2BANA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase P66 subunit
total genus 128
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2banA05
1D9DA 1RBRA 3IG1A 2F96A 3TR8A 2CJQA 4ZPBA 4W5QA 3KLGA 3D45A 2J6UA 5CYMA 2G8UA 2FBYA 4PA1A 4I2QA 2R2SA 3DI6B 3NH2A 4DQQA 4ED6A 3AO2A 1DLOA 3AO3A 1IKXA 3QIPB 5CYMB 2BRLA 2IA6A 5KFNA 4NLUA 3OS0A 1DTTA 4PWDB 3IN5A 5DK5A 3U3GA 3PW7A 4F2SA 3CO9A 4LY7A 4Z4CA 3VA0A 1ZBLA 4EO8A 2ZE2A 2ATLA 3EYZA 4Q8EA 3ZSRA 1TK0A 1L3TA 1WSHA 2J6TA 5J2PB 4KSEB 2X78A 3SYZA 2E6MA 4R8UB 5C24B 2HHXA 4N56A 1N6QB 4IBNA 4KAIA 1LWCA 2HNYB 4I2PB 4Z4HA 2OPQA 4ZVFA 2IDOA 4FBTA 2B4JA 4KHYA 3VQAA 5KG0A 2VG6A 4CJWA 1RT4A 1JLCB 3PW2A 3KOAA 3MAQA 1HQUA 2ETJA 3BGRA 1JLBA 3M8QA 1QAJA 4DSIA 2W9BA 3IRXB 5KT4A 2WONB 4PQUB 4KKOB 3TARA 2PY5A 3MEGA 1BQNA 3OYKA 1RT2A 4DTJA 2W9CB 3KK1A 1W9HA 4FK4A 3FDSA 4QCLA 4G1QA 5KT5A 2I5JA 2C2EA 4CFBA 5HRRA 3OYGA 4NRUA 4CEQA 4QPXA 3H5YA 2BGGA 4NYFA 1K6YA 1T3NA 2P5OA 4URGA 1WN7A 3HP6A 5J2QB 2BANA 3PJWA 1L3VA 1A5XA 3KKSA 1W25A 1KFDA 3AV9A 3O3GA 1ZYQA 4LD0A 3HYFA 4CEZA 3DLRA 1GX6A 4W5OA 4H54A 1KLNA 1Q9XA 4ZPAA 3C95A 4EBDA 4KV8B 3EZ5A 5EWFA 1YT3A 1S0OA 1RTHB 5DMRA 4CEFA 4LSNA 3SI8A 2VWJA 5KT6A 3OVNA 5J1EA 5KFMA 3NAIA 3HO1A 3HL8A 4CHNA 4F3OA 2IM1A 4UQGA 4DL6A 2IC3A 3M8SA 4JS4A 1S1WA 5KFOA 4KO0A 1REVA 1S1UB 1XHXA 5KT2A 5FDLA 4CIFA 4F4XA 4OPKA 3VQ9A 4K4UA 2G8IA 5CYQB 3S3OA 4FW1A 4G1QB 2AGOA 1QSLA 1JLCA 2JLEA 3P1GA 3MEDA 2AJQA 2IBKA 3NE6A 2O4GA 3O4NA 1L5UA 4DQIA 1RTJB 1NK4A 2EC0A 2OPQB 4PY5A 5T14A 4B3OA 1VRUB 4NLWA 4QAGA 3THVA 2EHGA 4CF9A 1S9EA 2WONA 4DU1A 1T8EA 2IGIA 3QINA 1LW2B 4DFMA 2FJVA 4Z4EA 4EYHB 2JEIA 5HRSA 3QO9B 2DPJA 2ATQA 3CJ0A 4QWDA 3VQSA 4CIEA 4KHMA 4TLRA 3BQ2A 1EP4B 2D3UA 4FJ9A 4MIBA 1EX4A 3SV4A 1EETA 1N6QA 2ITGA 3GIKA 3TVKA 2B6AA 2PYLA 2QKBA 3FSIA 1KVAA 4JRPA 3M9NB 4DF4A 2P1JA 3AO5A 3TQ1A 3OS1A 1U04A 4J2AA 1ASVA 1Z26A 2E4LA 3LWMA 3ITHA 2OA8A 2HHQA 4ED2A 3AVJA 1QE1B 4R5PB 3TAGA 3SI6A 1WNSA 4OL8A 1C1BA 4DMNA 4KHNA 3OSPA 4O44A 2RDJA 4OKEA 2P51A 2QE5A 3SFGA 1FXXA 3FQKA 3QIPA 1FKPA 3KTQA 3Q8SB 4DL2A 2Z1JA 3QIOA 2VG7B 4DQSA 1JLQA 3VQDA 1HNVA 2XC9A 4MFBA 3JSMB 4F4WA 4AH9A 4DQRA 1SH0A 4K8XA 2R2UA 4ED7A 1MU2B 1SUQB 2OYQA 2XGQA 3VQ8A 3A2FA 3QNNA 1X9SA 4E7KA 1C1BB 3V4IA 4R5PA 4XO0A 2GV9A 1I6JA 2OPRB 4NLDA 1U45A 3ITHB 4ZPDA 4KI6A 5L9XA 2YNIA 2A1SA 1TAUA 2OZMA 2KW4A 3MR3A 4DU3A 4RUAA 4WXOA 4PUOA 4ZVHA 2QK9A 4DL3A 1TKDA 1ZTTA 4Y3CA 1JLGA 1NKBA 1TQLA 1EKEA 3S9HA 1I3AA 4J9LA 4QW9A 4ICLA 3QESA 1KHWA 4ELTA 3KK2A 4FJKA 5D3GB 2FC0A 1U47A 4XPEA 3KKRA 2WB4A 4M95A 1C6VA 4KHWA 3AVLA 1S10A 4DSFA 1NK5A 4O4GA 2PZSA 2AQ4A 4EYIB 2GBZA 3OL9A 2D5RA 3AA2A 1S9GB 2WK4A 4ECRA 4GW6A 3T5LA 1IKVB 3UDLA 1N4LA 3NF6A 3DRRB 1VSDA 1UWBB 4M94A 5EWEA 3O3HA 1RTHA 2VWKA 3QYYA 3C6UB 4GC6A 1G15A 4AHTA 3AVAA 5DQHA 4OKKA 4CGDA 3OYLA 1KLMB 5K14B 3V81B 3OYDA 2HHUA 4ZP9A 2B5JA 1B9FA 3HKWA 2YKMB 4W5TA 4ZMMA 4FJLA 2YNFA 2HHWA 4CFAA 1GX5A 3LANA 3OYIA 1RT1B 3PR4A 4E3SA 4NLQA 4CESA 5J2MB 1HQEB 1IM4A 4MK9A 1ZTWA 4KTWA 3LWLA 4CE9A 1JX4A 3F73A 2UVUA 4CGGA 4FLZA 4QWAA 3KLHB 2R2TA 3CFOA 4G3IA 4CJEA 3V9SA 4WFXA 4ECTA 3OHBA 3LP2A 3AVHA 4ZP6A 3WNFA 3T5HA 1IKYB 1WSEA 3F9KA 3HM9A 1HJRA 1TAQA 4Z4FA 4OKJA 3SUQA 2W42A 4U6PA 4IFYB 4EP4A 3V81A 4PQUA 2Z1HA 4I9LA 4O3NA 2W9BB 3NDKA 1UA0A 3H5XA 2PYJA 4CJUA 4CJKA 3CVKA 1RBUA 1R0AA 4J9RA 1UWBA 3V6DA 4CCHA 5KFTA 1B9DA 3I5AA 4FBUA 1Q9YA 4RUCA 4ZTFA 1CSJA 3RB0A 4CHOA 3M9OB 5CZ2A 3U6FA 3TWHA 1BISA 1KTQA 2BE2B 3QEVA 4KB7A 4M42A 4JV2A 3SPZA 2Y1IA 1CLQA 4FM0A 1S97A 2XCAA 3RAQA 4W5NA 3C6TB 3NMAA 4CGIA 4WYWA 5E41A 3SFUA 3ISND 2JEJA 4AHUA 2W7PA 3KK2B 1A5WA 1D5AA 3L8BA 2IAJA 5KFUA 3TAMA 3DLEB 4PUOB 3V6DB 2X74A 2ZQBA 2FVCA 4I2PA 2FLLA 4K4VA 1B92A 4HUGA 1TGOA 3PO4A 4J2EA 3H5SA 5DQIA 3ZT0A 4CEAA 4B9VA 4ID1A 4ED3A 4DL7A 4Q8FA 5L1KA 2YHBA 5KFPA 2IS3A 2G8HA 3CIZA 4BE1A 1HYZA 1X9WA 4BE2A 1SUQA 3KLVA 4BE0A 4DTSA 2D0CA 3WNEA 3MFIA 1RDBA 3BSOA 3MECA 3D0PA 2OZSA 2AX0A 3LPUA 1BCMA 3MXIA 4MFBB 2HW3A 5KFZA 3K5OA 2BR0A 4ECSA 5DGAA 1S6QA 5F8LA 3NBPB 1SH2A 5I3UA 4YR3A 2FLNA 5F8JA 3UR0A 4IDKB 3KHHA 3QIDA 4HUEA 3CM5A 3PW4A 2YNFB 1BI4B 4J2BA 4DTNA 2CKWA 4ECYA 1SH3A 4EO6A 3MF5A 3LP1A 3VQ6A 3QEPA 3ZSZA 4TXSA 1LW0A 3ASMA 4FJ7A 2UVWA 4KTQA 1YVUA 3RBEA 3MR2A 1S6PA 3DLBA 4CJVA 5KFVA 1VSLA 3AVGA 2FJXA 1RT3B 3SUOA 2GC8A 1N56A 3T5JA 4KFBB 1EP4A 3AA5X 3VA3A 3DM2B 3KMQA 1X9MA 3NF8A 4QWBA 2ASJA 4C8MA 2DTUA 3GIMA 1N5YB 4DTMA 4ZHRA 2IJFA 4BACA 1JLBB 3KK3A 4DL5A 4M41A 1RBSA 4E1NA 1C0TB 4HVJA 3V1QA 1D0EA 1XR7A 3KD5E 4H4MA 3AVCA 2C28A 1VSEA 4K4XA 3KLIB 2BQRA 4WFZA 4ZHRB 2R8JA 2HNYA 2XO7A 4N76A 4WZMA 4MKAA 3LZJA 4QOZB 2RPIA 3VQQA 3BJYA 4EEYA 1S9FA 3QEXA 3HVRA 5FROA 3OYFA 2YNIB 1BGXT 4TY9A 1VSIA 2R2RA 4KO0B 2E9TA 3MEEB 4NCGA 5CYQA 1HMVA 1QS4A 2WOMB 3D5MA 4CJFA 3ZSQA 4Q5VA 2FLPA 4QW8A 2P5GA 1ZBFA 2IC3B 3CDWA 2Z1GA 1J9AA 4K8ZA 4DSJA 2ZKUA 3CWJA 1UOCA 4Q44A 4EZ9A 1NKEA 2ALZA 4JS5A 3VQ5A 2V9WA 3EPIA 1KVCA 3CYMA 4Q0BB 1NK6A 4IR1A 2E9RX 2XWYA 2JGUA 3SV3A 1S0NA 3E51A 1RT1A 3HJFA 2XRIA 4CFDA 2W9AA 3PW5A 1VSFA 