2BANA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 subunit
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
total genus 128
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2banA05
3C95A 3ZT3A 4DF8A 2G8WA 5CYQB 4XPCA 3V1QA 1BGXT 3VQCA 2G8KA 4DG1A 4F4KA 4PUOB 1NJYA 3V1OA 1N4LA 4W5OA 4MIAA 4CHOA 3LPUA 2DPJA 3BJYA 4FM1A 3OYIA 2DFEA 2BQUA 5DG9A 4NLPA 2R7YA 3QGIA 5HBMA 2UVRA 5I3UB 4TN2A 4QWAA 3SQ4A 3PX0A 2O4IA 3DYAB 2W9AA 1K1SA 4CJ5A 3QETA 1LW0A 5KFMA 1HYZA 3NAHA 4EP5A 5CYQA 2A1SA 3GILA 3KMQA 3CDUA 1W9HA 2HHVA 3I0RB 4ID1A 2ILZA 5KGWA 3IS9B 3OYBA 5KRTA 3ZSQA 3FSIA 3AO1A 4IG0B 4K8XA 1RBTA 2GIRA 3DOLB 3NGDA 3OYAA 2ASJA 1IKXA 3E01B 2D41A 2IC3A 3I5CA 3TAFA 1LWFB 1IM4A 2HHUA 2E6MA 3ULDA 3BDPA 4FK4A 1JLEB 2D7SA 3CJ5A 2HB5A 4RU9A 3QEXA 4RW6B 2VG7B 2B4JA 1UA1A 2P5OA 3HSTB 4G1QA 3NBPB 3V4IA 1HQUA 3HT3A 3G6VA 5KI6A 4ZTFA 3MXMA 3HVTB 4RNHA 3HYFA 4AILC 1C1AA 1L3UA 3UPFA 5D3GA 4QAGA 5F8MA 4EYHB 2VA3A 2QV6A 3LAKA 4TQRA 1VSMA 4ECUA 4J2DA 1LWCA 1RTIB 1S1XA 4Z4IA 3KK1B 4K4YA 4N76A 4IDKA 5DQGA 1YVFA 1ZBFA 3QZ8A 4NYZA 2C2EA 1XR5A 1T94A 1Y97A 2YNFB 4DWIA 2X74A 3KHGA 1XR7A 4IH7A 3VQPA 3KMSA 5J2MA 1GX6A 4TY8A 1S1UA 5K14A 4OLBA 3PJWA 2X6NA 2AX1A 3RBEA 4KO0A 4JV1A 4OL8A 2V0NA 1BL3A 4FJLA 3DRSA 4CF8A 4Z4EA 3HVAA 4NLWA 3V6HA 4DS5A 2X6SA 2YKNA 1HPZA 4YP3A 2OZMA 4IKAA 4YNQA 3L3VA 3KIOA 3GIMA 1VRUA 3LZIA 3RMAA 4FJ9A 1JLFA 1D0EA 1VRTA 3L2UA 4B9VA 5KFNA 2D5RA 3I0SB 3TARA 3KHLA 3Q8PB 4B8CA 4CFBA 5DLFA 4KHSA 2GUIA 4LSNA 3VQ9A 3GQCA 3CIZA 3DDKA 3RRHA 1XR6A 4CK2A 4G1QB 3RTVA 5F8LA 4HUFA 4TYBA 4IH6A 3U6FA 1CZ9A 3PO4A 3C6TB 1WSFA 3LP1B 1R0AB 3L2VA 1KFDA 5JS1A 3NCIA 5C25B 4FJXA 4E19A 4CJUA 3L2WA 2CJQA 3DRPB 4WFZA 4Z4HA 1QSSA 1JXLA 2IDOA 4F2SA 3KHRA 1RDBA 2HHXA 4KPYA 1F21A 1HNIB 3HVWA 1C1BA 1S0MA 2IS3A 2ZD1A 1KVCA 3VQBA 3KLHA 3PJXA 3SUQA 3K58A 1ASVA 4IR9A 3NGYA 1QHTA 4G3IA 3UDLA 3M8QB 4ED0A 4EBDA 4CIGA 5KFHA 4LH4A 4IG3B 2YNFA 3EY1A 4CJ4A 3TAMB 3ZSOA 4J2AA 3DM2B 3OLBA 2XCAA 1NK6A 1TK8A 1RBSA 1SKSA 1VSHA 3V6KA 4YQWA 3MEDB 3OY9A 3GV7B 1A5VA 2KFZA 1D9FA 1BQNB 3MR2A 1J5OB 3DRSB 4W5TA 4M3UA 1NJZA 4B3OA 2YKMA 4B9TA 4B9SA 1B9FA 1Z25A 4M45A 2HHQA 3QIPA 3PW5A 1MU2B 1ZBIA 4I2PB 5KFQA 2DY4A 5HBMB 3LALA 3OYNA 4ZVGA 3CVKA 1YVUA 2OPRB 4CFCA 3BQ1A 1SH0A 4CJPA 5KFJA 4CE9A 3KTQA 4N41A 3SFUA 2VA2A 2BQ3A 3FQKA 3K57A 1WAJA 4QCLA 3TABA 1NHVA 4WYLA 4ZP8A 3NH0A 4KTQA 5CY4A 2B43A 4E3SA 3G6XA 3PX6A 3ZT4A 3ZT0A 3MF5A 4I2PA 1C6VA 4RG8A 1JLBA 3S3NA 1BCOA 3T19A 4KFBB 5T7BA 3KOAA 2XY6A 3G6YA 4E7IA 3PZPA 1SH2A 4H4OA 1HARA 1RT5A 4IH5A 4B9NA 2E9ZA 3DI6A 1WSIA 4NZ0A 4O3OA 3VQ5A 4CF2A 3M8QA 2E4LA 1LWFA 4NCGA 3OS0A 1BI4B 5CZ2A 3NE6A 2RF2A 2LSNA 2HNZB 3S9HA 1C1BB 1N56A 4QWDA 4ECZA 4EBEA 3LZJA 4IG0A 4RZRA 4OPKA 1RA6A 1NOZA 1QUVA 3QNOA 1IKXB 4IOBA 3HM9A 4FM0A 2Z1HA 2X78A 1KHVA 1EETA 1JLAB 4BDPA 1EXQA 2B6AB 5HLFA 3TI0A 2OPSB 1FKOA 4HCCA 3TVKA 3RR8A 5KFSA 1T03A 3MR6A 3KK2A 1FKPB 1U09A 1U47A 2DPIA 2OPPA 1BIUA 4OKJA 4DU3A 1RNHA 1QSYA 3RB4A 3FFIA 3VQEA 3V9ZA 3VQAA 1RT3A 4B3OB 5I3UA 2OPQB 4O4GA 3CG7A 3QINA 4AHRA 4ECRA 1KRPA 1NJXA 3EYZA 2FBTA 1NJWA 3NH2A 2XCPA 1CXUA 3D0PA 2HHSA 3KLFB 1NK5A 4LQ9A 4H8KA 4MH8A 5E41A 3C6UB 3QEPA 1ZTWA 5DLGA 4U6PA 1TAQA 4LD0A 1HQEB 1ZYQA 2W8KA 1S9EB 1TKXB 4QW9A 4NLQA 4DTUA 4TY8B 3OHBA 4DTPA 4FK0A 5KG5A 4KI6A 1LW0B 5DGBA 2AQ4A 2ILYA 1NOYA 1RBRA 1EKEA 4KSEB 5SZTA 4K4SA 4FZXC 2PY5A 3CFPA 2IC3B 3Q8RB 1T8EA 4Q45A 5KG7A 4CJFA 4CEBA 4M3TA 3U3GA 4FLUA 5HRPA 1C0MA 2V4RA 3QGGA 2RDIA 3QIOA 4U7CA 1X1PA 3OL9A 1NKEA 2IJNA 1S6QA 4ZPBA 4MKAA 4DMNA 4CJKA 3E01A 1J54A 2WK4A 1MMLA 4K4WA 3T5LA 2B5JA 2XC9A 1B92A 1HQUB 2RKIA 2VG5B 2ZKUA 3MR5A 4M41A 4Y1DA 1IKWA 4QPXA 1TV6A 4FBUA 5KG6A 3P83D 3QNNA 1KLNA 4MKBA 4KHQA 4CGIA 3UQSA 3KLHB 4WFYA 4N5SA 5I42A 4MK8A 1S1WB 3LWLA 3CJ4A 4FLYA 3CM6A 5EWFA 1TK0A 3HP6A 3U3YA 3OHAA 3AA5X 4YR2A 4KB0A 4CIEA 4BACA 4J2BA 5KG1A 5J2NB 3PW7A 1IG9A 5EU7A 3OL7A 1WNSA 2YNHB 2OPPB 4KAIA 2HVHA 1T05B 4DL4A 2P5GA 3H08A 3WNGA 1RT3B 3NKYA 2P1JA 4BE1A 1S0OA 4ECYA 1S1TA 1JLCA 2FJVA 1S49A 3PW2A 4MFBA 1RTJB 1HNIA 5KFEA 3RB0A 1SUQB 5HROA 3SQ2A 1KCFA 4FJHA 4JLHA 1DLOB 3ISND 4DQPA 1ZTTA 3OYFA 1RAJA 3AO5A 2A1RA 3S3OA 1Q8IA 2E9RX 4LSNB 1VSFA 4E7HA 1GOAA 4DL5A 3PW4A 4Z4CA 5HRNA 1S0NA 4BDYA 5KFCA 3ZCMA 2FVCA 4F8RA 4Y1CA 4WXOA 1U4BA 1S4FA 3DLEB 4NLRA 3OYDA 4O3SA 5KT4A 3PVXA 1HMVA 5KFAA 2G8FA 3V6DB 2HMIA 4NRUA 3ITHB 4JUZA 4O3QA 3NF9A 5L1JA 3CQ8A 1T7PA 2F8SA 1TKTB 1HNVB 3F9KA 3BGRB 2BANB 3O4NA 5JS2A 1LW2B 2XY8A 3KNAA 4E0DA 1HJRA 4J9SA 4CK1A 3JSMB 1RT4A 1RTDA 1XHXA 1X9SA 1WSHA 1ZBUA 4DFPA 3IRXA 4RUAA 1JLEA 4J9LA 1O1WA 3P1GA 3L8BA 3M9MB 4J9MA 5KRSA 1EETB 1JLAA 2BQRA 5FROA 2IM2A 4DL2A 5D3GB 4FJ8A 1JKHB 1NK7A 1KLMB 4IQXA 4QOZB 1WSEA 1J9AA 4Y2AA 4KKOB 4C8MA 4CEAA 3DRRA 2FLLA 3KLGB 4FLVA 3RR7A 4CFDA 2HWHA 3ZSZA 4DFKA 1CZBA 3BQ0A 1N5YA 1RT6A 2ATQA 3ZSRA 4FLTA 3PR4A 1SV5B 1JL1A 3DLGB 3AVCA 1DTQB 5CYMB 3H4BA 2Z1IA 4CJRA 4RUCA 4CHYA 1HRHA 4BE2A 5HLFB 3QIDA 2PYLA 5KFKA 4NLOA 5J2MB 2GV9A 1N6QA 3LP0B 1TQLA 3DLRA 3OYGA 4RNMA 4E1NA 2Y1IA 2C2RA 3BSAA 