2BANA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase P66 subunit
total genus 128
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2banA05
4N5SA 2C22A 2FBXA 3KLGB 4FLVA 3THVA 1NJZA 1TK8A 2W9AA 3ZSOA 4I9LA 2BANA 4JS4A 2WB4A 4CEFA 3VQSA 3L8BA 1L5UA 1LW0A 1CLQA 3I0RB 4NLSA 1TL1A 3VA3A 1RT4B 2HWIA 3KLIB 4ID1A 4FZZA 3PVXA 4DQSA 1RA7A 1S5JA 1X9SA 5HBMB 4CK1A 2DFHA 4C8LA 2W9CA 2VWKA 1BQNA 2VA3A 1SL2A 3C6UB 4TQSA 5I3UB 2R8JA 2F8EX 2BRLA 3G10A 4Z0UA 4PA1A 4ECYA 3VQ9A 3KJVA 3G6VA 4DQIA 4HVJA 2I5JA 1VRTA 1VSMA 4W5NA 1RTJA 1HYSA 1RT6A 3KK3A 3V4IB 3HP9A 3WNGA 1WN7A 1BIUA 4FZXC 3VA0A 3BQ2A 1ASVA 5J2NA 3FFIA 2OH2A 2YNIB 3JSMA 1JIHA 3RB3A 3LWMA 3H40A 2F96A 4KAIA 1A5VA 3G6YA 5EU7A 3DLGB 2D7SA 1J9AA 2C2EA 2O4GA 5KTQA 1RTDB 4R5PA 3Q8SB 3M8QB 1T7PA 1NKBA 3QNNA 4Q0BB 4HCBA 5HROB 4O4GB 3KHLA 4J2EA 4OLAA 3BQ1A 1MMLA 3JYTA 1NK4A 4H4MB 4IRDA 4KI6A 2J6TA 4Q45A 3B6OA 1FK9A 2J6UA 5DGBA 4CHZA 4IOBA 4DS5A 4FJ7A 3VQCA 1TVRA 2ALZA 4IG3B 4CJPA 4CK2A 1VSFA 1IKXB 4KO0A 1KFSA 3T3FA 4ED7A 3DRSB 1RT1A 4CJRA 3ISNC 3AO3A 3T19A 2X78A 1S6QB 3N6MA 4O3NA 3GQCA 4F4XA 3C95A 3WNEA 1SUQA 3DI6B 4CIFA 3P83D 4EBCA 4MK9A 4MIBA 4RW6A 3H59A 3V6DA 3OYHA 1QE1B 3L2WA 2HWHA 3QZ7A 1RDRA 3HVTB 1ASWA 1RDCA 1C0TA 4MQ3A 2JEJA 2FBTA 3LALA 3M9MB 3RRGA 3GV8B 5J2MB 3DOKA 4CJWA 4C8KA 5KFXA 4EYHB 2IA6A 4DWIA 4NLQA 4FJNA 1S1WB 3UPFA 4FK4A 2IOCA 5FROA 3NL0A 4IH5A 4K4VA 3K58A 1A5WA 3NF7A 3HVWA 4KB1A 3CM6A 5J1EA 2Y1IA 1UAXA 4ECVA 1I3AA 1UOCA 1W0HA 1SL0A 1NKEA 2JC1A 2AGQA 4F4WA 3TAGA 1NK9A 4DQRA 3MEGB 3L2RA 3MR5A 4CHPA 1TKTA 4JV0A 5F8LA 3BREA 3QGHA 5DQHA 2IM1A 4J9KA 3OY9A 1RBRA 1RDBA 4KTWA 2A1RA 2E9TA 2OYQA 1RAJA 5KFPA 2C2DA 4FJMA 4CHQA 3CM5A 1SKRA 4IFVA 1SH2A 3N6NA 2BANB 2XGPA 1OS5A 1HQEB 1REVB 2KFNA 4FJKA 4ZVFA 1GX6A 1TL3B 4FBTA 1L3TA 1RCHA 2X6NA 2HMIA 1XC9A 2IC3B 4ZVHA 3QESA 2E9RX 2HNZB 4FJJA 3KLHB 4RW4B 4FLWA 1WSFA 3EPGA 3NGYA 3CJ2A 4WYWA 4LD0A 4FCYA 1TKZA 2AX0A 1EX4A 1BISA 2W9CB 3SV4A 2O4IA 1S1TB 2IDOA 3P5JA 3HSTB 2R2UA 4YFUA 4YQWA 1ZTTA 1KHWA 2WHOA 3C94A 1VRTB 2V0NA 4CJEA 1HNVA 3RTVA 1S1VA 2VG5A 3LAKA 3VQEA 3EZ5A 1S0NA 1C0MA 4LSLB 3L2VA 4DTXA 3K5OA 3NCIA 4TN2A 5J2NB 1Z25A 4K8ZA 4KB0A 3QINA 2G8WA 4GC6A 1Z4UA 4Z4HA 3DLGA 5KT4A 1HJRA 2HNDB 1RTDA 4Q44A 4O4RA 2XY7A 1T3NA 1SV5A 2FJXA 4HKQA 4B3OB 3AA4A 5KFQA 1U48A 4E7LA 3C6TB 1VRUB 2BR0A 4OKEA 5KFFA 1FK9B 1RYRA 5KG1A 3CYMA 2ILZA 3M9OB 5CZ1A 3PO5A 4AHUA 4E1NA 2PZSA 3QNOA 3ITHB 4CGGA 3V6KA 4NCBA 1RT1B 4DSEA 2FVPA 4OJRA 1JLFB 4DTJA 4KFBA 1S6QA 4FJHA 5KG7A 4B9SA 1RTHB 2IM0A 1CSJA 2HB5A 2I1RA 4B9TA 3DOLB 3V9XA 5KFEA 4ELTA 3V1QA 1RT5A 3AVAA 3DRRA 1K6YA 4CEEA 2XHBA 4M3XA 1Q9YA 3GV7B 4CEQA 3KLEB 1J53A 4YMEA 1C0TB 4DF8A 4EP5A 3DLKA 3OS0A 3MXJA 4KV8A 3PW4A 1NOZA 4YNQA 3T5LA 4IRKA 1ZBIA 1RT3B 1C6VA 1IKVB 5KFWA 1JKHA 3CDUA 2JEGA 3PR5B 5EWFA 2KQ2A 5L1JA 3LPTA 3MEEA 1S6PA 4MK7A 2D0CA 2FJVA 3OL9A 3AVLA 4BACA 1BCMA 3AA3A 4DF4A 2QK9A 3A2FA 4HUFA 4FZYA 4TYAA 1X9WA 1JL2A 4O0IA 5JUMA 4UQGA 3VQ8A 4RNNA 4FS2A 4RW8A 1IKWB 3KD5E 3SZ2A 4WE1A 4ZPBA 2FC0A 3BDPA 5L9XA 5I3UA 3G0ZA 3LAMA 3QIPA 4KTQA 3KLVA 4CFDA 5D3GA 3GILA 4AHRA 4K8XA 2R8GA 3HPOA 5KFJA 1HYSB 3OL7A 4H8KA 4GC7A 2UVRA 3ZSQA 5HRPA 3HK2A 5F8NA 5HRSA 3CVKA 2ZE2A 3CO9A 3QEVA 3KLHA 3M8RA 3MR6A 4O3SA 4FVMA 4RNMA 4XO0A 4J9OA 1NJYA 3FFIB 3LWLA 4QWDA 4J9LA 5CYQB 3SUPA 4CF2A 3JSMB 4B8AB 1S1TA 4I7FA 3NBPB 4MFBA 5L1IA 2AX1A 1F21A 4F4KA 2BDPA 2YNGB 4NCGA 2HNYA 4O0JA 1RBVA 4Q0BA 1Q8IA 3LP0B 4Y1DA 3OYIA 4ZPDA 4DTOA 4I2QB 2VG5B 4W5OA 3PV8A 4TXSA 3NGDA 1HPZB 3QO9B 3KKSA 4W5RA 4DL4A 1WSGA 1TKXA 1Z26A 3O4NA 4GMJB 1TVRB 4IG3A 4MKBA 3H4DA 3OS2A 4NLUA 1RYSA 4KE5A 2QKKA 4EEYA 1TKDA 5KFZA 4OPKA 4DU3A 2EHGA 5KFDA 3IGNA 3NKYA 1LWEA 1MU2A 5KFRA 3PHEA 1RT2A 1SV5B 3M8PA 3NAHA 4CHNA 3HP6A 4RW6B 5CY4A 3PX6A 2KZMA 4E89A 2Q3SA 3RRHA 1S0OA 2AGOA 1CZBA 3T5HA 1KVAA 1JLQB 3OHBA 1JLAA 3HVTA 2ATQA 3CFPA 3NGZA 4EP4A 2FVSA 4QWEA 3ZT2A 1GX5A 3CDEA 4RNOA 3V81A 1N56A 1N5YA 4BE2A 1HARA 4IKAA 3H5YA 5EWEA 4RUCA 4EO8A 2XI3A 5KFCA 3IS9A 4DG1B 3ZSWA 5I42A 4RU9A 4ELUA 1GOAA 4KKOA 2UVVA 3H5XA 4ID5B 4CCHA 3FQLA 4ECRA 4RW7B 3SPZA 2BE2A 1ZETA 3LP1A 1QSSA 3VN5A 3LPUA 4DS4A 1TKTB 1RDAA 2B43A 4F3TA 1EP4B 3O3GA 1T03A 4K4SA 1TV6B 4LH4A 3L2QA 3RMAA 3IRXB 4I2PA 5C25A 1JLBB 4FK2A 1RT3A 1W9HA 3KK2B 4CEDA 3LP2A 1EETB 3HYFA 3KK1B 3CG7A 4C8OA 4DMNA 2JEFA 5KRTA 3EPIA 4DSFA 3AVGA 3V1OA 3QLHA 4CJVA 3AO5A 3KD1E 1SH3A 3S3NA 1BQMA 3ZCMA 4RW4A 5HLFA 4DQPA 2OPQA 5DG9A 4WXWA 2YHBA 4Y2AA 2YNHB 2HHXA 4OGCA 4NLPA 3K5MA 3SCXA 1L3SA 1KLNA 3OYLA 4ICLA 3QIPB 2E6MA 3NAEA 4U6PA 2CKWA 4Z4CA 2IAJA 1HNVB 3AVFA 3OYDA 2Z1JA 3H4BA 3RAXA 4QWAA 4ZPAA 4YR0A 3TAMB 1S49A 4CGHA 2D3ZA 1N6QA 4ZP7A 2B6AB 1LWCB 4TYBA 3AO2A 2A1SA 4ZVEA 4TY9A 3AA2A 1HNIB 4NRUA 2FLPA 2GIRA 3NBPA 4CJTA 2ETJA 4F3OA 1NK7A 4FLUA 3GIIA 3I0SA 1ASUA 1QHTA 4OGEA 1X1PA 4OVLA 4GW6A 3MFIA 4PWDA 3QEPA 2P5GA 4ECTA 4XPCA 4DEZA 2ASJA 1NHUA 3C6TA 2XCAA 3SV3A 3SI6A 4IFYA 1GOBA 3NF8A 5KT2A 3AVKA 3MAQA 4NLGA 2HVHA 3SUOA 3OL6A 5DLFA 3DM2A 3PW7A 4IR1A 1SH0A 2YNFB 3SFUA 3CJ3A 3SI8A 