3K5LA 1U09A 3SQ1A 3H5UA 3IGVA 1IH7A 4C8OA 3FRZA 4HYKA 1OS5A 4CGFA 1UA1A 2FBXA 3T3FA 1TV6B 3SCXA 1XI1A 3DLGB 4M3YA 4YQWA 1F21A 1RA6A 3RMDA 3D28A 1C2PA 1RILA 2XY7A 2F8TA 1TKTB 3MEEA 1FKOA 4Y1CA 5HRPA 2W9CA 1IKVA 2IAJB 2RKIA 3G6XA 1DTQB 5J2NA 2I5JB 4CHYA 1S9GA 5KFCA 5F8MA 3KK1B 4CJSA 3ULDA 3CDUA 4H4MB 3L2RA 3M8PA 2HB5A 1D8YA 1GOAA 3PV8A 4CJ5A 4ECWA 5F8GA 1BIZA 1IG9A 3V6HA 5KTQA 3AVIA 1S1TB 2X6SA 2D3ZA 4EBEA 2XY8A 1RTJA 3FQLA 2YV0X 3BSNA 2KFNA 1HQUB 4FZXC 4CHZA 4JLHA 4KI4A 3IS9B 4KFBA 1L3SA 5FDLB 2AX1A 3HPOA 1NJYA 4KBIA 3DRSA 4J2DA 1FKOB 1S1WB 3ICLA 3NKYA 2G8FA 5C24A 3GILA 1NNDA 2WHOA 4MQ3A 3SNNA 1C1CA 3I0RB 1RTDA 3HPHA 3OYBA 1IKYA 3GYNA 3NGDA 4O3PA 3LP2B 1J5OB 2B43A 3PX6A 3JSMA 5KG7A 4IRKA 5JUMA 1HNVB 2HNDB 3I8DA 2QXFA 3G6YA 2HHVA 4CK1A 1WNEA 2FBVA 4RW9B 3I5BA 1HPZA 2O5DA 1QHTA 1CZBA 3RMBA 5DLFA 3UQSA 3HP9A 4W5RA 3NGZA 1S6QB 2HNDA 1J53A 4B8CA 3OYAA 4AHSA 4LH5A 4WE1A 4RNNA 3V9UA 3KMSA 5CZ1A 2UUTA 1C0MA 4F2RA 1FK9B 4ECZA 3LP3A 1TVRA 3QGGA 1HMVB 5I42A 2FVQA 4CF0A 1TK5A 3AA3A 3HVWA 1S48A 4M3ZA 3N6LA 3B6OA 5HLFA 1KHVA 3CQ8A 3TAFA 3NAEA 4FJHA 4Q45A 5L1LA 5EWGA 5KFGA 2DFHA 3QLHA 4IR9A 3KHGA 2V4QA 4FCYA 3IS9A 1RBTA 4B9MA 3S3MA 3H40A 1JLAB 5EDWA 2WRMA 4J9NA 4FJJA 3KLIA 1RT7A 4RW4B 4K4YA 1NK7A 1JLFB 3OSNA 1KVBA 4FLVA 1ASWA 4RW8B 3QZ7A 4IG0B 4M3RA 4CECA 2JEFA 1LW2A 1CXUA 2V0NA 1JLAA 1SKSA 3IAYA 3M8PB 3CM6A 1RT4B 5DGBA 4OLAA 3KK3B 2OPSB 3Q8QB 4HUFA 3DRPA 1JXBA 5T7BA 3RB6A 1W0HA 4B9NA 4E1MA 5HP1A 3OS2A 1S6PB 3B6PA 3VQPA 2RKIB 3OYMA 1NKCA 3VQEA 1S1UA 5KFIA 4MKBA 3DLKA 4E0DA 1TL3B 2IMWP 5KGXA 2VA2A 3HT3A 4WE1B 1ITGA 1RT5A 1TV6A 4Y1DA 1BI4A 2DY4A 1RDAA 1MU2A 1JIHA 5KFAA 4NLYA 1IKWA 3C94A 3ZT1A 4KREA 1LWEA 2Z1IA 4J9OA 1NOYA 4TQSA 3KLHA 4CERA 3LAKA 5HRNA 2HHTA 4ECVA 3BQ0A 1U49A 4I7FA 1FKPB 4DQPA 4RNOA 4AHVA 4NLSA 4M3WA 1T05B 3K5NA 5KRTA 3LAMA 1X1PA 3IG1B 4O44B 4FLUA 3QNOA 3MECB 3PY8A 3E01A 5KFRA 4H4OA 1S49A 3ZSYA 2BQUA 4J9QA 4RW9A 4CEDA 3I0SB 4DL4A 3NF9A 2D41A 4AHRA 5EU7A 2B5JB 4RZRA 4MH8A 3TAQA 1S1VA 2E9ZA 5K14A 3SUNA 1SKWA 3MTKA 2ASDA 1BQMB 3JYTA 4O3RA 1LV5A 1J5OA 4F4YA 4FM2A 3AVFA 3DRRA 4Z0UA 1WLJA 3GQCA 1YTUA 1RYSA 4TYBA 4CJ4A 3QEIA 4KPYA 3PVXA 5KG6A 3H98A 4TY8B 1D1UA 1SL0A 5KFDA 3DYAA 3P83D 5KGWA 4GVMA 3M9MB 3DOLA 3DRSB 4BWMA 3C6TA 1HYVA 1S5JA 4CHPA 3NF7A 3V9XA 2VG5A 2FVSA 3U3YA 4OJRA 2HAIA 1HYSB 1XC9A 1Z25A 3NHGA 4B3OB 1JXLA 4L8RB 1DTQA 4RW7A 2BRKA 4I9QA 2ZD1B 4NLOA 4WYLA 4FJNA 3CFPA 1R0AB 3AO1A 2AWZA 3NAHA 5L1IA 1HYSA 3JYTB 4DLGA 3OL8A 4ECXA 5SZTA 1RDRA 4O5BA 3NH1A 5J2PA 4CJQA 2D0BA 3DYAB 2WTFA 1T7PA 3L2WA 3HSTB 1WSJA 3TANA 3DOKB 3SJJA 5JXSA 3DDKA 2IM2A 1TK8A 4RNMA 1TP7A 4MK8A 4FJMA 4HCCA 3MXJA 1K1SA 1LW0B 4R0EA 2UVRA 2AGPA 4FW2A 4CHQA 2XI3A 4FLXA 3NH0A 1BQMA 2QKKA 4CF2A 2J6SA 5KG3A 5HBMA 4ZVGA 3DLGA 1RYRA 2HVIA 1JLQB 5KT3A 4WFYA 4I2QB 5J2MA 3H59A 1J54A 3VN5A 4E89A 4ECUA 4KB0A 3E01B 3VQ7A 4ED8A 4DG1A 4OVLA 2BANB 4RW6A 4B9TA 1VRTA 4ECQA 4LH4A 4DSEA 2FBTA 4C8NA 1KLMA 4NLVA 2E6LA 4BDPA 4WZQA 4HKQA 4EP5A 2W7OA 2R8GA 5KFHA 2A1RA 4ID5A 3LZIA 4FYDA 4B9SA 1XR5A 4FS1A 1ZBHA 1LWEB 4YR0A 3L2VA 4IKFA 1IKWB 4E19A 3RR7A 1ZBUA 3KIOA 4Q43A 3DLEA 4O3SA 1WSIA 3SZ2A 4O55A 2HVHA 4YFUA 1I39A 4C8LA 1GOCA 4J9KA 4DFKA 5EUHA 2YKNA 3FFIB 4Z4GA 4E7JA 3QO9A 4BDYA 2YKNB 3FFIA 1LWFB 3ALYA 3OYEA 4J9PA 1QAIA 1JLGB 2ILYA 3EY1A 3CFRA 3DM2A 1KRPA 1S4FA 3UPFA 4DTPA 3P5JA 4KRFA 1JLEA 4NLRA 1XHZA 3QEWA 2XGPA 3QGIA 2OH2A 4OGEA 4DTXA 2OPRA 3L2QA 3RB3A 3ZSVA 4DWIA 1SV5B 4URSA 4ZVEA 4RW8A 4TN2A 3HVTA 1C1AA 1WSFA 1JL1A 1T94A 3OYJA 1N48A 3I5CA 4RG8A 4DU4A 4IQXA 4NCBA 4NLTA 1NJWA 5F9NA 3CJ3A 2C2DA 1RNHA 4NCAA 5JS1A 1ASUA 3CJ4A 3NGYA 3G10A 5CY4A 1RT6A 3AVNA 5J1EB 4CF1A 1HRHA 1XWLA 5HLFB 1HNIB 1Z4UA 2AGQA 1TL1B 5KFJA 2IM0A 4FK2A 1VSJA 3QETA 5I42B 1BHLA 3MFHA 3RR8A 4HTUA 3OY9A 2D0AA 3GIIA 4AHCA 3NGIA 4QWEA 3HXMA 4KHSA 3OL6A 4IOBA 4DS4A 3DMJB 3PW0A 4ZP8A 1WAFA 3OLBA 1HPZB 2YNHB 2R8IA 1KSPA 3L2UA 2FVRA 1VSMA 3QGHA 5KG4A 3K57A 3PHEA 2HMIA 2GIRA 4CJRA 1LAWA 3Q8PB 4F50A 5KFQA 2XCPA 1A5VA 5C25A 4Z4IA 3NCIA 3ZT4A 1T03A 5KI6A 1SV5A 3I0RA 3H2LA 3RTVA 3AO4A 2EX3A 4AILC 4NRTA 3BSAA 2FJWA 2GUIA 4RU9A 1S9EB 3HHKA 4CGJA 4J9MA 3KJVB 4ZTJA 2RF2B 4F8RA 1S1XA 2JC0A 2BE2A 3KHLA 3HPGA 5C42B 4TY8A 5KT7A 5KFWA 2OPPB 4IFVA 3T19A 2G8WA 4LQ9A 5KFXA 4ICLB 3CJ5A 1WAJA 4B8AB 5C42A 4FLWA 4IH7A 4K4ZA 1QSYA 4TSXA 3CJ2A 3SQ2A 4FJ5A 1YVFA 4M45A 4DEZA 1NK0A 3O4QA 4H4OB 1LAVA 1VSHA 2XHBA 2BDPA 3V6JA 3PJXA 1VSKA 3BQ1A 1JKHA 1S0MA 1Q8IA 4GMJB 4KV8A 3KLEB 2V4RA 4PWDA 4IG3A 4M3TA 2HMIB 4H8KA 4HCBA 1TKTA 3H4DA 3T1AA 1HQEA 3SPYA 4JV1A 4CFCA 2JC1A 1IKXB 4JV0A 4I7FB 4IFYA 5KFSA 4ED0A 3PZPA 3AVBA 2HNZA 2KFZA 3DI6A 3SQ0A 4DG1B 3ISNC 2R8KA 3MXMA 2NUBA 2YNHA 3G86A 4LSLB 2ILZA 3OL7A 3O3FA 3KLGB 4ZPCA 5J2QA 2BQ3A 1RT5B 3MR6A 3OHAA 2WOMA 1MMLA 4Q0BA 3LPTA 5FRNA 3L3UA 4MIAA 5KFLA 4NLGA 1ZETA 3TABA 3K59A 3N6MA 3TAPA 3NL0A 5HP1B 4FVMA 4DFJA 1U4BA 3RWUA 1ZBIA 4KKOA 1BL3A 4KE5A 3QZ8A 2HWIA 1BQNB 4YR2A 1NK9A 4F3TA 3EPGA 4FZYA 4GC7A 4FK0A 3BDPA 3GV8B 4YNQA 4N5SA 3SUPA 1NHVA 4ELVA 