2BANA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 subunit
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 128
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2banA05
1KFDA 1RDAA 3DLRA 1L5UA 1JLEA 3F9KA 3KLGB 5F9NA 1XR5A 4JRPA 1GOAA 2W42A 4CGIA 2E9RX 4OGCA 1JLGA 4IKAA 3EPIA 1HPZB 3AA4A 2YNIA 3OS2A 4CEOA 3V81A 3HP6A 3NAHA 1X9SA 3ZT1A 4M3XA 3VQDA 5C24A 5KT3A 4HCCA 5K14A 3TWHA 1CZBA 1XHZA 1TL1A 3DRRB 1REVA 2DFFA 3L3UA 1KCFA 1WSGA 4J9NA 1RT4B 2W9BA 3KHRA 1SH2A 3KKSA 1RT5A 4LSLB 1BQNA 1SV5B 2FVCA 1RDCA 3QLHA 3CVKA 3PX0A 1SH0A 3LANA 2VG7A 3MEDA 2PYLA 2OZSA 4XPEA 4NLVA 3OJSA 5DQHA 3KLIB 3AVAA 3QIPB 4EP4A 3LP0B 4TSXA 4ZPAA 2G8UA 4FVMA 4QAGA 1B9FA 2IA6A 3OL8A 3IRXA 1CXQA 4CECA 2VWKA 4CFAA 4DQQA 1SH3A 5HBMB 3G6XA 5CZ1A 4W5QA 2FBVA 5DLGA 3MECA 4I7FA 3DI6A 1N6QA 2ATLA 1W9HA 4Y1DA 4O44B 4J9MA 4DQIA 3DM2A 1ZTTA 2JEJA 3PR4A 1HNIB 4FM2A 5KFOA 5CYMB 4CGJA 4PY5A 4ZVHA 4CF1A 2IAJA 4OPJA 4DSJA 1XR7A 5JS1A 4TY8B 1FKOB 4CESA 4IFYB 4ECYA 2WHOA 3L2QA 1TAQA 5KG3A 3I0SB 3KLEA 3WNGA 1IKXB 3NDKA 3O3GA 1ITGA 1JLCA 3GYNA 3VQSA 2W9CA 3HPGA 3HVTA 3MEGA 2HMIA 2GIQA 4IRDA 4FLZA 1YTAA 1EETB 5DG7A 3BR9A 2I5JA 1FKPB 1C1CA 1VK0A 3LAMA 5J2QA 4O3QA 3HYFA 1SUQB 2YNGA 4B9NA 2W7PA 3T1AA 2NUBA 3RB0A 2YNHB 4BWJA 1ZTWA 4R0EA 5KFRA 3C6UB 1LW0B 1WSJA 2HHVA 3AA2A 3TARA 3AA5X 3DLEA 2E9ZA 1KVCA 4KHWA 1NK0A 2O4GA 2X74A 4W5TA 1S9GB 4IG0A 4OGEA 4H4MA 4G1QA 1IM4A 3BSCA 2B4JA 1N48A 3OS0A 1RTJB 5KGWA 1RT2B 4B8AB 4QW8A 1IKVB 4IH5A 3K2PA 2UUTA 3G6YA 1ZYQA 1S10A 1C2PA 4ECRA 3AVCA 2HAIA 3M9MB 4URGA 4F4KA 1IG9A 3B6OA 1NNDA 4XO0A 4NRUA 3K59A 1C0UB 1ASVA 5EWFA 1C1BA 2QV6A 3VQAA 3SFUA 3MAQA 4JUZA 2C2RA 4DFJA 1B9DA 1NK9A 4ED0A 2C2EA 5KFHA 1JL1A 4CJRA 3E01A 1RTHB 4E19A 2RDIA 5KFNA 4CFDA 4KO0A 5CYQB 4FJKA 4TYBA 4NYNA 5C42A 1JXLA 4O5BA 3MEEB 4J9KA 3CFPA 1TK0A 4J2AA 1S9EB 1UWBA 4LH4A 1Q8IA 3OYCA 3V6KA 4RG8A 2ZKUA 5KT4A 3RMAA 4KI6A 4GMJB 3RWUA 4ED6A 3RMDA 1HYSB 1IKWB 1S5JA 1A5XA 2EC0A 3QEIA 3FFIA 1RT7B 5KT2A 4ICLA 3SJJA 4NCGA 4AH9A 4CF9A 4IG3A 1QUVA 3HM9A 4KB1A 2BQRA 2ZE2A 5J1EA 4NLSA 2Y1JA 4E7HA 2G8KA 3L2RA 4CJWA 5J2NA 3LPTA 4BDPA 2O5DA 5T14A 3DLKB 2VA2A 4FM0A 4CIFA 3H5SA 3KD5E 3PW0A 2DPJA 2CJQA 4R5PB 1G15A 1YVFA 3AO2A 4DF4A 1EP4A 4DG1A 4N47A 5FROA 1VRTB 3DOKB 3DRSA 4ZP8A 2C28A 2R2TA 2HNDB 3C95A 5HRRA 4K4ZA 1NJXA 1S6PB 1HARA 3KLGA 4FJNA 2BR0A 4K4SA 2HW3A 2WONB 3T5KA 4QPXA 4TLRA 1TVRA 1R0AB 5F8LA 4ECSA 3V9XA 1RDBA 2RF2B 1HPZA 3SUOA 1RBRA 3E51A 2HHWA 1KTQA 1J9AA 3D45A 4FJ5A 3PUFA 5EWEA 5KFLA 4TYAA 5KRTA 2FLNA 3PW7A 2R8GA 2BE2B 4Q43A 2FBYA 3K5OA 1JLQB 2GIRA 4O3NA 1Q9YA 1BISA 1NOYA 1HRHA 4UQGA 4WZMA 1IH7A 4ECTA 3NCIA 3PV8A 3H4DA 1RA6A 5KG1A 1A5WA 4ECZA 4RW9B 4LSLA 4IKFA 4FJXA 4IH6A 4YR0A 1SV5A 2VG5B 1BL3A 4CHNA 4M3YA 5KG0A 1ASUA 2QKBA 4AHTA 3ZSWA 5J2PA 4O0JA 3BGRB 5F8NA 4K8XA 3AVFA 2IM3A 2XI3A 3KLIA 3FQKA 4R8UB 3VQ5A 3QIPA 2I1RA 3GQCA 3LP0A 3WNFA 2KFZA 4URQU 4WZQA 3GV5B 1NK6A 3RBDA 5HBMA 2IS3A 3JSMB 2ASJA 2CKWA 3ASMA 4BE2A 2F8TA 3ZT4A 1TL3B 2OA8A 1NHVA 2A1SA 5KTQA 2OH2A 3TANA 4O44A 1FXXA 3NE6A 3CJ3A 1LAWA 2R2RA 1VSLA 1QHTA 4ZPCA 1RA7A 1U45A 1VSDA 1WAFA 1NKEA 1HNIA 4DLGA 4KI4A 2BRKA 3PW5A 4YFUA 1JLBB 1EX4A 4I9LA 3DOLB 4M3TA 2IC3A 2WCXA 4TY8A 4RUAA 5L9XA 3KK1B 3V4IB 1JXEA 4DFPA 4K4TA 3NFAA 2UVUA 3OJUA 2XY8A 4WYWA 4F3TA 1FK9B 3I0SA 1C0TB 3Q8SB 4HTUA 3VQ6A 3UQSA 4QW9A 3BSNA 4OJRA 1S1XB 3OYLA 5HLFA 3ZSOA 4O0IA 5I42B 1N5YB 4RUCA 4DTXA 5KG6A 5EU7A 2OZMA 2XRIA 5HRPA 3G10A 3LPUA 4KFBA 4J9QA 4CJ4A 4F4ZA 1T03A 1LW0A 4J9PA 4CEDA 2KTQA 4NLDA 1BI4B 4CE9A 4C8LA 4E89A 1NK7A 4F3OA 3ULDA 1YVUA 4N56A 1S9GA 4KHRA 2IJNA 4ID1A 3PJWA 3VQCA 3CJ5A 2P1JA 3ITHB 2GV9A 4EBEA 2AWZA 4E1MA 4RW7B 3AVJA 2E6MA 4XIUA 1NHUA 2ALZA 1DLOB 3KNAA 4DTPA 1RAJA 1U47A 4YP3A 3CM6A 1RT2A 3HP9A 4URSA 2XHBA 3V1QA 3SUQA 1U4BA 3T5LA 4BE1A 3OSPA 1OS5A 2FJXA 1TQLA 1C0UA 3LP1A 3DRPB 2HHXA 1Q9XA 3VA3A 4KHNA 5F8JA 2Q3SA 2KQ2A 2FLLA 4CJEA 4AHCA 1NKBA 2AQ4A 3TAMB 1JLFA 2BDPA 4KV8B 5D3GB 5KFFA 2HNZA 3L2WA 3OLBA 3FRZA 1C0MA 3LZJA 4AILC 1RT6A 4F2SA 4RZRA 4KTZA 2V4QA 3MEEA 4I2PB 4YQWA 3ZSYA 5C25B 5JUMA 1S9EA 2YV0X 1IKYB 3PY8A 2C2DA 2O4IA 4FLTA 3C6TA 4CCHA 3N6NA 1KHWA 3ZT3A 3MXMA 1HMVB 3QIDA 4FJLA 4FJ9A 4IH7A 3OYNA 2R2SA 4NYZA 3PR5B 2BGGA 1JKHA 1RT7A 5SWMA 4FYDA 4O3SA 4BE0A 4DSFA 3VQEA 3ZCMA 4CEZA 3KK3B 3DYAB 3BSAA 3RB4A 1ZBIA 3SV3A 2RPIA 4OPKA 1TGOA 4N41A 3WNEA 4HUGA 5KFSA 4FM1A 4FLYA 4IFVA 4HKQA 1S1UB 4Z4GA 2G8VA 4MK9A 4Y34A 1QE1B 2BANB 3GV8B 3QERA 1U48A 2X78A 1SKSA 4E3SA 3JYTB 3DLKA 4KAIA 4ZP6A 1RT3A 1BHLA 3SFGA 4R5PA 1RTIA 4OKKA 3VQ7A 4C8OA 2JEIA 1VRTA 4C8KA 4KBIA 2DFHA 2W8LA 1D8YA 3V9UA 2G8IA 1TKZB 2IGIA 2AJQA 3N6LA 1GX5A 4DFMA 2HNDA 2XI2A 3H5UA 1NOZA 2B5JA 5KT7A 2HNYB 3LWMA 1R0AA 4DS5A 1T05B 2RF2A 1D1UA 5I3UB 1MU2B 3BREA 4DMNA 1DTTB 3VQ9A 2VA3A 5DK5A 1J54A 1KVAA 4YR3A 4LQ3A 4GC6A 3V1RA 4CJVA 4K4XA 3QGGA 4OKJA 1KRPA 2F8SA 3FSIA 1J5OA 1KHVA 5J2MB 4DU4A 3BQ0A 2ITGA 3OHAA 1QAJA 4RNOA 1JLQA 1LWEB 4DS4A 2ATQA 1CSJA 1S48A 1XHXA 4MK8A 4CIEA 4K50A 5FRNA 3S3MA 2XY6A 1BQMB 1VRUB 4RW9A 4IOBA 