4CF9A 2WONB 4O3RA 4RG8A 5KGWA 1JLFA 4KFBB 4IG0B 2AQ4A 2HHVA 2BQRA 1RT2B 4HUEA 3SJJA 3MTKA 2RF2B 4ZVGA 4DSKA 1C0UB 4AH9A 1QAJA 1TK5A 4HHTA 3OYGA 3TAEA 2FLNA 1FKOA 1VSDA 4M3YA 3DYAA 3V9UA 4DSJA 3V9WA 1TAUA 4ZMMA 4F50A 4X2BA 2EX3A 3HO1A 2R2TA 3DLKB 3ZSZA 1HYZA 1BI4A 3I0RA 2FBVA 4AHCA 4K50A 3KLIA 4DL2A 1FXXA 3QGGA 3CFOA 3ALYA 2OPSA 1IKVA 3RMCA 4ED8A 4JLHA 3IS9B 1NK8A 4KI4A 1LWFA 4NLWA 3HXMA 4ID5A 4O44A 1WSJA 2IMWP 1RBTA 1WLJA 1KLMA 1A5XA 4FK0A 4WFXA 4WFZA 5KFVA 4FW2A 4PUOA 3RBDA 2UVWA 3BQ0A 4Y2CA 1RTJB 1RT6B 1XWLA 4N47A 4M3TA 3L3UA 3VQDA 4FXDA 3OYKA 5KFAA 3TR8A 4CK3A 4E0DA 5CZ2A 5KFLA 4FLXA 3AVBA 3MR2A 4OKKA 4I2PB 4RW9A 4M94A 3MEDA 2HAIA 3UIQA 3ICLA 3BGRA 4DFJA 4CIEA 1FKPA 4NLTA 1C1BB 2OZMA 4FLYA 3LANA 2IGIA 5FDLA 2JEIA 3QLHB 3SQ4A 4WYLA 4O3QA 4ZHRB 1BQMB 2HHUA 5CYMB 1C1CA 1VSEA 2G8IA 2OPPB 4WZMA 2HHSA 4CGIA 5HLFB 5HROA 3VQQA 2W7PA 1S9GA 1LAWA 1WAFA 4H4MA 2W8LA 3UQSA 3KKRA 2JGUA 4I7FB 4ECSA 3TI0A 1DLOA 5KI6A 3RB4A 2G8VA 4ICLB 3SUQA 4FJ8A 2G8FA 3HHKA 4NCGB 2YNGA 3MECB 1IKXA 2UUTA 1JLEA 4F2RA 2F8SA 1S9EB 4CFCA 4TQRA 5C24A 4HUGA 2O5DA 4KHSA 4DSLA 3N6LA 1W25A 1YVUA 1UWBA 4LSNA 4E7HA 4FM1A 4B9LA 4ED6A 2FVRA 4C8NA 2BGGA 2NUBA 3O4QA 3T5KA 2AU0A 2DPIA 1NK6A 4WXOA 4ECZA 4WZQA 3HM9A 4DSIA 1K1QA 4DL5A 1LWEB 1MU2B 1RTIA 3I0SB 2Z1IA 3WNHA 4G1QA 5J2MA 3DMJA 4CJ3A 4ECXA 3K57A 3MR3A 3VQ7A 2WOMA 3OS1A 1JLGB 2P51A 2LSNA 2W42A 4IFYB 1JLQA 2ATLA 1ZBHA 5JS2A 3H2LA 4FBUA 4ZP9A 4CIGA 4N41A 3QYYA 4PY5A 3E01A 1SKWA 4CGDA 4CEZA 3EY1A 4IH6A 1CZ9A 4F4YA 3DLEA 2B5JB 1B9FA 1DTQA 3KLFA 3TARA 4IG0A 4J9QA 1LW0B 3RMDA 2IJFA 3KHHA 3I5AA 5DK5A 5T14A 4CJSA 3ZT4A 1N4LA 3IG1A 3HVRA 4KKOB 1XR5A 3Q8PB 2YHAA 5KT7A 1IG9A 1IO2A 1QAIA 1N48A 4CHOA 4J9RA 4NLXA 4ECQA 4KHUA 4CJKA 3VQ5A 4Y3CA 3PY8A 4RNHA 1R0AB 3VQ6A 3I5BA 5DMRA 1HMVB 2IC3A 2OPRB 4ZTFA 5KRSA 1EP4A 2I5JB 2VG6B 1TV6A 4M3WA 4I9QA 1ZBFA 4E7KA 1B9DA 4CJUA 2R7YA 2GV9A 2XO7A 4FM2A 3KK1A 3HKWA 1S97A 4K4ZA 3LP3A 4FM0A 1NJXA 4OKJA 4M42A 2JLEA 4Y34A 3OYMA 4PUOB 3V1RA 4MIAA 3M8QA 1IH7A 4J2DA 3V6HA 2YNHA 3L3VA 4LSLA 2D41A 3AO4A 2DPJA 1TQLA 1J54A 3GIJA 4H4OA 4DTPA 4KTZA 5KFKA 3RBEA 3NFAA 3QZ8A 4DTSA 2KZZA 1I6JA 5K14B 3NGIA 1BCOA 3OSPA 4ZHRA 4EZ9A 1VSIA 5KT6A 3T5JA 1QSLA 4M95A 5J2PB 5KFYA 3VQBA 1U09A 1CXQA 3V6DB 5DGAA 1WSHA 3DRPB 3MXIA 1SUQB 3DI6A 4FJIA 4ED0A 4NCAA 4FLTA 4OL8A 1YTUA 2KW4A 2FVCA 3MECA 1D0EA 3OYAA 4CFBA 3FRZA 2VG7B 5KFSA 3TABA 3AVCA 5C24B 1JLCB 4F2SA 3TWHA 4KHRA 1BGXT 3S3OA 3QGIA 3G6XA 3KLGA 3PO4A 4KSEB 1T05B 1WSIA 5SZTA 2WONA 2AJQA 3TQ1A 4DU1A 4KAZA 3QEXA 4NRTA 3KMQA 4W5TA 5J1EB 1RTIB 4FS1A 3LZIA 3DMJB 3ZSYA 2HHTA 3RB6A 3MEGA 1JLGA 3HPHA 1CXUA 4B9UA 1U04A 4R8UA 5HBMA 2WRMA 1U4BA 3KMSA 1WSEA 5FRMA 4KHQA 2VWJA 1FKOB 3IGVA 3VQAA 3DYAB 3SQ0A 4J2AA 3OVNA 3SPYA 1JKHB 4JS5A 3PJWA 4DQQA 1NNDA 3K59A 5KFTA 4O3OA 3MFHA 1LW2A 4IFVB 4CFAA 4URGA 4CGJA 1S6PB 3AVMA 4O3PA 3KJVB 1DTQB 3KLFB 3K5NA 1TL3A 4KPYA 3KK3B 4CERA 1K1SA 4M3ZA 5KFBA 1TKZB 2ZKUA 1UA0A 5DQGA 4RW8B 4EZ6A 3DLHA 4M41A 1NJWA 3LZJA 4URSA 4Q43A 5D3GB 4IQXA 3SQ2A 4DFPA 3KTQA 2OZSA 1S1VB 2OPRA 1NK0A 1VSHA 4O4GA 4YR2A 1S4FA 4CF8A 4RW9B 4J9SA 5F8IA 5CYQA 1JXEA 3BGRB 2IJNA 1RNHA 5F9LA 5EUHA 4IR9A 5FDLB 2R8KA 4MFBB 4KHNA 1TAQA 5CYMA 2HNYB 4W5QA 3TANA 1IKYA 2JC0A 4HYKA 1ZBLA 3V9ZA 2G8HA 2DY4A 1S9GB 5KG3A 1B92A 4FJXA 4HCCA 2XGQA 1QE1A 1S1XA 3PW5A 4E7JA 1VRUA 4H4OB 3KHRA 5L1LA 3NDKA 4KHMA 4NLOA 4K4XA 4NLRA 2R8HA 1JXLA 3KHGA 1JLEB 3ZSRA 4QPXA 2FVQA 2UUWA 2YKMA 4URQU 4NYFA 3ITHA 3DOKB 1RTHA 5J2PA 3OL8A 4H54A 3I8DA 2ZQBA 2GC8A 4NLDA 3WNFA 1S1WA 3DRPA 3K2PA 5KG6A 4EYIB 3SUNA 2AWZA 3DRRB 1QS4A 4DTRA 4DTMA 1JLAB 4Q5VA 1JL1A 3KLEA 4WFYA 1NK5A 3OYNA 3VQPA 4AHTA 4DFKA 3TAQA 4Z4IA 1DTTA 3Q8QB 5KGXA 4RUAA 2AGPA 5J2QB 4AHVA 5KG2A 4ED2A 4AILC 4KBIA 3VQ4A 3HVAA 2Z1GA 1G15A 4CJFA 2R2SA 1XHZA 1RBUA 4ZP6A 4ECUA 1WAJA 1HQUB 1T05A 5I42B 3O3HA 1SL1A 2DTUA 3RMBA 4JV1A 2FLLA 3QIOA 3MEEB 2KFZA 3DLEB 2B5JA 2BE2B 3AVJA 4MK8A 4NYZA 4FJ5A 3LP1B 1S1UA 5KFUA 2HMIB 4DTNA 3D5MA 4JV2A 2PYLA 1XR6A 5HP1B 4B9VA 5FRNA 4K4YA 3RWUA 1YTAA 5C42B 1GOCA 2D3UA 4R8UB 1YVFA 2QV6A 1IKWA 4KB7A 1RT7A 3IG1B 2B4JA 2FJWA 5C25B 4LY7A 1BIZA 2UVUA 5KFOA 3PX0A 4YP3A 3BJYA 3LP2B 5SWMA 1S0MA 2HHWA 3S3MA 1BHLA 1WNEA 4PQUA 5JS1A 5DQIA 1LW2B 1R0AA 1T94A 3SQ1A 3UDLA 2RDJA 4TSXA 3ISND 3GIMA 4K4WA 4CGFA 3T1AA 4CJ5A 2ZE2B 4QAGA 3CDWA 2DFEA 1ZYQA 4R0EA 4LQ9A 4DLEA 1D1UA 5KFHA 4XIUA 4DFMA 3H98A 2GUIA 3NH0A 3U3GA 4M45A 4B08A 3F73A 4BE1A 2HNDA 3ULDA 2V4RA 4NYNA 5KFNA 3S9HA 2IAJB 1D5AA 1NHVA 3FDSA 5HRNA 3NH1A 1S48A 3LP0A 4BWMA 4EO6A 1HPZA 4B3OA 3MF5A 4CECA 2XC9A 4I2QA 1D9FA 4FLZA 1S9FA 3BSNA 1N6QB 4Q8FA 1LWCA 1U49A 3QO9A 3RR7A 1J5OB 3E51A 4GVMA 4C8MA 1TKXB 2HVIA 3PUFA 5K14A 3AO1A 3OJUA 2Z1HA 4ED3A 3V9SA 3SYZA 3V6JA 2PY5A 3M8PB 3CWJA 4YR3A 1KHVA 4B9MA 4QW9A 4QOZB 3SFGA 4U7CA 5KT3A 2QE5A 1TP7A 2BQUA 4CE9A 4XPEA 2IS3A 3OYFA 4KHWA 3RAQA 1QSYA 4Z4FA 3TAPA 2YNFA 3BSCA 3LDSA 3KIOA 4K4TA 3CIZA 1VK0A 4KHYA 1L3VA 2V9WA 2IBKA 4IDKA 3AVIA 3F9KA 1RBSA 1JLCA 2G8UA 1TL1B 3IN5A 4CJQA 1D9DA 5KFIA 