XMQI 4DV2I 1QZRA 4DUZI 4LF6E 1R6MA 3L7ZA 4DR1E 1U2RA 2C37B 4AIMA 4JI2E 2Z5BA 2BA1D 4B3TI 1FKAE 3QT7A 4M1KA 3P3GA 4U3BA 1A6FA 5GMEA 2HK2A 2Z5CB 4IZKA 1IBMI 3WU4A 4GKJI 4YY3E 4LF9E 1ZM3A 4YHHE 4P52A 4NXNI 5A2QQ 4JI3I 1VI7A 4X65E 5FLXQ 4HYMA 1WUUA 2DEJA 2EFGA 1XXEA 4LCGA 2AJ4A 2BR2A 2V2ZA 2JEAA 4JYAE 1NZ0A 3B8HA 4OO1B 1N34E 1MU5A 5C0XC 3D4JA 4FW5A 1Y4UA 4JI6I 1PVGA 4HY1A 3PS2A 4Z7YA 4DR2E 4LFAI 1Z5AA 4RPFA 4PU9A 2JE6B 4NBQA 4DPYA 1Z0VA 1N36E 4ED4A 2PO2A 1OJ4A 1Z0EA 5DNLA 1N33I 1I94I 1YH8A 1BKNA 4ISAA 2UUAE 2PNZB 4HACA 2BA0G 2IOPA 4JI0I 1NHIA 1XMOE 1MG7A 1YHCA 1HNXI 4OO1D 4LFCI 3ZM7A 1UDNA 3UHMA 4X66E 4DR5I 1KTVA 4AQYE 2C39A 1KVKA 2XEXA 1B63A 4DPUA 4IZJB 5K36D 5JEAD 3PS3A 4DV2E 1FNMA 4K0KI 4DUZE 1S16A 2UUBI 4OO1A 1Z0TA 1Z0GA 1IBLI 4FW6A 3J7AM 2CGEA 2Z5EA 4USKA 2PO1B 3JAMQ 5GMDA 2UXCI 4IFDD 4B3TE 5LMUI 2HKJA
chains in the Genus database with same CATH topology
1OYPA 4BA1A 5C0XE 1E3HA 1R6MA 3L7ZA 2C39B 2C37B 4AIMA 3M7NG 2BA1D 2BA0D 3CDIA 5C0XF 2NN6E 2PNZA 4OO1E 2WP8B 3DD6A 2WNRB 5K36A 5JEAA 3KRNA 1UDOA 3GMEA 5C0XB 4BA2A 1UDSA 2NN6F 2PO0A 4OO1F 3L7ZB 2NN6C 4OO1C 2JE6A 2JEBA 3U1KA 4IFDA 3M85D 2BR2A 2JEAA 1OYRA 2NN6B 3GLLA 1E3PA 4OO1B 5C0XC 4AM3A 4BA2B 5K36E 5JEAE 3M7ND 2PO0B 4BA1B 1OYSA 2JE6B 4NBQA 5C0XD 2PO2A 3HKMA 5K36F 2JEAB 5JEAF 4IFDE 5K36C 5JEAC 2PNZB 2WNRA 2PO1A 2BA1G 2BA0G 2C38A 3B4TA 2NN6D 5K36B 5JEAB 4OO1D 3H1CA 1UDNA 4IFDF 2C39A 4IFDC 2C37A 5K36D 5JEAD 2NN6A 2JEBB 2PO2B 4OO1A 4IFDB 2BR2B 3GCMA 1R6LA 4AIDA 1UDQA 3CDJA 2WP8A 3M85G 2PO1B 2C38B 4IFDD 5C0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYP A;  4BA1 A;  5C0X E;  1E3H A;  1R6M A;  3L7Z A;  2C39 B;  2C37 B;  4AIM A;  3M7N G;  2BA1 D;  2BA0 D;  3CDI A;  5C0X F;  2NN6 E;  2PNZ A;  4OO1 E;  2WP8 B;  3DD6 A;  2WNR B;  5K36 A;  5JEA A;  3KRN A;  1UDO A;  3GME A;  5C0X B;  4BA2 A;  1UDS A;  2NN6 F;  2PO0 A;  4OO1 F;  3L7Z B;  2NN6 C;  4OO1 C;  2JE6 A;  2JEB A;  3U1K A;  4IFD A;  3M85 D;  2BR2 A;  2JEA A;  1OYR A;  2NN6 B;  3GLL A;  1E3P A;  4OO1 B;  5C0X C;  4AM3 A;  4BA2 B;  5K36 E;  5JEA E;  3M7N D;  2PO0 B;  4BA1 B;  1OYS A;  2JE6 B;  4NBQ A;  5C0X D;  2PO2 A;  3HKM A;  5K36 F;  2JEA B;  5JEA F;  4IFD E;  5K36 C;  5JEA C;  2PNZ B;  2WNR A;  2PO1 A;  2BA1 G;  2BA0 G;  2C38 A;  3B4T A;  2NN6 D;  5K36 B;  5JEA B;  4OO1 D;  3H1C A;  1UDN A;  4IFD F;  2C39 A;  4IFD C;  2C37 A;  5K36 D;  5JEA D;  2NN6 A;  2JEB B;  2PO2 B;  4OO1 A;  4IFD B;  2BR2 B;  3GCM A;  1R6L A;  4AID A;  1UDQ A;  3CDJ A;  2WP8 A;  3M85 G;  2PO1 B;  2C38 B;  4IFD D;  5C0X A; 
