2BANB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 subunit
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
total genus 98
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB03
2IM2A 1TQLA 3KHLA 4WXOA 3V6DB 5DLFA 3LP2A 1HMVA 2GIQA 1TVRA 4ED7A 4RW9A 2JEFA 1JKHA 4IRKA 4G3IA 1S1XB 3QGHA 5EWEA 1FK9B 3NKYA 2ASJA 4KKOB 2ATLA 4PQUB 5HBMB 4NCGB 1IKXB 4DL5A 2VG5A 3DRSA 5KFWA 3BGRA 3MR6A 4I7FB 4H4MA 1GX6A 3MTKA 3GIJA 2W7PA 3BQ2A 4ZHRB 2J6SA 4O44A 3DYAB 1BQMB 4I2QB 5DQIA 1RT1B 5DG7A 1JLAA 1C0UB 4F4ZA 1BQNB 1R0AA 1TKTA 3KLVA 5F8JA 2AX0A 2IM3A 5KFSA 4J9LA 3SFUA 4WZQA 3FFIB 4WE1A 4EO8A 2D3UA 3BQ0A 1S49A 1HQUB 2VG7B 5J2QA 2O5DA 4NLRA 4QPXA 4NLYA 1RTHB 3EZUA 5F9NA 4YR2A 1S6PA 2V9WA 1IKWA 2D41A 3H5SA 4ED8A 1N5YB 1N6QB 1RA6A 5KFRA 4EYHB 2FJVA 1DTTB 1C1CB 1S1VB 3LP0B 2UVVA 3DRRB 1RTJB 3IRXB 3DI6B 3NL0A 2IM0A 2W9BA 4J9NA 4ZPAA 2IM1A 4IH7A 5J1EB 1RTDB 3QIDA 2VG6A 3OL7A 3CJ0A 4F4YA 4ID5A 4WYWA 5DG8A 4WFZA 3DLEB 2ALZA 4MFBB 3ISNC 3MR3A 1S9EA 2YNGA 3MFHA 3QLHA 5F8MA 2IMWP 1S1TA 2FJXA 4ZP9A 2V4QA 1JLQA 4KO0B 2BR0A 4Q8EA 4R5PA 3GIKA 2C2DA 4IDKA 1C0TB 4TYAA 3I0SA 5D3GA 1KHVA 3FQKA 5F8NA 4RW4A 4PUOA 4RW8A 3M8PB 3CIZA 2FVQA 3BSOA 2R8GA 5KT4A 2AWZA 3QZ8A 5KFQA 3Q8RB 5HLFA 2XGPA 2C2EA 3DRPB 4RW7A 1SH0A 3I0RB 3QO9A 2YKMB 3KNAA 1RAJA 4I7FA 5HP1A 2IAJB 3H5YA 4RUAA 2W8KA 4X2BA 1RTIB 4IOBA 4K4XA 4IG3A 4MK9A 5KT7A 1OS5A 2VA3A 5C25A 1HNIB 5HROB 1FKPA 2J6UA 1RT7B 2HMIB 3CVKA 3V81A 3C6UA 4JUZA 2WTFA 1QUVA 2R8IA 1TKXB 3I5AA 3ITHB 4NYZA 3MECB 5J2PB 4R0EA 4O3RA 3SFGA 1JIHA 1D0EA 1RYSA 2QE5A 5KFNA 1T03A 5KG1A 3CJ4A 4NRTA 2WOMA 4URSA 2I5JB 1K1QA 3G6XA 2B6AB 4O4RA 4DL7A 2D3ZA 5F9LA 4MH8A 4NLUA 4ICLB 3KLHB 4Q0BA 1EETA 5KFUA 1DLOA 2FLLA 1JLFA 3RAXA 3KK1A 4MK7A 4QWAA 1C1BA 3DM2B 5J2NB 4LSNB 4RW6A 4WXWA 3IS9B 3T1AA 3QIPB 4LQ3A 2W8LA 3PW4A 4IH6A 3E01A 1S1XA 1KLMA 4URGA 2DPIA 4FS2A 3GYNA 4TY8A 5KFTA 4J9SA 2QV6A 4JV0A 2WCXA 5EWGA 5CYMA 1IKXA 2GIRA 4PWDB 4NLWA 1JLEB 4NLQA 5I3UB 4B3OB 2YNGB 2UVRA 4YMEA 3GILA 3MEEA 4KAIA 3OSPA 1QE1B 1S9FA 1RT5B 2YNIB 1TP7A 4R8UA 4WFXA 4ECUA 1R0AB 1TKTB 1S6QB 4H54A 2XCAA 2FVCA 5F8LA 1VRTA 1TV6A 3M8PA 1TL1B 5FDLB 3KJVA 3FRZA 3V4IA 4MIAA 4O3OA 4QWDA 2HWIA 1RT3A 2B5JA 1I6JA 3GQCA 3GV7B 1UWBA 5KFMA 5L1KA 2RKIB 