3S3NA 4U7CA 1C0TA 5DG8A 4Y2CA 4NCGB 1RDDA 4FM1A 3M8QB 4OGCA 2KZZA 3EZUA 3OJUA 2ZD1A 4RW7B 2IM3A 1JLEB 3VQBA 2WCXA 4IRDA 4IFVB 2OPPA 4O3OA 3LDSA 1NHUA 4KHQA 3PX0A 4O0JA 3DRPB 5L1JA 1VRUA 2W8LA 4CEOA 4YMEA 2RF2A 5F8IA 4NYZA 4URQU 2UUWA 3MEDB 1XR6A 4E7IA 4K4SA 4F4KA 1BIUA 4IG0A 3K58A 1NJZA 5KG5A 1SL1A 4OPJA 1WSGA 4FJ8A 1C0UA 3QERA 1QQCA 2O4IA 4E7LA 5C25B 1REVB 3N6NA 3TI0A 3ZSWA 5KG1A 1TVRB 3KHRA 4RNHA 1K1QA 1DLOB 2RDIA 2IOCA 1TKXA 4NYNA 1D9FA 1RT3A 4K4WA 4CEEA 2F8EX 5F8NA 3V6KA 5KFEA 3MR5A 2XI2A 4NLXA 1HARA 1QTMA 3K5MA 4KB1A 5DG7A 4CK2A 1VK0A 3PX4A 4JRQA 3GIJA 4FXDA 3V9ZA 4K50A 4M3UA 3LP1B 4E7HA 4NLPA 1FK9A 1QE1A 2X6NA 4LSLA 2HHSA 2AU0A 4IDKA 2F8SA 2HNZB 3OLAA 1HNIA 2DPIA 4KHRA 5I3UB 3CG7A 1RCHA 3WNHA 1RTIB 2B6AB 3RMCA 2GIQA 3NBPA 2R7YA 1EETB 3ZCMA 4O4RA 4BDZA 1TKXB 1Y97A 1RT6B 4BWJA 2C2RA 5HBMB 3TAMB 3BR9A 1JKHB 3ZT2A 4FJIA 5KFFA 3KLFB 3OJSA 3DLHA 4FJXA 5KRSA 1RT2B 2R8HA 1RDCA 4Y2AA 4MK7A 3MEGB 2ASLA 3ZSXA 4FLTA 4CJTA 1EXQA 3DOKA 2KQ2A 4DTRA 4FJGA 4K4TA 3BGRB 4IH6A 4ED1A 4FZZA 5FRMA 2DFFA 5HROA 2YNGA 5SWMA 4FLYA 5KG2A 2G8KA 5J2NB 5HROB 4O3QA 1SKRA 2VG6B 4IKAA 1KCFA 4KTZA 1TKZA 1JLFA 3KJVA 4KAZA 3BSCA 3PO5A 3RRGA 4B9LA 4IRCA 4WXWA 4EZ6A 4EBCA 2VG5B 4N41A 5KFKA 3OYNA 2I1RA 4ZP7A 4OLBA 2D7SA 1T03B 4NZ0A 3G6VA 2DFEA 2G8VA 3RRHA 1S1VB 4ID5B 1DTTB 5DG9A 4B9UA 5C5JA 4IH5A 5JS2A 1JXEA 4DLEA 2XY6A 4TQRA 3ZSOA 4XPCA 4CGHA 4FS2A 1VRTB 4RW6B 3DMJA 3I0SA 1QUVA 4JUZA 4LSNB 2W8KA 3HK2A 3HVAA 4F4ZA 4B08A 3RBDA 2FVPA 4RNFA 1SL2A 5KFBA 4N47A 4CF8A 2XY5A 1NOZA 3AA4A 4DTOA 3GV7B 1L3UA 2YKMA 5DLGA 4O0IA 2JEGA 3VQCA 1TL1A 1T05A 1RA7A 3BREA 1GOBA 3M8RA 3L3VA 3IGNA 3T5KA 4IG3B 3KLEA 1RBVA 3PR5B 3V1OA 1RTDB 1YTAA 4CJPA 4C8KA 1C1CB 3NFAA 3AVKA 3VQ4A 2C22A 3LALA 3IRXA 5F8HA 3TAEA 3DLKB 4CJ3A 3GV5B 1QSSA 3HVTB 3K2PA 5KFYA 3LP0A 1C0UB 1TL3A 4CEBA 4YP3A 4LQ3A 3C6UA 2KTQA 3RMAA 1CXQA 4CIGA 4KHUA 1JL2A 5D3GA 4QWCA 1TKZB 3KNAA 1CZ9A 3G0ZA 2Q3SA 2LSNA 4CJLA 3AVMA 2OPSA 3UIQA 3H08A 3OYHA 1S1TA 3RAXA 4CK3A 3ZT3A 1NJXA 5F9LA 2YNGB 4DSKA 3CDEA 4DF8A 1U48A 4O4GB 1S1XB 2UVVA 3H4BA 1LWFA 4X2BA 4DS5A 3DOLB 4J9SA 1RT7B 4RW4A 3KD1E 3RB4A 4DTUA 2ZE2B 3KLFA 3V4IB 3V1RA 3LP0B 3SQ4A 4XIUA 4TYAA 1UAXA 1N5YA 2VA3A 4M3XA 1LWCB 4DSLA 1NK8A 3QLHB 4R8UA 1RAJA 2KZMA 3Q8RB 4Y34A 3OYCA 1BCOA 2QV6A 5DQGA 1O1WA 1IO2A 3PUFA 3WNGA 2VG7A 2YHAA 4DFPA 1RTIA 1KFSA 2IJNA 4HHTA 4ELUA 2Y1JA 2HWHA 3V9WA 2RN2A
chains in the Genus database with same CATH superfamily
1D9DA 2MHEA 3O5TB 2MQQA 2CJQA 4ZPBA 2H5JB 3KLGA 5D0HA 1NHKL 3CULA 2R2SA 4JK8A 4LFAF 1HNZK 4P7TA 4BQLA 1DLOA 1IKXA 1TUWA 2BRLA 2C3YA 3OS0A 2A6AA 2IVFB 5DM7L 3TNVA 5DK5A 2ZJQL 1BHNA 4DOZA 3J7AP 1KKHA 1NLKL 5E7OB 1KAYA 3VA0A 1ZBLA 3OXLA 4EO8A 2JLGA 2ZE2A 3M2UB 4Q8EA 2I7PA 3VEOA 4DBQA 4JAXA 2CNOB 1WSHA 2J6TA 2KXHA 3K7RA 4UUXA 3SYZA 4OLOA 1V4SA 4R8UB 3ENHA 5C24B 4N56A 3MWPA 3QSIA 4U7UD 4IBNA 1OWXA 1RACB 2DNQA 2B4JA 3AXKA 4KHYA 4CJWA 2VG6A 3B8AX 1RT4A 9ATCB 2AYMA 1SPBP 1IR1A 3BGRA 3M8QA 4YOTA 4G9ZA 5BYQA 2WONB 2RHQB 4JI7F 2G13A 3I56S 1IVZA 4DV4F 1UJ4A 4ES3A 3FDSA 1DARA 3MR7A 5DM7Q 4CFBA 3GSIA 5G0RB 1SAZA 5CH7B 4NL5A 2V4JB 3CJTA 1KXPA 1CJKB 4WP3A 2XMKA 1T3NA 2P5OA 5HK4A 4ZA1A 2Q66A 1WN7A 3HP6A 2GV1A 3PJWA 1V3RA 3AV9A 2C42A 2YKQA 2W1BA 3DLRA 3TSUA 4H54A 3G4SN 1Q9XA 1N33K 1YGYA 4ZPAA 3EZ5A 2I38A 1CQNA 1M5VC 3MM8B 1S0OA 1RTHB 3OTOF 4LSNA 4F0HA 1TR0A 2IIHA 2KFYA 1PILA 4CHNA 4DX7A 3ULHA 4HH1A 1RWXB 2IC3A 5KFOA 3CCSN 4KO0A 2W2PP 1XHXA 2CQ2A 2FUG9 4MTPA 5GAHI 4F4XA 2G8IA 1QSLA 1JLCA 2JLEA 5LL6Z 4BY9C 2AJQA 3O4NA 2MJNA 2C3MA 3VAHA 4K43A 3NNAA 2P8IA 2EC0A 1QZ5A 3SBGA 2EK6A 4NLWA 1N36J 4DU1A 4I6AA 1FXLA 2MY8A 1T8EA 3D3CJ 4DFMA 2WUSA 4A8SA 5AQOA 5DRKA 4Z2XA 5HRSA 3QO9B 2HRYA 1FVSA 3CJ0A 3KG0A 4QBUA 4CIEA 4H0YB 4CT9A 2J8AA 5D78A 5BR9A 4GKKK 5THWA 2D3UA 3J80U 4F04B 4M5DB 2HIYA 1U2FA 4ZVQB 5DJBA 3TVKA 3TA0A 2PYLA 1ZA1B 2POKA 4OX7A 4DF4A 2P1JA 4QJVA 4W4MA 1U04A 4RO0A 1ASVA 1Z26A 2CZVC 2ZUAA 4DV0J 1YKWA 2AKWB 2F9JA 3AVJA 3TAGA 1WNSA 4DMNA 3THXA 3IMQJ 1NJIT 3M6WA 3X1LB 4YOXA 3TUIC 1FXXA 1JJ2M 3KZBA 4DR1F 1Z1ZA 1VR6A 4DL2A 2Z1JA 3QIOA 4DKWA 1WJ9A 5M1FA 5M1NA 4JKCA 1G3OA 2NLWA 4G1PA 2YY3A 2XC9A 2XMWA 2VQEK 3CCWA 3N9UC 3FUYA 3CCRS 4IO1A 4P10A 1V3SA 4ZK7M 2XGQA 1X9SA 4E7KA 4R5PA 4XO0A 2O8EA 4FPAA 1EQMA 2IVNA 2AYBA 3D0GE 1U45A 1AROP 2NR0A 4DPYA 4P73A 1CG2A 1TAUA 2A1SA 3R3LA 2OZMA 4DU3A 5KOXA 2O67A 4OI0A 4DL3A 1YLXA 2K06A 4AL5A 1VQ7N 1EKEA 3S9HA 3OFHA 2V7YA 1I3AA 2QTDA 3X3UA 5H9FJ 4OYBA 2QIFA 1X3NA 3KK2A 4B1VA 2UUAF 4FJKA 5D3GB 2FC0A 1U47A 4DHVA 3BUZB 4M95A 2IY5B 1U1PA 4HI2A 3AVLA 1S10A 1TFYA 1X0FA 4EYIB 1SXLA 3AGKA 3AA2A 1DAXA 3TW0A 5ETRA 3HSJA 1NGCA 2LEAA 3IWLA 3UDLA 4DR6K 1N4LA 2LXUA 2ZVIA 4DV3K 1XNQF 4Y65A 3QYYA 1NDLA 3UFCX 1Q18A 4AHTA 1J6ZA 3OYLA 3CD0A 2HHUA 3T1YF 1B9FA 1QHAA 4A5AA 4WQ4A 3SBMA 3A13A 2V8VA 5DZ6A 2YNFA 1IQZA 2LLZA 4X64F 5IOLA 4I6MB 4QS9A 4CFAA 1GX5A 4YB7A 3EXCX 2OHDA 4NLQA 1Y9OA 5IC4B 3B4DA 1YJ9N 3F73A 2UVUA 2MY7A 1T9XA 4AQYK 1AFJA 2KJWA 4JI3K 2C2NA 1IKYB 1WSEA 1CJTB 4YOWA 1HJRA 