3KJVB 3CO9A 4CHOA 4I2QB 3S9HA 4WFYA 4LSNB 5KGXA 4FJIA 4FJJA 2D0AA 1RBVA 5JS2A 3TVKA 3BGRA 1CZ9A 1O1WA 1T3NA 4AHUA 3NF8A 1WSEA 3KD1E 2D3ZA 2OPSA 2YKMA 4AHSA 4GW6A 4TXSA 3NL0A 2UVRA 3AO4A 2YHBA 5DLFA 1VSHA 1NJZA 3DLHA 3AO5A 4Y3CA 3V6JA 2ZQBA 3AO3A 4BDZA 3AVHA 1TL3A 5KFTA 5DQGA 3I0RB 1HNVB 3O4QA 3RR8A 5HROB 1VSJA 1HYZA 1N56A 3NF6A 5CZ2A 4DQRA 4WE1A 1D9FA 4IQXA 2AGOA 4JV1A 4DSKA 5KFBA 4YNQA 3IG1B 3LAKA 4MFBB 4ZVEA 4CHZA 3QZ8A 1JLBA 4JLHA 4O55A 4E7IA 3NBPB 3KK1A 4KHYA 1HQUA 2D5RA 2OYQA 1S0MA 3K5NA 1CLQA 1I39A 1FK9A 4MH8A 1RT1B 5KFZA 1W0HA 3V6DB 3ZT2A 4B9UA 2YNFB 3IGVA 1HQEA 2HVHA 4Q0BB 3OHBA 4DQPA 3ISND 3NGIA 2FVQA 1LW2B 5KFDA 5I42A 5HP1B 1N5YA 3BJYA 2DPIA 3K57A 4NLGA 5C5JA 4ELTA 4ID5B 5KFUA 1J53A 2WOMA 4B9VA 3KLFA 4DTMA 4RW4B 3SYZA 4C8MA 1K6YA 1S1WB 1RCHA 4EYIB 3SPZA 3KMSA 4DL7A 3D0PA 1ZBHA 4ZP7A 1TV6A 3CYMA 4PQUB 3K5MA 4KB7A 2R8JA 3ITHA 4J9LA 2VG6A 2HWIA 3M9OB 3NF9A 4WFZA 2RKIA 4RW7A 1T7PA 4MKBA 2FLPA 1S0OA 2DTUA 3IS9B 1JLGB 4CJPA 2YNIB 2IM1A 4DEZA 5F8IA 4FK4A 1S1TA 2ILYA 3OYMA 1RYSA 1S6QA 2QE5A 2IMWP 3VQBA 2AGPA 1BCMA 4W5OA 3MR3A 4CJ5A 3PO4A 4FJ8A 2AX1A 2BQUA 2GUIA 3KK2B 3AVMA 3ZSXA 4DTOA 3OS1A 4Y2CA 4LH5A 3DRPA 3NMAA 1RBUA 1QSLA 4LY7A 4KRFA 5KFQA 4NLTA 3EZ5A 3AA3A 4LQ9A 3NGZA 3K5LA 4QWDA 3DLGA 4KV8A 2Z1GA 2W9BB 2V0NA 2D3UA 1BQNB 1BCOA 4RW8B 3ZT0A 4FJ7A 5KG7A 2C22A 4FJHA 3CG7A 4RW6B 3T19A 3Q8RB 4I2PA 4PUOB 4NZ0A 2XGPA 1EXQA 5KG2A 4OLAA 3LP3A 4EO8A 1HMVA 4GVMA 4C8NA 3OYKA 2Z1JA 2FJWA 3SQ1A 2A1RA 3CDUA 2OPRB 3OL9A 2R7YA 4M3WA 4MK7A 4CIGA 4DTRA 3L3VA 3P5JA 1T8EA 3RTVA 4XPCA 3AVKA 3VQQA 3LALA 1WLJA 2YHAA 3PW2A 3TAGA 4EBDA 3MR6A 3MECB 4K4YA 5EUHA 4KB0A 3M8QB 3ZSVA 2GBZA 3DYAA 4CHYA 4CF0A 3DM2B 3DRRA 4DQSA 5SZTA 4F4XA 2R2UA 4E7LA 1QE1A 2BANA 4QWCA 1RT4A 2X6SA 2LSNA 3OL6A 3TAQA 2J6TA 4ED1A 4EZ6A 1Z4UA 4KTQA 4NCAA 3JYTA 4HUFA 1TKTB 1D0EA 1WAJA 2JLEA 3EPGA 4IR9A 4ED2A 5EWGA 5KFWA 1X9WA 1NK4A 3ICLA 3BQ2A 3KLEB 3SI8A 4Z4FA 3MXIA 1SKRA 3OSNA 2KZZA 3C94A 4NLRA 1JLCB 4CJLA 4E7JA 4DTUA 2D41A 4M45A 3IGNA 4IBNA 3HVTB 3QESA 1X9MA 2HHTA 2HMIB 1D5AA 1TK8A 4CK2A 4WFXA 3RB6A 1JX4A 4WXWA 2HNYA 3H98A 3FQLA 1VSFA 5HRNA 3SZ2A 4KHUA 1T05A 5I3UA 2YNGB 1DTTA 4J2BA 4N76A 2XY5A 4CEFA 2XC9A 1ZBLA 4FJMA 5KG5A 3M9NB 3SUPA 5J2MA 2HVIA 3Q8QB 3AVGA 4B9MA 3HVRA 3H5YA 5CYMA 2D0CA 4CEQA 2G8FA 4H4MB 1LWEA 2DY4A 4L8RB 2PZSA 4M3RA 1ZBFA 3U6FA 3I5BA 1FKOA 4IFYA 2ASLA 2D0BA 4HHTA 2FJVA 4NLXA 1WSIA 4WYLA 3CQ8A 3OYEA 2GC8A 4H54A 3H5XA 4KSEB 3VQPA 1IKXA 3OYHA 1LWFB 4RNHA 1KFSA 3KJVA 3QZ7A 3QO9B 4I2QA 3CDEA 2KW4A 1UA0A 2RDJA 4LSNA 1WN7A 4FBTA 1EETA 1JXBA 1FKPA 4KHQA 1SUQA 1UOCA 4OL8A 3G0ZA 3GIKA 3CJ4A 2YNHA 4AHVA 4JRQA 3C6UA 2FBTA 4KO0B 2XCPA 2XY7A 5KFCA 5F8HA 4CGFA 4DL6A 5JXSA 1GOCA 3I0RA 3PJXA 5KFVA 1HNVA 3NF7A 2G8HA 3OYFA 4DL2A 4FJGA 3O3HA 3KLHB 2W9AA 4FK2A 1VSMA 4MIAA 5KRSA 3QGIA 3LDSA 1RTJA 1QQCA 2JC1A 1IKVA 3KHHA 1UAXA 4NLPA 2UVWA 3SNNA 3OYDA 5KFAA 1WSFA 4DSEA 2JEFA 5KFEA 2FC0A 4B08A 4FZXC 3FFIB 2ZD1B 2FBXA 4NCGB 4B8CA 4HVJA 1QAIA 4IG3B 4Z4EA 3SUNA 2ASDA 1RDDA 3KKRA 3NBPA 4J9RA 4FK0A 4N5SA 2IOCA 1RT1A 4Q8EA 4KHSA 3LP2B 3DMJB 3VQ8A 4DF8A 4DTJA 5J2NB 1UA1A 3U3YA 4FLVA 4CEAA 1RTHA 2W7OA 5KFGA 1QS4A 3AO1A 5CYQA 5CY4A 4ID5A 3EY1A 2RN2A 3HSTB 4DL4A 1RILA 2E4LA 2R8HA 4O4GB 3DRSB 4RW4A 3I5AA 2IJFA 3HL8A 3L8BA 5DMRA 5DG9A 4CHPA 1JL2A 3OL7A 3RRGA 1S1WA 3I5CA 3ISNC 1TKXB 2OPPB 3ALYA 2HB5A 4NLWA 1HYSA 1IKWA 4PQUA 1RTDB 1VSEA 4ECWA 3HPOA 4DL5A 4IRKA 3V9SA 4EP5A 1TVRB 3IS9A 3HHKA 4E1NA 4EEYA 1Y97A 1L3SA 2IM0A 3FDSA 5FRMA 1K1QA 1C1AA 3NH0A 3EYZA 4RU9A 3TAPA 4DSIA 4EYHB 4OLBA 3S3NA 3MXJA 1LV5A 2VWJA 4Q44A 4ZPBA 3KK2A 2BRLA 4TQRA 4RNNA 2J6UA 4BWMA 1I6JA 3IAYA 4HUEA 1S1VB 4Q8FA 4HYKA 1VSIA 3H08A 3DOKA 4PWDB 2IM2A 1DTQB 4ZVFA 2UVVA 4CJTA 3CJ2A 4KE5A 2XCAA 4TY9A 4RW8A 4KKOB 3RAQA 3HXMA 1S6PA 4Y2AA 4K4WA 1NK8A 3SCXA 4RW6A 3RB3A 5J2PB 4BDYA 2WONA 4PUOA 3NH1A 4CGGA 5KFYA 5HRSA 5KFJA 3D5MA 4ZHRB 4W5NA 4DSLA 1NKCA 2B43A 2OPRA 3U3GA 1HYVA 3QEXA 1TAUA 4DLEA 2FVSA 3S3OA 3M8PB 3OLAA 4ECXA 2BE2A 4FBUA 3M8QA 1ZBUA 4CJ3A 4F4YA 3LZIA 5L1KA 4H4OB 4CERA 3PVXA 3NKYA 1JLAB 1U49A 4FLWA 3H59A 4B9SA 4O4RA 4NLUA 4CGHA 2P5GA 1IO2A 5FDLB 4IDKB 2UUWA 5KFIA 2VG5A 4HCBA 2IC3B 3ZSZA 4OVLA 1TKTA 1WSHA 3DDKA 2G8WA 4QOZB 3OYAA 3F73A 3RRHA 4ZP9A 3NHGA 1I3AA 1BGXT 1SKWA 4YR2A 4CFCA 4F2RA 3H40A 4NLYA 4R8UA 3SV4A 4RNMA 3O3FA 4F8RA 5HLFB 3G86A 3JSMA 3ZSRA 3CDWA 4W5RA 3GIIA 4B9LA 3TAEA 2HHQA 2OPQB 2B6AB 3RBEA 3NAIA 4Z0UA 1S0NA 4KFBB 4KAZA 1T03B 1QSSA 3QIOA 1LWCB 1HJRA 3IN5A 3TAFA 1SL0A 3TABA 1KLMB 3AVBA 5KG4A 1TP7A 3QETA 3DOLA 3MR5A 3QNNA 4FW2A 3N6MA 5DG8A 3V4IA 3UPFA 1GX6A 3V9ZA 4M94A 3HVWA 2QKKA 2R8IA 3RAXA 4CF8A 1C0TA 4FZYA 1LWFA 3QO9A 3MR2A 2YKNB 1W25A 4Q45A 1JIHA 3CIZA 3T5JA 2V9WA 1S1XA 1YT3A 3H2LA 2JEGA 3OYIA 3BSOA 3RR7A 3LP1B 1Z25A 4B3OB 2JC0A 4NCBA 4ECQA 1S97A 1U04A 2F8EX 1X1PA 4U7CA 3KHGA 1BIUA 2EHGA 1JLFB 3HT3A 2HHUA 5T7BA 2HNZB 3MFHA 3O4NA 4M95A 3UR0A 1A5VA 1RNHA 4CJUA 4DFKA 1BI4A 3KHLA 3OVNA 1RT6B 4WXOA 4QWEA 4MQ3A 2BQ3A 1YTUA 1JLEB 4CJQA 4JS5A 2D7SA 