1N5YB 4KV8B 4CEAA 4IRCA 2RF2A 3U6FA 2WK4A 4LH5A 4CF1A 2P1JA 1JXBA 3GIKA 1U45A 5F8MA 3OLAA 4DG1A 2GBZA 4E3SA 2KTQA 2QXFA 4M3UA 4OPJA 5EDWA 1BQNB 3PR4A 4IH7A 1JX4A 3OHAA 4J9PA 3KNAA 4RW7A 1QQCA 4FJ9A 4CESA 5KFMA 4CJLA 4O5BA 1BL3A 1BI4B 5J2QA 3EZUA 3OYEA 4BWJA 4G3IA 3G86A 2ASDA 1T03B 5EWGA 4ED1A 2RKIB 2GIQA 5DLGA 5DG7A 3AVNA 1NKCA 2OPSB 4LQ3A 3KK2A 2V4QA 3ASMA 2XY6A 1EETA 5F8JA 2J6SA 1D8YA 2RDIA 1HQUA 4AHSA 4WE1B 4NZ0A 1O1WA 2YNIA 4O44B 1XHXA 4DU4A 2XCPA 2E9ZA 4ZTJA 4Z4GA 2W9BB 2OA8A 1S1UB 4FJGA 3TAFA 2OPQB 2D0AA 5HP1A 2XWYA 5C42A 2D0BA 5E41A 4HTUA 1ITGA 2E6LA 5KT5A 3NH2A 1T8EA 5F8HA 3P1GA 3HPGA 2YKNA 4QWCA 3M9NB 3QIDA 4TY8A 1C1BA 4PQUB 1LAVA 2ILYA 3Q8RB 3NF6A 3QEIA 2CJQA 4KO0B 2W8KA 3DRSA 1C1CB 2WCXA 2G8KA 3TAMA 3PW2A 4KREA 1HRHA 1KTQA 1L3UA 2ASLA 1HNIA 3EYZA 3QETA 2XRIA 4J9NA 3CQ8A 1IKYB 2X6SA 5KG4A 2ZD1B 4PWDB 3PZPA 3ZSXA 2P5OA 1ZBUA 1YT3A 2R2RA 4O55A 3FSIA 1UA1A 2HHQA 1S1XB 4DL6A 1C2PA 5F8GA 4CEBA 3DM2B 3D45A 3NMAA 1J5OA 4E1MA 2BRKA 2RPIA 3OYCA 4DLGA 1Q9XA 2YKMB 3AV9A 3V81B 1RT4A 2XY5A 1I39A 4JRPA 2WOMB 4Y1CA 3IAYA 4IBNA 3U3YA 1C0UA 5L1KA 3UR0A 1RILA 3L2UA 5KFGA 2IM3A 4FYDA 1VSKA 3C6UA 2YV0X 3E01B 1DTTB 3GYNA 1EKEA 2D5RA 4ZP8A 4IDKB 3NHGA 1HQEA 1REVA 3AVHA 4N56A 1SKSA 2ITGA 3I5CA 4FW1A 4CJ4A 4J2BA 3PJXA 3V4IA 2W7OA 4BDYA 1XR7A 2HNZA 4BE0A 4Z4EA 4K4UA 2X74A 3IRXA 4DL7A 4BDPA 1JLBA 1RA6A 3RR8A 4L8RB 2F8TA 3OSNA 4CEOA 1LWFB 2IM2A 3D0PA 2E4LA 5KG0A 4MKAA 4RZRA 1EXQA 1KLMB 3B6PA 3TVKA 4M3RA 4OLBA 3D28A 3GV5B 3M8SA 1KFDA 4ZPCA 4R5PB 4E7IA 1WNSA 1HMVA 3BSOA 3FQKA 2VG6A 3CJ0A 5T7BA 2RKIA 1RT7B 4EBEA 3NE6A 1NOYA 3H5UA 3JYTB 3OYBA 3OLBA 1KVCA 2FBYA 2Y1JA 3BR9A 1FKPB 1X9MA 3H08A 3MEDB 4JUZA 4TLRA 3PW0A 4CHYA 4E19A 2HW3A 1Y97A 4N76A 3O3FA 2VA2A 2DFFA 1LV5A 5HRRA 4JRQA 2PYJA 2W9BA 3NF9A 3DDKA 1VSJA 4NLYA 5F9NA 2OPPA 1KSPA 1RDDA 3OYJA 1U47A 4DL3A 4B8CA 4IKFA 2B6AA 3K5LA 3MXMA 1DLOB 2YKNB 1KVBA 5DG8A 3CJ5A 4B9NA 4TY8B 1TGOA 4QCLA 5C5JA 1S9EA 2XI2A 4EBDA 4FJLA 2XY8A 3HL8A 4KRFA 3ZSVA 2C28A 3CFRA 4RNFA 3QEWA 3BSAA 4Q8EA 2R8IA 3RB0A 4CF0A 4MH8A 1C1AA 1UWBB 4LSNB 2WTFA 3AA5X 3H5SA 3PX4A 1KRPA 4F8RA 1QTMA 3QERA 2RN2A 3KOAA 4DTUA 3SNNA 1QUVA 2EC0A 3HT3A 3DOLA 1S10A 3DLRA 4BDZA 3DLBA 4NLVA 1XI1A 1KCFA 4J9MA 1RT5B 1HYVA 4QW8A 1TK0A 1IM4A 4ECWA 1VSLA 4F4ZA 2C2RA 4G1QB 5KG5A 2QKBA 2VG7A 2ZD1A 4QWBA 3ZT0A 2BQ3A 3OJSA 3HJFA 5JXSA 3CJ4A 3ZT3A 3ZT1A 3NAIA 1ZTWA 4ELVA
chains in the Genus database with same CATH superfamily
4N5SA 3UR3C 3IBWA 3KLGB 4FLVA 5K5MA 3PSFA 1CJVA 2HBYB 3ZSOA 1GXUA 1F3FA 4CEFA 3VQSA 3L8BA 1LW0A 2W2PP 4NLSA 2HWIA 3BN4A 2C3PA 3KLIB 2HVEA 4OQJA 1AXQA 4CLFA 4PYDA 4BR5A 2R7VA 2W9CA 2N4DA 2QLWA 2R7RA 1SL2A 4XEIA 2VPWB 4A8OA 5HATA 5I3UB 2GELA 4KH1B 3FZKA 2RT3A 4Z0UA 2KHCA 3OFFA 4MMOA 1RT6A 1D9AA 3TTDA 3KK3A 2L41A 5JVGQ 1Y10A 1BIUA 3CI5A 1S99A 2M7SA 4XH5A 4A61A 1VRQC 2YNIB 4M5IA 3JSMA 2F5GA 3LWMA 1S5ZA 4HDHA 5EX0A 1A5VA 3SCJE 2GWJA 4QYRA 1X3NA 3Q8SB 1NDLA 1T7PA 3QNNA 1G6BA 2HFZA 1NPPA 4MKYA 3ILOA 4RKUC 1CJUB 4IRDA 1T3VA 2GTDA 1FK9A 2J6UA 4ZVUB 1NPRA 4FJ7A 5M2RA 2HS3A 1TVRA 2P9UA 2DGTA 2H54B 2MYFA 4CJPA 4CK2A 2B0GA 4OZ0A 3AQOA 1KFSA 3TA1A 5TKWA 3QBXA 4OZ1A 3N01A 1A0OB 5HMWA 4CJRA 3T19A 1S6QB 4O3NA 3GQCA 4F4XA 2DVIA 1KOHA 2ZBCA 2B4UA 1SUQA 4CIFA 2E5IA 3ZZOA 3P83D 3CB4A 4MIBA 3UDVA 2P9EA 4DL0C 3ZZTA 3H90A 2PBDA 4KGZB 2CQ3A 1F0XA 1DHMA 5HJYA 3EZWA 1E6YA 4LR7A 4QS7A 4J8FA 3UWTA 2KKZA 3QNWB 4YOXA 4MQ3A 2E8AA 3G82A 4AM6A 4KRWA 1O6XA 3GV8B 3TWZA 3AOCA 4DWIA 3VWSA 4LVNP 3CC7N 2YY3A 3NL0A 4IH5A 4JI4J 3K58A 3NF7A 1TYQA 4M7XA 3CM6A 3W8PA 3DC2A 3LL3A 5J1EA 1WF2A 3NCQA 1I3AA 4EFHA 2AGQA 2WVFA 4R0JA 2C3YA 4JV0A 1IBMF 1U1QA 2RNEA 1RDBA 2NZTA 3ONQA 2C2DA 1YQHA 3N6NA 1OS5A 1REVB 3PYDA 1V9OA 2N82B 4FBTA 4Y2IA 2HMIA 1XC9A 4PXEA 4ED4A 1H1VA 3K8WA 4H5WA 1NDKA 1N0VC 3EPGA 4LD0A 2W9CB 2GX8A 2O4IA 2FZCB 3HSJA 4OYBA 1S6OA 3O8WA 2ZVIA 4QZVB 4YFUA 4YQWA 3HSGA 3LOUA 4QBUA 4RUBA 3PCOB 3THXB 1HFEL 2D4WA 2LKZA 2V0NA 1HNVA 4H5VA 1S1VA 3AD8C 3EZ5A 3EVWA 3NP5A 1U8SA 2IY5B 3K5OA 3EX7B 3NCIA 4TN2A 1Z25A 4FWPA 4K8ZA 1M5PC 3CJCA 4GC6A 5E26A 3IBFB 4J9VA 1Q81O 5BN8A 3ENOA 2GVDB 2CPHA 1FXLA 4JKCA 5IS2A 1T3NA 3BKUA 4PKGA 5E84A 5H1SV 3E2EA 3MMAA 5KFFA 1FK9B 1ZBTA 2CVEA 4ZLJA 3M9OB 3EKUA 4HTLA 3MM9A 3CE8A 1U24A 2ROGA 4DX5A 2QEXN 1DY3A 3ITHB 2VQEK 2FVPA 2OTLN 4DTJA 4KFBA 4Q2LA 3PRBA 3HRGA 5KG7A 4B9SA 1RTHB 2IM0A 1CSJA 2HHPA 2MGZA 3D3CJ 3V9XA 3OR2A 2V2QA 1N36F 2PMWA 4CEQA 3IWXA 4DU8A 3JAMY 3BBCA 4JI5J 2HZAA 4QIEA 3DLKA 1X5OA 4A8WA 4DR6J 3D0IE 1XNQJ 4QYZK 5DDQC 4Z7CA 2A41A 2EFVA 3T5LA 4X65F 1RT3B 3Q0AA 1IKVB 1CC8A 1YBTA 2OEKA 1JKHA 4K42A 5EWFA 1RWOB 1VQKS 3D6FB 3MEEA 2FC9A 2FSJA 4GVBA 3H45C 2V4JB 2QK9A 5H9FJ 4TYAA 2GIFA 1FDNA 1U26A 3LDQA 4NX9A 4OZNA 3SZ2A 3P4IA 4WE1A 4ZPBA 2FC0A 5B0FA 4H0TB 5I3UA 3BBFA 4CFDA 2Z0GA 5D3GA 4K8XA 5L9NA 3QRQA 3D6TB 5CABA 2LEAA 1HBOB 3TR5A 4QS9A 2UVRA 3ZSQA 4YHHJ 3HK2A 4LF4K 1E6VB 2ZE2A 2XSFA 3PEJA 2CJ9A 2IVNA 4O3SA 5DZ6A 4NASA 1GFWB 3LWLA 5GIPA 2V94A 5EX5A 3HSDA 4CF2A 4TU9A 1P8ZA 3JSMB 4I7FA 