3SUQA 3T6JA 2W42A 3VEVA 4PQUA 4O3NA 2HS0A 1QUPA 1WOOA 3NDKA 2A0FB 3TU5A 4KHPF 2Z56B 3BBCA 3N5FA 4CHOA 3MZIA 3A3OB 4KB7A 4M42A 4X4NA 3D6RA 4CZFA 3MN9A 4FM0A 4EGLA 2DR5A 1RKJA 2K1RA 3C6TB 1OH6A 2V5HG 3CCTA 3NMAA 1H2TZ 3NVMA 4CGIA 2W25A 3SCJE 3CPWR 3SFUA 4P2MA 5AE2A 4BR2A 1H38A 2JEJA 4AHUA 3PYDA 2W7PA 1A5WA 3L8BA 2IAJA 3TAMA 3HOTA 5CD4H 1F9EB 2FVCA 4FNHA 1SJ1A 2FLLA 3D54A 1HR0J 4HUGA 2M5YA 1ITPA 4J2EA 1IBLK 4DL7A 4BBYA 3FEZA 5KFPA 4U7UK 1HBOA 2IS3A 3CIZA 4BE1A 4BE2A 4HH0A 4I6YA 2CNLB 3KLVA 4DTSA 2OJ3A 3WNEA 3WDOA 3MFIA 4XTTA 1ELOA 3BSOA 2OZSA 2BTFA 4YDDB 4JI1K 1QM9A 4MFBB 3VGKA 2X1BA 5KFZA 1S6QA 3CJQA 3NBPB 3MAHA 3CJKA 2AJ1A 4F36A 2MKCA 5B08A 3UNYA 4E8UA 4MKYA 3KHHA 5A2QY 2P9SA 3HD1A 2LFVA 1BI4B 5FPNA 2YQ1A 5AQZA 4ECYA 1T3OA 3F56A 3H20A 4JI8J 4EO6A 4OYAA 2RSQA 1RAGB 2HGNA 4TXSA 3ASMA 2UVWA 1EX8A 3W63A 3VQTA 5G0RA 1VC0A 1YJRA 1S77D 1YVUA 4CJVA 5KFVA 3QATA 3AVGA 2FJXA 4H0PA 3SUOA 3ZTOA 2GC8A 1JJ4A 4CLYA 5HI7A 1EP4A 2EVZA 5D6GA 2CPYA 2ASJA 4CO5A 5I3PA 1U1LA 2AJ0A 4DXLA 1N5YB 3M2VA 1RADB 1VISA 4ZOSA 3EE8A 3ELHA 4OZJA 3AJ1A 4FP9A 2JX2A 3I55S 1T3VA 1U1KA 1UZHA 2Q36A 3FVYA 4LBPA 1XR7A 1Y64A 3KD5E 4CLUA 3HHLD 3CMAN 2BQRA 4USUA 2OGUA 3ULEA 3HSCA 2CFXA 4JKGA 4WZMA 1ZC6A 4MKAA 3LZJA 2HWTA 2NZ4A 3BJYA 5HVFA 1BWVA 1S9FA 2LDYA 3LPYA 4PEOA 1VSIA 2F4VK 2R2RA 4DV7J 4KO0B 2KO1A 2E9TA 1QS4A 3V2UC 1CJVA 2WOMB 1S3XA 2NXUA 3ZSQA 3DRYA 2FLPA 2HQCA 4CNYA 2CQBA 3QRQA 3PYEA 2ZKUA 3PHTA 3DXBA 3CWJA 5BRFA 2Y1LB 4HL9A 3MM7B 1NKEA 1UW9A 2B4VA 3VQ5A 3EPIA 2ZJQQ 3U9DA 1VQKS 3MM8A 4IR1A 5I3QA 1U2VA 2E9RX 2CNKB 2O8CA 1CEZA 3MN6A 2JGUA 3WXIA 4QU7A 1S0NA 1RCXB 2DNPA 3ILOA 4ANDA 3JB9k 1HBUB 4GVEA 1BDGA 4IEIA 3FRZA 3VAJA 2FBXA 1Y7PA 1ZS6A 1HBOB 1TV6B 3SCXA 3TJ9A 4M3YA 3CCMN 4OHZA 2L9NA 4FWRA 4GNIA 2CNNB 4FXWA 1RA6A 5IT4A 3RMDA 4CYUB 1RILA 2F8TA 1RBLA 3MEEA 1FKOA 5HRPA 1LOUA 3R1LA 3UR3C 2RKIA 4KH5A 4B9QA 1DTQB 5J2NA 2M7SA 2DNOA 1WD6A 2AEJA 1M1HA 2B9XA 2AP6A 2RQCA 3FSYA 3LUYA 4H4MB 5K9FA 2HB5A 3VHQA 4CJ5A 5T7LB 5KQ8A 1IG9A 5ETKA 4Z37A 3AVIA 2X6SA 3FC9A 5C0YA 2UU9F 2PD1A 1IBMF 2KFNA 3ZZPA 2MZTA 2L9WA 2Z8QA 1RAIB 1KVIA 4JLHA 3D2EA 5AQPA 3ZZRA 2PFDA 1S7IA 4NMXA 3VZHA 3HPOA 1NJYA 4LIWA 3OD2A 4A8KA 1FKOB 4OX6A 3GILA 1R8HA 4FWSA 3Q8UA 4BG8A 2CJBA 3J81j 3K0JA 3W64A 1N32K 4DUTA 1LEOA 2Q1NA 1J5OB 2DHGA 3PX6A 1VQSA 1UVLA 5JUMA 3MPUB 2HNDB 1XJWB 3G6YA 2HHVA 2XO6A 5D15A 3VV2B 3CCLS 3OVBA 1CJUA 1HPZA 3R6MA 3HP9A 4W5RA 2QL5B 1RWNB 2RB7A 4DB3A 2QJ3A 1IJEB 1RGIA 4WE1A 2DYAA 3GU0A 4LSZB 3KMSA 2QA4N 5CZ1A 3BKUA 3LP3A 1TVRA 5I42A 4CBWA 2BW7A 2HBZB 3I4HX 3N6LA 4O8KA 3B6OA 2GJ2A 4F0KA 4USIA 3TAFA 2BACA 3NAEA 4KGZB 4Y6IA 3J7YP 2F4VJ 3RG6A 1Q8LA 2DFHA 3QLHA 3OA9A 2V6AA 3M4XA 4B1WB 2V4QA 2B8PA 4RUHA 3RJMB 4CI6A 4B9MA 3CC7N 3H40A 1JLAB 4J9NA 5JLHA 2L08A 4RW4B 2DVIA 3OSNA 1KVBA 5K8MA 1NPRA 3QZ7A 4IG0B 3WBZA 4CECA 1LW2A 2YHYA 1SKSA 1X4DA 1F0XA 4OLAA 3HM8A 2OPSB 1M90O 2CGLA 5E5NA 1VQ8N 2ASPA 3IA0A 1JXBA 1S59A 1W0HA 3VQPA 2V7ZA 2C3OA 3IR6B 1NKCA 2UXBJ 3LOUA 2QT7A 3HLUA 3KJQB 5LSRA 4E0DA 4C1NI 1TL3B 2FC8A 2IMWP 4B3MF 1FE4A 5A6PA 1Y11A 2BKPA 1RDAA 1JIHA 2M2BA 4O0NA 1H74A 5C10A 3GG4A 4L3NA 3ZT1A 4KREA 1LWEA 4F7VA 3P45B 3QFPA 3GJQB 2A42A 2Z1IA 4TQSA 2X51A 5DDQC 4I7FA 1FKPB 1SIWB 5A8KA 2XMUA 1QD1A 1T05B 3DXMA 1SJ4P 4R79A 3IG1B 2YJEA 1AFIA 1KVKA 3FCWA 1EQYA 3E01A 1S49A 3ZSYA 4DV6J 3BF4A 3ETMA 5E26A 4CEDA 3I0SB 1FWPA 4LF6F 4D3GA 2IVMA 5EU7A 1O6XA 2BJ9A 4RZRA 3TAQA 5K14A 4PWUA 5L39A 4J9VA 1SKWA 4LFAK 3MTKA 2ASDA 1BQMB 2EK1A 4KGVB 4O3RA 4BLGA 3GMGA 4FM2A 3AVFA 3OBYA 3DRRA 1WLJA 4TYBA 3DFEA 1FESA 3PVXA 4TVAB 2NPFA 2VUGA 5I4MA 3MUTP 3DRSB 3PJ9A 4B3TJ 3VF6A 2XS2A 3QPIA 5ETVA 2VG5A 1NZ8A 4OJRA 1WHWA 2HAIA 5HQLA 1HYSB 1Q53A 1XC9A 3U8XA 3U02A 2DHXA 2GJIA 2BRKA 3H45C 1RDWX 3AO1A 5L1IA 2NYIA 3OL8A 5SZTA 1RDRA 4X62K 2VOOA 3DGVA 4GVLA 2D0BA 2LCWA 3EE3A 4JKHA 3DYAB 2WTFA 3L2WA 3HSTB 1AUSL 3DOKB 3MMBA 3SJJA 2KYZA 3P5TL 4MIWA 3Q0AA 3MXJA 1BUPA 2UVRA 1FTRA 4OHXA 5D4PA 4JI8F 3M6VA 2A10A 1PYSB 4FLXA 3NH0A 4DR4K 1BQMA 3G96A 4NXMK 3O2IA 1RHRB 3UKUB 1REGX 1RYRA 3K8VA 1IN0A 1YJ9S 4OV6A 1V5VA 4WFYA 5J2MA 3OW2M 3B78A 1J54A 3PIOL 3J80O 4DUYK 3MMAB 3BP8A 3MWBA 3DLJA 2ZM6J 4QR2A 5D0EA 2FBTA 4C8NA 2J0XA 1KLMA 4NLVA 2M70A 2E6LA 3H1VX 1NSQA 4HKQA 2W7OA 2R8GA 4KRWA 3BH6B 4A48A 1QTNB 3OR1A 4FS1A 3MK6A 4KH0B 1ZBHA 3HD2A 4YR0A 3L2VA 4IKFA 2C2KB 1IKWB 4L76A 1KQSM 3GJTB 5JICA 3NP5A 4JI2F 2OO4A 4YFUA 4USJC 2EEYA 3SSSA 3KKFA 2ASOA 3TSPA 2XSFA 4J9KA 2QFJA 3W61A 3D2FA 2XSJB 3QDKA 4Z4GA 4E7JA 4QU6A 3QO9A 4ZJOA 2XSJA 5AQFA 4P74A 4QS7A 2LXIA 1VAZA 1WOSA 4ZPVR 5CR4A 3EY1A 1FHTA 3P5JA 4KRFA 2P9UA 3GL1A 3SQGA 3KYLA 1XMQK 4DUYF 3LGHA 2VPXB 4BR5A 1SQEA 3US5A 4DTXA 2QWMA 2DEJA 3KFWX 5A2QU 3I6PA 2GWJA 4TN2A 4PKGA 1CS4B 2FSJA 3QBXA 1C1AA 3OYJA 2A41A 3FJ2A 4RG8A 4DU4A 4NCBA 1NDKA 3QNWB 3MXHP 1RNHA 2OTJN 2LA4A 5CY4A 3OXFA 1XWLA 1HRHA 3UWTA 4XAKA 4PQAA 5BRDA 1UEVA 4YOVA 2MYFA 1Z4UA 2MXYA 5L46A 2DRAA 3D7EO 2H5IB 4FK2A 5AZIA 1VSJA 1NDCA 3MFHA 3Q22A 2BJ1A 4ZVRB 5IWAK 2EKYA 4OZNA 3GIIA 2VWBA 3NGIA 