4K4ZA 3OSPA 4Z4GA 4KHYA 2BANA 1TKZB 1S1VB 5C42B 4Q0BA 4RW4A 1Z26A 4BWJA 1YTUA 1KFSA 5KT7A 4X2BA 4EO8A 1N48A 4NCBA 3KKSA 3L2QA 2HAIA 4OKEA 1VRTB 3EPIA 1ASWA 1VSEA 4E7JA 3DMJB 4N47A 5KFWA 3TAQA 1U45A 3CJ0A 5EWGA 4CJLA 3CDEA 4Y2CA 4OGCA 1QAIA 4ZPDA 3FRZA 2RN2A 1TL1A 3D5MA 3MFIA 3HPOA 2QKBA 4CF9A 4FJMA 2D0AA 4XO0A 3OS2A 3O3HA 1UWBA 3SI6A 3CO9A 3IN5A 1NK0A 2IAJB 4CHNA 1WLJA 5C24A 4NLDA 4R8UB 1QSLA 2Y1JA 4YMEA 4Q8EA 4IR1A 4DLGA 4M94A 3L3UA 4RW7A 1C1CA 3SQ0A 4FCYA 3NHGA 3GV5B 2FLNA 1N5YB 4DTXA 1QS4A 5FRNA 4O0IA 3CYMA 4CJTA 3V1RA 3LP2B 1IKYA 3VQQA 3WNFA 4HUEA 3OL6A 2UVVA 4KHMA 3HK2A 3N6MA 5DQHA 2IJFA 2IAJA 5DG7A 3SUPA 3TQ1A 3OLAA 4I7FA 2ETJA 2AGPA 2BE2B 1KTQA 1C2PA 3PUFA 1UAXA 2C2DA 1JX4A 1HYSB 3HO1A 3B6OA 2QE5A 3AVMA 1RT1A 2D0CA 5L9XA 1D8YA 1TKZA 4J9NA 4FYDA 1FXXA 4ED8A 4PQUB 3K5LA 3BSNA 3AO4A 3QERA 4ZP9A 4RW4B 3SV4A 2IM3A 3M8PA 1QAJA 3H40A 4ZHRA 1TVRB 1CSJA 4KREA 4NCAA 5J2PB 2CKWA 5KFOA 3OJUA 2XI2A 3RMDA 4KB1A 2GBZA 2BDPA 3QYYA 4FJ7A 3PV8A 4ZVEA 5DQIA 5C42A 2WB4A 3K5OA 4UQGA 2XO7A 3AVKA 3ITHA 4C8LA 4DF4A 3SPZA 4L8RB 1S6QB 4J9QA 4RW9A 2HHTA 2W9CB 2R8JA 3AVAA 2XHBA 2BGGA 2I5JB 3T5KA 4CJSA 3O3GA 2HNDB 2PYJA 4CJVA 3KD1E 4DEZA 1TKTA 4HHTA 1C1CB 3BGRA 2FVSA 1NK9A 5KT2A 4DSIA 5KG0A 5KFTA 3UIQA 4NCGB 1RA7A 1U49A 5J2NA 3TAEA 1HPZB 3DI6B 2FC0A 3AVLA 3RRGA 2XGQA 3V6DA 2WOMA 4ECWA 4CF0A 3SFGA 4CJ3A 3LDSA 4B8AB 2F96A 2JEGA 4ZPAA 2IA6A 1GX5A 1QE1B 2IM0A 4HVJA 1KVBA 2RF2B 5J2QB 3V4IB 4KTWA 2OPSA 4FLWA 2KW4A 1S48A 4DL3A 1XC9A 2J6SA 3GIIA 3IG1A 5J1EB 1S5JA 2R8GA 3K2PA 4KE5A 3OL8A 4HKQA 3FFIB 4IFVB 3T5HA 3AA2A 4FJKA 4K4UA 4NYNA 1ITGA 2OPQA 3KK2B 2XGPA 3ZSWA 4E7KA 2P51A 1JLCB 1VSLA 5EUHA 3KLEA 2Z1JA 3SUOA 3KK1A 2YNIA 4AHTA 3SPYA 3ZT2A 1SL0A 4YR3A 1BISA 1RT7B 2W9BB 3QGHA 4GC7A 4ZP6A 3KLIB 1RYSA 1S6PA 3D45A 3DLEA 1J53A 3L2RA 3LP0A 3KLFA 1VSKA 2HMIB 3HHKA 1VRUB 1NNDA 3QO9A 2F8EX 4O3NA 1HYVA 4OLAA 1RBUA 3OYMA 1HQEA 4M3XA 3DYAA 5KG2A 3GIJA 2J6UA 1ZBHA 4M3YA 4NLSA 4EEYA 2EC0A 2EX3A 4DU4A 1RT6B 4WFXA 4GVMA 2V4QA 4CEOA 4QWEA 3K5MA 1JXBA 3ZSYA 1K1QA 4DG1B 3IS9A 2I1RA 3SV3A 4HTUA 4NLUA 1LAVA 4AHCA 3TANA 2B5JB 3VQSA 4CEEA 1A5WA 4PA1A 4F4YA 5KFGA 4O5BA 4W5QA 2VG6B 4CHPA 3CJ2A 4FJNA 3DLKB 4FZZA 4OJRA 1IKVB 1RT4B 1RTDB 3H5SA 1WSJA 4DQSA 1I6JA 1I3AA 4J9RA 5CZ1A 4IFYB 3H59A 4ED3A 3KK3B 2G8VA 5KTQA 4HUGA 3K59A 1C0UA 3PX4A 2FJWA 3IG1B 5J1EA 1LWEA 3T5JA 1L5UA 2GIQA 4KHRA 1LAWA 4ECVA 1L3TA 4KV8A 1S9GB 4DSFA 4KHNA 1ZETA 3MEEB 2UUWA 5F8NA 4ECSA 1RT2A 3LANA 1JXEA 3KJVB 3DLHA 4DFMA 3ISNC 5F8HA 4IRCA 4WXWA 5HP1B 5EDWA 4KHWA 1UWBB 1RBVA 3KLIA 3KK3A 2XRIA 1EX4A 5KFRA 2JEJA 4O44B 3TAMA 3KLEB 1OS5A 4ECXA 1WSGA 4DTJA 4J9KA 2G8UA 3MEDA 2V9WA 4F50A 4ID5B 2YNGA 1YTAA 2HNZA 1KHWA 2BE2A 1T03B 4CHQA 4TQSA 4NRTA 3WNEA 5EWEA 3QO9B 3QIPB 3NL0A 1U04A 4C8OA 2Z1GA 4WE1B 5L1IA 4HYKA 1KVAA 3IGVA 3GIKA 5KFZA 1S9FA 4ED1A 2KFNA 3LPTA 4EP4A 4IKFA 4RW8A 4Y3CA 3AVJA 4W5NA 1TK5A 4BE0A 1TVRA 3DMJA 2DFFA 3GV8B 4CJWA 3ASMA 4KFBA 4EBCA 4J9PA 1BHLA 3K5NA 2C28A 3KHHA 5F8GA 5DGAA 1VSDA 4B9LA 2WRMA 4DSJA 1BI4A 4DFJA 2VWJA 3N6NA 4E1MA 4FBTA 3LP3A 3H5UA 1W25A 1NKCA 4O55A 4AHVA 1HMVB 5HRRA 2QXFA 2JLEA 2DFHA 4DLEA 3QESA 4DQIA 2O5DA 3I5AA 3C94A 4JRPA 3HVTA 2HWIA 4K4VA 2OA8A 4I9QA 4ZPCA 3VQ4A 5K14B 4KAZA 4LH5A 2ITGA 3MEGA 1U48A 4TY9A 2B6AA 4ELTA 3HJFA 3NBPA 2G8IA 4IFYA 3CDWA 5FRMA 3QZ7A 3MEEA 2IMWP 4CJEA 2IM1A 3G0ZA 1RT2B 5C5JA 4C8NA 3KD5E 4W5RA 4F3TA 1Z4UA 4IRKA 3PW0A 4B08A 4GW6A 5KFDA 3Q8QB 1W0HA 5KFVA 1Q9YA 1GOCA 2FBVA 4I7FB 3RB6A 2NUBA 2HVIA 4WZMA 1D1UA 4FJ5A 2JGUA 4MQ3A 1S10A 3ALYA 4ED7A 3RAQA 3P5JA 1G15A 4IDKB 3EZ5A 2WONA 4YFUA 4M3ZA 1VSIA 3HPGA 2UVWA 3CWJA 1RT1B 1REVA 1JLGA 3MR3A 2R2UA 1VK0A 1FKOB 3QLHA 3UR0A 4DTNA 3VA3A 3OYLA 3OJSA 2R2SA 5L1LA 1JLQA 1SL1A 2YKNB 1NKBA 2YNGB 4ID5A 4F2RA 4DSKA 2HHWA 4EZ6A 3NMAA 1QE1A 4RW8B 3SJJA 1RDDA 4E89A 3IAYA 2QKKA 2IBKA 2ZE2A 4F4XA 2ZD1B 3VQ6A 4CGGA 3KKRA 1ZBLA 3V9SA 4DTSA 2FJXA 3TR8A 5KFLA 1UOCA 2W42A 5FDLA 3VN5A 4FW2A 3WNHA 1L3VA 1RCHA 4CHZA 1RDCA 2VG5A 3HKWA 4KB7A 4ED2A 5KFXA 3RAXA 5F8IA 1BQNA 4CEQA 3I0RA 5KFFA 3D28A 3DOKB 4O3RA 5F8JA 3LP1A 1R0AA 4MK9A 4CEZA 4URQU 2HNDA 1RTHB 3PR5B 3QEIA 2XY5A 2DTUA 4FJIA 4ED6A 2GC8A 2YNHA 2FVQA 1Q9XA 3H2LA 1S1WA 5J2QA 3H98A 3DOLA 1L3SA 2VG6A 5C24B 4DSEA 2F8TA 3SYZA 4XPEA 1S97A 4FVMA 4CEFA 1HNVA 4TYAA 3RMBA 3JYTA 4MIBA 4FM2A 2BR0A 4ZVHA 4CK3A 3H5YA 2RPIA 2AWZA 1RDAA 4PWDA 1SKRA 1JLBB 1DLOA 2FVRA 3NDKA 3O3FA 4MK7A 2BRKA 4CEDA 4CIFA 3SUNA 1XHZA 3QLHB 5KFIA 3AVIA 1EP4B 4WZQA 5HROB 1IKYB 3CFRA 1B9DA 4GC6A 1LWCB 1RTIA 1S1XB 4JRQA 1RILA 2FBYA 1S6PB 4K4XA 2R8KA 3NF8A 4J2EA 3JSMA 3E51A 4O4GB 1BQMA 3H5XA 2OPRA 1D9DA 4K50A 4O4RA 3BR9A 2JC0A 4KKOA 1CXQA 4PWDB 2XI3A 3V81A 3M8PB 3CM5A 2E6LA 4AHUA 3HL8A 4NLYA 3Q8SB 4Z4FA 1JKHA 2HNYA 5FDLB 1TKXA 5KFUA 4R5PA 4FS2A 2O4GA 3NAIA 1NHUA 1LW2A 2AGOA 3LAMA 4KI4A 1TAUA 4ZHRB 4K8ZA 4KRFA 4QWCA 4ZVFA 1RT5B 1S1UB 1WNEA 2C22A 2IOCA 5J2PA 2W8LA 3OYKA 4FJJA 3NH1A 3DOKA 2D0BA 3G86A 5F9NA 4K4TA 4N56A 4CCHA 3MXIA 4FK2A 4URGA 2I5JA 3NAEA 4JV2A 4O0JA 3V9WA 4TLRA 