4FS2A 4F50A 4Z4HA 4X2BA 4G3IA 3L2VA 4OKEA 4ELUA 3Q8PB 3QEWA 3KLHA 3KLVA 1DLOA 3QYYA 1L3VA 3C6TB 4DWIA 4ECVA 1S49A 5KT5A 2R8KA 3V81B 4FZZA 1VSKA 2F96A 1RBSA 3QINA 4U6PA 4CJFA 4JV2A 1JKHB 4E7KA 2ZD1A 3QEVA 1XI1A 2QXFA 2ILZA 1WNSA 4ED3A 4J2EA 2IDOA 4CEEA 4QWAA 4QWBA 3G6VA 5L1IA 5C24B 5K14B 3HVAA 3PX4A 1KSPA 1TL1B 3DLBA 1REVB 3HPHA 3LP2A 3DMJA 2E6LA 4KPYA 3TAMA 4IFVB 5F9LA 5KT6A 5D3GA 4FLUA 2KZMA 4ZPDA 2EX3A 4NLQA 4DU1A 1RT5B 5DQIA 3OY9A 4CK3A 4RNFA 3QLHB 1QTMA 1RT3B 1MMLA 2HWHA 1SL1A 1RTIB 1SL2A 4ED7A 2VG7B 5C25A 3MEDB 3RMBA 1IKYA 4E0DA 4ZVGA 2W8KA 4O4GA 3KMQA 3AVIA 2P5OA 3SPYA 3KOAA 2V4RA 3VN5A 3M8SA 4LD0A 2ETJA 1KLNA 3M8RA 3SQ0A 1TKXA 2OPPA 5KFXA 3TQ1A 3IRXB 3VQ4A 4FXDA 3CM5A 2B5JB 3GIMA 3A2FA 3T5HA 1NJYA 2X6NA 1RTDA 1T94A 4FS1A 4NLOA 4Z4IA 4I7FB 1N6QB 3DI6B 1XR6A 2WRMA 3KK3A 3SQ4A 4NRTA 1BIZA 1F21A 5EDWA 5KFMA 3GIJA 3D28A 1J5OB 1S1UA 3QGHA 4CJKA 4PA1A 3MFIA 3P83D 3V1OA 2PYJA 1S9FA 2IAJB 1RYRA 3HJFA 3TI0A 4ED8A 2IBKA 5F8GA 1S1VA 4IR1A 1KVBA 3NAEA 2Z1HA 4PWDA 1DTQA 1L3UA 3NGDA 2AU0A 4K8ZA 1TKZA 3GILA 4KKOA 2W9CB 4TN2A 3VA0A 5KFPA 4CHQA 3MEGB 4MKAA 4B9TA 3OYGA 1S4FA 4O3OA 3V9WA 4Z4CA 3THVA 2PY5A 2I5JB 4FCYA 1C1CB 4J9SA 2AX0A 4Y1CA 4GC7A 5J2QB 3PHEA 4J2DA 4DL3A 2XO7A 2OPSB 4BACA 2YKMB 1MU2A 3SI6A 4ZTJA 4ZHRA 4M3ZA 2WTFA 1U09A 4JS4A 1XWLA 5F8MA 3BDPA 4J9OA 3DLEB 1RDRA 2P51A 4M3UA 3M8PA 3CFRA 4QCLA 3UDLA 4IG0B 3HK2A 2XGQA 3QEPA 1ASWA 4G1QB 3P1GA 4DTNA 4WE1B 4IRCA 4H4OA 3CWJA 4H8KA 2FVRA 1JLAA 3AVNA 1BQMA 3CFOA 4K4VA 5L1LA 3PZPA 1VRUA 3TR8A 3KIOA 2KFNA 5FDLA 4IDKA 1D9DA 1K1SA 3T3FA 5E41A 4AHRA 3CJ0A 4M41A 1HQUB 4F4WA 4ECUA 1C1BB 1RBTA 1XC9A 1WNEA 3OYJA 3B6PA 4NYFA 3HKWA 4CFBA 3MTKA 3PO5A 3OYBA 4MIBA 3K58A 4KTWA 1NK5A 4EZ9A 4M42A 1HQEB 3H4BA 3UIQA 3ZSQA 3E01B 4JV0A 4EO6A 5KFKA 2Z1IA 5C42B 1TKDA 3PX6A 2OPQA 2B6AA 4YMEA 3I8DA 1GOBA 2WOMB 5DGBA 5HROA 4ELVA 1UWBB 2QK9A 3AVLA 3KLFB 1QSYA 3RMCA 2AGQA 1LWCA 4K4UA 4O3PA 1B92A 1EKEA 4EBCA 4FLXA 2Y1IA 4KREA 1L3TA 4I9QA 5DGAA 4CGDA 1TV6B 5KI6A 4O3RA 1KLMA 3IG1A 5L1JA 4MFBA 4CJSA 1CXUA 2VG6B 4ICLB 3BQ1A 2RKIB 4CF2A 4KHMA 2DFEA 1C6VA 2WK4A 4DTSA 2HHSA 2E9TA 2WB4A 1S1TB 4CEBA 3KTQA 4ZMMA 1TK5A 3HO1A 2ZE2B 5J1EB 3AV9A 2JGUA 4TQSA 4CK1A 3V6DA 2YKNA 1S6QB 3NH2A 3PW4A 2YNFA 2XWYA 4Q0BA 1LAVA 1LW2A 1ZETA 3NGYA 1NJWA 5HP1A 4ZTFA 3EZUA 4B3OA 3SQ2A 3V6HA 3MF5A 1N4LA 1EP4B 4DG1B 4Q5VA 3DLGB 3WNHA 3L2UA 4DU3A 3QNOA 3GV7B 2FVPA 1Z26A 2J6SA 3LWLA 4FW1A
chains in the Genus database with same CATH superfamily
3LA0A 3DLRA 2BUPA 3F9KA 2PMHA 2LYVA 5F9NA 4HLBA 3SMSA 4C11A 2CGKA 3I9ZA 4CGIA 2BTFA 5LMNF 1JLGA 3PEHA 2YNIA 2MEWA 2FD2A 4Y2IA 1GFWB 2CQ3A 3M1VB 3V81A 4CT9A 1K9MT 2CPFA 3NAHA 5ETTA 2QSFA 3CD7A 2H51B 5A0YA 2A42A 4H0XB 2DCUB 2E88A 1LK5A 3FBBA 1WUAA 3TWHA 1FNMA 1Q81T 1REVA 2J0SD 1XN9A 1KCFA 4JI2K 4YOXA 5DDRC 1YI2N 4J9NA 3KHRA 3TVYA 4LSLB 2CQCA 1SV5B 2V51B 3TU5A 4N77A 4IOCL 3PX0A 2XSFA 3D6TB 1DFDA 3N0VA 2VG7A 3MEDA 1Y5NB 1HBMA 2OZSA 4NLVA 4OHXA 2CQGA 5B0FA 2HBQB 4JEPA 3H90A 4A2AA 4ZVOB 3KYLA 2GNKA 2K3IA 3O44A 2IA6A 3IRXA 1CXQA 4CECA 3CDAA 3IRWP 5HBMB 5CZ1A 4W5QA 2E5LF 5DLGA 3MECA 3OD2A 3FSYA 2HAFA 2ATLA 2ADCA 1W9HA 4P10A 2P9NA 4O44B 2CPYA 4J9MA 1RWVB 3DM2A 4WFAQ 5FPDA 3LM2A 2ZEJA 5KFOA 5F3ZA 4PY5A 2OO4A 2J9EA 2DNYA 4CZGA 4DSJA 1XR7A 4PL7A 3I82A 5JS1A 4TY8B 4LR7A 4DV4J 1FE0A 4F36A 2WHOA 3NGKA 1TAQA 4CBXA 1OH8A 2N3OA 4AFFA 1NPKA 1YRUA 1VQ4S 1IKXB 4DI6A 2V4JA 3D0GE 2W9CA 4BQZA 3HPGA 3J8AA 3MEGA 2Z56B 2KHCA 5H1SQ 1EETB 3OV7A 1G4CA 1B7YB 2V8HA 3I96A 1XEZA 2D0OA 2ZBCA 3MPVA 1SUQB 2DD8S 4CZEA 2J0XA 2YQ1A 3ZX2A 4V19J 5KFRA 3PYDA 2HHVA 1WSJA 3AA2A 1KXPA 3AA5X 4IYQA 2Z0GA 1NK0A 2O4GA 3WZ0A 4H4MA 1WOPA 2AP6A 2O1PA 1NMDA 4G1QA 4GV6A 2YX1A 1TMMA 1RT2B 4F67A 4WFBL 3TUIC 4ZCLA 4WF9Q 3KG0A 3MPUB 1HBUA 1M5VC 4N7TA 4WP9A 3ZZUA 2NLWA 1TTHB 3M9MB 4E8UA 1IG9A 1EB0A 3B6OA 3GZ7A 4CLTA 3R2CJ 1ASVA 4BRAA 1H98A 3KK7A 4BR0A 2DISA 2VONA 3SFUA 3MAQA 2A10A 3G4SS 3O6WA 2C2RA 4Y2MA 3R8YA 4LF9K 1LK7A 2EFQA 3VVUA 2KKHA 3B8HA 2L9DA 3CJ8A 1NJIO 1RHQB 3OXGA 3W61A 1JL1A 3OTCA 3KUGA 3PACA 5CHCB 4JKGA 1PCAA 2A3ZA 1V5IB 3DAWA 4WYBA 3MEEB 1ZZFA 3CD0A 2PGCA 1S9EB 3O5BA 4JKFA 2RHQB 3W9HA 3V6KA 3R97A 2V34A 3EGZA 1GLFO 2I0XA 3BEXA 2PMWA 4KI6A 1FD8A 1FERA 4ZK7M 3CXCR 3ENHA 3RMDA 3ENAA 1S5JA 3HX9A 3HHEA 1A5XA 2MY7A 1RT7B 4ICLA 3HD1A 4IG3A 4X4SA 5A8RA 4JI8F 3D1QA 2ZKTA 4RCHA 2E1RA 2LQ5A 1X4BA 2HYIB 4FYXB 3D4JA 2ZE2A 3PSIA 1VHXA 4BRIA 4ZCIA 2O8EA 4HI2A 4BDPA 3DLKB 2VA2A 3P3DA 4HHUA 2KM8B 3H5SA 2BJ1A 2DPJA 4R5PB 3ET6A 2Q66A 1YVFA 4DF4A 3DU6A 1EP4A 4DG1A 2DGQA 3EMTA 1U0HB 1VRTB 4ZP8A 2P9PB 1N32K 1P6TA 1RJJA 2FQQB 2R2TA 1VQ6N 4PG7A 2OD6A 4K4ZA 3UFCX 3C14B 3CO0P 3KLGA 1IBLF 2G2ZA 1WHXA 4YDXA 2BR0A 4NWBA 2JVRA 1I94K 3R7NB 1T11A 5IQQA 4BR5A 5IT4A 4ECSA 4ZPTR 4X62F 3KHYA 2HHWA 1PKUA 5K5MA 4LF6F 3G96A 4FJ5A 3MAAB 2CNOB 3LDQA 1U1LA 5KFLA 2J7WA 5KRTA 2HS3A 4QIGA 4K41A 2R8GA 1YJ9S 4HHHA 1WC3A 1ROFA 2GIRA 4O3NA 4A8XA 1Q9YA 4RBVA 1BISA 3R3LA 3QFHA 5CZVA 4UQGA 3R1LA 2VDHA 2UUBK 3UDVA 3PV8A 5H9FJ 4I6MA 3F5TA 2ZWHA 4H4KC 