3A3PB 2XMVA 4DS4A 4QS8A 3DMJB 3PW0A 1NGGA 1K44A 4JN4A 3OLBA 3B54A 4ALZA 4JI4J 2R8IA 1Q0NA 1FT8A 3QGHA 1SB6A 3PHEA 1H2VZ 3HHNB 2HMIA 2HFUA 2DB1A 2Q1LA 2NZCA 1LK5A 3H3NO 2KT2A 4CZCA 1SKUB 2NXEA 2ZBIA 2C2OB 3CJ8A 3GZ7A 4FYXB 2JWKA 3L09A 1SV5A 3I0RA 3D0IE 3AO4A 1MWMA 2GS8A 2UUBF 1S9EB 4CGJA 2OEJA 5AE1A 4I4BA 5CAAA 4WCEL 1XK8A 2NXJA 2PO4A 2HLTA 4JI2K 5KT7A 1MDUB 2NRTA 4MDBA 3FZHA 1X4AA 2OPPB 4IFVA 1G6BA 4UUWA 2ZFHA 4LQ9A 2G8WA 3CJ5A 4B3SK 3AY0A 3G71N 2D9PA 3I96A 3MX2A 3ID8A 5C42A 4QIEA 2BE7D 4CYUA 4CO2A 2XTJP 4YS2A 5L38A 3MUMP 1FFGB 1YJUA 4DL0C 3K89A 4L3QA 1JJCB 2VD3A 2J8SA 3TP2A 4H4OB 3RSEB 3V6JA 3K0SA 5F0UA 1S0MA 4OYOA 3MM6B 2M52A 2V4RA 4DR2J 4PWDA 4X4RA 4IG3A 3LDLA 2HMIB 3UW1A 2B9YA 3N4QA 1FERA 3T1AA 2YHWA 3SPYA 1IKXB 4IFYA 5CABA 4RU2A 5KFSA 3L0QA 1EQ0A 3AVBA 4WBFA 3N4WA 3N79A 2LQ8A 3ENQA 2R8KA 4BVOA 3MM7A 3L4QA 5AQHA 3CDBA 3OL7A 3O3FA 3MX5A 3HI0A 1IWGA 1GK8A 3T9NA 3C14A 3MR6A 3NS6A 3JQMA 2WOMA 3LPTA 1G7CB 4MIAA 3R97A 4DV0K 3TABA 2OI2A 1RTZA 1OO0B 4FYVB 2AV5A 4OO1J 5HP1B 1U4BA 1LFPA 2AMCB 3BKFA 5L8RC 3QZ8A 3D68A 2HWIA 2Y8YA 4CZKA 1UVKA 3BDPA 4ELVA 2BVZA 1C0TA 4NCGB 2LMIA 3A5OC 4BS2A 1BLUA 3GCXP 2KZZA 3VQBA 2WCXA 4FKXA 4BRQA 1NHUA 2Q6BA 3P49B 3TX0A 4A57A 3DRPB 1YJTA 4U95A 5L1JA 1VRUA 4CBUA 3VEZA 4OFZA 2PA3A 4I56A 2YWEA 4LFBK 1N88A 5F8IA 5BPLA 2UUWA 3MEDB 1HPMA 3R1XA 4XDDA 3Q86A 4IOCL 2E8AA 4K4SA 4WPAA 3ZNJ1 4IG0A 2XMAA 3K58A 1KWMA 2QYCA 4OPJA 2BUNA 4FJ8A 2CJYB 3QERA 4YEAA 3M6GA 4E7LA 3N6NA 4LF4J 3ZSWA 2MQLA 5DM6L 2M0GB 3FSXA 2GHVC 3QFHA 2VCPA 2O3DA 2HGMA 3ZX3A 4NYNA 2VZ9A 1P8ZA 4CEEA 2F8EX 2KN4A 1RHMB 3CCEN 5KFEA 3MR5A 5M1KA 5AQWA 1HI1A 2GQQA 1H2UX 4ILHA 4KB1A 4CK2A 2MQ8A 4JRQA 2IFXA 1HW9A 3GIJA 3LP1B 4E7HA 1MA9B 2PIIA 3MMVA 4KIAA 2UXCF 2X6NA 2VC0A 3F5TA 3BKTA 2WVCA 4J90A 2CUYA 1RSCA 1U6FA 2DPIA 2GNKA 2ZZTA 1RTIB 1GNKA 1HWJA 3NBPA 1DEJA 4O4RA 4BR7A 3MPYA 3BGFA 2EXUA 5HBMB 3L4BC 3PIPQ 4DR1K 3TAMB 4HI1A 4PL8A 3ZT2A 3PYFA 4TNOA 5E3CA 3WC0A 2JSXA 1O5JA 3W60A 1NAQA 5FLXO 1UTAA 2UU9J 1WC5A 4Y2AA 4WQ5A 3MHYA 5F3ZA 2ASLA 3ZSXA 4CJTA 1PC5A 3CCMS 2M9KA 3J81O 1R31A 1YBUA 3HFKA 3OR2B 1HNWK 3EJMA 4LF5F 4OHYA 5A8WB 1VQ8S 4FJGA 4ED1A 3FZFA 2DFFA 1RHKB 2JJ4D 3L7PA 2BABA 2ZH8A 2JL9A 1T44A 3MCNA 2MMYA 2VG6B 4IKAA 1KCFA 3ONQA 5BPNA 2DH9A 3KJVA 1Q4RA 1XNQK 4B9LA 4EZ6A 4EBCA 3EVWA 2ZZMA 4LF9F 2I1RA 4ZP7A 2NREA 2CXEA 2V8HA 1MMDA 1I94J 2GQCA 3PRBA 2DFEA 2G8VA 4IXCA 3RRHA 2MKSA 2GIFA 1IBKF 5M1QA 1DTTB 1ZAWA 2UXDF 4WIQA 3DOMA 5C5JA 4E1JA 4PXDA 5JS2A 2B7BB 2UV8G 4WTOB 1JNZB 1FDDA 4FS2A 4RW6B 3KUGA 3CXCM 2XBPA 3EICA 1NM2A 4B08A 3RBDA 1HKAA 4DZDA 2IDEA 2E5HA 5EX3A 4DTOA 3GV7B 5DLGA 2MEWA 2JEGA 1VMBA 2VH7A 4ITSA 3M8RA 2XEXA 3C8YA 3POTB 2XWXA 1U2VB 3AA8A 3NEKA 3IUCA 4IG3B 4DU7A 4MO4A 3KLEA 1XNQJ 2YWFA 3CCJS 2VJUA 3AFGA 1YTAA 3E66A 1FE0A 4ERDA 3VQ4A 1HFEL 3LALA 4OYXA 1N32J 4BRDA 2DITA 5HAOA 2VQFJ 4YB6A 3GV5B 2WTUA 4FF4A 3BV8A 1C0UB 3VENA 1TL3A 2KRBA 3JQJA 4YDUA 3RMAA 2QO3A 4QWCA 1J5EK 1CZ9A 1HBNA 1SC4B 4CJLA 4JI8K 3LDQA 1NPPA 2DNRA 2NRZA 2MSTA 2Q0UA 4ILJA 4CK3A 1NJXA 3ZT3A 2Q0RA 3CDEA 1U48A 4PZVA 4O4GB 1S1XB 1RU2A 2J9CA 3OVSA 1NGEA 1PAEX 1FJGJ 4C0HA 4QIWD 3D2FB 1VHFA 3KD1E 3RB4A 5K5MA 3MWTA 3CO0P 3V4IB 3S01A 4WCEQ 2G1DA 3C66A 3LP0B 1RI7A 1N34J 1NBWA 2ZEJA 1WHVA 1UAXA 5LSOA 1LWCB 4AD6A 2ZH4A 4GKJF 2GVDA 1WB9A 1MWKA 3Q8RB 1YHQN 5GAGP 3W65A 3A8YA 2QV6A 1S12A 1O1WA 1IO2A 3WNGA 3BZCA 1KFSA 1UW4A 4HHTA 1VIOA 3FZMA 3E8OA 4N41A 2LQJA 1RBRA 4MDAA 3TR8A 3LL3A 1T11A 2GA7A 3W2WB 3D45A 2G8UA 5AQGA 1RKIA 4B3MJ 4OX9K 3O08A 1VQKN 4U9RA 3AO2A 4C8ZA 4PWDB 3U3GA 2N4CA 3B82A 1VK3A 4IZ9A 2QI2A 1K73O 1FFSB 4HHUA 4WK3A 4NEYA 1VYAA 2D74B 1BWFO 2NLXA 4KSEB 3QT6A 2X78A 4FWNA 4AT1B 2E6MA 3VGLA 4JKDA 2HNYB 1MN9A 4ZVFA 2MQMA 4FBTA 4D3HA 3VQAA 4NI2B 2P9IA 3PDNA 5K8NA 4BC9A 2CJAA 2E1ZA 1S7HA 3CJ7A 3NNHA 4AXJA 1EWRA 4H4KA 1JLBA 4FYWB 4FOIA 3CJAA 3G8SA 4DSIA 2E7WA 3VWSA 2W9BA 4PQUB 3FRYA 1H0HB 2WVFA 4NLBA 1RT2A 4GO5X 2OTJS 4FK4A 4CZLA 3OYGA 1WUUA 1BOTO 1ICEB 2E1AA 2BGGA 1K0VA 2VIHA 1RHUB 3DKDA 3KUHA 4K2XA 5GAGI 5D0RA 2I2YA 4EHUA 3TSQA 4H5TA 5J2QB 2BANA 1L3VA 3CD6S 3ZO7A 4ANEA 1ZYQA 3AAPA 2X7IA 4CEZA 2RD5C 2QSFA 1GX6A 4F67A 2J0QD 1GLJO 3JTOA 4AXIA 3KDOA 2JZ5A 2D4WA 4JI2J 2LECA 5ITHA 4B3TK 3D66A 2O8BA 4YOYA 1PBAA 4HT5A 5EWFA 2CQPA 4A46A 4CEFA 5AZJB 5LXYA 3SI8A 2VWJA 3OVNA 3S6EA 1S72S 5HMWA 2HMPA 3A8KA 2GHWA 3W8PA 2EFVA 2D3O1 3R5BA 2DGTA 1P8GA 2JH3A 4HTIA 2W2MP 4DR4J 4CIFA 2FHOB 3VQ9A 2RHSB 3A1YG 5GAHU 5CYQB 1VHIA 4G1QB 4FW1A 3S3OA 3F9MA 3ILLA 3MEDA 2IBKA 2O4GA 3WEEB 1RAHB 4DQIA 1RTJB 1VQ9N 1NK4A 2OPQB 2EHGA 3TEGA 2I7NA 3EO3A 2RIJA 3R8EA 2EWSA 3UVJA 2JEIA 1JCFA 3WX8A 2K8GA 2FC9A 1OY9A 4LF1A 1HHTP 3FKBA 3M32B 2KG0A 4MIBA 1EX4A 4CZMA 2PA8D 1IQTA 4FN5A 2DGVA 3CQYA 2B6AA 1KVAA 3IBCB 3S7RA 3AO5A 3OS1A 2YH0A 2CQDA 2CGJA 3J7AN 2HHQA 3OFFA 1EO1A 3SI6A 1C1BA 5LMUK 3F44A 4OZ1A 2RDJA 5BRHA 3Q89A 4JHDA 3OTCA 3O6WA 2F9DA 1GQEA 4HR2A 1QQMA 3SFGA 2VQFF 2Q79A 2UXDK 4U96A 3KTQA 2L48A 3T9ZA 2EBGA 2VG7B 4DQSA 3DRXA 5ETOA 4P71A 1R0CB 3WIUA 3L6QA 3JSMB 