5DG8A 4ZMMA 1WAFA 3PHEA 3HXMA 4WE1A 4JV0A 2FVPA 2W9CA 2PZSA 3AO3A 1SKWA 3SI8A 4Q0BB 3QEWA 4B9MA 3GYNA 4QW8A 4DQQA 1N6QB 4EYIB 2XY7A 5C25A 3F73A 4FLXA 3BREA 5DK5A 2WOMB 3I8DA 2R8HA 3T1AA 3JYTB 5HRSA 3C6TA 4LQ3A 4CECA 4DTRA 4CGDA 4AH9A 3BSCA 2W7PA 4O44A 4OVLA 3QEVA 3FQLA 4Q43A 1IKWB 3C6UA 4TXSA 3MEGB 1X9WA 4YR0A 5F9LA 1S9EA 2JC1A 1JLQB 3CJ3A 1X9MA 3LWMA 1DTTA 1NK8A 1BQMB 1XI1A 4DSLA 3V6JA 1JLGB 2ALZA 4GMJB 5KFYA 1J5OA 4H54A 4ECTA 5T14A 4PUOA 3DM2A 4M95A 3TWHA 4MFBB 1RTJA 1FK9A 4M3WA 1LV5A 3LP2A 3AVHA 3VQ7A 3VQDA 4DTOA 2QK9A 5L1KA 4RW7B 1T05A 3MTKA 1BCMA 4OGEA 4H4MB 2YNIB 2KTQA 4AHSA 2HNYB 1SV5A 3N6LA 4NLXA 4XIUA 1S1VA 4CFAA 1SL2A 3SQ1A 3KLVA 3OS1A 1TL1B 1K6YA 4EZ9A 5KT3A 4DTMA 3AO2A 1WN7A 3A2FA 3MECA 3OSNA 3EPGA 3BQ2A 4Y34A 1IO2A 2YHAA 4DL7A 4CGJA 3SZ2A 1QTMA 2AGQA 1ASUA 3MAQA 3AA3A 2ZE2B 1RTHA 2RKIB 4NLTA 3SNNA 5I42B 4ZTJA 2G8HA 3RB3A 5KT6A 2RDJA 3AV9A 4F4WA 3I0SA 5KFBA 2YV0X 4BDZA 2OH2A 2WTFA 5SWMA 4F3OA 1GOBA 2FLPA 3AA4A 4DS4A 3HPHA 4DL6A 2E9TA 3TAPA 3FDSA 4IBNA 1C0TB 1CLQA 3I5BA 3DLKA 4FJGA 2J6TA 3NGIA 2BRLA 4RW9B 1RYRA 4ELVA 4CGHA 4JS5A 3VQ8A 1REVB 5JUMA 4FS1A 1XWLA 3TAGA 3HVRA 1C0UB 1JIHA 3M9NB 4F4ZA 5JXSA 4R8UA 3OYEA 1SUQA 1DTTB 4FXDA 3ZSXA 4KBIA 1SH3A 2OYQA 4CESA 3ZSVA 4ICLA 1YT3A 1S9GA 4KV8B 2R8IA 5DMRA 4J9OA 4TSXA 1HYSA 3KLGA 3THVA 1C0TA 4Z0UA 4I2QA 4LY7A 4H4MA 3KJVA 4ELUA 4Q44A 1TL3B 3NF7A 2D3UA 4FLZA 3RWUA 4RNOA 2Q3SA 3AVFA 3IGNA 5HP1A 1FK9B 3SCXA 1EP4A 3M8RA 3V9XA 2R2RA 1JL2A 4C8KA 1RDRA 1TKDA 5KFPA 4NLGA 4CF1A 3OYCA 3DRRB 3NF6A 1JLFB 4KTZA 3MECB 4IG3A 4R5PB 2ZQBA 3ICLA 3RBDA 4URSA 5KGXA 1VSJA 4KO0B 4Q5VA 3AVNA 3EZUA 4PQUA 3G10A 4I2QB 4B9UA 4O3PA 2WCXA 4OKKA 2R2TA 4RNFA 3B6PA 3H4DA 4FZYA 2EHGA 2W7OA 3MFHA 2JEFA 3IRXB 3PY8A 4WYWA 4ZP7A 2YHBA 1A5XA 2KQ2A 3M9OB 3V81B 4E7LA 2FBXA 3M8SA 4OPJA 3DLGA 5KT5A 1NK4A 3PO5A 2OZSA 5KG4A 3O4QA 2UUTA 4EO6A 1D5AA 4PY5A 4JS4A 4DU1A 2IGIA 2KZMA 1BIZA 3HP9A 4M3RA 3OVNA 2ASDA 2ATLA 4DQRA 2VWKA 2KZZA 1QQCA 4HCBA 3DLBA 4H4OB 2UVUA 4IFVA 1TV6B 3MXJA 3BSOA 4FW1A 3ZT1A 1UA0A 2JEIA 4NYFA 3DRPA 1KLMA 4LSLB 4CJQA 3OYHA 4RNNA 2WHOA 3AVBA 4R0EA 4ECQA 2ASLA 1TL3A 4QWBA 2AJQA 4M42A 2VG7A 4ICLB 2AX0A 3V9UA 5KG3A 3S3MA 1KSPA 4IRDA 4KHUA 2XWYA 1RT7A 2W9BA 1T3NA 3VA0A 1MU2A 2AU0A 3T3FA 1LWEB 4NLVA 1TP7A 4RW6A 3NFAA 1TGOA 1IH7A 1IKVA 4Q8FA 1I39A 4BWMA 1DTQA 2WONB 5CYMA 4CGFA 2D3ZA 4CERA 3RMCA 4I9LA 2HW3A 3AVGA 1FKPA 4LSLA 3CFOA 3NGZA 3OYJA 1S1TB 2YKMB
chains in the Genus database with same CATH superfamily
3C95A 1ZOTA 4DF8A 4R79A 2G8WA 2CPFA 1HLWA 4WIIA 4DV1J 2G8KA 5E3CA 2O01C 1ITPA 4F4KA 3U1LA 3V1OA 3BO3A 4J8FA 1WI8A 2ZDOA 4CHOA 4FF4A 1SJ3P 2IMOA 3BJYA 4FM1A 4USMA 1JJ2M 3RZAA 1SB6A 3RSEB 1V3ZA 4PPDA 4E2FB 3GFHA 5H9EJ 3TSUA 1HX1A 3X3UA 3VAHA 2YWHA 2W9AA 2H5IB 1LW0A 3NAHA 2ZC4A 2VUGA 4OHYA 2A1SA 3ADAC 4DR6F 1BE4A 2XMUA 1UFKA 1UFLA 5C2FA 1U1LA 1RDUA 4IG0B 4JKGB 4NZ6A 3TEGA 3HZEA 1RBTA 5B08A 1NUEA 4LF4F 3NGDA 2ASJA 2D41A 2IC3A 1Q82T 3PIOQ 3SSSA 1XNRF 4X66J 3WT0A 1LWFB 3J80O 1IM4A 3K0SA 1WBBA 3ULDA 1WTFA 3AB2B 4ZLJA 2D7SA 2NZCA 3OFHA 3M7VA 3VEWA 1YUWA 3WQPA 2BE9B 1UA1A 5JVGL 4FWNA 3NCQA 2G1HA 1NZ8A 1R89A 3WBZA 4UZCA 2IRUA 2EWSA 2XO6A 2GWJA 2ZBQA 2QJ3A 2ZJQQ 4ZTFA 2KO1A 3MXMA 3SSRA 4RNHA 3A12A 4LUBA 1C1AA 3ET6A 1RWVB 5F8MA 3UCUP 2DGWA 3K5PA 4TQRA 1VSMA 4ECUA 4DV6K 1Q79A 4DDFA 1QVGR 1XERA 5DQGA 4GKKJ 3ZO7A 5HQLA 4EU0A 3QZ8A 3WUHA 1XR5A 1Y97A 2X74A 2NXUA 4EUVA 1Q95G 4IH7A 3VQPA 5DZ7A 1KOHA 2H3EB 1AFJA 1VQMN 3KZBA 3U9DA 2RD5C 1UPPA 1GK8A 3CETA 3W0LA 2Q79A 4CLSA 1SJFA 1IBKF 4YB1P 4OL8A 3NNHA 4K7QA 4Z4EA 3BDEA 3HVAA 2W4PA 4CBWA 4BRAA 1HPZA 4YNQA 1HNZF 4JI5F 2NRHA 3BBCA 3KIOA 3M2VA 4GVBA 4B9VA 5KFNA 3I0SB 2QTDA 2DH8A 3Q8PB 5B7WA 3O6QA 5DLFA 4KHSA 4YY3F 3VETA 4M7YA 3EE9A 2FHKA 2QMXA 3VQ9A 2J8SA 2WVEA 3EDQB 3RRHA 1XR6A 1MSWD 2PDAA 2A2DA 5F8LA 4HUFA 2J8AA 4IH6A 3C6TB 1WSFA 2RQCA 3LP1B 2CWXA 2QWLA 1PJ7A 2RS8A 1FO1A 1MMNA 1XN9A 5HVHA 1BY9A 3NCIA 1SS6A 2UUCF 2C42A 2D3O1 4LR9A 4WFZA 2IDOA 3QB0A 1PKUA 4KPYA 4FWLA 3PIPL 4GO5X 4QIGA 5T41A 3HVWA 1N5TA 1C1BA 1CS4A 3VQBA 3CPWM 1QVFM 3NGYA 3NMUA 1LKZA 5AQHA 4JYAF 4M5KA 4ED0A 2RSQA 4LH4A 4IG3B 3CT9A 1RHKB 1B7FA 2I38A 3PIOL 1SKSA 1VSHA 7FDRA 2MQNA 3C14B 3ZETB 1EX8A 2HFNA 1D9FA 1NB7A 3DRSB 1GT8A 2FHJD 1VQ5S 4M3UA 2YKMA 2X1GA 3TJ9A 1Z25A 4M45A 1OH7A 2E1ZA 4IJNA 3LALA 3SBGA 5BRFA 3CVKA 3UI3A 4Y2KA 3OFEA 2QLJB 4CJPA 1UW4A 4LF9F 4QIVA 2Z57B 4N41A 2BV3A 2WFBA 2GVDB 3MK6A 4RX6A 1AXQA 4QCLA 3TABA 1Q53A 5GIPA 2B43A 4M8LA 4U9RA 3BH6B 4K59A 2Z58B 4E3SA 2B9XA 2LA4A 3ZZTA 3ZT4A 5D4LA 1F9EB 1N0VC 4IOCL 4NLCA 3CCMS 2VONA 3R3TA 2FSNA 2XY6A 1XNRK 3G6YA 2EPIA 3PRDA 1HARA 4IH5A 3GWCA 1VK3A 3MCMA 4OX7A 3AB4B 3SBTA 1UFWA 2KVQE 1EKSA 5LMUK 1LWFA 5D0GA 3EZWA 1HBMA 3NE6A 2HNZB 1RHMB 4CO1A 2EKYA 1HI1A 3BZCA 1SQFA 2GVZB 4RZRA 1QUVA 4X4VA 2EI5A 3WX4A 1IKXB 1K73T 4TU9A 4FM0A 2AJ2A 1FNOA 2PA3A 2C3OA 1N36F 1EXQA 3TI0A 4DR5J 4I4BA 3TVKA 1YVNA 1RWWB 1QAYA 2DPIA 2OPPA 1BIUA 4JD2B 3D6TB 3TA1A 4OKJA 4OZJA 1RNHA 1IR1A 4J9VA 3RB4A 1U24A 3A1YG 2ZH2A 3K7RA 