4KY3A 2JL9A 5L1IA 4J91A 5IM0B 3O9UA 2O8EB 4NCGA 1KS2A 3NS6A 1VQMN 1RFQA 5AXLA 4P6QA 4QIWD 4I2QB 1M5HA 4ZLPA 2MZTA 2VG5B 4LJMA 4DCOB 1IG8A 3KKSA 5ETVA 2YH1A 2ZVSA 1M1HA 3IP0A 4V19X 3H4DA 3OS2A 5IWAJ 4AL6A 3R8EA 5KFZA 4ZJLA 4OPKA 2EHGA 1M0SA 4P72A 3PHEA 2DGUA 1RT2A 1KXPA 4FWRA 2XSJB 4RW6B 3HBTA 5CY4A 1WKLA 2KZMA 1FJGK 1RISA 1WELA 1NGCA 1ZC6A 4FZVA 1S0OA 2AGOA 1MDUB 1YHQS 3T5HA 2HVDA 3M2RA 2ACMA 3NGZA 4CLZA 4EP4A 4JI1J 1TL5A 4DR3K 2FVSA 1GLCG 3MR7A 1GX5A 4WFNQ 5CR4A 1U1OA 3Q22A 2J4RA 2BJ9A 4BE2A 2HGLA 2O8CA 1VC6A 2JLGA 2XI3A 2XMMA 2DHHA 4RU9A 2HBJA 3H5XA 1FJ7A 4CCHA 2W6LA 1DEJA 3SPZA 4CZKA 4BGBA 1ZETA 3P6YC 1VDHA 1O8BA 4DS4A 1TKTB 1JJHA 2AF6A 4F3TA 1EP4B 3O3GA 3L2QA 1KTVA 3RMAA 3IRXB 4W4MA 4I2PA 1XMQF 5C25A 4DUYK 1W9HA 2KG0A 2QZ8A 1DQ9A 1W2IA 3MM6B 1EETB 4UOHA 3DDNA 2LEBA 2P9SA 4DSFA 2OTJS 3HJVA 3ID8A 3CW2C 2F9JA 1EJ7L 3KD1E 3H2VE 5CHCB 1VQNS 3MAHA 4WTYA 3R3LA 5BYQA 3EE8A 1R8AA 1FRMA 1RWPB 4LF8K 2B7BB 2YHBA 4OFZA 2M5YA 2XHCA 3G2XA 2QG9B 4NLPA 3D3BJ 3E66A 3QSYB 5IC4B 1HW8A 1KOOA 2XMKA 1E4GT 1HNVB 2J76E 3EGZA 3AVFA 2DNOA 1JQGA 4DV3J 1UWAA 1Y7PA 1YX2A 2ZWOA 4TYBA 2A1SA 2FLPA 2GVDA 4KHPK 2UXBK 5GAHP 1IWAA 4FLUA 2MQOA 1RU1A 2H3GX 5K9FA 2EFOA 4DI6A 1X1PA 2O01C 4GW6A 1YSJA 1K73O 1NPKA 3J81U 2ASJA 4UTGA 1NHUA 2AMCB 2XCAA 3ZETB 3SI6A 3NF8A 4J37A 4RBVA 1NUEA 1Y4ZB 4LFBK 3C19A 3SUOA 4X4UA 3DM2A 5C10A 4WU3A 3FC9A 2WONB 4O3RA 1Z2ZA 1R8CA 4KFBB 2AQ4A 2HHVA 3WT0A 3ULEA 2NYIA 4YUDA 1NNEA 1HX1A 4HHTA 1VLYA 1Z1ZA 1VSDA 4DSJA 3V9UA 4DV0K 1BG3A 1VQKN 4WFAL 5E0OA 3HO1A 3VETA 1M5SA 2R2TA 1BI4A 3I0RA 4ER8A 4PPZA 1Y9OA 4TU8A 1WI8A 2ZBRA 1FXXA 3WQUA 3QGGA 1KWMA 2RIJA 2OPSA 1U2FA 4BG9A 4F7VA 3HXMA 4O44A 4FK0A 4WFZA 3DXSX 5HVGA 4GVBB 4PUOA 4OX8A 3KG4A 5IQQA 2ALYB 4L75A 1RAFB 4NXNJ 3J7AP 3DCAA 4M3TA 3U9DA 3CCSS 4FP9A 3T7ZA 3TR8A 2H65B 4CK3A 2EEYA 3MWTA 3MR2A 4I2PB 2NUUG 3UN2A 3E1YA 2HAIA 3PJ9A 3UIQA 1KEKA 4L6V3 4CIEA 1U1LA 2Z8QA 4AL7A 5J1NA 3TYTA 4FLYA 3LANA 2DGVA 2OHDA 2JEIA 3MAAB 4NI2A 3JB9k 4WYLA 2KVIA 2AEMA 1BQMB 2HHUA 2G8IA 4DV6F 2HHSA 3GOIA 3OVAA 3VQQA 2W7PA 2C2MB 1LAWA 3VF0B 1YI2S 4JBCA 1WAFA 3W5ZA 4H4MA 3ETOA 2B9YA 3MN5A 1NSAA 2J8AA 3SMZA 3H8YA 4I7FB 4ECSA 3U1LA 4BC2A 4M1KA 4MTPA 4ICLB 4DPWA 3SUQA 4WTOB 4LR8A 1LQ9A 1IKXA 3RAMA 4X64J 3OFGA 2XZWA 1AUSL 3NOGA 1OYEA 4AL5A 1VQON 4CFCA 3MUMP 2O5DA 2QYCA 1QZ6A 2VZ9A 4DSLA 5HAOA 2KL8A 5HQLA 4DR1F 4ZOSA 4E7HA 4ED6A 2FVRA 2NUBA 4MYUA 2KRBA 3T5KA 1E6YB 1K1QA 1RTIA 1FA0A 1X4GA 3NS7B 4USUA 2Z1IA 3ZEUA 3HHLA 2FDNA 4I69A 2F9WA 3MR3A 3VQ7A 1BC6A 3C14A 3ZETA 2W42A 3P31A 4LRCA 1LNQA 2CQIA 5JS2A 2YKQA 4ZP9A 2HPUA 2X7IA 5IZHA 4P75A 3EY1A 3D2FB 2B5JB 4IOAQ 3HI9A 2Y3YA 4J9QA 5LJVA 2A10A 2CQGA 4ILGB 3VOVA 3I5AA 5T14A 3OXLA 2VD3A 4QIFA 3MPDA 1T44A 1N4LA 3IG1A 1FXRA 3UCGA 3HVRA 4GO7X 5GAGP 5KT7A 1H2VZ 3K0JA 1N48A 4CHOA 4J9RA 4NMLA 4Y3CA 1BWFO 1R7IA 3IDHA 1DJ0A 3I5BA 1HMVB 4ZTFA 4F04B 1EP4A 1TUGB 2WSEC 2NLWA 1F5CA 4E7KA 2GV9A 3Q86A 4FWMA 1NM1A 2XO7A 3B4MA 4FM2A 4ZITA 2DBBA 3HKWA 1S97A 4K4ZA 1BQXA 4FM0A 4WCEL 4OKJA 4QPTA 4F3QA 3HT0A 2CQ2A 3FZBA 3OYMA 1V3ZA 4MIAA 4LBIA 4DR5K 2L3MA 1IH7A 4J2DA 1F9HA 3V6HA 3L3VA 4LSLA 1UZHA 2G4BA 1UVJA 4FPRA 5HVFA 1S3XA 5AQSA 2CG8A 3GIJA 4H4OA 2JH3A 3GSDA 3NFAA 1OIAA 2GHVC 3D1QA 1I6JA 3P39A 3NGIA 3U4LA 5KT6A 2RHQB 4R25A 1WG5A 4J7CA 2IDLA 4M63A 1SUQB 1REGX 4FJIA 2W40A 3EL2A 1HL6A 4F9OA 4FLTA 1X0FA 4OL8A 2IVMA 1YTUA 2KW4A 3G82B 4BCAA 2OTJN 2XMJA 2O3DA 1BOTO 4CFBA 3MN7A 2JRSA 3O1LA 2ZJRQ 4F26A 2XTJP 3TA2A 4J5OA 1VQ9N 4JKGA 1SQGA 3TWHA 2RAQA 5GAEI 2HQGA 1HLUA 3G6XA 5GADU 3PO4A 2LVWA 3QFPA 5A0YB 3W9IA 1U2VA 4KAZA 4FOEA 4NRTA 1TFWA 1XMQJ 3KZBA 5AQLA 3QMQA 2HHTA 3V2UC 4IFEA 2QMWA 3MEGA 1Q18A 4B9UA 4R8UA 1FI4A 1WSEA 1N8RT 1RWXB 2A2DA 4KT0C 1P1LA 1FKOB 1TU0B 1UEUA 3VQAA 3R6GB 3OVNA 3A5MC 1JKHB 4ES3A 4DQQA 3R27A 1Y3JA 2NXNA 3SJHA 2CJBA 3I56N 3MFHA 3WEEA 4H0PA 4DCPB 4DR6K 2H9ZA 5EOYA 4EUVA 1Q82O 1V5VA 2NRVA 3T9ZA 2XNQA 2XLKA 2ZKUA 2HEKA 5DQGA 1NJWA 3U1MA 1GLBG 3LZJA 3D67A 2FHJD 3A8IA 3CCEN 4Q43A 4L72B 2IMOA 2JVOA 2JSXA 3SAHA 4DFPA 4M5DA 2H48B 5AQNA 2OP5A 3VGSA 2OPRA 2ZH4A 4DDFA 3TO8A 2DR5A 3M1VB 3DKDA 1K9MO 2A0FB 4YB6A 4Y28C 1J6ZA 3A8JA 1SC1B 4RPFA 4XK8C 2DYAA 1WC5A 1M1GA 3V4MA 2N3LA 2RHSB 5D0HA 2VDIA 4KHNA 1TFYA 1RAGB 2GUPA 2SXLA 5DDRC 4JKFA 3VPZA 4LF4F 3QT7A 2K7JA 3RVCA 4PABA 1B92A 4WQ4C 5CCMA 4FXVA 3SMSA 3PW5A 3MMAB 5ADXH 3B8AX 3ZZUA 3MOZA 3W9HA 3KHGA 1X0PA 3NGUA 3O08A 1PIEA 3M2UB 2DGWA 2UUWA 1Z05A 1Q82T 3FZ2A 4BR9A 4URQU 2IVPA 1RTHA 4OHVA 3OL8A 2XSJA 3NS5A 3LW5C 2GC8A 2HG4A 2EFPA 3DRPA 3K2PA 4EYIB 1WHXA 2HHHJ 2P6TA 1SC3B 2BMBA 1VJWA 1JLAB 1CC7A 4Q5VA 1N8RO 1IQZA 3OBYA 2IDEA 2JWNA 4AHTA 1RWKB 4Z4IA 4LF6J 5LM7E 1HBNA 4AILC 4KBIA 4QR2A 4LSZB 4RWXA 1H2TZ 4Y2MA 1AUDA 4DR7F 3KUEA 2ZHAA 1T95A 4L73A 4JKAA 3KYLA 1HQUB 2DTUA 3RMBA 4I6WA 3GB0A 2CQ4A 2E29A 2I9SA 3C15B 2B5JA 7FD1A 4RX6A 3K7RA 3W3DA 4NYZA 4K25A 2Q6BA 1R6YA 5C2CA 2YWKA 4JI2F 3RWUA 1YTAA 5C42B 1GOCA 4R8UB 4H0XB 1S57A 1RT7A 3IG1B 1DZ5A 5C25B 1W97L 1U1MA 4LF4J 3WQTA 2HFNA 3IWLA 3EZOA 4O8UA 