4NA3A 4WF9Q 4DQRA 2X3DA 1VC5A 3ENWA 4YORA 4I64A 3DC2A 4ED7A 4B1YB 1MU2B 4UOFA 5IXUA 1IV0A 4MLEA 3QNNA 1CULB 2ZJPL 4CLPA 1C1BB 1WEXA 1QDUB 1EWQA 2OPRB 2AW0A 3CF5Q 2E5JA 5L9XA 1T95A 4RTFD 2YNIA 2IRXA 3NNCA 3MR3A 3I9ZA 4RUAA 4OHVA 3I33A 4ZVHA 2QK9A 1TKDA 1OH5A 3SBTA 1NKBA 1FXRA 2GUPA 2PMHA 3A4TA 2D0OA 2R7SA 2YPZA 3QESA 4ELTA 2N7CA 2LQ9A 3ZZYA 2W01A 1FJ7A 3D6MB 2HK2A 4XPEA 3DJCA 4ISGA 2V8DA 6AT1B 4KHWA 1QVFM 4B02A 1IXKA 1U0SA 4UW2A 4RWXA 1RE1B 2GBZA 2I0XA 2D5RA 1S9GB 5EX5A 1XC3A 4GW6A 2XG8A 3R5GA 3H1QA 2HFZA 2ZNZA 1R3NA 3NF6A 3DRRB 1U1MA 1UWBB 1VSDA 4M94A 5EWEA 5TKYA 2AF6A 1WOPA 3O3HA 2WVBA 1RQ0A 3CQXA 4CTAA 5HATA 3C6UB 1OPIA 2VQEJ 1TUVA 4CLLA 3HKWA 4QPTA 4RJVA 1HKCA 4ZMMA 1FNMA 4FJLA 1U2CA 3AHPA 1VQLS 4GKJK 1SC1B 2KT3A 3M30B 1RT1B 3ATUA 3PEHA 4ZVOB 3C16A 1XEZA 4MK9A 1ZTWA 3M6UA 3LWLA 4CE9A 2GGPA 4CH1A 2ZC3A 4DV6F 3PG9A 4G3IA 4C9DA 4CJEA 3V9SA 3MTJA 4A47A 3HHEA 2XHWA 1VQ5N 2DGQA 3EE9A 3HM9A 1NSPA 1VBYA 1N5SA 1TAQA 2VPWB 4EP4A 3WQTA 4JI1F 1G2EA 4I9LA 3ZYYX 3EEQA 1WEZA 2NSBA 2PSZA 2PYJA 3CVKA 4DV2J 1R0AA 2OLWA 2PEBA 2DGWA 1SZ2A 4ZTFA 4OMFG 4K59A 5CZ2A 5CE3A 2KKHA 3KWMA 1EIYB 3U6FA 3TWHA 4FF3A 1BISA 1A6LA 1KTQA 2BE2B 3NWRA 4IQMA 3QEVA 3P96A 4JV2A 3SPZA 1ATRA 4FYYB 2QN6B 1CLQA 2E7XA 2ZBRA 4DR5F 2F3JA 4OI3A 2XCAA 2QLFB 2MQNA 4W5NA 2KB2A 4CO4A 3BYRA 1WSRA 3MPVA 4LF7K 4BRPA 2P5VA 3ISND 4IO9L 2GAGC 5KFUA 3VF4A 5C7PA 4U67L 1OY8A 4I2PA 2HIQA 2L3MA 4LFCJ 4USWA 1B92A 1NGHA 3PO4A 4B9VA 4Q8FA 2YHBA 4DUZK 5IWAF 1HYZA 1X9WA 1P9QC 5JVGQ 1IBMJ 4BE0A 3O3LA 2Q97A 3I4PA 1RDBA 1V5IB 3ZTPA 4UOGA 1IUJA 5CA5A 2EFGA 3PTWA 3CCVS 4UF4A 2HSTA 1AYEA 2ABYA 2HW3A 5LJ5Y 5LMNF 3CCQN 4H4KC 2B4OA 1NUEA 2WSFC 1SH2A 1IJFB 2FLNA 5F8JA 3SQOP 3UR0A 2CZ4A 4CLFA 4IDKB 3P3DA 5HJXA 3KVGA 3WUHA 3KHYA 3CM5A 1PG5B 5F41A 3D6TB 2RMLA 1M5KC 1YX2A 5AQLA 1SH3A 2GVDB 2H5EA 5F1XA 2HLUA 3VQ6A 3QEPA 1A7GE 4FJ7A 5U47A 2XYGB 3TUZC 2UUCF 2CQIA 1S6PA 3DLBA 2XLJA 5EOYA 1U24A 1RT3B 3T69A 2VHGA 3UE2A 3T5JA 4KFBB 1JJ2R 3NF8A 4C8MA 3HF5A 2DTUA 4ZHRA 2IJFA 2E5LF 1FO1A 3CC4N 1JLBB 3KK3A 4PHTX 3R5AA 5FD1A 4DL5A 4BRAA 3THWA 4E1NA 5E3PA 4CLZA 1Q7YO 3ILIA 1D0EA 1P6TA 1WC0A 2LU1A 4M5HA 4PPZA 4H4MA 3ZZOA 3KLIB 4CWBA 4WFZA 5KQDA 2HNYA 4W92B 2DGOA 3TTFA 4ZLNA 2RPIA 3HVRA 4GV9A 4JI4K 4QIGA 4ZDNA 2VGNA 5CYQA 2HK3A 3D5MA 2HBRB 4CJFA 5A8RA 4GY2B 2EC2A 4QW8A 3H6EA 1ZBFA 1J9AA 4DSJA 3SDEA 4OI4A 1DBDA 4EZ9A 5MAOA 2FQQB 1TUUA 3CJ9A 2QA4S 3GFHA 3CPEA 3GYXB 3W66A 5B0EA 4Z7CA 4Q0BB 1O8BA 2DNHA 3UDVA 4ZVPB 2YWWA 3V5RA 1WBBA 4J7CA 3C14B 3SV3A 3E51A 4WK1A 4JHDB 2XRIA 3BO4A 4ZN3A 1XNRK 3G8TA 2FHMA 5AJ3K 4C98A 1LWXA 4AM6A 1Q81O 4YY3K 3NY0A 2ZHBA 1A0OB 4DR2K 1SC3B 4C8OA 1IH7A 4B3SF 3GFZA 2MKJA 4CO1A 4YQWA 4NEZA 2NXCA 3D28A 1OYEA 1C2PA 1H72C 5AQJA 1DQ9A 4DCPB 2W9CA 1VQNS 1U1NA 4JI6K 2QLBB 3FGUA 2I5JB 3BZQA 4GRSA 5IM0B 3ULDA 4MMOA 4F25A 1GLDG 3CDUA 2W4DA 3P38A 1H7XA 1LKZA 5LMNJ 3TRGA 1GOAA 2DNGA 3QAEA 4IJNA 4LF8K 1YJWN 3GG0A 3V6HA 1ZBTA 1HUXA 1S1TB 4DR5J 3QJPA 4OX8A 1RTJA 3R6GB 1HQUB 1WWHA 3KG4A 3AARA 2COLA 1YJNS 1HI0P 2NUHA 3IS9B 4OYPA 4KFBA 2DRDA 1TMMA 4KBIA 3DRSA 1S1WB 1HWKA 3NKYA 3QMQA 4B3TF 2Z2ZA 3IP0A 1VQ4N 1C1CA 3I0RB 1PIEA 1IJJA 4PG5A 4RBUA 3VAFA 1R6YA 2MGZA 2O66A 3NGDA 4I0WA 3LP2B 1UVJA 1M1KT 2B43A 4BGBA 3GJRB 3JSMA 1TELA 4FPRA 1KNZA 4IRKA 2QWOA 2QXFA 1VQMS 1F5AA 3AOCA 2FBVA 4RW9B 4MYUA 1VFJA 2O5DA 4P2FA 3FFKB 3UQSA 2DNKA 2RDDA 5AXNA 3NGZA 1S6QB 1M0SA 2VFSA 4AHSA 1ZM3A 4RNNA 3V9UA 2RILA 3C0BA 1HMVB 2FVQA 4M5KA 3AA3A 5AFUH 4M3ZA 3SSQA 2G2YA 4WQ5C 4CLSA 1NGBA 1M5OC 3Q8YA 5KFGA 3RBXA 3A12A 2OP5A 4QYRA 4IR9A 4S0MA 1T6DA 3RGIA 3E9OA 5D77A 4ZVTB 1ZPVA 5L9NA 1HBMA 5DZ7A 4FJJA 1RT7A 2QXLA 2D69A 4OZ2A 4NA2A 3VVUA 1PAUB 4RW8B 2WVDA 4TLQA 3MGJA 2DH8A 2KRRA 2ZWOA 2DHSA 3M8PB 2E1CA 1RT4B 1VQLN 5EN1A 2HVZA 1OSCA 3Q8QB 3DAWA 2V52B 1BUXA 1R59O 5T7BA 2HVDA 3OS2A 1S6PB 3B6PA 1UJ6A 2A5XA 2Q31A 3OYMA 1KN6A 3VQEA 3DLKA 2NSCA 3WHIA 3QMLA 2VA2A 4Y1DA 1N5TA 1MU2A 2JWLA 4F0MA 4O8UA 5KFAA 3C94A 4KHPJ 5LJWA 3CEDA 1SQGA 3GIRA 4J9OA 1Y0HA 4ZIWA 2R7WA 1HQ2A 1X4FA 1W2IA 3BQ0A 2MZJA 1SCJB 4JI0F 4X62F 4DQPA 4RNOA 1WF2A 4AHVA 4CZJA 3K5NA 4LBHA 1U8SA 3N01A 2X1GA 4USTA 3C6HA 2FF6A 3QNOA 3P8BB 1HNXK 3NGSA 1DKGD 4USVA 4DL4A 2DR8A 2DHAA 2V4JA 2FF3B 2RQMA 1S1VA 2DNZA 3D1OA 3R2CJ 1OH7A 4C11A 3QFUA 1IWAA 4F4YA 5ADXH 3HDSA 3A8JA 3WIVA 2HGLA 4Z0UA 1NGAA 1SQKA 2E66A 3EZOA 2XMJA 1PGZA 1RYSA 1BA0A 3VZIA 4A8QA 2UXBK 2KG1A 5KG6A 4TY8B 3SEOA 1D1UA 1F2HA 5GADI 4BWMA 1KQGB 1HYVA 1S5JA 4CHPA 5CCMA 1QVFR 3FEXB 4ANCA 1MWYA 5ADXA 3U3YA 4AL6A 3HHLB 3CCUS 3NHGA 4L8RB 1DTQA 3CCQS 4RW7A 2ZD1B 1VQ9S 3CFPA 4PYAA 3ID6A 2U2FA 2AWZA 4UT4A 1HYSA 3MM5B 4DLGA 4ECXA 2A40A 1XNRF 1UEUA 3HOSA 5J2PA 2V2ZA 4CJQA 3AQPA 3OR2A 1D8ZA 4DV1J 1OKJA 1NH8A 1KQKA 1TK8A 3CCJN 1TP7A 2BOAA 4YY3J 2MLZA 3MPDA 2UYTA 4RBVA 2OFGX 5IZHA 3ZXWA 3QAUA 5KG3A 1K8KB 3DLGA 5AXKA 2CGKA 1JLQB 5ADZA 2WZ1A 2A18A 3H59A 2CWXA 4E89A 2BJEA 1OQ3A 2PDAA 4XH1A 2QM1A 3FNNA 4OVLA 2BANB 4RW6A 4B9TA 4TU7A 1PC4A 5FIIA 2LDIA 4WZQA 4BRHA 4EP5A 1E3MA 5KFHA 2ZZNA 3T1HK 