4JK9A 3R5BA 1UMJA 3DRYA 2CGKA 5E0OA 2A1BA 2FBTA 1TYQA 3NH2A 1G1XA 3D0PA 1J6ZA 4ANCA 2KI2A 5L8RC 4LQ9A 2GUPA 2CQ4A 5E41A 1ZTWA 4U6PA 1TAQA 1KNZA 1ZYQA 1HNWK 3UCZP 4BR2A 2IA0A 4DTUA 3DGVA 4JI2F 5KG5A 4JI1J 2FYXA 4PHTX 2IC3B 4V1Ak 5KG7A 2F7VA 4CEBA 1G6BA 5BPNA 2IRYA 1ZPWX 2V34A 2CQDA 1X1PA 4GVEA 4P7VA 1VOMA 4GKKF 4CZFA 5BR9A 1ULRA 1WOQA 4UUWA 1Q5YA 2MQQA 2MTLA 1GEHA 1WDTA 4M41A 1FWKA 3THTA 1NBWA 4QPXA 1TV6A 5M1OA 2MZRA 3TUPA 1RI7A 3QNNA 4KHQA 5I42A 5HAOA 4OI1A 2Y1LB 2MSTA 3CJ4A 5IT9Y 3U3YA 4JI4K 3OHAA 1HBUA 1NH7A 4KB0A 4LR8A 4BACA 5J2NB 4USJC 1WNSA 1YIJN 3M6UA 1UEVA 3FEYB 2OD6A 4KAIA 2HVHA 2RRBA 3BGLA 2KJWA 2RU9A 1H1VA 2DGQA 3MM9A 4BRHA 3NKYA 2N3OA 3OR2B 4KGZB 3BZQA 4BE1A 3GZ7A 1ZS6A 1R43A 5T7LA 1S1TA 2MQMA 3C7NB 4GY2B 4MFBA 3RB0A 1SUQB 2K2PA 5JVHL 3SEOA 4CD3A 3M6XA 4ZVQB 4USTA 3SQ2A 3FGVA 1H74A 1PIEA 4JLHA 1IBLF 2ZNZA 4DPUA 1WC3A 4ES1A 1WOSA 1RAJA 4LF9K 1VBKA 3LA0A 4L3NA 2HS0A 3S3OA 5GMKa 1Q8IA 4PQAA 2CPEA 4LSNB 8ATCB 4DV5J 3VR1A 1VDHA 4DL5A 3F44A 1VQLN 1AUDA 2IVOA 4BDYA 4F8RA 5JLFA 3DLEB 4A62A 4O3SA 5KT4A 3PVXA 5KFAA 1CPZA 1VQ6N 4C11A 2RVJA 3VVTA 3GONA 3A5LC 3ITHB 4JUZA 2CNKB 1T7PA 2AEFA 5BN8A 5AQKA 1OMSA 1HNVB 1RB0A 3F9KA 1MROB 4CO5A 3FZKA 3AGKA 4CIOA 1X4FA 2C3UA 5IM0B 1BWFO 1LW2B 3MM8A 2P9GA 4E0DA 4TVAB 4OI6A 6FDRA 1VK8A 4J9SA 2ROGA 3MGJA 2LQ8A 1XMQF 1NH8A 4C23A 3H8YA 4NMLA 4H5VA 4C3KA 1MA9B 1ZA1B 3BPSP 3CJ8A 4BVPA 5AJ3K 4J9MA 4CT9A 5FROA 2IM2A 2PMHA 1PAEX 4RJVA 4DU8A 2HHHF 2WVFA 1WSEA 1NGJA 1J9AA 3DRXA 2ZH9A 4CYUA 4Y2AA 5L9NA 1SC3B 3KVGA 2FLLA 1RWNB 3NLCA 1NDKA 2BVZA 3L9ZA 2HFOA 2IJRA 2HWHA 2IRXA 2M8HA 1CZBA 1HNXJ 5CD4A 2MDAA 4PCQA 1HHQA 1N5VA 4DR3K 4C2MA 1JL1A 3NS6A 4LRAA 3AVCA 3H4BA 2FDNA 3VALA 5HLFB 3DN9A 3N5FA 1PGZA 3VEOA 2ROEA 2GV9A 3VVUA 3W5YA 4DPOA 3OYGA 1A6LA 1CC7A 4KHYA 1DHMA 1YHQN 5C42B 4WTYA 5A8WB 5IT9U 4RW4A 1Z26A 3FBEA 5C2GA 3U9ZA 4QBUA 4QR0A 3FKBA 2CQHA 3RVCA 3H42A 1VRTB 1QTNB 3FEXB 4WKYA 3UO0A 4E7JA 3AA9A 3GL1A 5KFWA 1AYEA 5GAGP 4Y2CA 4P71A 1QAIA 3FRZA 2RN2A 4FXVA 2VPYB 3D1QA 4CF9A 4NE9C 3HRGA 1UWBA 2XYHB 4X84A 4DX7A 2CA9A 1WLJA 2RRNA 2JVOA 3BPDA 1C1CA 3D0IE 3ONQA 1Y11A 2VQFF 1YITN 1N5YB 4DTXA 1NGEA 3CYMA 2ZOMA 3V1RA 3VQQA 3W8PA 4CWBA 2UVVA 4A2AA 3HK2A 4OX9F 3N6MA 3Q2SC 1X60A 4DU7A 4LMZA 5HL7L 4IOAQ 2RUSA 2OEJA 5H1SV 1NMNA 3OLAA 2ETJA 2KKZA 2K1RA 4LRFA 1UEKA 4GV6A 1KTQA 1UAXA 3IR6B 5AFUH 3C14A 3B6OA 4ZKAA 1RT1A 4PKIA 5IWAK 4MMOA 1VQYA 1TKZA 4J9NA 4LFBJ 1LNQA 1Q0NA 3K5LA 1OY9A 3BSNA 1TUGB 5AXKA 5JVGQ 1MW7A 2XULA 4ZHRA 1CSJA 4KGXB 1NGAA 3FK4A 5IXUA 4KB1A 3ENVA 2BDPA 2JH3A 2AJ1A 1TL7B 3PV8A 4ZVEA 2B9EA 5DQIA 1T0TV 5C42A 5A8WA 2HQDA 1KTVA 4P2SA 4F3QA 3AA8A 3BKTA 3DLJA 5M1FA 1XNQJ 3AVKA 1KAYA 3MZIA 5A2QU 5AZIB 1U02A 1H38A 3D6FB 2AJFE 4J9QA 3IM8A 2V68A 2W9CB 3VWSA 2YWFA 5SUHA 1IVZA 3AVAA 1OQ6A 5G4DA 1H7XA 5BRDA 3UD4P 2RHQB 2JRSA 1KVIA 5ADXA 1DQAA 1RWPB 3BGRA 4ID8A 1FJ7A 3G82B 3ZEUA 5KFTA 1U25A 5B0BA 1ICEB 3TAEA 1NMDA 1UCNA 3EKSA 3G9CA 2FY1A 2WOMA 3ZXWA 3I4HX 1MN9A 1K0TA 1QHAA 3D2FB 5MLCV 3D54A 3JXUA 2JEGA 1KVBA 3CXCM 4LREA 4KTWA 4BRNA 5AQWA 1HWUA 1S48A 4NI2B 1QLNA 3IG1A 1R27B 4U96A 2MHEA 4YB5A 3AA2A 1HKBA 2K1RB 4K4UA 4NYNA 3AAPA 1DGKN 2XGPA 2BKNA 1CS4B 1O13A 4JI0K 1CBKA 3U7JA 5EX3A 2R7SA 1U2RA 2Z1JA 4AXIA 4CO3A 1LCUA 3DGPB 3ZT2A 3A8YA 4H5TA 1IBMJ 2CIMA 2W9BB 3FJ2A 4IXCA 4Q7AA 1RYSA 4QIWD 3DLEA 1SIZA 3L2RA 1TUWA 3FZ2A 3KLFA 1VRUB 1NNDA 2F8EX 5CZVA 1QVGM 4OLAA 2H1YA 4WP9A 3E1YA 3SAHA 1MMDA 3DYAA 5KG2A 5KPZA 4HLBA 2WSCC 2YKPA 1ZBTA 1RT6B 4X4NA 1VQLS 4WFXA 1V5IB 2D4WA 1HI0P 1Y7PA 1JXBA 1HNXK 3W9IA 3SAGA 1K1QA 3M6GA 4N77A 4HWIA 3SV3A 5IT9O 1NHKL 2A18A 3VQSA 3CXCR 4PA1A 4F4YA 2W2NP 4O5BA 4W5QA 2VG6B 1TL4A 2X1FA 1IBMF 3HDSA 3JSYA 1RTDB 3H0PA 3R97A 3GOIA 2RMLA 3O80A 3IFEA 5F0XA 3W3SA 3H59A 2W6KA 4TNOA 3K59A 5FLXU 2GIQA 3E9LA 2UYTA 4ZLPA 4NXMJ 1NGBA 4Y0FA 2XTJP 4JI0F 4ANEA 3GU0A 5AXNA 4FF1A 3LANA 4C6AA 4UY8O 3KJVB 4FKXA 3KJNB 2J76E 1RBVA 3THYB 1EX4A 5KFRA 2JEJA 4O44B 2OHDA 2CPXA 4ECXA 1DY3A 3R5GA 1FW6A 2G8UA 3MEDA 4F50A 2DYAA 2YNGA 3DXKA 3KWMA 3IR5B 1NGHA 2P9UB 2F4VF 5DZ6A 4DV2F 1FJGK 4IEIA 4DHYA 3B8HA 5EWEA 2ASYA 3NL0A 3DHXA 1SQGA 4I67A 1W7WA 5L1IA 3CPEA 5GMDA 5KFZA 4ED1A 4X62J 3LPTA 4IKFA 5IT0A 4RW8A 4W5NA 4GKJJ 3KG1A 3FC9A 5C7PA 2LECA 1VLOA 1OWXA 1B3TA 5F8GA 4DV4J 1BI4A 2CPZA 3OTBA 4DFJA 2VWJA 1ZA2B 4O55A 5DDQC 1BXNA 1R8PA 1NM2A 1UJ4A 2JLEA 3QESA 4UOGA 1Q18A 4JRPA 2OA8A 1U0HA 4FPAA 2BKOA 2VPZB 1J5EF 4KAZA 4LH5A 3MEGA 4TY9A 4DV2J 5E3QA 4IFYA 2FHJA 3TZXA 3I56S 5FRMA 2XMTA 2IMWP 4U8VA 2MGZB 2W25A 1Z4UA 4A48A 3PW0A 4B08A 5LT5A 1RAAB 3J7YU 4DR2J 4DUZJ 3SCJE 4GKJF 3EMTA 5KFDA 3C19A 2MQ8A 4JI8K 2BX6A 1DEJA 1SJ1A 5HMYA 1OH6A 3VGUA 3BGFA 1VJQA 3ALYA 2VHGA 4BC4A 2QWNA 3PHTA 3EZ5A 1YRUA 3HPGA 3I55S 2JWKA 1GXUA 2YJEA 3CWJA 1RT1B 1ZAVA 2F4VJ 1REVA 1JLGA 4KR0B 2R2UA 3R1LA 3G8QA 2R2SA 3CJKA 5L1LA 5HO4A 1SL1A 4F0HA 2NSCA 4A8OA 4F2RA 3CQXA 1XK8A 4WU3A 2HHWA 2F40A 2YCHA 2BW2A 3D2EA 1IV0A 3BKFA 4E89A 2DCUB 4BRIA 5EOYA 5ADZA 3B78A 1ZBLA 4YY3J 2P6SA 4YOEA 1RZMA 3KWIA 1FKAF 1RADB 3G6EN 