3B8AX 1QQOA 3HFKA 2VC1A 1WOOA 5KG0A 3J7YU 2QKBA 2QFJA 4AHTA 3PIOL 1H2UX 3M8WA 3T6JA 3ZSWA 5F8NA 3A1YG 1F6TA 4K8XA 4X64F 3OXLA 3KLIA 3FQKA 1R8AA 2RRBA 3VQ5A 3GQCA 3CQXA 3BBCA 3ZLJA 3QATA 1NK6A 4GKJJ 1PJ7A 5LMNK 2ASJA 3ASMA 1R31A 2Y0SD 5H9EJ 1NHVA 3S7RA 2A1SA 3TANA 4Y28C 2D1CA 3NY0A 3TA2A 1ESVA 1VSLA 4JD2B 1N52B 1RA7A 3ULEB 2EG2A 2MZSA 1MWKA 3PRDA 2BM0A 1HNIA 2QYGA 4I56A 4KI4A 1FD2A 1FT8A 4YFUA 3V2UC 3AAPA 2HVEA 4I9LA 2ZJRQ 2YX7A 4GVLA 1KS2A 4RUAA 3CJBA 3CQYA 4LIWA 4RUHA 2XY8A 4FKYA 4WYWA 1HHQA 4LBPA 3W2WA 3CCVN 2BABA 4DV6F 3J81U 3W65A 3W8GA 1CZAN 4CI0B 2CPXA 2PC6A 5HLFA 5I42B 2QI2A 4H0YB 4LRDA 3QT6A 1YGYA 1C0GA 3W3DA 3NP5A 3O2IA 2FJDB 4J9QA 3AA8A 3LGHA 2E5LK 2H3EB 4A47A 4P73A 3DGPA 3CF5Q 1D9AA 4CLYA 2LQ8A 4LF5J 2CAJA 3PJWA 3VQCA 2P1JA 3ITHB 2ALZA 3THXB 4ZVQB 4NL5A 3QBCA 2PI5A 5I3QA 2R9LA 2XHBA 1SQEA 1RAHB 2XM3A 3I32A 4FN5A 3SUQA 3MM5A 2WVFA 2RQ4A 1U4BA 1WI6A 4BE1A 3OSPA 3GOIA 4LRAA 2E1PA 1C0UA 3LP1A 2HGLA 3GYXB 3PM9A 1KN6A 5F8JA 2F1FA 2FF3B 3RW6A 4K59A 4TLQA 4KV8B 5D3GB 3L2WA 5A2QY 3FRZA 5B0CA 5CABA 2OEJA 3R5DA 1VAZA 4AILC 4MYTA 4KTZA 3DNCA 2R3VA 4I2PB 4DOZA 4YQWA 1YJ7A 3PY8A 2ZH7A 5M1KA 3NVMA 3N6NA 1LWXA 3ZT3A 1RBAA 1RWOB 1TUVA 3QIDA 2MSSA 4C8ZA 4NYZA 2BGGA 1OY6A 3ZNUA 2E2NA 5SWMA 1GQEA 5B0AA 1PC4A 5HMZA 4M5DA 5KAKA 4O3SA 4BE0A 4DSFA 3J7YP 1YZ7A 3ZCMA 3KK3B 3DYAB 2EK1A 4JNEA 2HIYA 1P27B 1F2HA 4FLYA 1M5HA 1S1UB 1IBKJ 2BVZA 1U48A 2LEBA 4E3SA 3JYTB 4O8UA 2FHJA 2DR8A 1RTIA 2C1EB 3FUYA 2JEIA 4U7BA 1WC0A 2G8IA 2ZBQA 3L09A 1TKZB 3N6LA 2HNDA 2FY8A 2V7YA 3SQGB 4G1IA 4DV2F 5HANA 2HNYB 2RNEA 3LWMA 4CZFA 1R0AA 5G4DA 1D1UA 4P2SA 4DMNA 2VA3A 4HDGA 5DK5A 1J54A 2ZGYA 1MWYA 3V1RA 3GE1A 4K4XA 3QGGA 4OKJA 3W8PA 4XH1A 2FZCB 2OKQA 4BR4A 3BO4A 2A6MA 1NCLA 1NM1A 1JLQA 2GS8A 1KDNA 4DS4A 5D4PA 3M6WA 2K2PA 5DS7A 5FRNA 2ZH2A 4IOBA 3JAMU 2KLAA 3VF0B 1X0FA 3CCUS 2D0AA 4BY9C 1HFEL 4RU2A 1CZ9A 3FJ2A 5C2GA 1O1WA 4LBHA 9ATCB 3G25A 5CCMA 2D3ZA 2YKMA 2VJUA 3EVOA 3HZEA 1RHRB 2RMLA 4BRLA 4IOXA 4AHSA 1IBLK 3MURP 1UVIA 1GLDG 3TZXA 4USVA 2H65B 3U02A 4JAXA 2MTLA 4Y3CA 2QWMA 4X62K 4OPHA 4LRCA 2NYHA 3C65A 1XUPO 1SJ4P 4WIQA 5HROB 4LF6K 5EX0A 2EFPA 1DHMA 1OYDA 4ED5A 3MM8A 1HWUA 5HK4A 4IQXA 3OTOF 2ZDOA 4UF4A 4YOWA 4UQTA 1NM2A 3MOZA 3R5JB 4PXCA 2J7KA 3FEZA 1UJ5A 3IG1B 1WORA 4ZVEA 4H0PA 1YI2S 3QZ8A 2NLXA 5IQ6A 4E2FB 3UVJA 3UN3A 2OYQA 2DPNA 5KFZA 4GO5X 4IO8A 1W0HA 3ZT2A 4B9UA 1HQEA 2JRSA 1R7IA 4JBCA 3CCLS 4P7VA 3PKYA 3AD7C 2B4UA 5AXMA 1X4FA 3DC2A 3O3LA 4X64K 1LW2B 2LA6A 1AA1B 3K57A 2Z2ZA 1WF2A 5M1OA 3L4BC 3KLFA 4DTMA 1RCHA 2E1AA 1PC5A 2AJ4A 1TV6A 2CPZA 2VKRA 1YX2A 3BBBA 5GMDA 1XQIA 2DRAA 2HWIA 3NF9A 3OR2B 4WFZA 4RW7A 1UAWA 1T7PA 2FLPA 5AQLA 2UV8A 4CJPA 2M70A 4ZJOA 2IM1A 1KQSM 1WG4A 2OUGA 1S1TA 2JSXA 3OYMA 2JZ5A 1PBUA 1RWKB 2NRTA 3MX5A 2IMWP 1BU6O 2AGPA 3CPWR 4W5OA 4ETXA 4IOAQ 3E9PA 1FEEA 1OH6A 4CJ5A 4FJ8A 3OS1A 2VIHA 4X66J 1YJWN 4LY7A 3OUYA 2JNJA 2V8PA 1FFSB 4DV6K 2NS1B 3EZ5A 1B0PA 3K5LA 2Q2RA 3HOSA 3DLGA 3B82A 2V0NA 1WC5A 5B0EA 1S22A 1WD6A 1BQNB 3D54A 1BCOA 2AJ0A 2QLBB 4A46A 4DX7A 4FJHA 4RW6B 2PFFB 3D1OA 1YVNA 1EXQA 4JI7J 4OLAA 2DRDA 4ZVUB 3IKMA 1HMVA 3MM9B 4ANCA 2CQBA 3VEWA 3VALA 4M3WA 4MK7A 1R89A 4WU3A 3L3VA 3CCEN 3M4XA 3NWRA 3NWGA 4V19S 3HFVA 1HBOA 4XPCA 3LALA 3NEKA 4KB0A 3QMQA 2GJ2A 4CHYA 4CF0A 3DLLL 5SZTA 3OR1B 2R2UA 3AOCA 3WXJA 3WC0A 2X6SA 1RT4A 5A6PA 1PSDA 4KTQA 5AQFA 3LW5C 3VEVA 3RSEA 2V2ZA 2V94A 1TKTB 4FF4A 1TELA 3IM8A 3M7VA 4UTGA 2P9UB 1R43A 2IIHA 1NGGA 4Z4FA 3MXIA 3C94A 4QS9A 4CJLA 4E7JA 4CYUA 4AL7A 2HMIB 1TK8A 3VGSA 4WFXA 3RB6A 3POTA 3H98A 1R0CB 3ZO7A 3SZ2A 1NJIT 5DM6L 4ILRA 5I3UA 2DCLA 4J2BA 1VS3A 1OVYA 2XY5A 2KFYA 3K0SA 4CEFA 3W63A 1P8ZA 4FJMA 5KG5A 5IC4B 5J2MA 2GVDB 4TU8A 3H5YA 4QIEA 2D0CA 3KWIA 3EL2A 1GNKA 2VODA 1AZSB 2V67A 4L8RB 1MA9B 4M3RA 5B0DA 1FKOA 2D0BA 4CZLA 5RUBA 1GLAG 2KXNB 3OYEA 2DGUA 4HTLA 4YB7A 4X4NA 3O9QA 3TTCA 4I6YA 1LWFB 1KFSA 4H5VA 5BR8J 2KW4A 5K8PA 1UA0A 2VYPA 3L9ZA 1SC4B 3D6FB 1VQ6S 2ATCB 1S7HA 2F3JA 1HL6A 2JHEA 4P2MA 2D69A 1ZA1B 4KHQA 1N34K 2ZGZA 4IDHA 3FZHA 5J1PA 2HZVA 4LMZA 1FE4A 3KUEA 2XCPA 5KFCA 1VQKS 1WHWA 1GOCA 2MKHA 3NF7A 2G8HA 3OYFA 3T6BA 3DHXA 2GHPA 2W9AA 3CCMN 1VSMA 4ZCMA 3LDSA 1VQMS 1SJFA 3Q8UA 3KHHA 1UAXA 3C6AA 2UVWA 3SNNA 1ZAVA 1TUWA 3MM7B 2FC0A 2E5JA 3TSUA 2ZD1B 1XK8A 2OFHX 4Z4EA 3W64A 2ASDA 3NBPA 4CZKA 4CH1A 4FK0A 4N5SA 4OJGA 3SLCA 2IOCA 1RT1A 1LEOA 3MDQA 1KVJA 4KHSA 3VQ8A 1NGIA 4C4WA 4DTJA 5J2NB 4U67Q 4FLVA 4YY3F 1QS4A 4QYZJ 3AO1A 3FFKB 1GLJO 4CO3A 3HRGA 3THYB 5CY4A 5JLFA 3EY1A 1FDBA 1YITN 1U8WA 4BLGA 1RILA 4NXNJ 4O4GB 3DRSB 2ADBA 4RW4A 3I5AA 4CHPA 3I5CA 3MOJB 3DWLA 4DX6A 3ALYA 1RHUB 5B8HA 2GA7A 4PQUA 1JNZB 4CTAA 4ECWA 1WKJA 3OTOK 5BPLA 3VEYA 3TX0A 3IS9A 3HHKA 3C7NA 1TMJA 4EEYA 2HS4A 1L3SA 4LVOP 3FDSA 5FRMA 3RRKA 3NH0A 4RU9A 1X5SA 3ZZZA 4D3GA 4F0HA 3SDEB 4JI6J 3S3NA 3A0IX 5AQKA 1B0TA 2VWJA 3CCVS 4EK2A 1OQ3A 4RNNA 2J6UA 4KH0B 3IAYA 5G0RA 1EZZB 3T9ZA 1S1VB 3X1LB 4CZJA 2Y8WA 3DOKA 2XG8A 4AQYJ 4FVUA 3CJ2A 3M30A 2XCAA 3F41A 2HZCA 3VZHA 1N36F 4TY9A 4KKOB 3HXMA 1S6PA 