#chains in the Genus database with same CATH topology
 3T1Y I;  1IBM E;  4WUC A;  2HHH I;  4GKJ E;  3Q6N A;  1Z0W A;  1MX0 A;  1USV A;  3M6A A;  4NXN E;  1KKH A;  1Z5B A;  2ZM6 I;  2HFS A;  2E5L I;  4JI3 E;  2UXB I;  1H72 C;  3M7N G;  4DV0 E;  3CDI A;  2NN6 E;  2PNZ A;  2F1D A;  2VF3 A;  2O1W A;  4WUD A;  1XNR I;  3DD6 A;  1FJG I;  5ELW A;  2WNR B;  5C0X B;  1PIE A;  4BA2 A;  4KHP I;  4GQU A;  4MDT A;  4DR3 E;  4B3S I;  2NN6 F;  2PO0 A;  4JI6 E;  3J81 Q;  2NN6 C;  4IZJ A;  4DV4 I;  5IT9 Q;  3ZKB A;  2BM0 A;  2ZBK B;  3U1K A;  4LFA E;  2VES A;  3LPS A;  3M85 D;  4Z7C A;  3GLL A;  2A2D A;  1E3P A;  1RR9 A;  5DRQ A;  1DAR A;  3WU3 A;  4MQY A;  2WW4 A;  4LF8 I;  1Y6Z A;  3U1Y A;  3CWV A;  1N33 E;  4JI1 I;  1I94 E;  2E1R A;  3HJC A;  4NXM I;  5IWA I;  4KQV A;  2VQF I;  2HK3 A;  4JI0 E;  1USU A;  4LF5 I;  4GKK I;  1HNX E;  4BA1 B;  4DR5 E;  5C0X D;  1RHY A;  2LJP A;  4PRX A;  1ZM4 A;  3QT6 A;  1Y60 A;  1Z0C A;  4DUY I;  4K0K E;  1XNQ I;  2WNR A;  2UUB E;  1NHJ A;  2O3Z A;  2BA1 G;  2R42 A;  2C38 A;  2CZ9 A;  4JI7 E;  4DU7 A;  5A2Q C;  5K36 B;  5JEA B;  3H1C A;  5FLX C;  4FW7 A;  1S4E A;  2UXC E;  4PRV A;  4LF7 I;  4QNJ A;  2C37 A;  5LMU E;  4XTJ A;  3T1Y E;  4DU8 A;  4LFB I;  1J5E E;  4DR6 I;  4IFD B;  5EL9 A;  1Y5Y A;  2UXB E;  1R6L A;  2ZM6 E;  2E5L E;  2Z5C A;  2IER A;  2O1T A;  4X62 I;  4P7A A;  4FN5 A;  4ZVI A;  1VIS A;  1ZM2 A;  1OYP A;  2UU9 I;  1XNR E;  4BA1 A;  5DRP A;  1FJG E;  4FW3 A;  1E3H A;  1KIJ A;  3QT8 A;  2IES A;  3B78 A;  1RRE A;  4KHP E;  1XMQ E;  4OX9 I;  1H7U A;  1K47 A;  4N3O A;  4JI5 I;  5DRO A;  4DV4 E;  3ZZT A;  4B3R I;  4LF9 I;  2AE8 A;  2UXD I;  1Y4S A;  4OO1 E;  3J80 Q;  1H74 A;  2WP8 B;  4I3H A;  3K85 A;  1FI4 A;  5K36 A;  3B82 A;  5JEA A;  3QT5 A;  4DR4 I;  4DPT A;  2VQE I;  5EKW A;  4FWH A;  4LF8 E;  2Q2E B;  4JI1 E;  4OO1 F;  3L7Z B;  4NXM E;  4FWD A;  5IWA E;  4OO1 C;  2JE6 A;  1P42 A;  2VQF E;  1ZM9 A;  2UUC I;  4IFD A;  4GKK E;  4LF5 E;  1D6T A;  2Z5B B;  1ELO A;  3J7A G;  2HKE A;  4USM A;  4MU0 