2W42A 5FDLA 3WNHA 4XH5A 1IJJA 5E33A 1EIYB 1RCOB 4IOXA 1RUSA 4MYUA 4CLYA 4AL6A 3BUZB 3HFKA 4DV3J 3QWPA 3RAXA 4X62K 3MWBA 3M30B 5KFFA 3DOKB 4Y00A 2HURA 1R0AA 1F60B 4CEZA 3TA2A 2HNDA 2EFPA 2DXDA 5IV4A 1T6DA 2UXDJ 2VJUA 2DTUA 4ED6A 5M1PA 4OX8A 2VG6A 2E5LK 2HPUA 1X4CA 4CZGA 2QL5B 5CYJA 4JI7F 3DC2A 2BR0A 4ZVHA 3D1OA 2ADCA 5IS2A 1NGCA 1DLOA 2FVRA 4V19X 3NDKA 2KRBA 4QYRA 3O3FA 4QQBA 1X5TA 2BRKA 4K5SA 4JP8A 4OHXA 3AVIA 4OYAA 3CFRA 1B9DA 1BHNA 2BABA 2YXLA 1X5PA 3A8IA 1S72N 4PR6A 2CGJA 2F8MA 4MIWA 3KJFB 3R1HA 1TUVA 2PEHA 3BR9A 1N34K 1R0BG 3C3LA 1I94K 2CPYA 4OI4A 1OYDA 4NLYA 4CLKA 5FDLB 5BXIA 1NDCA 2P6TA 3A0IX 1QM9A 4LFBF 2UU9F 1TAUA 5LMNK 4K8ZA 4QWCA 1VQMS 4YOVA 2RE2A 2NS1B 1N0UA 2QGFB 2W8LA 1AW0A 2NNWA 3NH1A 3ILIA 3A3PB 3SCLE 3MMBA 4DCJB 3I32A 4K4TA 4N56A 4CCHA 4JHDB 2R7XA 2I5JA 4JV2A 3JS6A 3V9WA 1NAQA 4NEYA 3KYLA 4ZMMA 3R7SB 1WAFA 4WE1A 3WIVA 3UKRB 1RAGB 2W9CA 3IWNC 4B9MA 2Q36A 1CQMA 2KU7A 2XY7A 5C25A 4ILJA 2FSJA 3C8YA 1Y0HA 2WOMB 4XDDA 2J9DA 2CQ3A 4L74A 3JYTB 3HSDA 4ILHA 2WZ1A 5E84A 3JTPA 4CGDA 3BSCA 1NM1A 4BVOA 5K9FA 5KQ8A 3B6BA 3TTFA 4OJGA 1KP6A 1X9WA 3AJ1A 3AJDA 1S9EA 1OQ3A 4L75A 1I94F 1L3KA 2MZJA 3MCSA 5ETRA 4GMJB 1GLFO 2WVBA 4MFBB 4ILLA 4M3WA 5BR8F 3AVHA 1YWXA 4QU7A 5K8PA 4LR7A 3G25A 4ZPWR 3MTKA 1KBRA 4B17A 4X65K 4AHSA 1SV5A 3N6LA 2DR9A 2QYGA 1ZH5A 3CULA 4B02A 4CZKA 3I56N 2I2YA 1SL2A 1X7VA 2Q2RA 5MAOA 1HHTP 1K6YA 3F41A 2R7WA 2GELA 2JLGA 4MT1A 5HVGA 3OSNA 2E8AA 1UZHA 3BQ2A 1I1GA 3VEVA 5D4NA 4OX6A 2IYGA 1QTMA 3MAQA 2B8QA 2RKIB 4NLTA 4DR1F 1P1TA 4V19J 1H2UX 3M2VB 1MG7A 4RO0A 2WVDA 3PTWA 2YV0X 4B3MK 4CM2A 4F3OA 2Q43A 4DS4A 3AA4A 2OJ3A 3CDBA 3HPHA 2AZ1A 4BQZA 2R7OA 2MSSA 1SQKA 1YAGA 3I5BA 4DBQA 2NXJA 3HZ6A 2HGNA 4RW9B 4RBVA 1NNEA 3UVJA 5JUMA 3WC2A 2HFSA 4F4ZA 3OYEA 1SUQA 4FXDA 1YTYA 3R3LA 3ZSXA 5EX5A 4JKDA 1NO8A 4ICLA 1XQIA 1CJUA 5EY4A 5F3ZA 3MM5A 1NSQA 2EBGA 5A8KA 4TSXA 1NLKL 3QT5A 2ZJPL 2E66A 5FJ4A 5AZJA 1TL3B 2D3UA 4FLZA 3RWUA 2NYIA 4RNOA 3AVFA 4HTIA 1NRKA 4KHPK 2RUGA 4O23A 3U02A 3M8RA 3SJHA 3V9XA 1JL2A 3E8OA 2MLXA 4FPIA 2A10A 2AMCB 3LW5C 2DNOA 2ZBIA 3G96A 1JLFB 3MECB 4KY3A 3MX5A 3BF1A 4URSA 4UOHA 4KO0B 5A8KB 2E29A 2BTFA 2QA4G 3SQOP 3TSQA 1JMTA 2OSRA 3G10A 2K06A 4MTPA 4J9UE 2MKYA 3VGMA 3DU6A 1Y9OA 4NZ7A 3H4DA 2W7OA 3QDKA 3IKMA 2GVDA 2W2MP 5HANA 1GXLA 3PY8A 5H9EK 4B1XB 1M1KT 2YHBA 1EQYA 3EM1A 1A5XA 3M9OB 3TO8A 4RR5A 3O1BA 2QZ8A 1N54B 4ZVSB 1QQMA 2OZSA 3HF5A 2LQBA 3Q86A 4EO6A 1XMBA 2QTWA 4QU6A 4DU1A 2IGIA 4M3RA 2ASDA 2MKSA 3FE1A 1QQCA 2BBEA 2J0WA 4CP5A 1NB2A 3WC0A 2QSFA 4JI7K 3SMSA 1RAIB 4LSLB 1SJ4P 1KQSM 2EEYA 2VPWB 4LF4J 4M42A 2VG7A 4JKEA 3QBCA 3GG1A 4KHUA 1RT7A 3G71S 1S3XA 5GAEU 2AU0A 3T3FA 1SJQA 2EFNA 4NLVA 4LFAK 1Q16B 2DR6A 1IKVA 5IFMA 3QRPA 4Q8FA 4IYQA 1DTQA 2WONB 4DPYA 3OVBA 1WF2A 2HW3A 3RYLA 4LSLA 3NGZA 4ZA1A 4B3SJ 1NDLA 1FERA 2CQ2A 3ZT3A 1CC8A 1RQ0A 2DNZA 3F0NA 3V1QA 3VQCA 3J81j 2GGPB 2QEXN 3LGMA 4W5OA 4MIAA 3W9JA 2UXDK 5C10A 3LPEA 4P73A 3D6HB 3MUVP 3CJCA 4OHWA 5HBMA 5ETQA 3O9TA 3VHQA 4TN2A 3OVSA 3V2UC 5F41A 2CQGA 2E1RA 3PSIA 1K1SA 5LMUJ 5KFMA 1HYZA 3ID6A 4EP5A 1WOOA 4FOIA 1WG4A 2HZCA 1VHXA 3HMJG 1OVYA 1UKUA 3M30A 1WEYA 5BR8J 4YOUA 3CCSN 3IS9B 1K44A 3DLLQ 3B82A 3AO1A 2RHKA 3H1QA 1WJ9A 2GIRA 3EVWA 1NGDA 3OYAA 2NREA 1IKXA 3E01B 2H54B 1C4CA 2M8DB 3VV2B 4GMKA 2E1YA 1BWEA 2CJBA 3MURP 1X5SA 3BDPA 2HBQB 1JLEB 2E2QA 4FK4A 2W01A 2ZH7A 2B4JA 3VGSA 4L76A 3SK3A 2Q97A 5B0CA 1HQUA 3HT3A 3G6VA 3KG4A 4OI3A 4UTGA 5AE3A 5ETNA 5KI6A 2F4VK 1HBMB 2HHHK 3HVTB 3HYFA 2LMIA 1SC4B 5M2PA 1Y64A 1OSCA 2CZVC 3UPFA 2ZVSA 4PG5A 1XTZA 5IWAF 4B1VA 2VA3A 1GLBG 4J91A 3UDCA 5LJVA 1KXPA 5A6PA 3V5RA 4DR2F 3WEEB 2A0FB 1RTIB 1S1XA 4Z4IA 3M1VB 1Y4ZB 5K8NA 4K4YA 4NMXA 5HQ8A 4N76A 1U2VB 4KJIA 4U7BA 1KOOA 2O8EB 4H0YB 4LRDA 3Q7CA 3O3LA 1XR7A 1Y3KA 5C2CA 2XQCA 1YJNN 3G4SN 4TY8A 3I8BA 1S1UA 5K14A 1EZZB 4B3RJ 4OLBA 2IVMA 1KWMA 2AX1A 4KO0A 4JV1A 1RWMB 1J2VA 1BL3A 4ED4A 1YJ9S 5EHHA 4M5NA 3EN9A 1FDBA 3O1WA 2YKNA 2B9YA 4P74A 2QSWA 3UW1A 1WF0A 4FJ9A 4JV5F 3RMAA 4GKJK 2BKPA 2D5RA 3TARA 1CJVA 1UVKA 3VAFA 1FJEB 4CFBA 1YJWS 2GUIA 3ZYYX 3NXZA 3L09A 3GQCA 3CIZA 1AT1B 2NZTA 1VR6A 5AQTA 4YY3K 4CK2A 3CCWA 3ZX0A 4G1QB 5CCMA 3GMGA 5IM0A 3UE2A 1KFDA 5JS1A 2I6WA 2VQEK 2DKOB 4FPBA 3KKFA 3QJJA 4FJXA 5HVFA 2FJDB 4E19A 2KHCA 1G3OA 4CJUA 3DRPB 4RWXA 4Z4HA 3NOCA 2L3MA 2VQFK 3TTCA 3KHRA 3FZHA 1JNZB 4ZJQA 3R8EA 3K58A 2A6MA 1ASVA 3UDEA 4FYXB 4EBDA 3G2XA 1ZZFA 5A76A 2YNFA 4F36A 3TAMB 3WEEA 3WXKA 2DNQA 4ZCKA 1H0HB 2UXBK 3M8YA 2ALYB 3NCRA 2XB2D 1EWRA 2B4PA 4ERDA 4JI7J 3CCSS 2CZ9A 3R27A 3W61A 1J5OB 4W5TA 5E3PA 3W66A 5T7LB 3PKMA 2P9KB 2HHQA 1MU2B 3VESA 3OBIA 2DY4A 1PCAA 4Y28C 4X65F 4C3MA 4OO1J 1YVUA 4CFCA 5KFJA 3THXB 2ZGYA 3QMLA 3AY9A 3K57A 4WYLA 4KTQA 3RG6A 3CE8A 2D1KA 2P2CB 2CZ4A 2A6AA 2KXNB 4B3SF 3QNWB 2VDIA 2P9KA 3CCMN 1D9AA 2V67A 4WBFA 3A3OB 1JLBA 3T19A 2DR7A 2K7KA 4KFBB 1WC5A 2VICA 2E1CA 2F1FA 3BY5A 4FL9A 1VQ9S 4MLHA 2WSEC 4AT1B 1RT5A 3TUZC 2NXEA 3DI6A 2QLXA 1WSIA 4L73A 4DR7J 3M8QA 4OZ3A 3FR0A 2QIFA 4NCGA 2UP1A 1BI4B 4WFNQ 5CZ2A 5LMUF 5J1PA 