3BJYA 2HHWA 1WNEA 1YJWN 1ICEB 5JS1A 5DQIA 4X62J 2VQFK 4X66F 2NUHA 1OSDA 1R0AA 5D8HB 1WBDA 2ZM6J 2P9LB 3UDLA 4TSXA 4CGFA 1TUVA 1Q86T 4CJ5A 3CDWA 2DFEA 5AQUA 3PEHA 3MMBB 3D66A 2HZCA 2Q3PA 3BDEA 2GUIA 2Z57B 4ZVSB 2IIRA 3SK3A 2QN6B 3CDAA 3UVJB 4YOVA 4BE1A 1JJ4A 2HNDA 3DGVA 5KFNA 2IAJB 2O8FA 2HFVA 4GKJK 1W7WA 2W24A 3NH1A 4B3OA 4YORA 1BA1A 2XC9A 1NLVA 4I2QA 4XDCA 1QDUB 3D7SB 2NRRA 2YJEA 2DH8A 2CNLB 4EIAA 3RR7A 1J5OB 2KXHA 3LDLA 4C8MA 1YBAA 3L7UA 3VEOA 3QATA 1G99A 4HTJA 5K14A 1IBKF 1NSKL 3AO1A 4BGAA 3BH6B 3V9SA 1OPIA 5LSOA 1W2BR 1KHVA 3S41A 4B9MA 4DN9A 3SFGA 2QE5A 4XPEA 2IS3A 4ISEA 1IBLJ 1OY9A 2RE1A 4JV5F 5EGYA 3RAQA 4Z4FA 1MG7A 2QLXA 3D4JA 3KIOA 3CIZA 1RGVA 1OJ4A 1SJ1A 2V9WA 2KHOA 2GJIA 1RBSA 3JAMU 1D9DA 5KFIA 2O8CB 4KV8B 4CEAA 2GAGC 2RF2A 3U6FA 2WK4A 3GIKA 1DFDA 3JQKA 1FRJA 2CQBA 3IAM9 3OLAA 2HRUA 5GADI 1XJWB 4E3SA 2QXFA 4OPJA 3CCES 1L3KA 2UUBJ 3PR4A 3EO3A 3UE5A 4A62A 3OHAA 4J9UE 4N7TA 4J9PA 3KNAA 4RW7A 2AYEA 1NU0A 1QQCA 4CJLA 2VBWA 1BI4B 3EZUA 2OAUA 1XQIA 1X4AA 4RBTA 2OO4A 2MQLA 4NXMK 2UXBF 1CPZA 5DLGA 4F3MA 1NKCA 4DR7K 3MM5A 4JI8F 3R6LB 2YWEA 3SIPB 3KK2A 3Q7BA 1EETA 5F8JA 2J6SA 3QPIA 1HQUA 4NZ0A 2Q36A 1O1WA 2YNIA 4USWA 4WKYA 2D3O1 2E9ZA 3VF4A 1SJ4P 2OA8A 3O80A 2E1AA 4OLOA 5HL7L 3CO0P 3ETMA 2R7OA 2HLTA 5HP1A 4BRNA 4TNOA 3Q2SC 2UUCF 2R3VA 4HTUA 1ITGA 4DV2K 4WPAA 5K20B 4BRHA 3P1GA 2YKNA 4QWCA 4C97A 3KG1A 1LAVA 2ILYA 2BJ7A 2E66A 2APOA 3QT6A 4FWLA 4KO0B 3DRSA 3ZNUA 1S79A 4PXDA 3CERA 2W2OP 1HRHA 1YRUA 2DNZA 3FGVA 2FC8A 3MUVP 4G6VB 3EN9A 4ED5A 2UUBF 2GEMA 3EYZA 1JXVA 3QETA 2XRIA 3CQ8A 2UU9K 4IQMA 2V5HG 3D54A 5KG4A 4I67A 2CGJA 5KOWA 4JHDA 1U6ZA 2J7KA 3P5BP 4ETXA 3UD4P 2LDYA 3FSIA 1S1XB 1C2PA 3FLCO 2WBRA 4B3TK 3WXKA 3NMAA 5LY3A 2CPIA 2BJ1A 4Z2XA 3OYCA 4KHPJ 2EG2A 2NZCA 2ZOGA 1HIYA 3AV9A 2NRXA 4ZPVR 4LR9A 3TPQA 2UUAK 5GMEA 3TQEA 1UW4A 3LH2S 4WK3A 1ULRA 1I39A 3IAYA 1QQMA 2PSZA 2Z2MA 4IBNA 2QL9B 3O3LA 1XNRF 2MKIA 3TW0A 2BTFA 3WBZA 2E1MC 2HK3A 3GYNA 5LT5A 1D09B 1UETA 1YZ6A 2YBVA 1HWUA 1REVA 3P4UB 3AVHA 4N56A 3EE9A 3I5CA 1U1KA 3J7AN 2Q0UA 3PJXA 3V4IA 3UN5A 2F3JA 1XR7A 3EMTA 4DR2K 4ZK7M 4OI1A 4Z4EA 3AXKA 5IOLA 3RG6A 4BDPA 5B0EA 3WZ0A 2BBEA 3RR8A 2F8TA 3D0PA 3FJ2A 1KLMB 3D28A 4IYQA 1H7XA 1UEVA 1M5OC 4E7IA 1WNSA 2HSEB 1PILA 1ILYA 4EHTA 2YKPA 3BSOA 3FQKA 4K59A 1TR0A 5T7BA 1GXTA 4EHUA 3FZFA 3R2CJ 5A6PA 2VH7A 4U9RA 4MDBA 3FBBA 3BR9A 4X62F 1U1NA 3J80U 3MEDB 1UP1A 2GGPB 1T9YA 4M5GA 2HW3A 1Y97A 3U27A 3P3DA 2VGMA 2DT9A 3PM9A 1YWXA 4GRSA 3CXCR 3G9CA 3BM7A 1RHRB 2PYJA 1I94K 1OH7A 4JP8A 5C7PA 1I94F 5F9NA 1ITPA 3MXHP 3GJSB 2JNJA 3D68A 1T9UA 3GCWP 1YI2N 3OYJA 4B8CA 5I3QA 2YKNB 3O2IA 1CJTB 4QCLA 5C5JA 1S9EA 2XI2A 4OLPA 3MM9B 4RNFA 4Z94A 4Q8EA 5C15A 4MH8A 2I2YA 4FPBA 1YJTA 1JCEA 1NU4A 1FX2A 1NGJA 1QTMA 2OTLS 3UFCX 1R0CB 4DTUA 3DOLA 3DLRA 1ZPWX 1PG5B 3CT9A 3AJDA 3MM8B 4OYXA 1GLLO 5ETTA 3CD6S 2BJEA 4PKIA 4ECWA 4F4ZA 2WVBA 3HHLB 1HKBA 3C0BA 1K44A 4C8ZA 2BQ3A 1IQTA 5EVZA 4U96A 3R3TA 1W2BM 3EEQA 2LECA 1NSPA 1HPMA 4LFBJ 1ZTWA 4ILRA 2C22A 2FBXA 1BD6A 3R7BB 1NJZA 4U8YA 3QJLA 3D2FA 3N4PA 4DV1J 3WXMB 4JS4A 4PKDB 2WB4A 4WU2A 1ZH5A 1CLQA 1G3OA 3BV8A 4IZ9A 4IOCQ 3VA3A 5ETRA 2X1GA 4ID1A 2QYGA 1RDUA 2J0XA 1HQ2A 4DQSA 3A12A 3AFGA 4CK1A 3R5CA 2B9WA 3W2WA 1BQNA 1EZZB 2VA3A 5AXNA 1WKJA 2M52A 4OJ1A 4XH1A 3C6UB 2W4PA 4TQSA 1UFLA 3G10A 4PA1A 4ECYA 3R97A 1RUSA 3VQ9A 3KJVA 4FXWA 3G6VA 4DQIA 4HVJA 3GR0A 1VSMA 2RUSA 1R3NA 2L9DA 3HP9A 1IJEB 4UW2A 5IQ6A 2JHEA 1WN7A 4FZXC 3VA0A 3BQ2A 1AT1B 1PGZA 5J2NA 2RQKA 3FFIA 2ASOA 4KHPF 1SXLA 5CZXA 4NE9C 2IA0A 2EPIA 1JIHA 2F96A 4GY2B 4KAIA 3G6YA 3DLGB 2D7SA 1UVLA 2HQCA 1RTDB 1HNZF 3AGKA 3PYGA 4X66K 1NKBA 1NMNA 4YB7A 5HROB 3K2YA 3U8XA 4OLAA 4PHTX 5B08A 4CJ7A 1NK4A 4QYZJ 3KXDA 4KI6A 4IXCA 5DS7A 2VC1A 1NO8A 4Q45A 4B9QA 3SBTA 2K3KA 4IOBA 3W0LA 3QDKA 4LF5F 4KO0A 3T3FA 4ED7A 3DRSB 2VB6A 4OHYA 1RT1A 4CLLA 3ISNC 1HHSA 2CQ1A 1WC0A 3N6MA 3POTA 3A8KA 1NGGA 3ZXWA 3UO0A 2E88A 2E5LJ 4H5TA 2ZOFA 4EBCA 4MK9A 2QA4G 4RW6A 3H59A 3V6DA 5D0RA 3QFHA 3OYHA 1FFSB 3CCLS 2EFGA 1QE1B 4M5MA 1U2CA 3L2WA 2HWHA 3KKFA 1WUAA 2D3OR 4OI2A 2QX0A 1F5BA 3CJTA 2JEJA 3LALA 1VQ8S 3I82A 3CJQA 3DLLL 3DOKA 3EDRB 3TEGA 4BQLA 4C8KA 3OTEA 4FJNA 3B8HA 3KNGA 2CAJA 4K4VA 2HVZA 2PA3A 3HVWA 1U2VB 3N9UC 1YJ7A 4KB1A 1X4DA 4MJKA 2DRDA 3PDNA 1NKEA 3KWIA 2JC1A 1RBLA 3MEGB 3L2RA 3MR5A 4CHPA 3SEOA 1TKTA 3BREA 3QGHA 1HI0P 1H0HB 2XZTB 3Q8YA 4A48A 4J9KA 1BO5O 2A1RA 1HNWF 3THWB 3DRXA 4NA2A 2DR9A 5KFPA 4M5KA 4JI7F 1SKRA 1HKAA 4F0KA 4BS2A 2KFNA 4FJKA 3QT8A 4ALZA 3THTA 1L3TA 1V5IB 2IC3B 3BO3A 2HNZB 2GMHA 3KLHB 4RW4B 1RAOA 4FLWA 5LMUF 3W2WB 2RRBA 3QGPA 3ZO7A 2KVQE 3W3SA 1RI7A 4I0WA 1KHWA 1F2GA 3HFZB 4C0OC 4DPXA 4FDFA 4DR4J 1S0NA 5HL7Q 5HMZA 4I1TA 5FPDA 3L2VA 3TEHB 4DTXA 4BQZA 1Q5YA 3MMBA 5J2NB 4KB0A 4FF2A 1RP5A 2G8WA 5B0DA 1E3MA 4RR5A 3OT9A 1Z4UA 2LMIA 4Z4HA 4FYWB 2CJAA 3DLGA 1SKUB 2R7QA 5D0GA 2Q43A 1RHMB 1RTDA 4Q44A 4O4RA 2M8DB 2L9WA 2XY7A 1FDBA 5CQGA 3L4QA 4B3OB 5KFQA 1VHXA 1U48A 4E7LA 5HI7A 5E2QA 2CJKA 3C6TB 2BR0A 4A8MP 4FYVB 4OKEA 2DXDA 3W61A 2FXUA 