3P5BP 4JI5K 4NZ6A 4DQ8A 3BEGB 2QWQA 3RR7A 3KIOA 4K5SA 1U02A 1S57A 4Q43A 3KXDA 2GX9A 1RWWB 3M8WA 2ZJRQ 4FWQA 1WSIA 1YHQS 4HACA 4C8LA 1GOCA 2NCKL 3MAAB 4FF1A 2HQDA 1LWFB 3OYEA 4J9PA 4F9OA 2ZJRL 1QAIA 2J9EA 1WDDA 3CFRA 1S4FA 5IWAJ 5BXIA 1XHZA 1NO8A 5ETNA 3WEEA 3WQUA 2XGPA 1YTYA 4OGEA 4GV6A 3PEJA 1VRQC 3THWB 2UUBJ 2HHPA 3QBCA 5B0GA 3HVTA 1DQAA 4LF7F 3NS5A 1T94A 3HTVA 1N48A 3BYPA 3MPWA 5F9NA 2FTRA 3CJ3A 2MPUA 2C2DA 1B99A 4NCAA 5JS1A 3CJ4A 3G82A 2N3OA 1RT6A 3AVNA 3IM9A 3ZFVA 5HMYA 4CF1A 1CJTA 2AEMA 2ALYB 2NS1B 2I6WA 2B0GA 2QW9A 4OYMA 4OV1A 1N0UA 5HLFB 2VV5A 1HNIB 2ZWHA 1FEEA 3PRDA 3M7VA 1WKLA 4CIOA 5M1PA 1BHLA 3A5LC 4HTUA 1UFLA 4ATNA 3Q2TC 2NRRA 2ATCB 3OL6A 4AQYF 3FBFA 4IOBA 1R0BG 3ENOA 4OJHA 4A2AA 3W2VB 2V63A 3CDAA 2QEXS 2DGSA 4P72A 4B3SJ 4ID8A 3L2UA 1CJKA 4ZLLA 3TZYA 2CG8A 3MI7X 2NUUG 3I56N 4P7VA 4UOCA 1LAWA 3Q8PB 4F50A 4BRLA 5KFQA 3VVTA 1N5VA 1VBZA 3BH7B 2MTLA 1A5VA 2P9LB 3VEYA 4Z4IA 1HNWF 1AZSA 5AQVA 2K2PA 5KI6A 4ES2A 2EX3A 4AILC 2CQ0A 5AQYA 5JVHL 2GUIA 4RU9A 4A8MP 3MD3A 3QJLA 1LOTB 4J9MA 4AFFA 2KXNB 2ZBQA 3HPGA 5C42B 2V2KA 4KQZA 1YI2N 2PT0A 1ZAXA 5JVHQ 2QX0A 3IC1A 2FZCB 3CI5A 4B8AB 1Y5IB 3TEHB 1FDNA 4IH7A 3ILJA 1M1GA 4JI6J 5GAGU 3SQ2A 4FJ5A 4BCAA 1YVFA 1YIJS 4M45A 5AQSA 3O4QA 1ATSA 4XK8C 1LAVA 1VSHA 1JQGA 1VSKA 1DT9A 1Q8IA 2CIMA 4L74A 4KV8A 2ZH7A 1IBKJ 2O8DB 1OIAA 2NZTA 4H8KA 3DXKB 3CJCA 1TKTA 4P2XA 4Q2LA 3IAS9 4JV1A 2JC1A 2E1PA 2P9KB 1BC6A 2HNZA 2BJ3A 2KFZA 1GEHA 2FGOA 4DG1B 3TA2A 3ISNC 3MXMA 3G86A 3D6HB 1FX4A 3M1FA 3KLGB 5J2QA 1RT5B 4DPOA 3EXYA 4C0OC 4Q0BA 5FRNA 2OUGA 5EGYA 1K47A 2WSEC 4NLGA 2XZDB 4C1NK 3N6MA 1V3ZA 1HKBA 3CGIA 3TAPA 4JI1J 3CJBA 1UCNA 1MROA 1BL3A 2WFBA 4JI0J 4IOAQ 1G99A 4ZCMA 2J9DA 4YR2A 3EPGA 4FZYA 4NXNK 4EI2A 2ROEA 2F1FA 1NHVA 3GCWP 5A0YB 1RABB 4LUBA 1XNRJ 4C4WA 4DPXA 1RDDA 4LF9J 4XEIA 3M8QB 4OGCA 1VLYA 3IBFB 4RW7B 3IM8A 1HHQA 4O3OA 4ZJLA 3MMCB 3C15A 3JAMU 1WF1A 4KGMA 4TU9A 5AR0A 2BKNA 4F4AA 3C65A 2UXDJ 4URQU 2E5IA 2KVQE 4KR0B 2GMLA 3VCDA 3AOBA 1KDNA 2E2PA 1NJZA 2DR6A 1SL1A 2PMWA 3EVMA 1C0UA 1HI8A 2UUAJ 1VJWA 2IDLA 2NPIA 3TI0A 3H46O 2J7WA 3KHRA 3O9QA 1H6KX 4RNHA 2A3ZA 5LT5A 3N28A 2RQ4A 3KJFB 3UKRB 4X65K 1X4HA 4W90B 2CQ4A 2K7JA 2XI2A 4L6V3 5HMXA 1QTMA 5K8OA 2O8BB 1E4FT 3W2VA 1VK0A 2CPEA 4LRAA 2HFVA 3V9ZA 1FK9A 2VKRA 2DKOB 2H3EB 2ZHOA 1FJEB 4LSLA 4C3LA 4HVZA 5AZIB 1ZM9A 1GLBG 1NGFA 3CG7A 3WNHA 3CCUN 4LR7A 1HLWA 2G4BA 1OSDA 1Y97A 1HLUA 1QLNA 3BR9A 1Z2LA 3HBTA 5D0GA 3D1QA 5KFFA 4WWSA 3W9IA 2R8HA 1UPMB 4A59A 1OY6A 3TZXA 2ZKTA 3DOKA 3MMBB 2FSKA 2KQ2A 1XTZA 4X65F 1YDLA 4H0VB 3FZ2A 4F26A 2VBZA 1D4XA 3M32A 5HROA 2YNGA 1GTHA 5EXWA 2RS8A 1KS2A 3PYGA 2B7CB 5J2NB 2AIRB 1SKRA 5AQXA 3LM9A 4KTZA 3VALA 3ET6A 1ZH5A 4KAZA 3HULA 1X7VA 5GMEA 5AQNA 5AQQA 2VG5B 1VQ6S 2UZAA 3OYNA 2L41A 3HZ6A 3L7UA 2J76E 3KWGA 4NZ0A 2E5LJ 2LQBA 4PG6A 3LPEA 1K8AO 1P9YA 1X9JA 4OYZA 2BV3A 3I31A 4JV5F 2D9OA 1SIZA 1I1GA 4ZS6A 1S1VB 4K7QA 4Q7AA 2F9WA 5DG9A 4NB4A 1JXEA 1JMTA 3ZSOA 4CRJA 3VEWA 2VBYA 4X4SA 2VU5A 1BY9A 1J5EJ 3HK2A 3HVAA 2UXBF 2OELA 5KFBA 2MKHA 3TX8A 1T9WA 4N47A 3BO3A 1L3UA 1NOZA 3AA4A 2VICA 1P90A 5CHCB 4G1IA 1TL1A 1K8KA 1RA7A 1B0VA 2Y3YA 4BR9A 1Q81T 2KLAA 5H9EJ 1TFWA 1U6BA 4QOTA 4C8KA 4CJPA 3ZC4A 4OZ3A 3H42A 3LO3A 3ENAA 3TAEA 2MHNA 3DLKB 4CJ3A 3HVTB 4DV5K 3K2PA 4B3RK 3U27A 2VJVA 3M1VB 1VCTA 4JKFA 1CXQA 4CIGA 2GX8A 5D3GA 1TKZB 4HLBA 1IBLJ 1Q82O 3OW2R 2N7YA 3L9ZA 3J7Z5 2HQFA 1UVNA 3AVMA 2OPSA 2HRUA 3AA9A 4KJIA 3H08A 4PCQA 2V67A 4DSKA 5LOQA 4DF8A 4M5JA 3CSKA 3H4BA 4X2BA 3BPSP 2Y0BB 3F41A 4DS5A 3DOLB 2ZGYA 2M8DB 4RW4A 1AT1B 3CNQP 1Y3KA 4DTUA 4CO3A 2P9IB 1YBTA 3V1RA 1ZAVA 3SQ4A 2LEPA 1N5YA 3M2VB 2VA3A 4DSLA 4OYIA 1NK8A 3SAFA 2KZMA 1KVJA 4Y34A 3OYCA 5DQGA 3PUFA 4DFPA 4DX6A 4DV5F 3GLJA 3GP9A 1BU6O 3QRPA 2Y1JA 2QMUB 5JLFA 1XMOF 1Q82T 4K25A 2RN2A 4PYDA 1PSDA 4LR9A 1IR0A 3DDNA 2J6UA 3RAMA 2FBYA 4OI2A 4PA1A 2AZ1A 3G87A 3DI6B 1MWQA 4R0JA 4GKKJ 1X8DA 3QIPB 1NPKA 4KBOA 5CYMB 3WC2A 5KFNA 4NLUA 1FI4A 1N36K 4FWOA 1N5QA 3IN5A 2BZ2A 2HFSA 4LR8A 4LY7A 2ZWPA 3H0PA 3EYZA 4X84A 3GSDA 3ZSRA 3CMES 1TK0A 4LF7J 1N54B 1L3TA 4HDGA 1C4CA 1R8CA 1V6HA 2OD6A 1TMJA 2CQGA 2HHXA 4IWVA 2LP4A 5AQMA 4CI0B 3JQKA 3FLCO 4NZ7A 2J7KA 1JLCB 1N32F 2FJEB 5HQ8A 3KOAA 5CCLA 1HQUA 3NS7B 4HTLA 2R7RA 3SMZA 4BR4A 2I8EA 3B6BA 2M88A 1AW0A 1QAJA 2ZGZA 3GTYX 4DV5J 5KT4A 1WORA 3DXSX 3SCIE 5HJYA 1Q95G 4DV6K 4DTJA 2KJVA 2W9CB 3KK1A 2DHHA 5H9EK 4DCHA 5KT5A 1P1TA 2I5JA 1RUSA 2Y0SD 5HRRA 4FPBA 4QPXA 4X66K 3W3DA 3MD1A 5AE3A 3ZEUA 1YQHA 4NYFA 1K6YA 2RJZA 3QT7A 5KAKA 4LFCF 1QJHA 1A5XA 3KKSA 1W25A 3NOGA 1Z6RA 1PBUA 4ISEA 4JKAA 4X62J 4W5OA 1Q5YA 1NU0A 2P9GA 3C95A 1B7FA 3CUNA 1YJWS 2BOPA 1TTHB 2KHCA 5AQUA 2DGUA 3VGMA 2MGZB 5KT6A 5KFMA 1JK9B 2FY1A 4F3OA 5B0BA 4Y2IA 3HFZB 3M8SA 1MWZA 1S6UA 2X3GA 4X4QA 3OT9A 1UVMA 2ZDOA 5FDLA 3PSFA 3NGUA 2VC1A 3J7A1 2H9ZA 4K4UA 1EHWA 4X4VA 2I9SA 4OPAA 5CZVA 2YI1A 2AGOA 1FRLA 4AF1A 5FLXU 2R7UA 2B4PA 5T14A 4B3OA 1VRUB 1H1VA 4WFBL 4U7BA 4QAGA 4OZ0A 4B1UB 2WONA 2R7QA 3M8YA 2IGIA 3FMBA 3QINA 1LW2B 2VDHA 4EYHB 2QYGA 2EFQA 