5F3TA 4PWUA 3P3DA 4BGAA 2QN6B 4IG0A 2EG2A 4KPCA 2BUPA 4OPKA 5C2DA 1M5HA 1WG1A 3P49B 4M5HA 5HLFA 3UE5A 3VERA 3PEJA 4HCCA 1CZAN 5KFSA 1T03A 5BPMA 3CJ1A 1FJGF 2DISA 3AT1B 4DU3A 1Q8BA 3AJ2A 3VQEA 1RT3A 2YX4A 3C15A 4YEAA 2LDIA 3CG7A 4IFEA 3RJMB 3QINA 4AHRA 4ECRA 1KEKA 5CHCB 1NJXA 1NJWA 3VTHA 3IBCB 4IJAA 1CXUA 2HHSA 1N32F 3KLFB 1ZC6A 3C6UB 2V50A 2O8CB 2PFDA 1KDNA 4NLQA 4WF9L 4TY8B 3OHBA 4FK0A 1LW0B 2AW0A 1RWUA 2LEAA 4RBTA 5DGBA 1LK5A 2ILYA 1NOYA 4K4SA 1VQ4S 2PY5A 3CFPA 3A5NC 4B3MJ 4CJFA 2XZWA 4X64K 3U3GA 2V4RA 3QGGA 2RHSB 3NGUA 2IJNA 4AM6A 4MKAA 5E5NA 1N5SA 3POTA 4LBIA 1Q8LA 3CIMA 2B5JA 2NZ4A 3CD7A 1RHJB 1HQUB 4B3RK 1I51B 5IOLA 2EC2A 2ZKUA 4YHHF 3M4XA 3CMAS 2JWNA 2CNNB 1F3FA 1FRLA 2V9KA 1IBKJ 1P9YA 3Q24A 2RQ4A 3IMXA 1FE0A 3GPAA 5CR4A 2KXHA 4MKBA 3AHPA 4KGKA 4ZK7M 4WFYA 4N5SA 2KYXA 2ZWOA 4FLYA 2OEKA 4IEEA 3CM6A 3HP6A 1NLVA 3AA5X 4EAHD 2HVDA 4M5GA 4KHPJ 4DV5F 4YDUC 3P6YC 4J2BA 2HBJA 1XMQJ 3SCIE 2YNHB 2BUNA 1VC0A 2XSFA 1T05B 4MKVA 3DFEA 1ATNA 2E2PA 2P1JA 3CCQN 3CJ9A 4CBXA 2DNRA 1X31C 1FRKA 3I33A 3LM9A 4E98A 1YDLA 1T3VA 5DRKA 1JLCA 2FJVA 3PW2A 1HNIA 5KFEA 5AZJB 2MKHA 2G0CA 4DQPA 5E3RA 3GCWP 2WVCA 2IFXA 2IDEA 1GMUA 4XTTA 5FIIA 4WTOB 4E7HA 1QUPA 4BCAA 1GOAA 3P38A 3BV8A 1E3MA 1OYEA 4Z4CA 2MEWA 1RE1B 3WXIA 2PT0A 5L38A 5KFCA 3ZCMA 4Y1CA 4ZS6A 1VBZA 1U4BA 2YX6A 4C7QA 1HMVA 4B3TK 4YHHK 1UPMB 5L46A 3AD7C 5L1JA 1GTEA 4N7TA 5JS2A 3GR1A 2AV5A 2GAHC 3KNAA 3ATUA 1HJRA 3W62A 1UAWA 2CJKA 1MWQA 2VV5A 2FJEB 3BN4A 1GMVA 4C1NI 1RTDA 1DAXA 1TZ0A 3H46O 3N4WA 3IRXA 4RUAA 3EE8A 1FRHA 3AFGA 3S1TA 1O1WA 3PCOB 4IDHA 3P1GA 3ZTPA 3CCTA 4BGBA 4LFAJ 2RJZA 5KRSA 2BQRA 1JKHB 4TLQA 1NK7A 4YN3B 3ZX2A 3TUIC 4IQXA 2I7NA 3R5AA 1ZZNA 3IP0A 2AJ0A 4DV7J 3KLGB 3IRWP 2G13A 3EXYA 4CFDA 4DFKA 3BQ0A 2UZAA 3B4MA 4ILGB 2PFUA 1RT6A 4G65A 2ATQA 3ZSRA 2B0GA 2KB2A 2ZH3A 4FLTA 3TZYA 3PR4A 5AQFA 3DLGB 2HS4A 1DTQB 4RUCA 2W4DA 1HRHA 4NXNJ 4O8UA 1DQ9A 2AYEA 2PYLA 5KFKA 5J2MB 1ZM9A 2CPDA 4OLPA 2E5LJ 4DL0C 1N6QA 4RNMA 4E1NA 1P8GA 2V69A 4OYBA 3M2UA 1O6XA 3BB5A 3BSAA 3OSPA 2R7QA 2YHWA 3U1MA 4Q0BA 3LM2A 4JKFA 4BWJA 1S7HA 1VC6A 5KT7A 1TYQB 1N48A 3IUCA 1X3MA 4NA3A 2PI4A 3KKSA 4OKEA 1AB8A 3NS7B 1KAXA 2HBLA 2MZTA 2M7SA 1XC3A 2XZTB 4QS8A 4N47A 3TAQA 5EWGA 3CDEA 4OGCA 4RUBA 1QY7A 3G87A 4ZPDA 4WK1A 4CI6A 2DH7A 1U6FA 3MFIA 3HPOA 4XO0A 1H73A 1YITS 4MLEA 3OS2A 2PIIA 2RIJA 3SI6A 3CO9A 4A8MP 1NK0A 2VFVA 2IAJB 5C12A 2GQQA 1QSLA 4IR1A 4DLGA 4DR1J 1G7CB 3H20A 4OHVA 2G9OA 4AQYJ 3NHGA 1E6VA 3GV5B 2ZGZA 2QWRA 3P5BP 1UTAA 3RUBL 1NG9A 5FRNA 2EW9A 2QLBB 3LP2B 3WNFA 5FPEA 2RE1A 2ZM6F 5IQQA 4KHMA 2Y1RI 2CQBA 2UXCF 3QBWA 1BA0A 3BGOP 3IR7B 1SIWB 2ZH8A 2KT5A 3SUPA 3BBBA 2C2KB 3TQ1A 4I7FA 1C2PA 1OY6A 1RXOB 2QI2A 1JX4A 3R2DJ 2YKOA 3M2RB 3AVMA 3LQVA 1YZ6A 5L9XA 3D2EB 1K9MO 3LGNA 1D8YA 1WUUA 1ZAWA 5K20B 3OR1B 4DV1F 4ED8A 4H03B 3QJLA 4ZP9A 2UU9K 1WUAA 3SV4A 2CADA 2IM3A 3M8PA 2V7ZA 1QAJA 1G4CA 3H40A 1IWGA 3ZZOA 4KREA 3CCVN 4NCAA 2CKWA 3O9UA 3OJUA 4DN0A 2GBZA 4UF4A 1PYTA 3QYYA 4FJ7A 5G0RB 3CJRA 2WB4A 5CE3A 2XO7A 1JJCB 3E3XA 3DXBA 3SPZA 4L8RB 1S6QB 3OTCA 2RILA 2BJDA 3BS9A 3CJAA 2HHTA 4KT0C 4F26A 4I6YA 3CDAA 4LJMA 1URRA 4LFBK 2HNDB 3AY0A 3TW0A 3D2WA 4HHTA 1C1CB 2FVSA 3EGWB 4Q2LA 1NK9A 4NCGB 3QFHA 1WKKA 5BYQA 1XNRJ 3L4BC 4PG7A 3AVLA 4WQ4A 4C11B 4CF0A 3LDSA 3LDLA 2W4CA 4DR7F 2UV8A 3TJAA 1HBUB 2IA6A 3IBFB 2M88A 1F9FA 3P5TL 2H4YB 2OPSA 3BF3A 1JJ2R 3A4TA 2KW4A 2HG4A 2V4JA 4DL3A 3IDHA 1WKJA 4F0KA 1S5JA 4JKHA 2FXUA 1BA1A 1B0TA 2J9EA 4HKQA 5ETVA 3T5HA 2ZFHA 1N36J 1ITGA 3C15B 1RKIA 1Y5NB 3CC4N 2G1DA 5EUHA 1LOUA 3HX9A 3SUOA 1UVJA 4MDBA 2DNKA 4HHJA 3SPYA 3NRBA 1ELOA 1SL0A 1LWXA 1YHQS 2B4OA 1RT7B 2KVIA 4GC7A 4ZP6A 3KLIB 4ZJOA 3PXGa 3CF5L 2P9CA 4DR3J 2VL1A 5AQLA 1N32J 3HHKA 1HQEA 1F6TA 4Z7YA 3GIJA 2HKEA 2QWMA 4BR7A 1RWKB 4M3YA 1LFWA 4NLSA 4EIAA 2VOPA 2EC0A 2EX3A 1AA1B 1ZM4A 3BH7B 4DR6J 4GVMA 4ZOSA 5LL6d 2AEMA 4QWEA 1QJHA 3K5MA 2Z4PA 2JVRA 1IR2A 2AJ4A 2Q3PA 1Q86T 3IS9A 3TEHB 2I1RA 4B3MF 4V19S 2B5JB 2A3ZA 2CRLA 1P1LA 1S22A 3UWTA 4FJNA 4DR7K 3LF0A 3MPDA 4OJRA 1HL6A 5LY3A 2DIVA 3ENAA 5K5MA 4DQSA 4J9RA 2HRYA 5CZ1A 3NGRA 2JLFA 3NNAA 4ED3A 3OXGA 3KDOA 5KTQA 1C0UA 2FJWA 3MMVA 3IG1B 4WIQA 3RU0A 4M5LA 4FWQA 3MM6A 2GFFA 4TKTA 1S9GB 1IBCB 5IC6B 4DSFA 1HQ2A 2UUWA 1M5VC 1BD6A 1M5PC 1BLUA 4AYBD 2XSJB 3C6HA 2VIHA 4IRCA 3AOBA 5GMEA 3W3DA 1OS5A 1WSGA 3CUNA 2E88A 4J9KA 3R2CJ 2AD9A 2V9WA 3QICA 4ID5B 4BR0A 3WZ0A 2UUAK 3UR3C 3ZTRA 4Z7CA 2B7BB 1KHWA 3MOZA 1T03B 4KH4A 4NRTA 1FESA 3WNEA 1UZDA 4P72A 5E3AA 1SQEA 3KUEA 1YJWN 1TL7A 4DV0F 1YZ7A 4WE1B 1J5EK 4QR1A 2QO3A 4EP4A 3MMCA 1TVRA 1HNZJ 3GV8B 3T9ZA 2W2OP 1NPPA 2E5JA 5JVHQ 3HULA 3ULEA 1NWKA 1A7GE 3HD1A 1VYAA 3K5NA 1BHLA 3TPQA 2CPJA 1CJVB 5DGAA 4B9LA 2WBNA 2WRMA 4DSJA 3MPUB 3N6NA 1RJJA 3H5UA 1W25A 1ESVA 4L72B 2OGUA 4X4RA 5HRRA 4DLEA 4DQIA 2BMBA 2O5DA 1URNA 1JWWA 1HWIA 3HVTA 1WSVA 1FTCA 3VQ4A 5CHIA 2ITGA 2IHR1 5FD1A 3UKUB 1U48A 3G8TA 3CJSA 2B6AA 3MTJA 1GLEG 3QZ7A 2IM1A 3G0ZA 5D4OA 3Q8VA 1RT2B 2W2PP 4W5RA 3T1YJ 1Q78A 3D7EO 1IXKA 2IIHA 3RW6A 2J0QD 2OI2A 4F9OA 3HHEA 