2J9DE 4LMZA 5AQGA 3CJ9A 2ILZA 3US5A 4E1NA 2PZSA 3QNOA 5T7LA 1ZAVA 4CGGA 4DSEA 3T1YJ 1S6QA 1V3RA 3POTB 5GMKa 4U67L 5FJ4A 1DGKN 3BGOP 2HB5A 1FDAA 4B9TA 3DOLB 2GJFA 2JX2A 5CH7B 3V1QA 1S76D 1PO6A 3DRRA 4B3TF 2MQMA 5AQYA 4M3XA 1ZA2B 3D6RA 4RLEA 4XDDA 1M90O 5LJ5Y 2HLUA 3W66A 3OS0A 4H5NA 4RUHA 2POKA 4BRGA 2PD1A 4KV8A 3Q2TC 3ULHA 1NOZA 3BZQA 4NXNF 4BRKA 3JXUA 2OD4A 1XMOJ 3EXYA 2JEGA 4HVZA 2CH6A 1H73A 1YITS 2KQ2A 1H6KX 1N54B 3PHTA 1S6PA 2D0CA 2FJVA 4OJ3A 2DB1A 3CD5A 2A40A 1MROA 1BCMA 3AA3A 1XMBA 2PO4A 4LFAF 2E44A 1U1PA 3B82A 2H51B 1HWLA 4ZJOA 3UD5A 1WHYA 1X9WA 4UQGA 3VQ8A 4OPAA 4RW8A 2R7XA 3W9JA 2NLXA 2FB0A 3M30B 4A5BA 2ZBQA 4LFCF 4UQTA 3J7A1 2QEXS 2YWGA 2KN4A 4H5RA 4AHRA 4P74A 3HPOA 1HYSB 4H8KA 4GC7A 5HRPA 2DNPA 3QEVA 3HMJG 3KLHA 3M8RA 2OSRA 1URNA 3HSCA 6FD1A 4XO0A 1NHKL 1NJYA 2KO1A 3FFIB 2GO8A 4QWDA 3E8OA 4U7UK 3CNQP 3NBPB 1NGIA 2V34A 1F21A 3O9RA 2U2FA 5LMNK 1N52B 1CVJA 3UVJA 1J2VA 2HNYA 1BWVA 1HNXK 1RBVA 3VEYA 4ZPDA 1HNXF 4WFBQ 2MY8A 2H3EB 1I1GA 3ZFVA 3QO9B 4W5RA 1EX8A 3G25A 4BC7A 3C7NB 2F4VF 3L09A 3VAFA 2CXEA 1YIJS 1YITN 2QKKA 1Q4RA 4EEYA 2O8BA 4GMKA 4DU3A 3NCPA 5KFDA 1LWEA 5KFRA 4ZLLA 3ZX3A 3NAHA 4DV7F 4CHNA 4KC5A 2Q3SA 1Y5NB 2KFYA 1KVAA 3PRVA 4OYIA 1GLJO 4PG5A 4BC5A 1EB0A 3HVTA 3RJMB 4QWEA 2BEFA 1A6LA 2BE9B 3CCSN 5EWEA 4RUCA 1WJ9A 4PKHA 1N36K 3M3ZA 1ZZNA 3IS9A 4ERDA 1OMSA 3ZSWA 5DJBA 4ECRA 4RW7B 2B9XA 1GMUA 3T1YK 5AE2A 2HQDA 2BE2A 4PAAA 5LMUK 3LP1A 1VC5A 5CXTA 1LOTB 1VJQA 3TUZC 3H3OB 4IJNA 1EARA 4MKVA 4U7UD 1Y11A 2UXCK 4IOCL 3QJPA 2G0CA 1T03A 3THWA 4ZVTB 2V50A 2MJNA 1QVGM 4CYUB 1RT3A 3SBMA 1P9YA 4D3HA 2XLJA 1WC4A 3KK2B 3LP2A 3CETA 4E98A 3CG7A 4C8OA 3Q89A 3EPIA 2HIQA 2YX4A 1ZAXA 2R7WA 2I8EA 3V1OA 3QLHA 3AO5A 3MPVA 5DM7L 3S3NA 3CC2N 4B3SJ 4QU7A 2ZDOA 4RW4A 1F5AA 4WXWA 1BMQB 4Y2AA 1K8AT 4OGCA 4BRQA 1JB0C 3K5MA 3GONA 1L3SA 3CCMN 1F2HA 2UV8A 1FESA 1KLNA 3OYLA 3CC4N 2GGPA 2IJRA 3Q8UA 2V2VA 5EHHA 5JLFA 2CPJA 3TVYA 1GH8A 2Z1JA 3H4BA 3GZ7A 2FJDB 3RAXA 4YR0A 4CGHA 1Q79A 4OZ2A 2P9KB 5F1XA 2B6AB 1NEEA 1HJOA 3TX8A 4NRUA 5IWAF 3HCXA 2ETJA 1K0TA 5IM0A 6FDRA 4OZ3A 3DGPB 3GIIA 4TVAB 1QHTA 4OGEA 2B8QA 2EW9A 3MFIA 3QEPA 3KK7A 4GNIA 3MURP 2FPHX 4NWBA 2LQ8A 3C6TA 3SV3A 3ENVA 4IFYA 1GOBA 2E1YA 2HBMA 3MMCB 5KT2A 1XN9A 1F9EB 5IV4A 3BF3A 1LCUA 3AVKA 3H1VX 3BO2A 3VV2B 3OL6A 5DLFA 3PW7A 2YNFB 1QY7A 2XG8A 3A3NB 3SI8A 2AKWB 1EKRA 5AQHA 4DBQA 2JLFA 3AOBA 4AF1A 4IG0B 4BY9C 1RWMB 3UDEA 3MMJA 3THYA 1RT2B 4GKJF 2QIFA 4ZVGA 4AH9A 1ATNA 1QAJA 4YHHF 3W63A 3B4DA 1HWJA 1WG4A 4P2XA 2ZZTA 1OO0B 4BR2A 1NGBA 3TAEA 1FKOA 2CZVC 3DYAA 3V9WA 4WF9Q 5HO4A 4F50A 1CJVB 4X2BA 2MEWA 1H2UX 2QLBB 2EX3A 2HS4A 2BVZA 3ZSZA 1FWLA 4AHCA 1GK8A 2RJZA 3L3CA 2F4VK 1Q8KA 2CDRB 3KLIA 3L4BC 1WDTA 3BYPA 5DM6L 1NMDA 1D8ZA 3ALYA 4A8YA 3E3XA 5D4NA 2VDHA 3HHLD 3IS9B 4ZPWR 1RSCA 4NLWA 4A4JA 2IMWP 1KLMA 4JI3J 2XMTA 3RBDA 1NJIT 2HFOA 3BQ0A 3FBEA 1RT6B 1I51B 4N47A 3L3UA 1FNOA 4E0DA 5KFLA 2DRBA 4OKKA 3QJJA 4JI5F 3MEDA 4P2SA 1OVYA 2DCLA 1FKPA 4IEIA 1DARA 2RHKA 2YWFA 3GJRB 4P73A 1YKWA 2CG4A 3GYGA 1C1CA 3VALA 4DCHA 3VAGA 4B17A 4CGIA 5HROA 2EBEA 4CLTA 3A13A 4HT7A 3N0VA 3TVZA 3KKRA 2R7TA 3SQGB 1VFJA 2R9LA 1DLOA 5KI6A 2QT7A 2G8VA 4YN3B 3HHKA 3G6ES 2YNGA 1LK5A 4AE5A 3AAQA 1DKGD 2F8SA 1S9EB 2QL7B 4MIWA 3SSSA 2G0JA 5FLXO 5C24A 5H1SQ 1S59A 3VTIA 2AJ4A 3C6HA 4KHSA 3CCUS 3N6LA 1V6HA 2PA8D 4OX6A 3L7PA 4B9LA 5KQ8A 4BRAA 3CCQN 3K89A 3LPYA 3MM8A 1OKJA 2ZFHA 3O4QA 2MLXA 3MMVA 1WSRA 3FKBA 1NK6A 2DPIA 1AA1B 3H3NO 4ECZA 1UVIA 4DL5A 1LWEB 2V8GA 4PL7A 1Z2LA 3JQJA 4CZHA 3WNHA 2P9GA 3DMJA 1TUWA 3J7YI 4ECXA 1G1XA 4PXCA 1JLGB 4L74A 3U7JA 3PIPL 1LWXA 2HF4A 2KH9A 3M4XA 3MGJA 5LMNF 5G0RA 2YHXA 2VKZG 1B7YB 1URRA 3PG9A 4CEZA 3IA0A 3MTJA 4QIVA 4IG0A 2Q79A 4NEZA 2ERRA 2XEXA 3NG8A 2MTLA 2IJFA 3KHHA 2WVDA 3Q8PB 1HKCA 5GAGI 1IG9A 1IO2A 4NLXA 3UDCA 3FCWA 1G4CA 4ECQA 4RNHA 2I6WA 1R0AB 2ZBIA 5DMRA 2IC3A 3AT1B 1TV6A 4FSVA 4M3WA 4NLBA 1P6TA 4I9QA 2FIUA 1N5TA 2OMLA 4E8UA 1XNRK 1VBKA 1ZA1B 4WJBA 3O9SA 3TJ9A 3S6EA 4JI4F 3M1FA 1JNZB 4PUOB 1FTRA 3V1RA 4PYAA 3NVKA 3M8QA 3UNGC 1LXJA 2YH0A 2YNHA 3D2EA 2D41A 2F40A 3AO4A 4NZ7A 2RB7A 3JTPA 2XBPA 4KTZA 4DTSA 4RJVA 2KZZA 2XS7A 3AY0A 5K14B 2VIHA 1BCOA 5K8NA 3OSPA 4EZ9A 1DT9A 4ETZA 4M95A 5J2PB 3VQBA 2Y8WA 2IPOB 2K06A 2K1RB 4DV3F 3V6DB 5DGAA 1WSHA 5AFUA 4OZJA 3DNCA 3AAPA 2HRTA 5HQMA 1Q8LA 1WC6A 3ILLA 3VESA 4FOIA 2VG7B 4KGVB 3AVCA 2D1CA 1JLCB 4F2SA 4FF3A 3MMCA 3MWPA 4CO3A 3VAMA 4KSEB 3OR2B 3D0HE 4GV3A 2DGOA 1YF5L 4USMA 3TJ8A 4O8KA 2AJQA 2XULA 3TQ1A 2VASA 2W6KA 1RAHB 1S7IA 3G6EN 4PWUA 3KMQA 4W5TA 4EMDA 1RTIB 4JN4A 1FVQA 2DXEA 5BYRA 1YUWA 3CJKA 1JLGA 2Y0SD 5HBMA 2KM8C 4QR1A 2C3UA 4KHQA 4H0OA 3DYAB 2E2QA 4LVOP 2UYTA 1FWPA 3PJWA 4HR2A 1IR2A 4LF7F 3IR7B 2A6OA 2ZH8A 1S6PB 4O3PA 3EJMA 2WC9A 1MROB 1PC5A 2G0IA 3K8VA 4KPYA 1VQ7S 3BO4A 4CERA 3CPWM 4M3ZA 5KFBA 1TKZB 1UA0A 3KDOA 5BRFA 1HBUA 4RW8B 4EZ6A 4NA3A 2ZJPL 3M30A 3WIUA 3UNYA 4ES1A 4WP9A 5D3GB 1OWXA 2DCUB 4KGKA 2QW9A 2VBZA 3TA0A 3F9MA 1RLDA 3UD3P 1X4HA 1NK0A 5LSLA 4YR2A 4IO9L 4L3NA 1R31A 3J80O 1S4FA 1BWEA 