A;  3JAM C;  2V2Q A;  4AM3 A;  4JI8 I;  4DV7 I;  2GO3 A;  5LMN I;  4HXZ A;  1XNQ E;  4MU4 A;  1FWL A;  2PNL A;  2V8P A;  4DV5 I;  4JI4 I;  4LF7 E;  3H4L A;  3HKM A;  4DR7 I;  2JEA B;  3PYG A;  2F4V I;  3PRY A;  4LOM A;  4LFB E;  4X66 I;  2PO1 A;  2V34 A;  4DR6 E;  3B4T A;  1HNW I;  2O1U A;  4OKG A;  4U3D A;  4DV6 E;  3NZK A;  3V2U C;  3J81 C;  4X62 E;  5IT9 C;  2V2V A;  2IOQ A;  1H7S A;  1XHK A;  1FWK A;  1HNZ I;  4JG4 A;  2UU9 E;  4OZE A;  4LFC E;  2JEB B;  3PS1 A;  4JV5 I;  2PO2 B;  3GCM A;  1N32 I;  4DV6 I;  2NPF A;  5LL6 R;  1Z59 A;  4OX9 E;  1ZXN A;  3T1H I;  3M85 G;  1NHH A;  1EA6 A;  4JI5 E;  4QNK A;  4HAC B;  4URL A;  4FW9 A;  4B3R E;  1N0U A;  4DV1 I;  2UXD E;  5C0X A;  2HFU A;  1IBL E;  4LF4 I;  2R3V A;  4MYU A;  4MU1 A;  5C0X E;  3K17 A;  2C39 B;  4DR4 E;  4DV0 I;  5BR8 I;  4B3M I;  2PNM A;  2VQE E;  4DV3 I;  3Q6M A;  1IBK I;  3OTO I;  1Z5C A;  2HHH E;  2BA0 D;  3WU5 A;  2GS8 A;  4X64 I;  3P3C A;  5C0X F;  4DPW A;  4DR3 I;  2UUC E;  4FWG A;  1PKP A;  1HR0 I;  5L3J A;  3LTO A;  4LF6 I;  2JT2 A;  3KRN A;  2DEI A;  4DR1 I;  1UDO A;  3GME A;  4JI2 I;  1UDS A;  3GON A;  2A2C A;  1B62 A;  3P06 A;  4WUB A;  4JI8 E;  4DPX A;  4DV7 E;  2BV3 A;  5LMN E;  2JEB A;  4B3S E;  2ZIT A;  4EMD A;  1OYR A;  2NN6 B;  4UTG A;  3HUL A;  3Q1Q A;  2OI2 A;  3PYD A;  4YY3 I;  4DV5 E;  4YHH I;  4MYT A;  4JI4 E;  3P3E A;  4X65 I;  1N0V C;  4DR7 E;  2GQ0 A;  2F4V E;  2GO4 A;  2J7K A;  3P76 A;  4BA2 B;  5K36 E;  4J3D A;  5JEA E;  4R1F A;  1HNW E;  3ZZ0 A;  3M7N D;  2PO0 B;  5DRR A;  1OYS A;  4JYA I;  1ZXM A;  4FW4 A;  1N34 I;  3F0N A;  1HK7 A;  2O1V A;  1EI1 A;  5DNX A;  5K36 F;  5JEA F;  3J80 C;  4IS9 A;  4JI7 I;  4IFD E;  1HNZ E;  5K36 C;  5JEA C;  4LPF A;  1Z0B A;  3LNU A;  1UEK A;  4JV5 E;  4DR2 I;  4UT4 A;  1H73 A;  4DXL A;  3PYE A;  4IZK B;  2NN6 D;  1N32 E;  3V5R A;  4DUY E;  3T1H E;  3ZZU A;  1J5E I;  4IFD F;  1N36 I;  2J65 A;  4DV1 E;  4IFD C;  2BM1 A;  4LF4 E;  3PYF A;  2UUA I;  2NN6 A;  5BR8 E;  2CG9 A;  2X36 A;  4B3M E;  2BR2 B;  1XMO I;  2X7I A;  4AID A;  4IZJ D;  4DV3 E;  3ZKD A;  3OTO E;  1UDQ A;  4MU3 A;  1IBK E;  3CDJ A;  2WP8 A;  4AQY I;  2C38 B;  4X64 E;  4LCH A;  3K1J A;  2CVE A;  4LCF A;  5FWK A;  3WU6 A;  1HR0 E;  1XMQ I;  4DV2 I;  1QZR A;  4DUZ I;  4LF6 E;  