4PPZA 1NJIO 1HW9A 1GOCA 5CAAA 4I7FB 4XAKA 1HA1A 2YQ1A 3NGKA 4BRQA 5D0EA 2JGUA 3P5JA 1V6HA 2FD2A 2PFFB 4IDKB 3ZC4A 3M6VA 2H51B 3UNGC 1OPIA 2PBDA 1BOTO 2ZBRA 2HHHJ 3L6QA 3VA3A 5KOWA 3OJSA 4CYUB 1V3RA 2DNMA 4ID5A 1GLCG 3SMPA 2MYFA 3NMAA 1QE1A 4RW8B 3SJJA 1RDDA 1VAZA 4FNHA 3TZWA 3W63A 2IBKA 1Y3JA 1NSPA 2HBMA 3CCRS 4P7TA 5D8HB 3V9SA 4ZITA 2FJXA 2DRBA 1SXLA 4YDXA 4WP3A 5C0YA 1XNQK 2H4WB 4Q2MA 4FW2A 4CHZA 1YBAA 1RDCA 2LU1A 2VG5A 3HFZB 4C0HA 3NVKA 3PYEA 2B4UA 4KB7A 4ZVTB 2E5LF 4BRCA 3LGHA 2P9LA 1KC8T 1JB0C 2C2OB 5F8IA 1QQNA 1OO0B 2OELA 1OPZA 3HI0A 5F8JA 1E6YA 4MK9A 4X62F 2W41A 1K8KA 3TQEA 1OIAA 3EKUA 2WW8A 3AOAA 1TUUA 1Q81O 2WUSA 1N52B 3QEIA 4M5DA 4E8UA 2XY5A 2BJ7A 1C0GA 2MZQA 2FVQA 4W90B 3GYGA 5J2QA 3CC2N 3DOLA 2BOPA 1UVNA 5LSOA 2F8TA 2XNQA 4CEFA 2VFSA 3THWB 4MIBA 4FM2A 3F56A 1FX2A 2RPIA 2VH7A 1RDAA 4PWDA 3MM6B 1JLBB 3OFGA 5B0GA 4FYVB 1VQON 1YJNS 4CLTA 1TFWA 4JI4F 5AQPA 5KPTA 6AT1B 4Y65A 1XHZA 4I6MA 1N33K 5HROB 1IKYB 4GC6A 1LWCB 4WP8A 1RILA 1S6PB 3K2YA 4K4XA 2AA4A 2ZM6K 4JEPA 1BQMA 3OR2A 1D9DA 3NWGA 5CABA 4KKOA 1GTHA 4LBPA 1CXQA 4PWDB 3V81A 2E6LA 4LF5K 3M2RA 3MHYA 3NP5A 1JCFA 3Q8SB 3ELHA 2HNYA 2KHDA 4BRMA 3LL3A 4R5PA 4FS2A 2F5GA 5DETA 4PG8A 4DV1K 5HN0A 3QAUA 3VQTA 2AGOA 3LAMA 4ZVFA 5D0RA 1WNEA 1VC5A 2XS2A 2BH1A 2WTUA 2IOCA 5ETSA 1WKLA 4OJ3A 1XJWB 4Z2XA 1N8RT 2YWGA 3OYKA 4FJJA 1YJ9N 2D0BA 1U2FA 2ATCB 2Z30B 4BR9A 3MXIA 4URGA 4K42A 2KT2A 1D4XA 4CH0S 4KH1B 3POTB 4FPRA 1WC4A 1Q4RA 4TLRA 3O08A 3C2PA 3HXMA 4JV0A 2KFYA 2ASMA 3SI8A 4QW8A 4DQQA 2UV8G 4JI1F 2W2QP 5I9EB 3A3NB 2PGCA 2NUUG 1CEZA 3T1AA 4EMDA 3OV7A 2DGTA 5FPNA 5HRSA 4LQ3A 4OYXA 3TP2A 4WFAL 1KN6A 4DX5A 1GMWA 5CA5A 4OMFG 5LJ3Y 3FQLA 1SCJB 1RBLA 4TXSA 1QD1A 1C4AA 4M5JA 3IA0A 1R8CA 5F9LA 2JC1A 4QZVB 3THYA 4DCPB 1JLQB 3CJ3A 3US5A 2ZJPQ 3LWMA 1DTTA 1BQMB 4DV3K 1XI1A 2C2MB 4DSLA 4C4WA 2CJXB 3V6JA 3DKDA 3IMQJ 3DM2A 4M95A 1RTJA 1FK9A 3M1VA 3FBFA 2MZ1A 2YNIB 2RDDA 4USHA 2KTQA 4A61A 2C3PA 4JI5K 4XEIA 1VQNS 1X9JA 3SQ1A 4CLFA 1CJKB 2KHOA 1YRTA 2NR0A 5A8RB 4HTLA 3MECA 4YHHJ 1EWQA 5AXLA 1IO2A 3FEZA 4DL7A 2WC9A 3QFPA 1ASUA 2FPHX 3AA3A 2ZE2B 5DM7L 3THPA 5KT6A 3AV9A 4W92B 4F4WA 2AF6A 5KFBA 4A47A 1B4SA 2B9WA 2QFIA 1M1GA 2FLPA 3TZZA 2GJIA 1GOBA 4CZHA 1KC8O 3QQCD 3KJQB 4DUZK 5F1XA 1UETA 5JMNA 2NSBA 4DI6A 2Y0BB 3CD6S 1CLQA 3DLKA 3ZZ0A 3OW2R 1RACB 3IM9A 4LFCF 2J6TA 4FJGA 2DGUA 2BRLA 1B99A 4B1UB 2JHEA 2P9PA 3FNNA 2E2OA 1V5VA 4KGVB 3CQYA 1XWLA 4FS1A 4ISEA 1GMWD 3HVRA 3M9NB 3HBTA 5JXSA 3L7UA 4N8NA 2HSEB 3OBYA 5CQGA 4DOZA 1FRIA 3W2VB 1RU2A 2YQ3A 1YT3A 1S9GA 2YI1A 3QBXA 2R8IA 5DMRA 1GNKA 3M6WA 1XBWA 3BKUA 3KLGA 2A42A 3HHLC 4ELUA 4Z0UA 4LY7A 3TTDA 3CJKB 3MDQA 1VQPN 3BYPA 5J1NA 2OSQA 1YF5L 1IWAA 3IGNA 3ENHA 3Q0AA 5HP1A 1FK9B 1EP4A 3ULHA 2WBRA 1HWJA 4UUXA 3HLUA 1W2BM 3LDOA 5AE2A 1TKDA 4NLGA 1O5JA 4LF8K 3DRRB 4IG3A 4DKWA 1T9WA 2ZQBA 1KQGB 3MUMP 2FGCA 3ICLA 2DXEA 4Q5VA 3AVNA 3EZUA 2IBOA 4PQUA 4C8ZA 3PFEA 1R59O 4I2QB 1Z2ZA 4O3PA 2VCPA 3FZBA 1BUXA 1ZXOA 3M2UB 1P27B 2R2TA 1U7LA 1YI2S 4ZPVR 3FSYA 2YBVA 1ATSA 1K8AT 1HNXF 1WD6A 4HT5A 2QYCA 4LRBA 2EHGA 3MFHA 2JEFA 3IRXB 1YJUA 4WYWA 3BP8A 3J7AN 3W64A 4A5AA 4E7LA 2J0SD 2FBXA 3MMAA 3DLGA 5KT5A 4LFCK 1FWLA 2QA1A 2XMJA 1VQKS 3QRQA 1IBMK 5LXRA 4JS4A 1BIZA 5LL6Z 1VQ4N 3JSBA 4DPXA 3IXQA 1CLFA 2ATLA 1Q7LB 3PDNA 4ZVUB 2FGOA 4DQRA 3PRVA 4HCBA 4HH0A 2VB6A 3MXJA 3BSOA 4FDFA 4NYFA 2W6LA 1YBUA 1KLMA 4CLUA 1PG5B 3CMAN 1SJRA 4BRKA 3TVZA 2WHOA 3F2KA 2AX0A 3V9UA 5KG3A 2Q6CA 3S3MA 1ZAXA 1GH8A 3LDNA 2XWYA 2W9BA 1TMMA 1T3NA 3P39A 2HRUA 1LWEB 2HRTA 3ISZA 5ADXH 4JI8J 4BWMA 4CERA 2L9WA 3AVGA 1FKPA 2G0IA 3CFOA 5D77A 1NPKA 2BJ1A 3VZHA 1HKGA 4XPCA 1PYOB 1BGXT 1FXDA 3P45B 4JI2K 2NLXA 4DG1A 2DGVA 2HK2A 4CH7A 4B1ZA 2DNYA 3UD5A 4GV9A 3OYIA 2B8PA 1B0PA 2CJ9A 3RGIA 5DG9A 4NLPA 3LUYA 3QGIA 2R4FA 5I3UB 2QT7A 1DBDA 2H5EA 2QWQA 4QWAA 1XNQF 2O4IA 2KM8B 3DYAB 4CJ5A 2D69A 2UXBJ 4C98A 1W2BR 1GFWB 5ETLA 1HR0K 2D74B 3RAMA 3GILA 2FLOA 3KMQA 3C0BA 3CDUA 1W9HA 2GMJA 5KGWA 9RUBA 4CW7B 4K8RA 4YB6A 5KRTA 4IO1A 3FSIA 4NA2A 4K8XA 5IWAJ 4ZVPB 2LVWA 3DOLB 2VFRA 3I5CA 3E9OA 2BM1A 3FMBA 3OQ2A 3TAFA 2AP6A 3A5OC 2HHUA 2E6MA 1E4GT 2I8EA 3UDVA 2ASOA 4DJBA 2FJAB 3AARA 2ZJQL 4J37A 4RU9A 2HB5A 4RW6B 5HSPA 2YHXA 4JI8F 2MPUA 2P5OA 4G1QA 3OW2M 2DGSA 3BN7A 4FWSA 2YX1A 4N8OA 4CBUA 4AILC 2G4BA 2JDJA 4QPTA 5AR0A 2QL9B 2A2CA 4QAGA 5M2UA 4EYHB 2QV6A 3UD3P 2DO4A 2HQCA 2YH1A 1T3OA 3T1YF 2K7JA 4FWPA 1LWCA 2GV1A 2R7TA 2C3MA 3SQGB 5GADP 3KK1B 4IDKA 2DT9A 2ZJRQ 2RRAA 2F9TA 4NYZA 3W5XA 1T94A 4NPOA 1UVMA 2YNFB 3DXSX 5IQ6A 3KFWX 5BJRA 1T9VA 1UJ5A 1ILYA 5M1QA 1UW9A 3SAFA 2P9SB 2BJ3A 1N88A 2D0OA 2HBZB 2V0NA 4FJLA 2LKZA 1VCTA 1IN0A 2HFVA 2VU5A 4DS5A 2ZJRL 2GTDA 2X6SA 4Z37A 4IKAA 5BYSA 3M8WA 2LEBA 2YWWA 3L3VA 3BO2A 2YPZA 1VRUA 3LZIA 2BACA 1JLFA 1VRTA 4ZCIA 3SLCA 5GADI 3KHLA 4B8CA 2DHGA 1KVJA 3EGVA 2GQ2A 2JX2A 5A6WA 4LSNA 4FNIA 3LO3A 2GWKA 3EWGA 3L4QA 1S6OA 4OYMA 3RTVA 4BC3A 3C7NA 5BN9A 1CZ9A 1R8HA 3U6FA 3PO4A 5AQIA 2YX7A 4YORA 2VDHA 4P2FA 4EFAC 4FXWA 3L2VA 2MKCA 2DPNA 3OFFA 1RTZA 1IM6A 4OPAA 4JB8B 