4K4WA 3RB3A 1OPIA 4KH6A 4BDYA 1BWVA 4B02A 2VBWA 4Q7AA 4CGGA 5KFYA 5HRSA 2QX0A 5LY3A 3HHLD 4PZVA 5DO2A 1HYVA 1TAUA 4NPOA 4FL9A 3NOGA 4DLEA 2QGFB 3D2WA 3M8PB 3G82B 4JOUA 1F9HA 4ECXA 2YJEA 5A6WA 3D2FA 1JMTA 2DNOA 4IOCQ 5D78A 4YHHJ 1RWMB 3NKYA 3VAFA 4FLWA 3KUHA 3MCPA 1RI7A 5MAOA 4B9SA 3A3PB 2MQLA 5BPNA 2HGNA 4HWIA 2IC3B 3ZSZA 1E4GT 2RRAA 3DDKA 2G8WA 3M6UA 1OY9A 3JTPA 4NLYA 3O3FA 2J9CA 5E0OA 3G86A 3JSMA 1ZAXA 3GIIA 1RLDA 4B9LA 2HHQA 2RHKA 2IJRA 3H3OB 4H03B 4FWKA 3MMAB 2HVDA 1O6XA 3FZMA 1FRKA 1EIYB 1WF0A 1FTRA 1LWCB 3T1YF 1HKAA 1P1LA 4DV1J 5GIOA 2H4WB 2RD5C 3LGNA 1SL0A 4FNHA 4H5RA 1KLMB 3R27A 3AVBA 4Z37A 5KG4A 5ETOA 3DOLA 2J76E 2HBJA 4FW2A 5BRFA 3N6MA 2A2CA 3V4IA 3VAKA 1Y3KA 3HDSA 3V9ZA 4Y6IA 4A59A 2QWOA 2QKKA 4EFHA 3DKDA 4JYAK 3VAMA 2IDEA 1W25A 4Q45A 1JIHA 3N28A 3CIZA 2RT3A 4U7UK 3G71N 4FWNA 1YIJN 2DNRA 4B3OB 1BXNA 3TA0A 3CE8A 4RL1A 2EFNA 2F8EX 5F0UA 2IHR1 3KHGA 1JLFB 4LBIA 3HT3A 1RFQA 2GGPB 2MQPA 2HNZB 2CZ4A 4JV5F 4M95A 2YQ0A 1SS6A 1XMQJ 4CJUA 1TYQB 2MLZA 3KHLA 1Q82O 3MMJA 1P90A 3SJHA 2PEBA 4JS5A 2MY8A 4Z4HA 2G1DA 3KLHA 1DLOA 3QRPA 4DWIA 4OV1A 2ALYB 2XB2D 4V19X 4ECVA 2Q1NA 1Y10A 2F9DA 3V81B 4QS7A 4CM0A 2GVZA 4PAAA 2BKPA 5A0YB 3J7Z5 2JJ4D 1UZHA 1WNSA 1MDUB 4QWAA 4LRBA 3F9MA 2MZRA 1NPRA 2H3GX 3PX4A 1REVB 3N5BA 1AB8A 2E6LA 3DMJA 1JK9B 2MYFA 5GAHI 5KT6A 1W2BM 1T9YA 3AOAA 4NLQA 1F2GA 3SSQA 3ENOA 1SIWB 2ABYA 4CK3A 1SQGA 1QTMA 1RT3B 2CPHA 5E3PA 1MMLA 1SL1A 2NPIA 1SL2A 4ED7A 2VG7B 3MEDB 2NRZA 1ICEB 2Q97A 4DCHA 3FCHA 1DY3A 3VN5A 3M8SA 3OHRA 2MPUA 2H5IB 2QIFA 3M8RA 1V6HA 3SQ0A 1IJFB 1TKXA 3A3OB 5KFXA 3ONQA 3IRXB 1NU4A 2B5JB 2RU3A 3T5HA 1IBCB 1NJYA 2X6NA 1RTDA 3SSRA 1N54B 4A48A 3WXIA 4FS1A 4NLOA 1NZAA 2WRMA 3U9DA 2P9NB 1EQ0A 1F0XA 3DXKA 2XS2A 4QS8A 5EDWA 1N33F 1MWZA 2RAQA 2BJ8A 2KL8A 3FRYA 1S0VA 1VLYA 3QGHA 3WQPA 1RAGB 4PA1A 4B3RF 2GHWA 1S9FA 1YBUA 4ED8A 4P6QA 3ISZA 2PFDA 1RLCL 1KVBA 4YY3K 5AQUA 4HH1A 1L3UA 3NGDA 4K8ZA 4WP8A 3CDBA 2V4JB 2W9CB 1HHSA 1HJOA 2IBOA 4UOFA 4PRFA 5KFPA 3C15B 1YF5L 3MEGB 4B9TA 1CBKA 4WFNL 1W7AA 3I56N 4TU7A 4FCYA 2QL9B 1NZ8A 5CYJA 4J9SA 2AX0A 4J2DA 4DL3A 4PR6A 4BQLA 2WTFA 1U09A 3W7BA 5EOYA 4J9OA 2HBYB 1RB0A 2YTCA 3GJSB 3G6EN 3C3LA 1XMBA 3CFRA 4QCLA 3UDLA 3VEXA 1WF1A 2CDRB 3D1HA 5DDQC 1AROP 4G1QB 3IWNC 3P1GA 4H4OA 2CG4A 1YJWS 3CWJA 4ZVSB 4H8KA 1NGHA 2JWKA 1JLAA 2YWFA 1HBUB 2M9KA 3LM9A 1FHTA 5AQTA 3VWSA 1YXQA 5FDLA 4IDKA 1D9DA 3V4MA 4FPBA 3AOBA 4EUVA 1NGAA 1HQUB 4M41A 4F4WA 1DQAA 3MMBA 1XC9A 3CJ1A 1N36K 5T7LB 3JXOA 1YSJA 2KI2A 4NYFA 2XYGB 5AR0A 4CFBA 3HM8A 2P9SB 3H4BA 5AQIA 1ZZNA 4EO6A 3CJSA 5KPRA 2D4WA 5MLCV 4ZIWA 2Z1IA 2XZTB 2UXBK 1TKDA 3PX6A 3CCES 4ELVA 3ZZYA 2HWTA 2XZDB 3VENA 4LFBF 5LXRA 4FLXA 4BR7A 1L3TA 5CZXA 1BA0A 5DGAA 4CGDA 3E9LA 4OJ1A 2I7NA 2HSEB 4O3RA 4ICLB 1FXLA 3H2UB 2XQCA 4NXMJ 1C6VA 3QBWA 1IR0A 2BX6A 1IVZA 2LA4A 4HI1A 2ZE2B 3A8KA 1KVKA 4TQSA 2PBDA 1S6QB 3PW4A 1WHVA 2RUSA 2XWYA 4WQ4C 2BM1A 2CQ2A 2MQQA 3BS9A 1V3RA 1NJWA 2AF6A 5FPEA 2FJBB 4ZTFA 3SQ2A 3V6HA 1CJVB 2GX9A 2O67A 2E2OA 3ET6B 4DR3J 1EP4B 4DG1B 2ZH3A 2P6SA 4GV3A 3WNHA 4DU3A 2RIJA 2XLKA 1X3NA 1XBWA 7FDRA 4PWWA 5DJBA 1L5UA 3IM9A 3KLGB 1FRHA 1XR5A 1GOAA 1Q5VA 3T1YK 2W42A 4OMFG 4LF4J 1RQ0A 2GHVC 4QIVA 1HNXF 2G1HA 3EPIA 3AA4A 4J9VA 2C2OB 2G0IA 4CEOA 3HP6A 1SBRA 4DV7F 3C8YA 4DR7K 1KBRA 4FWPA 1TFYA 1X9SA 4FWRA 4DPXA 1JJ4A 1RDUA 5HAOA 5KT3A 5K14A 4NEYA 3GFYA 3AY9A 1XHZA 5C12A 5ADZA 2CA9A 2DFFA 3L3UA 1JNRB 3QNWB 3NMUA 4C7QA 3QGPA 4DR4F 2W9BA 4I6MB 1PG5B 5EX3A 1WEYA 1FJGJ 2LU1A 2VV5A 1YWXA 1Q95G 1M90O 1SH0A 4JV5K 4XPEA 3OJSA 5DQHA 1JQGA 3KLIB 3AVAA 1E3MA 4YDUC 3CCMS 4FVMA 4QAGA 4FVCA 1B9FA 3OL8A 1E6YB 4DQQA 1YTYA 2RDDA 1SH3A 3VVTA 2JLFA 2CFXA 1ZM3A 1A7GE 2FBVA 4Z7YA 1M0SA 2VBXA 1ZAWA 5JVGL 3ENVA 4DQIA 3ZTOA 4DPUA 3NCPA 1ZTTA 3GMGA 1HNIB 5ETNA 2D74B 1VYAA 5CYMB 4CGJA 4YUDA 2Z30B 2E44A 4ZVHA 4OZ2A 4OPJA 3VESA 3VERA 2J7UA 2NRXA 2CQHA 4USKA 2GO9A 5AQMA 1U6FA 3L2QA 2HPUA 1T02A 4JI4J 1XNRJ 1RWPB 1YITS 3QQCD 3NDKA 3WHIA 3O3GA 2WAQD 3W2WB 4X65J 4CO2A 4JI3J 4L76A 1JLCA 3VEOA 3HVTA 4PYDA 1T44A 2GIQA 1RWNB 3J81Y 4FLZA 1EWRA 4UY8O 2I5JA 2W41A 3LAMA 4O3QA 2EK6A 2QA4N 1XNQJ 3R2DJ 2QWNA 2YNGA 1LKZA 3T1AA 3TEHB 3RB0A 2YNHB 2OJ3A 4R0EA 3C6UB 1X9JA 3THWA 3DLEA 1KVCA 5L38A 4WQ5A 3NOCA 2AKWB 2X74A 3M2VA 4F3QA 2ZJQQ 1N33K 4C0BA 2WSEC 1IM4A 3BSCA 2B4JA 2YH1A 2N4DA 3MCNA 5M1PA 5KGWA 5AZIB 2VC0A 2YWEA 4B3RK 1FVQA 3BN7A 2E20A 2UUTA 1ZYQA 1S10A 1NGFA 2F4VK 4ECRA 2OEMA 3AVCA 2VFSA 3MM5B 3I4HX 1UW4A 1PJ5A 2FC9A 1C0UB 5EWFA 1BWFO 2FSNA 2FSKA 3VQAA 4JUZA 2JLGA 1YBTA 3TA1A 5DRKA 2CVEA 3LF0A 4KH5A 4ED0A 4DV4F 1QLNA 5KFHA 3AQPA 1VQPN 2PN6A 3BF3A 2GFFA 1RTHB 1AXQA 4CFDA 4DCOB 1E6VB 4KO0A 5CYQB 2XYHB 4M5KA 1JXLA 2F63A 4O5BA 1TK0A 1WKKA 5CD4A 2GQCA 1UWBA 3HHNB 5CA5A 3SCLE 2MLYA 4B3MK 4BC5A 4RG8A 3UKUA 1O0PA 2DHHA 4GMJB 3RWUA 4FPAA 1J2VA 4ED6A 3CD5A 1HYSB 1IKWB 2VD3A 2EC0A 3QEIA 2L48A 2HRTA 1QUVA 4KB1A 1H3DA 3VQTA 3ZTQA 4CRJA 3QSIA 2A1BA 3QJLA 4FOIA 3GFZA 3IR7B 2DTJA 2YBVA 2Y1JA 3L2RA 2XZWA 1QZ5A 4MO5A 4R25A 2DIVA 4L3NA 2C3UA 2G4BA 4CD1A 