1R6M A;  3L7Z A;  4DR1 E;  1U2R A;  2C37 B;  4AIM A;  4JI2 E;  2Z5B A;  2BA1 D;  4B3T I;  1FKA E;  3QT7 A;  4M1K A;  3P3G A;  4U3B A;  1A6F A;  5GME A;  2HK2 A;  2Z5C B;  4IZK A;  1IBM I;  3WU4 A;  4GKJ I;  4YY3 E;  4LF9 E;  1ZM3 A;  4YHH E;  4P52 A;  4NXN I;  5A2Q Q;  4JI3 I;  1VI7 A;  4X65 E;  5FLX Q;  4HYM A;  1WUU A;  2DEJ A;  2EFG A;  1XXE A;  4LCG A;  2AJ4 A;  2BR2 A;  2V2Z A;  2JEA A;  4JYA E;  1NZ0 A;  3B8H A;  4OO1 B;  1N34 E;  1MU5 A;  5C0X C;  3D4J A;  4FW5 A;  1Y4U A;  4JI6 I;  1PVG A;  4HY1 A;  3PS2 A;  4Z7Y A;  4DR2 E;  4LFA I;  1Z5A A;  4RPF A;  4PU9 A;  2JE6 B;  4NBQ A;  4DPY A;  1Z0V A;  1N36 E;  4ED4 A;  2PO2 A;  1OJ4 A;  1Z0E A;  5DNL A;  1N33 I;  1I94 I;  1YH8 A;  1BKN A;  4ISA A;  2UUA E;  2PNZ B;  4HAC A;  2BA0 G;  2IOP A;  4JI0 I;  1NHI A;  1XMO E;  1MG7 A;  1YHC A;  1HNX I;  4OO1 D;  4LFC I;  3ZM7 A;  1UDN A;  3UHM A;  4X66 E;  4DR5 I;  1KTV A;  4AQY E;  2C39 A;  1KVK A;  2XEX A;  1B63 A;  4DPU A;  4IZJ B;  5K36 D;  5JEA D;  3PS3 A;  4DV2 E;  1FNM A;  4K0K I;  4DUZ E;  1S16 A;  2UUB I;  4OO1 A;  1Z0T A;  1Z0G A;  1IBL I;  4FW6 A;  3J7A M;  2CGE A;  2Z5E A;  4USK A;  2PO1 B;  3JAM Q;  5GMD A;  2UXC I;  4IFD D;  4B3T E;  5LMU I;  2HKJ A; 
#chains in the Genus database with same CATH homology
 1OYP A;  4BA1 A;  5C0X E;  1E3H A;  1R6M A;  3L7Z A;  2C39 B;  2C37 B;  4AIM A;  3M7N G;  2BA1 D;  2BA0 D;  3CDI A;  5C0X F;  2NN6 E;  2PNZ A;  4OO1 E;  2WP8 B;  3DD6 A;  2WNR B;  5K36 A;  5JEA A;  3KRN A;  1UDO A;  3GME A;  5C0X B;  4BA2 A;  1UDS A;  2NN6 F;  2PO0 A;  4OO1 F;  3L7Z B;  2NN6 C;  4OO1 C;  2JE6 A;  2JEB A;  3U1K A;  4IFD A;  3M85 D;  2BR2 A;  2JEA A;  1OYR A;  2NN6 B;  3GLL A;  1E3P A;  4OO1 B;  5C0X C;  4AM3 A;  4BA2 B;  5K36 E;  5JEA E;  3M7N D;  2PO0 B;  4BA1 B;  1OYS A;  2JE6 B;  4NBQ A;  5C0X D;  2PO2 A;  3HKM A;  5K36 F;  2JEA B;  5JEA F;  4IFD E;  5K36 C;  5JEA C;  2PNZ B;  2WNR A;  2PO1 A;  2BA1 G;  2BA0 G;  2C38 A;  3B4T A;  2NN6 D;  5K36 B;  5JEA B;  4OO1 D;  3H1C A;  1UDN A;  4IFD F;  2C39 A;  4IFD C;  2C37 A;  5K36 D;  5JEA D;  2NN6 A;  2JEB B;  2PO2 B;  4OO1 A;  4IFD B;  2BR2 B;  3GCM A;  1R6L A;  4AID A;  1UDQ A;  3CDJ A;  2WP8 A;  3M85 G;  2PO1 B;  2C38 B;  4IFD D;  5C0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...