2XHWA 4JI1K 4RW9B 3CD7A 4J9SA 3SAFA 3Q8VA 2H5JB 3OW2R 4P9SA 3CD6N 2KYZA 2OLWA 2R8KA 4DR5J 4A5AA 2F4VJ 4DR4K 1TAQA 1FJEB 3RGIA 1IKYA 3BKTA 4WBFA 2YXLA 3X3UA 4DU7A 4A2BA 1KC8T 2G8HA 2VC0A 2DY4A 4DKWA 1JNRB 4G1PA 1DAXA 5KG3A 1HNXJ 4J90A 4FYYB 2XGQA 2HK2A 4JYAK 1S1XA 5CD4H 2IRXA 4E7JA 2EKNA 4H4OB 2QO3A 3GU0A 3NDKA 4KHMA 4NLRA 1JXLA 4DX7A 4FPIA 2CFXA 3C65A 3Q83A 5T7LB 3FFKB 1YTYA 4GKKF 5D78A 4OI4A 4NLDA 4NL5A 1BY9A 1S1WA 4OJGA 2I38A 3GJQB 5T41A 3TJAA 3DRRB 3BN7A 4DTRA 4DTMA 4LF6F 5HJXA 1EHWA 1YDLA 3DXKB 2MQ8A 3OYNA 5AXKA 4BVPA 5FPNA 3Q8QB 2CIMA 4ED2A 1APSA 3RSEA 2LXFA 3AJ1A 1G15A 4FWOA 4JKGB 1U02A 1RBUA 4LF2A 1FDDA 3MWBA 2IFXA 2CQCA 5F0UA 5G0RB 3CMES 3O3HA 5E7OB 5A0YA 3GR1A 2M0GB 3BH7B 2BE2B 4W98A 1WOSA 4MK8A 4FO0A 4FJ5A 3LP1B 4HWIA 4CNYA 2CDQA 1GAOA 3M8YA 2PYLA 5FRNA 4K4YA 3WUHA 2QV6A 1VISA 2X51A 4CYUA 4DX6A 1BIZA 2UVUA 1XK8A 3PX0A 2FLOA 4YP3A 5SWMA 3LDOA 2RS2A 4DV0F 4NMXA 2RDJA 1PC4A 2UXDJ 2HZVA 2DK2A 2RQ4A 1YJNN 4PR6A 1RAEB 2JFDA 3T1YF 4R0EA 4C2MA 3JS9A 2GS8A 4DLEA 3BKFA 2NSCA 5KFHA 4XIUA 1KN6A 2ZH2A 4CZFA 4M45A 1GTHA 5M1FA 1RU2A 2ZM6K 3GE9A 3KUGA 1MMNA 4CD1A 4OYOA 3OV7A 2Q31A 4PWWA 1NHVA 3FDSA 1T9TA 1TL7B 1S48A 4EO6A 5KAKA 2V7ZA 1U25A 3FR0A 4WQ5C 3LGNA 2DO0A 4ITSA 4YOEA 2WZ1A 5GAHU 3BSNA 5JICA 1U49A 3QO9A 2D9PA 2LQJA 1YG0A 5D0EA 4GVMA 4H0VB 4B1XB 3CDBA 1TKXB 1AFIA 2ZH5A 2Q97A 1UEKA 1R43A 5KQDA 1FJGJ 5ELZA 2DY1A 2QSWA 3CWJA 2NXJA 4YR3A 1UMJA 3I55N 1TTHB 4QOZB 4CBXA 3H6EA 1TP7A 2BQUA 4ID8A 3VAIA 1FRLA 4Q2MA 3FCVA 4I6YA 1WORA 1T9WA 2MSTA 3OYFA 3A5OC 2ROPA 3BSCA 3R8YA 1VK0A 3M2UA 4IDKA 2IBKA 1SQKA 2W2MP 1ELOA 3AVIA 1JLCA 2G8UA 3IN5A 3THYB 4CJQA 1UFKA 3R5AA 1IBMK 4HH1A 1P9QC 4DV1K 1JXBA 1Q78A 1U45A 2XNRA 4E2FB 1KVKA 2Y9HA 1PCAA 2P9CA 1NXIA 5EDWA 1BQNB 1PJ6A 1YRXA 5ADZA 3VGVA 4BC3A 4CTAB 4FJ9A 4CESA 1BL3A 1AYEA 2OIHA 3CJKB 1J5EF 3G86A 3VGUA 2ASDA 1T03B 2VJUA 4ED1A 1HI8A 2RKIB 2DNGA 1Q5VA 2OPSB 4YDDB 4UT4A 2IHR1 3FE1A 2V4QA 2XY6A 2E1RA 2RDIA 4AHSA 3D0GE 4O44B 4DU4A 5A2QU 3CJ1A 1HR0J 4Z4GA 2W9BB 1FFGB 2FF3B 4FNIA 2OPQB 2W01A 3W64A 5C42A 2DEIA 2W2NP 4AFFA 3BGUA 3T1HJ 5KT5A 5F8HA 4AUKA 1WHWA 2HGNA 5ADXA 2VFTA 4AXIA 4JV5J 4HHUA 3ZZZA 2RE2A 3I9ZA 3CJ8A 1XEZA 1Q81T 2UXBJ 3PW2A 4LF9F 5AQTA 4JI5K 1VOMA 2CA9A 4ZVRB 1KTQA 1FJGF 3CHWA 3SDEA 5A8WA 3SQGA 3A3OB 1B70B 4ZPTR 2ASLA 2GWKA 1B4SA 3O5TB 1IKYB 5KPTA 1HI1A 2O8FB 1IWGA 4X4OA 2YHWA 3ZSXA 2FHKA 3OVBA 4Y2KA 1ZBUA 4C23A 5MLCQ 2MY7A 2R2RA 3CTRA 3LO3A 5AZIA 1ZM2A 3OD2A 4DX8H 3DWLA 1HNZJ 2GQQA 2GQ2A 4KR0B 3D45A 1J5OA 3PIOQ 3EM1A 5I3PA 4DLGA 2X1AA 2OUGA 1Q9XA 1Q53A 3V81B 3ILJA 2A18A 2XY5A 1YLXA 2OANA 3OTOK 4Y1CA 3MN6A 5AQMA 3C14B 2UXDF 4JV5K 2G2YA 2JWKA 3NWRA 5L1KA 4U95A 1RILA 5KFGA 2IM3A 4FYDA 2RILA 1IBKJ 1VSKA 2YV0X 1DTTB 5M1KA 2D5RA 3HD1A 4ANCA 4CP5A 2DISA 4IDKB 2PC6A 4LFAK 1N34F 4FW1A 2QFJA 3OTCA 2W7OA 2HNZA 3RBZA 2DTJA 3TZXA 1JLBA 1QUPA 1RA6A 3OSNA 1YZ7A 4CEOA 4MKAA 1UL3A 3VVUA 2Q0RA 5F0XA 4OLBA 2BX6A 1KFDA 4ZPCA 3LM9A 3JSRA 1HMVA 4LFBF 5IWAK 4P7VA 2NCKL 4KH0B 2Q6CA 4EBEA 2ZWHA 3NE6A 3H5UA 3MM5B 3OLBA 1KVCA 3SAGA 2HRYA 2PIIA 4X66J 4DV0J 3GG1A 1FKPB 2R4FA 3H08A 3PW0A 4CHYA 4E19A 4N76A 4UZBA 5L39A 2DFFA 1LV5A 5FPEA 4JK8A 2W9BA 3JXOA 1NH8A 3CCLN 1PKUA 3IM8A 3HOTA 5F3ZA 4F0MA 4RO0A 3CF5Q 3K5LA 3I6PA 1DLOB 1WDDA 1KVBA 3VF2A 4BVOA 2MHEA 2E1ZA 5GAHI 2XY8A 1NCLA 2C28A 4MO5A 3CFRA 3QEWA 3CC7S 3M6VA 4JYAF 1RLCL 5AT1B 1I94J 3LPEA 2EXUA 2VJVA 3EGVA 1KRPA 2Y1LB 3QERA 3X1LB 2RN2A 3PYEA 3HT3A 4KBOA 3QICA 1M5KC 1XI1A 1ZPVA 2CNKB 4J9MA 2DHXA 4K41A 4CRJA 2VBXA 2L08A 1VSLA 2HHHF 1UVNA 3CCVN 5KG5A 4QWBA 1KBRA 3SLCA 4HLBA 3HJFA 3IC1A 3CJ4A 4JHDB 3LA0A 3HHNB 1NDPA 1ROFA 4YOWA 4JI0F 2WVEA 1TK8A 2W9AA 3P5TL 4I9LA 2BANA 2E1PA 1VHIA 3O9TA 2VOOA 2XMUA 1U6FA 4C3KA 3VGTA 2A6AA 1AZSA 1TL1A 2MZQA 4M63C 3AARA 2CJYB 1EQMA 3EUNA 3PVXA 3QQCD 1FD8A 1IJFB 2HFUA 1RA7A 1UFWA 1X9SA 1S5JA 4OJHA 2DFHA 2LXUA 2VWKA 2QI2A 3GL1A 5HK4A 3OTBA 2R8JA 2F8EX 4QU6A 2EG1A 1XNRJ 2ZHBA 2BUPA 2I5JA 4A8SA 1RTJA 3CIPA 1HYSA 4X4NA 3T69A 3V4IB 2VPXB 2ACYA 1S72S 4LREA 3VZHA 2VL1A 2MZJA 3FZHA 2OH2A 3UE2A 4C48A 1KAXA 3GDQA 1VBZA 4WQ5A 2EWSA 3RB3A 4BRFA 3H40A 4ISFA 3TNVA 4KH6A 3GG4A 3IFEA 1VMBA 5KTQA 4M5DB 4JEPA 5BN9A 3M8QB 2J9EA 4Q0BB 1RKJA 1VQ4S 4J2EA 1C4AA 2QL5B 3P38A 3BQ1A 4LF7K 2OI2A 2K3IA 1YBUA 5M1PA 2J6TA 3IO1A 3B6OA 4DS5A 1IUJA 4YB5A 2ALZA 3CQYA 4GO5X 3FSXA 4XH4A 3AO3A 1R0BG 3PNIA 4L3KA 3R9LA 2K1RA 2C3MA 4K2XA 2LCWA 2V67A 4DPOA 4E1JA 1N33K 4DXLA 2K7KA 3JTOA 5CZVA 1RDRA 3TRGA 1CJTA 3HVTB 2P8IA 3W7BA 4UY8T 1FX4A 5M1OA 1C0TA 2DRAA 3RRGA 3R5BA 5E33A 3T1HF 1RBAA 2DEJA 3PIPQ 2R7SA 3DHXA 1S1WB 3GYXB 2R7UA 2NRWA 4FK4A 2IOCA 2WBMA 1IVZA 3HI0A 4JI1F 4CIOA 2Y1IA 4EI2A 4ECVA 1UAXA 2E5JA 1UOCA 4PG6A 1ATSA 2B56A 1HBNB 1NK9A 3UCZP 3RSEB 4DQRA 3PKMA 4O0NA 3BS9A 1T9VA 5F8LA 2PEHA 2MZSA 5DQHA 3MPWA 2IM1A 3OY9A 4JI4K 3CSKA 4RCHA 1N32K 4ZIWA 3TTCA 3G4SN 3Q23A 1HLWA 2BANB 2N3OA 3QRRA 1HQEB 1GX6A 3CQXA 1TL3B 1RCHA 2X6NA 4ZKAA 4ZVHA 2GHWA 3QESA 3H46O 4FJJA 1VCTA 3ZZRA 2B8PA 1J27A 2DY9A 4OYAA 1WSFA 2ZHOA 3NGYA 