1NLKL 1YJUA 2VQEJ 2CNNB 2ZH6A 1W97L 2CJQA 2Q0UA 5IZHA 2I8EA 4N47A 5FROA 1NDCA 2CQDA 5DETA 2ASYA 3MUMP 2DO4A 2HNDB 1Q0NA 3O6QA 3GDQA 1YJNN 4O0NA 3QDKA 2YWGA 1NJXA 4HT7A 3TSQA 5D0EA 2HW3A 2WONB 2EBGA 2R7UA 4QPXA 4TLRA 5D15A 4LFBK 1TVRA 1R0AB 5F8LA 4YB1P 1HPZA 2NUUG 1GLCG 3E51A 2FIUA 1J5EJ 2GV1A 4JP8A 3D45A 1S4EA 3DRXA 3MK6A 3PUFA 3GG1A 5AQXA 2FLNA 4MKYA 4UZCA 2BE2B 4Q43A 4JHDA 2RU9A 5D4OA 3HI0A 3K5OA 1JLQB 1CJTA 4FWOA 3J7YI 2ZH8A 3G71S 3ZX0A 2O8BA 2FDNA 2FJEB 1VCTA 1NB2A 2JDJA 5K8NA 8AT1B 1NSPA 1FRXA 3KJNB 2QWQA 1IG8A 4YOEA 2UU9K 1BL3A 3UKRA 3JAMY 5J2PA 2CIMA 4OHYA 2IY5B 2DGSA 1WC6A 4BRQA 4R8UB 3N4WA 1AUDA 1UEKA 3K89A 3EVWA 1R27B 3QB0A 3RBDA 3DLLQ 1HNXK 5CR4A 3ILJA 4C1NK 3EJMA 2ZITA 2MKIA 2DGTA 5KTQA 2DNHA 4DV7K 3NE6A 3CJ3A 2FLOA 4ISGA 4AXIA 3MMCA 3MM8B 2UYTA 1QHTA 1Q82T 4WTYA 1VSDA 4JI1J 2YWHA 1NKEA 4DR6J 1KQKA 3E2EA 1S99A 3VTHA 4KHPJ 4C0HA 4DR4K 1YZ6A 3UVJB 1JXEA 2HFOA 3EM1A 3NFAA 3PYEA 4DUYJ 2W24A 4FYWB 2FZKB 3Q8SB 1UEVA 4HTUA 3DFEA 5DM6Q 4DL0C 4C1NI 4DHYA 2J0WA 1U1MA 5KG6A 5EU7A 2OZMA 1F9FA 1NEEA 2IYGA 1J27A 2AYMA 3PFEA 3NCQA 4KFBA 3HMJG 4F4ZA 1T03A 2ZFHA 2PMZD 4FZVA 5BR9A 2KTQA 1BI4B 1XERA 5E3CA 2L3MA 2WC9A 1T9UA 4L75A 2ZOMA 1Y9OA 1PYOB 1OWXA 1A6LA 1NSKL 3PJ9A 4RW7B 3AVJA 2E6MA 1U47A 4BRMA 4YP3A 3NS7B 4WU2A 5JVHL 2DKOB 1X5PA 2VFTA 4ZOSA 4ZLNA 2FJXA 1HLUA 2K1RA 3DLJA 3GG4A 2XHCA 3TP2A 2EFVA 4KHNA 2O8FB 3I56S 1EJ7L 2KQ2A 3EXCX 5AQNA 3GG0A 4P74A 1T95A 4B1WB 3UN2A 2MKKA 4DV5J 2UUCF 3LZJA 5KOXA 2V6AA 2UXDF 4RZRA 2V4QA 5LSLA 2CADA 2F7VA 3G6ES 3NS5A 3EDQB 3NCRA 3JTNA 3OT9A 1DZ5A 5C25B 2XTJP 2CH6A 2ERRA 2C2DA 3CCZA 2O4IA 4FLTA 1GXLA 1QM9A 3VF6A 2M0GB 3B4MA 1HMVB 2Q6BA 2LFVA 2GAHC 4FJ9A 1YG0A 3CMAS 3OYNA 4GRSA 2CDQA 4C2MA 4KRWA 2FUG9 4I64A 4BRCA 4EHTA 3CMES 1FO1A 1X4HA 4GKKJ 3R1XA 7FD1A 3VQEA 4CEZA 4A8WA 4LF5F 3VHQA 1WBBA 3CC7N 1R8BA 4BG8A 2KH9A 3SV3A 4U7UD 2HQCA 4N41A 3AODA 2UUAJ 4IFVA 3CULA 3G87A 4USTA 2G8VA 5I3PA 2X78A 1SKSA 3ILOA 4KAIA 4B1UB 3B78A 1APSA 1BHLA 4DV4K 3SFGA 4OKKA 4WBFA 3FZFA 3AJ2A 3CW2C 4C8OA 4DZ6A 3CHWA 4PG8A 1DBDA 3GWCA 3WX4A 4J90A 2IGIA 2AJQA 1RWWB 4DFMA 4CYUB 2XI2A 3WXMB 3H5UA 1G6BA 1VBZA 1WI8A 4F9OA 2EXUA 3L4IA 3POTB 5M2UA 3I31A 4M5IA 3IA0A 1NU0A 5I3UB 1ZS6A 1MU2B 2BW7A 3IO1A 3VQ9A 1SC3B 4IEIA 4LQ3A 2LP4A 3CCJN 3FSIA 5J2MB 4DU4A 2XMTA 2GIFA 4PQAA 1QAJA 2R7SA 2IVOA 2L08A 3WX8A 5HVHA 2GQ2A 1HKCA 2C3YA 1CSJA 1IBMJ 3VEZA 1F1BB 1B70B 2M5YA 1XHXA 1BA1A 4NB4A 3ZTRA 1Q53A 1BQMB 1VRUB 4RW9A 2PSZA 2CPIA 4WFYA 4UZBA 5LM7E 4PKGA 3MM6A 1X5OA 1IBKF 3WT0A 5IWAJ 3IDHA 3LUYA 3CJCA 1WSEA 3MD1A 2X1FA 3NL0A 2RB7A 2MKJA 5CH7B 5ETSA 1T6DA 4B3SJ 1NJZA 3DLHA 4KIAA 3AO5A 2IPOB 4JI8J 3AVHA 1WBDA 3O08A 3TYTA 2KVIA 2JOQA 2MJUA 2OI2A 1VSJA 3CJKB 3NF6A 5CAAA 2IYIA 2JWNA 4X84A 3OFGA 1Q86O 4YNQA 2HLTA 3LAKA 4MFBB 1H7WA 1JLBA 3GONA 3R6GB 4YOUA 2EFOA 3NBPB 1IXKA 2D5RA 1GLBG 1S0MA 3O9UA 1JJCB 3W9JA 1GMVA 1CLQA 5B0GA 4KJIA 1I39A 3AGRA 1RT1B 1ATNA 4OI6A 3HJVA 2YNFB 4XAKA 1U26A 4Q0BB 2FVQA 5HP1B 1N5YA 5C5JA 3FBFA 4ELTA 5LMUJ 2NPFA 3VF2A 5AQHA 1KQGB 2OD4A 2XMKA 2WOMA 4CBWA 4RUBA 5KPZA 1XIQA 4NX9A 4WPAA 2P5VA 4RW4B 5LOQA 1QHAA 4OZLA 4DR2J 4DUTA 3NXZA 3SYZA 1YQHA 3ZZRA 4EYIB 3M32B 1JJ2R 1M90T 1R0BG 3CYMA 4PQUB 4Y2KA 2M3DA 4CTAB 4J9LA 2R8JA 2VG6A 1N0VC 3M9OB 3VZIA 2WBMA 3MXHP 1S0OA 3IS9B 2G0JA 4LSZB 3RZAA 2W7AA 1HD0A 2EI5A 1Z05A 3ZZTA 3MR3A 4LVNP 5HQ8A 4QU7A 3UCZP 3S41A 4LH5A 1UVMA 1RBUA 3WIVA 1VQLN 1Y5LB 5G0RB 4KRFA 5KFQA 2J8SA 3O1WA 4LQ9A 2DH8A 2DR6A 2KYZA 2Z1GA 2QA4S 4XH5A 2OANA 3M30B 2HFUA 5HJXA 3T19A 3SCJE 4UW2A 2QZ8A 2QLFB 2YHXA 1HD1A 4NZ0A 1Z6RA 2G9OA 4K25A 4FWMA 1Y7PA 4EO8A 2C2ZB 3BEGB 4ID8A 3M1VA 1OH5A 3T9NA 3CDUA 3OL9A 4GKJK 3RVCA 1RAFB 2R7YA 2ZH5A 4UY8T 3A5OC 4M5GA 4DTRA 3LO3A 1KWMA 5H9EK 3LH2S 3MR6A 5EUHA 2FC8A 1UVJA 2B9YA 2Q1LA 2V5HG 2Z8QA 1NG9A 4F4XA 3K7RA 3MGJA 4F4AA 4E7LA 1QE1A 4P72A 1VBKA 2J6TA 2MKSA 3EGWB 2VQFJ 1Z4UA 4HUFA 1VQPS 2YVSA 3PSFA 1RSCA 1WAJA 2JLEA 2LQBA 2APOA 4IR9A 5EWGA 5KFWA 4JN4A 1NK4A 3F2KA 3P31A 2W25A 3KLEB 3SI8A 4X66F 1RP5A 4DTUA 2D41A 4M45A 4YDUA 2CJAA 2LDIA 3L95X 2IMOA 3IGNA 2L9WA 3CTRA 1X9MA 1XMOJ 3H1QA 1UFKA 1HBNA 3FQLA 2EFGA 2CNLB 2IVPA 3PRVA 3MCOA 1RU1A 4ISEA 2XC9A 1ZBLA 2M52A 2DNGA 3O1BA 4BS2A 2HFVA 4AL6A 1U1NA 2GMJA 3IC1A 3AVGA 2HBZB 1U1KA 3HVRA 3I8BA 1RAOA 2IRXA 1SJ1A 4LF5K 1LWEA 3EE3A 4Q2MA 1ZBFA 3U6FA 3I5BA 1YUWA 1GT8A 3T41A 2VL1A 1VRQC 1WSIA 4WYLA 3CQ8A 2GC8A 2VOOA 1HKBA 4H54A 4JI0J 1IKXA 4A62A 3KJVA 3U1NA 3CDEA 1LFPA 2V68A 2BH1A 4DPYA 2CJYB 3D2EA 3P6YC 1EETA 4F25A 5K20B 1EWQA 3RUBL 1SUQA 1GK8A 1UOCA 1WG5A 3G0ZA 4DMZA 4AHVA 2CRLA 4JRQA 1VMBA 5BJRA 2F4FA 2OMOA 5C0YA 2FBTA 2ZHBA 3CJRA 4OPAA 5F8HA 1RWXB 4DL6A 5JXSA 1HNVA 3HSGA 4DL2A 5AJ3J 3DU5A 3KLHB 3D7EO 2M2BA 4MIAA 5DM7Q 5JMVA 3FBEA 4ZIVA 2FY1A 4PHTX 2GMHA 3BYRA 3BN4A 3IBFB 2QWLA 2GVZB 3FFIB 2FBXA 4NCGB 1P8GA 1SQFA 3IR5B 3BKTA 4RTFD 3CPWM 4FPRA 2NXJA 5GAHP 1RHMB 3DMJB 1IBKK 3M5RA 2HURA 2GTDA 4DV2J 4OQJA 1UA1A 4IEEA 2DRBA 5KFGA 1QY7A 2CWXA 3NGSA 2OHDA 5BR8F 2DGVA 3GIRA 2KVQE 3J80O 2E4LA 1HI0P 4B3TJ 