1SC6A 3C19A 2CPDA 4QWDA 3VQSA 1UFWA 4TLRA 3BQ2A 4KC5A 1EP4B 4KYZA 4WQ4C 2Q2RA 2DT9A 1EETA 3VF2A 1YAGA 5BN9A 3M8ZA 2QEXN 3FSIA 1NB2A 4GVBB 4WU2A 3SK3A 5BYSA 5F3TA 3TQ1A 4J2AA 3PNIA 4BGAA 2BE9B 3LWMA 3ITHA 2OA8A 4ED2A 2KVIA 3HZGA 1EAYC 1TU0B 3CJ1A 2MZRA 1QE1B 3PFOA 4EWTA 4OL8A 4KHNA 3OSPA 5EX0A 4OKEA 3GG1A 2FB0A 1VIXA 3FQKA 2NRVA 1RLCL 4C0BA 4K8RA 1FKPA 3Q8SB 2AZ3A 1JLQA 3VQDA 3JAMY 5IT9Y 2QGFB 3CIMA 3AD9C 4CT8A 4F4WA 1SH0A 4K8XA 2E1RA 4ED5A 3HSZA 1YITS 1TL7B 1HR0K 2OYQA 3A2FA 2KM8C 3V4IA 2GV9A 2Z0GA 4NLDA 4ZPTR 2VGMA 3ITHB 2DNYA 3JTPA 1JCEA 3TTDA 2R7TA 2KW4A 3O8MA 4IDHA 2D1KA 2UUBK 5DS7A 3NRBA 1F3VA 3BPDA 1ZTTA 4Y3CA 2QG9B 5HOOA 1TQLA 3N4PA 3MM9B 4J9LA 4QW9A 1GT8A 1NDPA 2VFVA 3TR5A 1X4GA 5A0YA 2WB4A 1QY7A 3RRKA 1C6VA 2PFUA 3M3ZA 3W1YC 1YJVA 2LQ5A 1UAWA 1VQYA 4EMDA 2PZSA 2AQ4A 3OL9A 3EDRB 5K20B 4J37A 3WXMB 4ZVUB 4ECRA 1SJQA 2ROGA 1IKVB 4GO7X 1YG0A 2VWKA 3J80Y 1G15A 3AVAA 3OUYA 5DQHA 4CGDA 1KLMB 5K14B 3V4MA 3V81B 1NGDA 3OYDA 1NZAA 2J9DE 4NASA 4HWIA 3KG1A 1HNWJ 2HPUA 3TUPA 4UOHA 4M7YA 1FJGK 4DI6A 1BE4A 2LVWA 1OYDA 2HHWA 1T9VA 3UNGC 1FA0A 3PR4A 3QSYB 2DXEA 4CESA 2H4YB 5J2MB 1HQEB 1IM4A 4KTWA 1WTBA 3O4WA 4PXEA 2AT1B 1HR0F 3A5NC 3O9SA 4FLZA 3KLHB 3CFOA 2BYCA 4QYZJ 4WFXA 5AFUA 4ECTA 3OHBA 3AVHA 4ZP6A 3WNFA 3F9KA 3MN7A 1ILYA 2A6OA 4Z4FA 4FO0A 3TTCA 4U6PA 4IFYB 3V81A 2RUSA 2Z1HA 4DPTA 1RB0A 1XMQF 1AB8A 1UA0A 4CTAB 2IIRA 4CJKA 4LVNP 3MURP 2MJUA 4J9RA 1UWBA 3R7NB 1ACMB 5KFTA 5IFMA 4YHHK 3I5AA 5M1OA 1Q9YA 4RUCA 2H48B 4CDIA 3DN9A 3WXKA 1CSJA 3BO2A 3GJSB 1Y10A 3RBZA 1KONA 2A3JA 2E20A 3VTHA 3G4SS 1FJCA 2MSSA 2N3LA 2Z2YB 4USMA 1S97A 5A6WA 3IWNC 1RBOB 1VHXA 3RAQA 4L3KA 1WKKA 2O8FA 5JVGL 4I1TA 2DH7A 3DWLA 2VPYB 1F2GA 2FJDB 2HS3A 1RWMB 4UY8T 2J4RA 2X74A 3H5SA 5DQIA 4CEAA 5L1KA 3VEXA 2G8HA 3NCPA 3TZZA 3R9LA 4JI6F 1SUQA 1MLAA 1B4SA 3OTBA 2D0CA 1DJ0A 5LMUF 2HHHK 4OLPA 4LFBJ 1RU1A 2RE2A 2VODA 3LPUA 1BCMA 3MXIA 1BQXA 2XZTB 3THYA 3KUEA 2BR0A 4W98A 5F8LA 3QB0A 2F8HA 1HKGA 5LJVA 1XMQJ 4DV3J 4OI1A 2IYIA 4H5NA 3VGTA 3R2DJ 1FDBA 4WIIA 1Q86T 1M90T 4CH7A 2BJ8A 2ZOFA 3LP1A 1I3OB 1QAXA 2YJFA 3J7YI 5E33A 4LRBA 3UN3A 1X4EA 1OQ6A 2GW8A 3ZX2A 3W9JA 1N8RO 2VASA 3FZKA 4PKHA 2KU7A 1VSLA 3EKUA 1IBMK 3FMWA 3MCPA 1N56A 2AD9A 4CD3A 3WZ0A 3DM2B 2UUAK 1Q79A 3GIMA 1DGKN 1UPPA 1VK8A 3BB5A 5B0DA 2V2VA 1S4EA 4OX9J 4YHHF 3T41A 2HHHJ 4M41A 2XS7A 3D9BA 1UFKA 1C0TB 4HVJA 3FK4A 3AVCA 1VSEA 4K4XA 2HSEB 4ZHRB 1NB7A 2XO7A 5AT1B 3AGRA 4BVPA 4N76A 3SMPA 1UEKA 4A8OA 3VQQA 4LRDA 4M63A 3QEXA 5F0WA 2VBWA 1BGXT 4ETZA 2GQ2A 1NEEA 4HACB 2XNRA 7AT1B 3W8GA 3KDNA 1Q86O 2P5GA 3CDWA 2Z1GA 4DR5K 4K8ZA 2PFFB 1MROB 3HHLC 5IC6B 1UOCA 2Q6CA 2FD2A 4JS5A 4C48A 4V19J 2P9SB 1ZBSA 1HL6A 3J8AA 5HL7L 1NK6A 2AYEA 4BRKA 3POTA 4J5OA 2XWYA 2P6SA 1RT1A 3MCSA 3W5XA 1FEHA 3PW5A 3THXB 3UDCA 1VSFA 3H2VE 2GVZB 1U09A 4KPCA 4DR6J 1K0TA 1YUWA 4HYKA 4CGFA 1WBDA 4JYAK 2F7TA 1UA1A 2GCFA 3T3FA 3CMEN 1IR2A 3W62A 3KNGA 1F21A 2NYHA 3NCRA 4F02A 1TKTB 2OSRA 4Y1CA 2E1MC 3G6XA 1CZAN 3ZNUA 4F3QA 5F8MA 4RUBA 3P6YC 3KK1B 4CJSA 1Q78A 3U1MA 4PXBA 2P9CA 4NLCA 1LQ9A 1GXTA 4BQZA 4HTJA 1U1QA 3L2RA 1N0VC 5KTQA 5ETSA 2QMXA 4EBEA 3FQLA 2YV0X 3BSNA 3T1HJ 4FZXC 3P31A 2XHCA 4Q2MA 3CHWA 1HNXF 3VTIA 4KI4A 2PBDA 3CD5A 1FFWB 2HBMA 1L3SA 5FDLB 2RHKA 5KPRA 5BYRA 3D0HE 2KYXA 4DR3J 2FHKA 4YHHJ 2WHOA 2P9EA 1RTDA 4B17A 2RU9A 5GINA 1S99A 1CULA 1IKYA 3GYNA 1KD1O 2FXUA 5CQGA 4CO0A 1RCOB 4O3PA 2HAFA 3DXMB 1NGIA 4EFAC 5EVZA 2HBLA 4UZCA 5LMNK 1GXUA 2ZH9A 4NMLA 4CK1A 1QZ6A 4IO9Q 2C3PA 2VPZB 1CZBA 4PKIA 5DLFA 4WP8A 1J53A 4CZIA 4LH5A 4X66J 5E84A 2BEFA 5B09A 2ADCA 4ECZA 4AL7A 4CF0A 1TK5A 2HQGA 3HVWA 2YX4A 3TA1A 1GLAG 2YBVA 4FJHA 3VAKA 5CZXA 2FGCA 3C7NB 5LSLA 3ZZ0A 2Y9HA 2IJRA 2B8QA 2YHXA 2D0PA 2ROPA 5LMUJ 1APSA 3TZWA 5EDWA 2MZSA 4WFNQ 2ACMA 3UN5A 3KLIA 4DR3F 4K4YA 1JLFB 1KEKA 3EMTA 4FLVA 1ASWA 2ZOGA 2K1RB 1CXUA 3AJ2A 2V0NA 3IAYA 3CM6A 1WC4A 5DGBA 4BRMA 1X60A 4MAKA 3CT9A 4XH4A 4ISFA 4V1Ak 5F2RA 4HUFA 2B56A 4A8FA 3RB6A 1FRIA 2GZOA 4B9NA 1MMNA 1KQSR 2WB1D 2GMHA 2BUPA 2RKIB 5JJBA 1S1UA 2PEHA 3FBBA 4IEEA 4MKBA 3BR8A 1X4CA 2DXFA 1R6VA 3HJVA 3JSBA 5KGXA 3HT3A 4WE1B 1J27A 3UCGA 2E1YA 1BI4A 3HCXA 4C7QA 2DY4A 1S72N 4K41A 1WOQA 5CHIA 4NLYA 1IKWA 1X5PA 1F9HA 3UD5A 4M5IA 3VPZA 4PR6A 2DISA 3AT1B 2ZH1A 1RAFB 3KLHA 2ZBCA 1RGVA 3LAKA 2HHTA 4ECVA 1RK8A 3JS9A 1PCAA 1QVGM 2BJ7A 2RAQA 1WEYA 5H9FK 1BA1A 5KRTA 3M30A 3VR1A 1YVNA 1X1PA 1RWVB 3WX4A 4FLUA 3MECB 4DV4K 5KFRA 3CW2C 5CXTA 2BQUA 4J9QA 2W7AA 3Q7CA 1D3WA 1N52B 3DOMB 4AHRA 5AQRA 4MH8A 1VQ7S 5JMVA 3SUNA 4PPDA 5AXMA 4M7XA 3N5BA 3JYTA 3MM5A 3TPQA 1LV5A 1J5OA 4PABA 3L95X 2VFTA 4DR3K 2HOEA 4AYBD 3C46A 5KOWA 1YTUA 2FHJD 4CJ4A 3QEIA 4KPYA 1SL0A 4USHA 4GVMA 3NMUA 5C12A 4LIRA 1NCLA 3V9XA 2ZNYA 3ZLJA 2WBRA 3O8WA 2HKEA 4C97A 4I6WA 3A8EA 2ZH3A 2P9LA 1R0AB 1X31C 2ACYA 4BC7A 3OFGA 3NAHA 3HHLA 3JYTB 3ENBA 2VL1A 4C6AA 2F9TA 3I87A 4O5BA 3IFEA 4OX9F 5C2DA 1RFQA 1T7PA 3TANA 5JXSA 4BHQA 2IM2A 4RNMA 4MK8A 4ZCKA 1LW0B 3U4LA 4R0EA 1YZ7A 4FW2A 1DQ8A 3RW7A 4BRGA 5DDPC 2XI3A 1FRKA 1TL4A 4BR0A 2AJ4A