2W7AA 5C25B 1HWLA 2Z2ZA 3A5MC 4DZDA 1LXNA 3MM8B 1F21A 1HNIB 2QC3A 4ZLNA 2FQQB 1S0MA 2ZD1A 1KVCA 2M4MA 4IR9A 1QHTA 4G3IA 3UDLA 3M8QB 4LF7K 4CIGA 4DR3F 2A5XA 3EY1A 4CJ4A 3N4QA 3DM2B 1DQ8A 1TK8A 4NOHA 1BU6O 3V6KA 4YQWA 2XG8A 4JD2A 2WSFC 2KFZA 3VF0B 3MR2A 4AM7A 5B0DA 4B3OA 4DUTA 4OZ2A 3GFYA 4LSZB 3PW5A 1ZBIA 4I2PB 5KFQA 5HBMB 2B51A 3OYNA 3EICA 4WWSA 4ZVGA 3ID8A 2OPRB 1PJ5A 3KTQA 3VPZA 2J7WA 2VA2A 3I6PA 2BQ3A 3AQPA 4IZ9A 3FQKA 1WACA 1WAJA 1NHVA 4DV4F 4ZP8A 5TKWA 3OVAA 5CY4A 5M1NA 1HKCA 1WTBA 2KN4A 3ZZUA 2FHOB 3G6XA 5IZHA 2RQKA 3PX6A 2GS8A 5FLXY 3ZT0A 4I2PA 1C6VA 4DR6K 4RG8A 4P6QA 3S3NA 1BCOA 2AYMA 4PYDA 5T7BA 2YTCA 2DIUA 3T6JA 4E7IA 1M90O 2V5HG 4A4JA 4LF4K 2E9ZA 3QWUA 5L39A 4HL9A 2DITA 4NZ0A 3KXDA 3AAQA 4O3OA 3VQ5A 4CF2A 4M1KA 5GAHP 3OS0A 2KT3A 2OFGX 3MOJB 2RF2A 3KK7A 2BZ2A 3S9HA 1C1BB 1N56A 3OPKA 2M3DA 5HATA 4EBEA 2JSXA 3LZJA 2U2FA 4M5MA 1M1HA 1RA6A 3RBXA 1NOZA 4BRGA 5KAKA 2H9ZA 1X4DA 1FA0A 4K5RA 4OYOA 1KHVA 4BDPA 2B6AB 1WF1A 2G2OA 1FKOA 3PSFA 3FCHA 4ZLLA 3RR8A 4DCHA 1FTRA 3MR6A 3I9ZA 1U09A 1S72S 1DJ0A 2QM1A 1HLUA 3V9ZA 3VF4A 4B3OB 3CCLS 5I3UA 3CEDA 1HPMA 4O4GA 1FI4A 4GNIA 1X8DA 3O9SA 3EYZA 2LDYA 1CJTA 2XCPA 4FO0A 4NWBA 2IPOB 4FVUA 1NK5A 4USUA 3KUHA 4H8KA 3EXCX 1RGVA 2E5IA 4LD0A 5CD4H 2W8KA 1S9EB 4QW9A 2Z56B 2DO0A 1R8AA 4DXLA 4KI6A 3N01A 1E4FT 2GW8A 5LMNF 2AQ4A 4OYZA 4FZXC 4EWTA 3OD2A 1T8EA 2Z2MA 4HHHA 4Q45A 3J81Y 5HJYA 4P75A 1IQZA 2JFKA 4M3TA 2XLIA 4FLUA 1EQMA 2GJFA 2BJ9A 5GAEP 3ETMA 4DX8H 1S6QA 4CJKA 3E01A 3GE9A 3HFVA 5LM7E 3PLAA 1VQ8N 3T5LA 4U8YA 2XC9A 4CRJA 2ZH5A 4QOTA 1WSRA 2VG5B 3GG0A 2AZ3A 3D4JA 1WHVA 4JNEA 2HMPA 4F67A 4DV3F 1IKWA 3M8ZA 1YSJA 1WC0A 4BR5A 4FBUA 5KG6A 1YJRA 3EZOA 2IYIA 2F65A 3FSXA 3UQSA 3KLHB 1NGGA 4PKDB 1NGIA 4MK8A 3LWLA 4NB4A 3CJBA 1VRQC 4CIEA 3HJVA 1R6VA 3PEHA 2MY8A 1FDNA 1HD1A 3PW7A 1IG9A 5EU7A 3MCPA 2OPPB 2DGOA 4DL4A 3K89A 4G1IA 2BW7A 3CJ7A 1NU0A 1JNRB 1V3SA 3SDEA 2CWKA 4H0PA 2DVIA 5C15A 3UN3A 3DXKB 2P9LB 1H3DA 4KIAA 1S49A 2YH0A 1ZM3A 4GRSA 4B3TF 4AL5A 1HNWJ 4FJHA 1K8KB 3IO1A 1JCEA 3ISND 1T9YA 3Q83A 3OYFA 5B0EA 1FFWB 2P5VA 4RWTA 4DV4K 2FZCB 1U0SA 3PACA 4MAKA 5B09A 3J7YP 3PW4A 2Y0SD 3PYFA 1P6TA 5HRNA 2CYYA 4R25A 1YJTA 1REGX 4WXOA 4JI6K 1S4FA 4ISFA 4NLRA 5ITHA 5AJ3J 3ZTOA 4DZ6A 3V6DB 4X4UA 2HMIA 3NCPA 1N8RO 2CXEA 4NRUA 2OTJN 2FY8A 2QWPA 4O3QA 3HHLD 3CQ8A 1TKTB 2VZ9A 4CZCA 1VQ7S 3BGRB 5IC4B 1TELA 4DUYJ 2J0XA 2R9LA 2LP4A 1FRJA 5ETTA 1IG8A 4LT6A 4USKA 5HJXA 1RT4A 2LYVA 1XHXA 1LK7A 1WHXA 1ZBUA 2XMAA 3GBTA 2WW4A 4ANDA 4J9LA 3OXLA 2ZF5O 2HQ3A 3L8BA 3HSCA 1XUPO 3M9MB 2VODA 2HVEA 3CCES 2VGMA 1EETB 1JLAA 2F63A 2YWEA 4FJ8A 3FFKB 1KLMB 2NCKL 5ETOA 2GVZA 1HKAA 4A46A 1HNWF 4C8MA 2XHCA 3Q8YA 3DRRA 4PG4A 5HL7Q 3RR7A 4E1JA 3HHLA 3GDQA 3ZSZA 1NDPA 4QIFA 3H45C 4C8YA 4DR4K 4HVZA 3UNYA 5E2QA 3U27A 3T41A 3AXKA 2O3DA 3DWLA 1M5KC 4DPTA 2Z1IA 3ILLA 4CJRA 4PXBA 4CHYA 3EO3A 1IR0A 4BE2A 4PWWA 4CO2A 1F2HA 3FZLA 2L08A 3LP0B 1TQLA 4MYTA 2OANA 2Y1IA 4QR2A 4F25A 4BROA 2P9UA 4K4ZA 4Z4GA 2BANA 1RHUB 1S1VB 4PG6A 2VPXB 3DOMB 4KH6A 1KFSA 4JI1K 2HAIA 3EPIA 1ASWA 2KL8A 1VSEA 2KLAA 4ITSA 3ATVA 4ZPTR 3DMJB 5A0YB 3IBWA 2DY1A 2CVEA 1NZAA 4ZJLA 1TL1A 2XSJA 3D5MA 1HBNA 2F7TA 2QKBA 1S99A 4CO4A 2R7UA 5A8RA 3S6EA 4FJMA 4YOTA 1LXJA 1Q82O 2Q0RA 4JBCA 5A2QO 1NPRA 4NLDA 3GSDA 4R8UB 2Y1JA 2GMHA 3QATA 3HOTA 1XMOK 3L3UA 1FVQA 2QWOA 3G71N 2H65B 4CDIA 2HS3A 1FHTA 2DBBA 2FLNA 2GCFA 3C6AA 1QS4A 4BQLA 4KH5A 4C1NK 2W40A 4CJTA 1N33F 3UVJB 2ZH4A 3LH2S 2V8DA 5AQRA 1YG0A 3OA9A 4F02A 3AD9C 4J7CA 2IJFA 1T9UA 3FRYA 3L4IA 2AKWB 5DG7A 3SXLA 1NJIT 2UXCK 4NYOA 4NLBA 2AGPA 1HFEL 2XWXA 4PXCA 1HYSB 3HO1A 3ZETA 1CVJA 4C9DA 1RLCL 2D0CA 2LQJA 1VQ8S 4ZIWA 1FXXA 4MJKA 4PQUB 3MUTP 5KFOA 2ADBA 2XI2A 3VAKA 1VHFA 1RGIA 3O6WA 4CQ1A 3JAMY 2DHAA 4IQMA 2IIRA 2X1BA 4ZIVA 3K5OA 4UQGA 5DJBA 4BY9C 4OZ5A 4I64A 2XS5A 4DF4A 2E20A 3GG4A 3PJ9A 4RW9A 3GLJA 2G0JA 2B4VA 2R8JA 2XHBA 1KD1T 2BGGA 2I5JB 2V7YA 3O3GA 2PYJA 2MGZA 3KD1E 4A8FA 4NXMF 1TKTA 3H2VE 4DV6J 5I4MA 4JI0J 1JK9B 1T9XA 5KT2A 5KG0A 1O51A 1RSCA 1FVSA 2QMWA 1RA7A 1U49A 4GKKK 5J2NA 3ZZPA 3CCUS 1U1NA 3DI6B 3A8JA 2FC0A 2O8FB 3ET6B 3RRGA 4A8WA 3SFGA 3J7ZT 4B8AB 4L3KA 3ENOA 4HTJA 4ZPAA 1WC1A 1QE1B 2IM0A 3TU5A 2RF2B 5AQQA 3V4IB 2F9DA 4FLWA 5HK4A 3DCAA 1SI9A 2V8HA 3GIIA 4CZMA 3JXOA 3VTIA 3TR5A 2R8GA 3EVMA 4KE5A 3OL8A 4AQYK 3VZIA 4FJKA 3QGPA 3BZKA 5H1SQ 1OH5A 3R8YA 3R5CA 5JICA 1JLCB 3KLEA 4DR2K 2CG8A 3C16B 2CAJA 4LF2A 5KQDA 1NXIA 2COLA 2P9IA 4H5NA 2B56A 1BISA 1X5OA 3QGHA 3D45A 3J7YI 1DURA 3QPIA 1CULB 1PBAA 4LF6J 5CH7B 1NEEA 2N4DA 2HMIB 1DARA 1TL5A 2ZKTA 2HSTA 3CC7S 3R6GB 1ZBHA 1KD1O 3T6BA 2WB1D 4EEYA 4DU4A 4ZCMA 2DHHA 2J5AA 3L7PA 2OIHA 1G99A 5LMNJ 3MMJA 1ATRA 4DG1B 1IQTA 1P90A 2PEBA 5D78A 4HTUA 4NLUA 1VJWA 4CEEA 2JJ4D 4K43A 2IVPA 1A5WA 3NWRA 2V51B 2DNGA 4FVCA 2BA9A 4FZZA 1JCGA 1WSJA 4M5DB 5H9FJ 1I3AA 1RU1A 1YGYA 4IFYB 3NVMA 3Q2TC 4HUGA 3PX4A 3ZZRA 5EVZA 5TKYA 5J1EA 3T5JA 3PFOA 1L5UA 4KHRA 4ISGA 1LAWA 1FX4A 2KYZA 2VQEF 3F5TA 1U8SA 3GTYX 4KV8A 2I9SA 3MEEB 5F8NA 1RT2A 2LXUA 5EN1A 4ALZA 4S0MA 2IY5B