1NSAA 1V9OA 3L8BA 2GZOA 1FWKA 2QTWA 1S1WA 3ISNC 1U2VA 4U9RA 1TKXB 3M8ZA 4O8KA 2XSJA 3ELHA 4IO9Q 1RBOB 4FYYB 2QN6B 4QQBA 1KQSR 4LJMA 1RTDB 5KQDA 1VSEA 2C2NA 3MPWA 3CUNA 4DL5A 2YQ3A 4EHUA 4OHVA 5C2FA 1Y97A 2BZ2A 4MO4A 4KQZA 2MZ1A 1IN0A 1C1AA 1DKGD 2YKAA 4DSIA 4EAHD 4EYHB 5LSOA 4ZVTB 3ZYYX 4ZPBA 3JS9A 3KK2A 1SC1B 5CD4H 3AQOA 2BRLA 5FLXO 1M5OC 3SBGA 4EFAC 2ZZMA 2DGOA 4HYKA 2X1GA 2Y3YA 1Q7LB 4ZVFA 2UVVA 3KNGA 2P9PA 2DGWA 1GTHA 4RW8A 2EG1A 3OTDA 3RAQA 3C14A 4A8YA 3QJPA 4PUOA 3R1HA 2DEJA 1OYEA 3J7AP 2U2FA 4CI6A 3D5MA 4F3MA 4DSLA 3U3GA 4F04B 4NXNF 2LQJA 1VHIA 4KYZA 4ZVRB 5BYRA 1CC7A 2COLA 3CC4N 3EICA 3HOTA 2YY3A 3LZIA 3CCWA 5L1KA 1L3KA 4F0KA 4UT4A 1WDDA 4H4OB 3OW2R 1P1TA 1X8DA 1JLAB 3WUHA 3H59A 2KN4A 4NA2A 2P5GA 2XMVA 5FDLB 4IDKB 4F26A 4BRHA 4HCBA 4JI6F 2MGZB 3KWGA 4ILGB 4QOZB 1TL4A 4WF9L 4J91A 3F73A 1BQXA 4HVZA 3MMBB 3RRHA 3NHGA 1HWLA 3MCSA 3CJQA 3R7BB 4C0OC 1I3AA 2AZ1A 3H40A 1H2TZ 2XNRA 4NLBA 2RJZA 4ZPVR 1MN9A 1MMNA 4FDFA 2IVMA 4C8YA 4F8RA 3GCWP 2VICA 4WK3A 2I6WA 2YHYA 2OEKA 3CDWA 4W5RA 1SKUB 3GFHA 5A8WB 2A6OA 3RBEA 4KGMA 4Z0UA 1S0NA 4E1JA 2WVDA 3QIOA 2KB2A 4PABA 1HJRA 4A8MP 1QJHA 1CQMA 3O1LA 4BHQA 3CC7S 4ILHA 2VGNA 1HR0J 3MAHA 3TABA 4RX6A 3NVKA 4WJBA 1TP7A 4BREA 1XTZA 1PILA 3MR5A 3QNNA 3AXMA 2HHPA 5HMXA 4JK7A 4ETZA 3IR6B 4A2BA 4BBYA 3H20A 2R8IA 4YOYA 4JKDA 4M5MA 2RSQA 3KDNA 5HO4A 3H2LA 1HI1A 1WOQA 3OYIA 2KG1A 3BSOA 3RR7A 4BVPA 4X66K 4K5RA 4NCBA 4ECQA 1S97A 3CCQN 1T3OA 4MKVA 4U7CA 2EHGA 3HLUA 3HSZA 5T7BA 3KDOA 3MFHA 3O4NA 2IRYA 1RNHA 1MWMA 1RT6B 1WTFA 3CCJS 1X4AA 2BQ3A 1YTUA 1NGBA 4F50A 1TUYA 2N7YA 3L2VA 2I38A 2HGMA 3Q8PB 4QU6A 1L3VA 3C6TB 1G2EA 3MN7A 3TZZA 2P9LA 1UMJA 4E98A 5MLCQ 4U6PA 1FNOA 1K0TA 4JV2A 5CE3A 1JKHB 4U95A 2O66A 2IDOA 4K0KJ 4QWBA 2ZUGA 3T1HF 1XQSC 5K14B 4OYAA 1ZH5A 4BCAA 3HPHA 3LP2A 4KPYA 2IVYA 4I0WA 5D3GA 8RUCA 2EX3A 4DU1A 2PDAA 3B6BA 4JK9A 5DQIA 2QO3A 1EKRA 4RNFA 2OTLN 4DR1J 1FRIA 5GINA 2HHHF 2K06A 5CCLA 2A5XA 3BPDA 5FIIA 4E0DA 5E3AA 3EN9A 4DQ8A 4PXEA 3SPYA 1LNQA 1QVGR 3CIPA 2ACMA 1S72N 3VQ4A 4FXDA 4FPIA 2KU7A 4XK8C 2G2OA 4YOTA 1XMQF 3TPQA 2DITA 4Z4IA 1QQMA 3KK3A 3SQ4A 3QWUA 1X0PA 4F7VA 5HSPA 3GIJA 3D28A 1J5OB 1S1UA 3I6PA 2K3KA 3GTYX 2YPYA 2JX2A 2HRYA 1RYRA 5IT9O 2IBKA 1AW0A 1VR6A 4CW7B 4M5JA 3NAEA 2YHWA 3EWGA 2Y9HA 1Q86T 4JK8A 1DTQA 3R5GA 2AU0A 5BR8K 1TKZA 3AJDA 4AL5A 2ZJRL 4CBUA 3VA0A 3EUNA 2C3MA 4MKAA 4W90B 1H7XA 3QAEA 5BRHA 4O3OA 4OI4A 4ZKAA 2I5JB 4C48A 2OPSB 4PXBA 2P9IB 4ZHRA 5U47A 2B9EA 3THWB 5F8MA 1G1XA 3M1FA 1VHFA 4DKWA 3DLEB 1RDRA 4M3UA 1UL3A 2AMCB 3M2VB 3QJJA 3R5BA 2E5GA 3GSDA 4WE1B 1VQLS 1D8ZA 1GEHA 1T9XA 1NMEB 3BH6B 4PKDB 3UN5A 3LPEA 3NNAA 5L1LA 1M5KC 5AE1A 4DZDA 4TKTA 3J7A1 4R79A 5E41A 3P96A 3UDEA 4LF8J 4AHRA 2HEKA 3ZEUB 3CNQP 4OJHA 3FZLA 3AT1B 1IUJA 4ZLPA 3B6PA 3FVYA 3HKWA 1SAZA 3MTKA 3K58A 3HSDA 3MN9A 1NK5A 4I4BA 4C6AA 3UIQA 4DX5A 5E33A 2BMBA 5KFKA 2DVIA 4ER8A 4QYZK 1NDKA 2AEJA 3JB9k 3US5A 3UNGC 3G9CA 2MZJA 2B6AA 5HROA 1UWBB 4NXNK 2QK9A 3AVLA 1QSYA 4J5OA 2AGQA 4U96A 3V5RA 4K4UA 3THTA 3P5TL 4O3PA 2LMIA 1IWAA 3UKUB 3VR1A 4LFCJ 4QPTA 4CJ7A 5DZ6A 5LJ5Y 2H5JB 4KREA 1IM6A 2HF4A 1URNA 3VGTA 3IG1A 2H5EA 4OX9J 4LR9A 3TEGA 2R7VA 4CJSA 4ATNA 3N9UC 1HUXA 3BQ1A 5EHHA 2RKIB 4KHMA 2OELA 2NXUA 2RS8A 3KTQA 4K2JA 3SBMA 2JGUA 2YKNA 3Q89A 2B9XA 2JH3A 4JI6K 2EKNA 1VC6A 1LAVA 2XBPA 1LW2A 3A4TA 5K9FA 2A3JA 3NLCA 3BGUA 3ENWA 2IRUA 3MF5A 1HKGA 3OVSA 3IFEA 1N4LA 1YAGA 1U6BA 3DJCA 4DV3J 4GO7X 2O01C 3L2UA 2HKEA 1V4SA 1R8PA 4AQYK 2FVPA 1GMWA 2P6TA 2J6SA 2XLJA 3H3NO 2AJ2A 3P49B 1KFDA 1NH8A 2NXNA 1RDAA 4WTOB 1F5AA 1JLEA 5JVHQ 5TKWA 2VWBA 2KXHA 1VC0A 4OJ3A 3OR2A 1ACMB 1NO8A 2E9RX 3S6EA 4I67A 4IKAA 1HPZB 2VFRA 5AXNA 2VB6A 2GO8A 1RZMA 4LRFA 5M1QA 2AW0A 2YX4A 1YDLA 2VPZB 1PIEA 4M3XA 1TUGB 1F60B 2F9WA 3BF4A 1HQ2A 4JHDB 2CQPA 5C24A 1CJTB 4ILJA 2VFVA 1W2BR 3BR8A 3DRRB 2O8BB 3PNIA 3QT5A 4M5HA 4NXMF 1WSGA 2J0QD 4YHHK 1SH2A 3KKSA 4H0OA 3CJ7A 4DV0J 1RT5A 1BQNA 2XS5A 3UKRB 2Y8YA 4ZJQA 3ZZOA 3BO2A 3CIMA 3LANA 3P8BB 4A4JA 4DUZJ 4TSXA 3A8EA 1N34F 3ZZPA 2ZWOA 4CFAA 2HBRB 1RHKB 3G6XA 4LUBA 2B8PA 2VPWB 1E4FT 4XH4A 3TZWA 1RAIB 2AYEA 4I7FA 3DI6A 4Y1DA 1RCOB 4ANDA 3H46O 3MMCB 1WWHA 2XS7A 4FO0A 4LF4F 2JEJA 2ZC3A 3KXDA 4ALZA 2PEHA 3T1HK 2QRRA 3H7HB 3HZGA 5K8MA 2IAJA 2I2YA 1FCAA 2DEIA 1SZ2A 4CESA 4IFYB 4ECYA 3D6HB 3OPKA 3Q8YA 1IJJA 1YK9A 3JSRA 1ITGA 1CJKB 5HJYA 4NLCA 2HHHK 3GYNA 3VQSA 2R4FA 2HMIA 3BGOP 4IRDA 4JKBA 2X1BA 3MMVA 2VDIA 3BR9A 2D1KA 1FKPB 4OZJA 3P5BP 3T69A 2HG4A 3FMWA 4B9NA 2W7PA 4ZLJA 3GPAA 5HVGA 3OVBA 3M6VA 1XMQK 4DN0A 3TARA 1JXVA 3SMZA 2ZC4A 2E9ZA 3AFGA 1TL7B 3GU0A 2K7KA 2DBBA 4N8NA 4W5TA 4QOTA 5CQGA 3U8XA 1D09B 4IO1A 1DGKN 2GQQA 4GMKA 3DXBA 3MTJA 3OS0A 1RTJB 1HWJA 4W92B 1ZBSA 4B8AB 1S6UA 4QW8A 1IKVB 4A8KA 4IH5A 1EKSA 3G6YA 4AT1B 3FEYB 1C2PA 4DPWA 3UO0A 4URGA 4F4KA 4AE5A 1IR1A 2Y0BB 4XO0A 4NRUA 2K1RB 2QV6A 1O13A 2ZNYA 4HL9A 3W60A 3OVAA 2X1AA 2VUGA 2E1MC 2RDIA 4JI4F 1XNRF 5C15A 2NXCA 4FJKA 4TYBA 4NYNA 5C42A 2N82B 4X65F 4JI3F 2QXLA 4ZPWR 4LFAJ 3L0QA 4MT1A 3EE8A 4J2AA 1B4SA 3ILLA 