3CJ2A 4FCYA 1TKZA 2AX0A 3VERA 1BISA 3QBWA 4YB1P 4A8QA 4K7QA 1S1TB 2QJ3A 2FJEB 2LXIA 2YTCA 2ZC4A 3P5JA 2PDAA 3G87A 3MCPA 2WHOA 3A4TA 2VOPA 5F2RA 5HN0A 4MO4A 2FHMA 4HT5A 3LAKA 2CH5A 1DQAA 4YDUC 5A8KA 2HS0A 3G8QA 4IOXA 2P9NB 4AQYJ 2MZRA 3QINA 4CBWA 3RYLA 2HQIA 4RBUA 3UCUP 2C2OB 2W4DA 2HNDB 5AE3A 2CPZA 1CBKA 1KNZA 3KDNA 1G2EA 3BB5A 3DGPA 5AQZA 4P7TA 4CT9A 2FJXA 4W90B 4X84A 1U0HB 2MKHA 3QSIA 4F67A 3J81j 4IJAA 3VEZA 3CUNA 4BG8A 5KG1A 5D6GA 5E3QA 3ENHA 3HLUA 3I9V9 3A5NC 4KH4A 3V6KA 1JJ2R 1RT1B 1D3WA 2KG1A 1JLFB 2WW4A 3TP2A 4FJHA 1RXOB 1YJ9S 2VQFJ 4X62K 3EWGA 2ZM6F 3M6XA 5KFEA 1WG1A 4LT6A 3I31A 1XC3A 4CEEA 4CZGA 1Q9YA 3GV7B 1J53A 4YMEA 3VEXA 2ZUGA 3QAEA 3T1HK 4OMFG 2UU9J 3AXMA 1M90T 4YY3J 4FNHA 4PXBA 1X5PA 1NMEB 1T6DA 3PW4A 4DV2F 3M7VA 3J7Z5 1Q7YO 4IRKA 2OEMA 1B7FA 1ZBIA 2MMYA 1V4TA 1C6VA 1GLEG 5KFWA 2WUSA 4X64F 3CMEN 2YVSA 2CRLA 3E9OA 4YEAA 3QWPA 4FKXA 3DLJA 3VEVA 2XWXA 5KPZA 4MK7A 3W65A 4JOUA 3OL9A 4BACA 3BUZB 3A2FA 2NREA 2U1AA 1JL2A 4O0IA 5JUMA 4RNNA 4FS2A 2BOPA 3D1HA 3KD5E 4DR3F 4Y0WA 3BDPA 3TU5A 2AA4A 3G0ZA 4ZN3A 3QIPA 2F63A 4KTQA 4D3GA 4WKRA 2DNKA 3ZX0A 3ZC4A 3CMAN 4AQYF 4JI7K 3CVKA 1NM2A 1VQ4N 4CLPA 4LRAA 2LA4A 1PAUB 3W1YC 4XAKA 4J9OA 2L48A 2ZGYA 2KJVA 5CYQB 4JI3F 3N79A 2JJ4D 4B8AB 5IT0A 2ZNYA 4MFBA 2AX1A 2P2CB 1ZZFA 4F4KA 4H03B 2YNGB 1FVSA 5JLHA 4IOAL 4HEA9 4O0JA 4Q0BA 1Q8IA 2WBNA 2PFFB 3OYIA 5GINA 3VGLA 2UUBK 2Y0BB 4ZLNA 3PV8A 3NGDA 1HPZB 1VQOS 2GQCA 4DL4A 3IXQA 4ILLA 1WSGA 3FBCA 1TKXA 3CF5L 4GMJB 4LF1A 4IG3A 4MKBA 4L3QA 4NLUA 1RYSA 3J81O 4M8LA 4JI7J 1TKDA 4OHXA 3MM7B 2FY8A 4YHHK 2V8PA 3IGNA 2BM0A 4P2FA 3PX6A 4E89A 3RRHA 1SQEA 2JWLA 2G13A 2ZDPA 1VQLN 1JLQB 4WQ4A 4N77A 4AD6A 3CFPA 2UUCK 2BM1A 3PRDA 4UUXA 3ZT2A 3G71N 4DJBA 1SAZA 1WTFA 4RNOA 3V81A 1P1TA 2HHHK 4F25A 3MZIA 1VK8A 2LQBA 2VBYA 1HARA 1M5VC 5LJWA 3H5YA 5L8RC 2XM3A 4NYOA 4JK9A 5BPMA 4EO8A 3NXZA 5KFCA 3V5RA 4JI2K 2DNRA 3CCVS 1OYDA 4GV9A 4DG1B 1BE4A 5I42A 4LRDA 5HMXA 3HULA 5J1PA 4ID5B 2HIYA 2QGFB 3DOMA 4MAKA 4CW7B 3H7HB 4C0BA 1WBBA 1QSSA 3LGMA 3W2VB 2NNWA 2NZ4A 2ZKTA 3TSUA 2BE7D 3C8YA 1TV6B 1MWQA 5JMNA 3ZTRA 4KPCA 4CZLA 1KD1O 4CEDA 3OFEA 4NZ6A 2XMAA 2JEFA 5KRTA 3AVGA 3HOSA 1CQNA 3J81Y 3T9NA 1SH3A 4WYBA 2Z58B 3KWGA 2PMZD 3ZCMA 2AP6A 1H72C 1EO1A 2OPQA 5DG9A 5G4DA 3MD1A 1B0PA 3H0PA 2YNHB 3D2EB 4BRIA 5CAAA 5IV3A 5B0BA 3QT5A 2QWPA 2F7VA 3AD7C 2E6MA 3I8BA 3NAEA 4U6PA 2R42A 4Z4CA 3ZTPA 2B4OA 1VAZA 4G1IA 2VGNA 4FPAA 2A6MA 3NNHA 3ATVA 3TAMB 1S49A 3U9ZA 4DV4J 1UPMB 2D3ZA 1N6QA 4ZP7A 1ZM3A 1LWCB 4ZCKA 4ZVEA 4TY9A 3O44A 3AA2A 1HNIB 3PFOA 7FDRA 2RDDA 4KQZA 1YVNA 2E7VA 3NBPA 1J5EK 3I4PA 2QFIA 1ASUA 4QIGA 1T9XA 3K5PA 2J0WA 1R89A 5FIIA 4PWDA 3R5JB 1U0HA 4DEZA 3VF6A 1KQGB 1SC6A 3DU6A 5AZIB 3I96A 4BRPA 5GVQA 2KXFA 3MAQA 1Y5LB 2DHGA 2GO9A 3CULA 2ZEJA 4IR1A 1SH0A 3SFUA 3CJ3A 4CF9A 4JI6F 4DHVA 3MI7X 4RG8A 5KGWA 1JLFA 2C1EB 1ZBSA 4CO4A 2PT0A 2BQRA 4HUEA 2GA7A 3IFRA 1QJHA 3MTKA 4B3MK 2WW8A 4LF8F 3OUYB 3OYGA 2D0PA 4F4AA 5HSPA 4DCJB 2FJBB 1RE1B 3QRPA 4ZMMA 4LFCJ 3RZAA 4DR3J 3WHIA 3DU5A 1ATRA 1HYZA 3MX2A 2FBVA 5IT9U 3CXCM 4K50A 2YQ3A 2BH1A 1P8GA 2J5AA 5KOXA 4LFAJ 4C7QA 3ENQA 2ZGZA 4C4WA 3RMCA 2O67A 3O6QA 1M1KT 1NK8A 1VBYA 1LWFA 1RCOB 2DKOB 4ID5A 3R5DA 1WLJA 1RBTA 5AQWA 4FW2A 3JSBA 1P27B 1RJJA 4Y2CA 1RTJB 1X3MA 1XWLA 2LP4A 3OYKA 5GAGU 4GVEA 4HTIA 3FUYA 1S22A 4FLXA 1X8DA 3AVBA 4DR6F 2PAVA 2DHAA 4RW9A 4M94A 5JVGL 3EXCX 3ICLA 3U02A 1UJ6A 4A2AA 1WSVA 1C1BB 1PYOB 2V8HA 1SJFA 4O5FA 3L6QA 2IGIA 3QLHB 3SQ4A 3HM8A 1N36J 4ZA1A 1VSEA 2MKJA 4C3LA 2G1DA 1RAAB 2WB1D 2CQPA 2CPYA 1RWUA 2OFGX 2CZ9A 3DN9A 3M32A 5GAEP 2EVZA 3HD2A 2HQ3A 2JGUA 5CD4A 4MDAA 1ACMB 2P5VA 2G8FA 2QMUB 1QAXA 2BJDA 2UUTA 3K9JA 1JLEA 4F2RA 3BEXA 1KDNA 2GVZB 2LU1A 4TQRA 3NMUA 3IMXA 1VQNN 1W25A 1YVUA 1N34J 5AFUH 4FM1A 2FZGB 4A46A 2UU9F 1WKKA 2BGGA 5C2DA 3ZLJA 2LFVA 4CVNE 1GLAG 4WZQA 3FEXB 2H4YB 2FSNA 4IO9Q 1H3DA 4OV1A 2IYIA 1N33F 1S77D 4CJ3A 2WOMA 2B51A 4I56A 3OS1A 4NPOA 3S1TA 4JD2B 2CGLA 2P51A 2LSNA 4IFYB 1JLQA 5TKYA 3AD9C 4FBUA 4GKKK 3WDOA 1EQ0A 4LBPA 4CIGA 4N41A 2V2KA 2ROEA 4CGDA 1SJRA 1CZ9A 4HACB 4F4YA 3DLEA 1B9FA 5AXMA 1DTQA 3KLFA 4CNZA 3RMDA 3OXFA 1KONA 1EKSA 5DK5A 4CJSA 3H2UB 3CMQA 3D1OA 4DV5F 1MWKA 2V69A 4OYWA 2YHAA 2ZF5O 2JZ5A 1B99A 1QAIA 1UKUA 2RH3A 1KVIA 4KHUA 4CJKA 3SBGA 1BA0A 3VQ6A 4C11A 3J8AA 5KRSA 1IBMJ 2UUAF 2I5JB 2VG6B 4LF9J 2ADCA 1NGFA 1RWVB 1WHVA 1B9DA 1GMWD 1WC3A 2IBOA 4OYZA 3UI3A 1B0VA 2PEBA 1XERA 2M2BA 3OTDA 4YS2A 2CADA 4DPTA 2KI2A 4JI6J 1WTBA 3ZTOA 3LP3A 3TTFA 1HBMB 1K73T 2JLEA 3B54A 1DQ8A 3TZWA 4CBUA 3TUJC 5AQPA 2KT2A 4B3RJ 4UY85 2BV3A 3ZTSA 4C6AA 1WUUA 2E2PA 1F1BB 2IYGA 1TQLA 5BPLA 2AJFE 1RKIA 3DAWA 3RBEA 1ZS6A 6AT1B 5F3TA 1QTNB 4I4BA 5E3AA 3MEKA 1VSIA 3T5JA 4G65A 3SSQA 4DV4F 5JVHQ 5D4LA 3CJBA 2FZKB 1CXQA 1U2RA 3MXIA 4M5LA 2VU5A 4ZDNA 4LF5J 2DJWA 4UOCA 1FO1A 2FVCA 4ILMA 4C3MA 4CI6A 5KPRA 4DUTA 5KFSA 4AM7A 4A47A 3CJSA 3CC2S 5C24B 1O5JA 1WACA 1R8HA 1S72N 4KHRA 1BGXT 3TOQA 8RUCA 3QGIA 4NA1A 3QFUA 3IAS9 1OPZA 8ATCB 1T05B 2VFRA 1ZXOA 4DU1A 4ZVOB 4B1UB 2VQEJ 2E7XA