3M6GA 2ACYA 2F5GA 4LH4A 1Q8IA 3OYCA 1KC8O 1ZPWX 3UNYA 1MN7A 3CC4S 5E5NA 3FZKA 2NRHA 4MLEA 3RMAA 4PG4A 3IMXA 2VH7A 1TU0B 5KT2A 3SJJA 1HWKA 1VBXA 4AH9A 3EKSA 1Q8LA 3FSXA 2NCKL 2FGOA 2BQRA 1NNEA 4I1TA 3EZOA 5J1EA 3ADAC 4NLSA 3R9PA 4CJWA 5J2NA 2BW2A 4BR2A 2QYCA 1T0TV 2MQOA 2EWHA 5F3TA 1WELA 2O5DA 3NG8A 3KKFA 3MI7X 4CIFA 3KD5E 3PW0A 4B1YB 2QMXA 3OQ2A 1LQ9A 3O9TA 4P9SA 3HSCA 3DRSA 1FXDA 1Z2LA 2C28A 1DJ0A 3FR0A 2MKYA 1KOOA 3C95A 2UXCJ 2QL7B 1HARA 4FJNA 1RWUA 4K4SA 3IFRA 2F65A 1FDDA 1RDBA 3R3TA 3S8SA 3SUOA 5EY4A 1FWPA 1RBRA 5F41A 4MAKA 2B56A 3SDEA 3C16A 2X7IA 3ZTSA 1IWGA 1T9WA 2FBYA 2CVIA 2LECA 4USIA 1HRHA 4WZMA 2Z57B 2H1YA 2AD9A 4MYUA 4H0TB 1V5VA 4RW9B 3QFPA 4IKFA 4FJXA 4JYAF 4IH6A 4YR0A 1S7IA 2VG5B 4CHNA 4M3YA 3CSKA 3MM6B 3HFZB 3AVFA 3HULA 2XI3A 2VQEF 2WBNA 4CZMA 4FNIA 4G6VB 1HNZJ 3M05A 3QIPA 2I1RA 2QFIA 3LP0A 1GH8A 2KFZA 4JI5J 2IVFB 1MSWD 2E66A 2EVZA 4URQU 4WZQA 3GV5B 1OJ4A 2OMLA 5B7WA 2LU2A 2CKWA 3ZT4A 3G82A 2OA8A 1S76D 1FI4A 4CNYA 4XTTA 3PFOA 1Y64A 4PG6A 4DB3A 4HTIA 3KG1A 4DX8H 2B0GA 1SJ3P 4A8OA 3Q22A 4WQ5C 3MUVP 4EMDA 5CHIA 1ZPVA 5HN0A 3HZ6A 4KGVB 2M88A 5ETMA 3CCRN 1JLBB 1EX4A 2IC3A 2WCXA 2HVZA 3THPA 2BEFA 4NXMK 5L9XA 3ZETA 1FESA 1GLEG 4CO5A 1I3OB 4K4TA 2OTLS 2UVUA 3SAHA 3I0SA 2CJKA 1BLUA 2P9CA 1C0TB 2B4PA 3UQSA 3TUZC 4OJRA 1S1XB 1ULRA 4O0IA 3W1YC 3TOQA 4KGKA 2LXUA 1S72S 1N5YB 4CQ1A 1SI9A 4CO0A 4DR3K 2XRIA 5HRPA 2BJDA 3KWMA 3G10A 3MMAA 3LPUA 2CQ0A 3WQUA 1LW0A 2EPIA 3UR3C 1U6ZA 3RBXA 1BMQB 1NGDA 4CEDA 1HPMA 4CE9A 4FF2A 1N5SA 3SBTA 1NK7A 3ULDA 4OV6A 1HLWA 1S9GA 4KHRA 1FWLA 2LKZA 2AT1B 5IT9U 4EBEA 2AWZA 4E1MA 1V3SA 4LF4K 4XIUA 1RAJA 3CM6A 4HEA9 3U1LA 4USMA 2B8QA 4FXWA 3V1QA 1FEHA 3T5LA 4JI1F 1ZM4A 1OS5A 3P45B 4DR6F 1TQLA 3VA3A 5EX5A 3OTEA 3W2VB 1NKBA 4KHPF 4WCEL 2AQ4A 3TAMB 1JLFA 2ROEA 2GJIA 2YWKA 5KFFA 2HNZA 3RGIA 1NDPA 2H48B 2QG9B 4DUYF 1FJGK 4F2SA 1U2FA 2ASMA 1OO0B 1NGEA 2I7PA 3ZSYA 5JUMA 2YV0X 1IKYB 2DR5A 4G9ZA 3EE9A 3U7JA 3NNHA 2BJEA 4CCHA 3Q7BA 4CT8A 3BB5A 1KHWA 2SXLA 3MXMA 1U0SA 4FJLA 1NMNA 2B9WA 2R2SA 1FDNA 4RR5A 2YKOA 2ZH9A 2ZM6J 5ETLA 2BYCA 2ASOA 1FRJA 3FEXB 1SVDA 4FYDA 3CCTA 3D0IE 2L9NA 1X7VA 4CO4A 4DPOA 1JWWA 5LT5A 3FKBA 1VIXA 2RPIA 1TGOA 4HUGA 3GE9A 4FM1A 1AT1B 1QE1B 3GV8B 3QERA 2RH3A 1Q1KA 5IM0A 4KH4A 1YJVA 3OTBA 3PIPL 1RT3A 1SCJB 2N4CA 3Q0AA 2DO0A 2BACA 4YN3B 2R7OA 4JI4K 1XNRK 3PRBA 2NRWA 1HNWJ 4KBIA 1D8YA 1R6VA 2DFHA 3CCLN 4X65K 4JI3K 2PA3A 1GX5A 2B5JA 3NGTA 3DOMA 4DU7A 1HBNB 5KT7A 4DV5F 4K5SA 2CWKA 2HQ3A 2RF2A 1XNQK 2UXBF 3K8WA 3BREA 3D7SB 1U1OA 1ZA2B 4FOEA 1N8RO 4YR3A 4EIAA 4CJVA 2X51A 1IR2A 2MZQA 1KRPA 2F8SA 5THWA 2E2PA 1KHVA 3C19A 3M2UB 2ITGA 4MDBA 1KVIA 4OFZA 4J37A 2NRVA 2DK2A 3G2XA 3OHAA 3CERA 4IXCA 4RNOA 2ZH1A 1LWEB 3R5CA 2HS0A 2ATQA 1WEZA 2Y1RI 4MK8A 4OYZA 4GKKF 4CIEA 4OI2A 1U2CA 2KG0A 2XY6A 3KJVB 2KDOA 4CHOA 4OYMA 1CS4A 4FJIA 2UUAF 3C15A 4FJJA 2YWWA 3D2EB 1VQNN 1X5TA 3BGRA 4PXDA 4AHUA 4CLLA 3NF8A 2CPJA 2C42A 3HKZD 4GW6A 1XC3A 2JFKA 4TXSA 3AO4A 2O8DA 1IJEB 4G1PA 1MROB 5DLFA 2VPYB 1VSHA 1Y5IB 4DU8A 1TL3A 4R0JA 5KFTA 5DQGA 1HNVB 1S5ZA 1HYZA 1VI7A 1UFLA 5CZ2A 2J4RA 3DCAA 1D9FA 4JV1A 3LTOA 3MN6A 1VK3A 4OYWA 2OFGX 4B17A 2RQKA 1RKIA 2ZF5O 1U1RA 2CPEA 4CHZA 1S57A 2FPHX 4DR7F 3PDNA 4JLHA 4O55A 4HACB 3KK1A 4KHYA 1HQUA 2I9SA 2YCHA 1FK9A 5T7LA 1LXJA 3QBXA 3V6DB 3UE2A 3IGVA 2P9SA 1IBMF 2YKQA 2HVHA 3SMPA 4GVBA 4DQPA 3OHBA 3ISND 2G2YA 3NGIA 2VQEK 3BJYA 4A8QA 2DPIA 4NLGA 5A8KA 2R42A 3IWLA 5JMNA 3K5PA 2CGLA 2KXFA 5AQOA 3L7UA 5IWAF 3ZX3A 2P9EA 4C8MA 1S1WB 2DNNA 1U2VB 3PCOB 4WFBQ 2ZJPL 2XSJB 3D0PA 3K5MA 4RBTA 4KB7A 4C11B 3L6QA 4QIFA 4B3SF 3QPIA 1JLGB 4OZ3A 4FF3A 4A5AA 2YNIB 5F8IA 1J5EK 1S59A 1GXUA 2K7JA 2ILYA 3E66A 1RYSA 2B7CB 2C2KB 1S6QA 1A9NB 2ZZNA 3PTWA 4DBQA 3VGMA 4EWTA 2V9KA 4DCJB 2AX1A 1OMSA 2GUIA 3KK2B 1KEKA 4Y2CA 2H54B 3DRPA 3NMAA 1CJVA 1QSLA 1HHTP 4DR5J 4NLTA 1DURA 1NHKL 1FKAF 3AA3A 3CD6N 3SCKE 4Q2LA 4KGXB 4ZLLA 5HMWA 4RW8B 5C2CA 4FJ7A 5KG7A 2BE9B 3UD3P 1CC8A 4J9UE 3TUPA 4PUOB 1H6KX 1B7FA 1HBMB 3LQVA 2XGPA 1CEZA 1IV0A 4NOHA 3ID6A 3LP3A 4KBOA 2W2MP 1BE4A 5LMUF 3MN5A 4OZ1A 2F40A 5E26A 1U7LA 4C8NA 5L8RC 2Z1JA 2FJWA 4BRPA 2LQ9A 3SQ1A 4PYAA 1VQKN 1YJRA 4Y0FA 5LSRA 4DR2F 1T8EA 2DNLA 4CLWA 3RTVA 3AVKA 2YHAA 3JSBA 3TAGA 5ETVA 4EBDA 3MECB 2B4VA 4C3KA 1VQMN 3I87A 2GBZA 3LL3A 3DM2B 4DQSA 4OIXA 4JI1K 2BANA 3FGVA 4QWCA 4DR6K 2FGCA 3IXQA 4ED1A 2YXLA 4UY85 2CQ4A 4ILMA 2F4VF 2MDAA 4KHPK 1KD1O 4D3HA 5AT1B 2YI1A 2ZOGA 1D0EA 4FWSA 4DUYK 1UFWA 3BZKA 2J9DE 3ICLA 3BQ2A 4LF7J 3OSNA 1RAAB 2KZZA 1ITPA 4XEIA 3UD5A 3ENQA 2HHTA 3VGKA 1E6YA 2FZGB 1RAEB 4CK2A 3TWZA 3MHYA 1N5VA 1CJUA 4U8VA 1JX4A 1DQ8A 5HRNA 3HI9A 3DXMA 3JSYA 1T05A 1DTTA 1H73A 3OFEA 4NYOA 4N76A 3LPYA 3QRRA 3HF5A 3N5FA 2HFSA 3GB0A 3AB4B 3M9NB 1M1HA 5T41A 4BR9A 3Q8QB 3A12A 3HBTA 4B3MF 4B9MA 5CYMA 3ILIA 1KC8T 4H4MB 1TFWA 2DNPA 2WZ1A 3TQEA 2QC3A 3TZYA 3PIOQ 2ASLA 2FJVA 5HQLA 1UTAA 4NLXA 1F9EB 1BY9A 3MR7A 1NSQA 2UUCJ 3TTFA 3OYHA 2UXDJ 3FK4A 4YDDB 2XMWA 3QZ7A 3K2YA 4I2QA 1U1QA 2W6KA 3O9SA 5IS2A 4ZITA 3AXKA 4LSNA 4LC9B 1X31C 2GX8A