4G1QA 1S1WB 3OLAA 3JYTA 2AGQA 3KOAA 1FK9A 4ED6A 4K4UA 2JLEA 3M8QB 4F50A 2AGOA 1TL3B 4XPCA 1KHWA 3I5BA 5L1LA 4YR3A 4LSLA 3PJWA 5C5JA 2BRKA 1T3NA 3DLKA 3KHRA 4Y2CA 3RB4A 1JLBB 3DLGA 4JV1A 1NNDA 3CDUA 4O4GA 4NRUA 4ED0A 3NBPB 3KMSA 1RT6A 3PJXA 2R8JA 3PVXA 3MEGB 3KLIB 5KFHA 3KK2B 2RF2A 1NHVA 1SV5A 4I2PB 3OHBA 1RT4B 5I42B 2E9TA 3LAKA 1CSJA 3RB0A 3N6MA 2ZD1A 5KT6A 4HYKA 1ZTWA 3PW0A 3I5CA 4EYIB 3KK1B 1S0NA 3HVAA 3KK3B 2ZKUA 2VA2A 2XWYA 5CYQA 5KFVA 2HNZA 3H5UA 1S4FA 4KFBA 4Y2AA 2W9CB 1DTTA 1S0OA 3IG1B 2R8KA 3E01B 3H5XA 2BANA 3TAMA 4TYBA 1S10A 1LW0B 4EEYA 2BQUA 3VQSA 1HMVB 2OPSB 3N6NA 5KG2A 3OSNA 3KHHA 3QO9B 1TVRB 3LP1A 2WHOA 4ECYA 4DL6A 4FBUA 2IJNA 1XR5A 2AX1A 5KT3A 4ID5B 2BE2A 5KFJA 4U6PA 4IG0A 5HROA 4K4ZA 2YKNB 3HVTB 2D7SA 4TLRA 3V6JA 3DOLA 4IFYA 4DL4A 1RT1A 1JLCA 1LW2B 1SH2A 4R5PB 5KG4A 2XCPA 4IKAA 4MK8A 3TQ1A 3G86A 2V4RA 4H4OB 2IBKA 5EUHA 1J5OA 2E9ZA 4RW8B 3M9OB 2YNFB 2IC3A 2B43A 3JSMA 3RB3A 3Q8SB 1S97A 4ZP6A 4ZPDA 3KLEB 4RNMA 3RAQA 4WE1B 1IKYB 4QW9A 1HQUA 5J2QB 3DOKA 4LSLB 3UDLA 2AQ4A 4J9MA 3CJ3A 3NAHA 1SUQA 1DTQA 4F4XA 4RW6B 5C24B 4ECQA 4IFVA 3QIPA 1Z4UA 5DGAA 3SI8A 1REVB 4ZVGA 3MEGA 1S1UA 4RUCA 3LALA 1ZETA 3BGRB 3BREA 5KFFA 4WYLA 1EP4A 3BJYA 3ISND 1T03B 3H4BA 4KHRA 2WOMB 4NZ0A 3BSAA 2RDIA 3E51A 1S9EB 2ILZA 3HKWA 2RDJA 4ECZA 1XR7A 5EDWA 3QLHB 1HNVA 3T5JA 4TN2A 3IG1A 3UR0A 4J9PA 5KG5A 1C1BB 3C6TA 1RT3B 2B5JB 2YNHA 3MEDB 4DG1A 1HPZA 4RNHA 4TXSA 5KFZA 1HYSB 4KKOA 5C42B 2XI2A 4RU9A 4NCGA 2BE2B 3FDSA 2OPQA 5DQHA 1JLGB 3H40A 3DRPA 4WZMA 1LWEA 2FLPA 3OHAA 4IQXA 1S1VA 3LP0A 4H4MB 4ZHRA 2YKNA 5F8IA 1IKWB 1BQMA 4I2QA 1N5YA 1S9GB 3DDKA 3V6HA 5HBMA 2R2SA 2HNDB 5J2MA 4NLPA 1RT6B 2HMIA 1RT7A 1IKVB 4TQSA 4DL3A 3V81B 2BQRA 2C28A 1J5OB 4M94A 3ITHA 5FDLA 3KJVB 3LANA 4K4VA 3FQLA 1C0UA 2WB4A 3QGGA 4IR1A 3EPGA 2JEIA 2C22A 3OL9A 4KBIA 5KFDA 2XI3A 5KT2A 2HNYB 3JYTB 3KK3A 4NLTA 2ZE2A 5JUMA 1RT2A 2FVSA 1IM4A 5KFYA 4FBTA 3OL6A 4PUOB 2R2TA 3PW2A 1FKOA 3DMJB 1LWCB 3IRXA 1T94A 4Q8FA 2XGQA 1HQEB 5HLFB 1VRUA 3DLGB 4RW7B 4MKAA 2R2UA 3CDWA 5JXSA 3RB6A 1JKHB 2R2RA 4RW9B 2WRMA 5I3UA 3EPIA 4HKQA 5D3GB 4Y34A 3D5MA 3H59A 4ECRA 3KLFA 3G6VA 2WONA 2E9RX 4MFBA 2HAIA 4J9KA 5KFPA 1FKPB 4O3PA 4PWDA 4KB7A 1T05B 1C2PA 5KFCA 4EBEA 4K4WA 3HVTA 4K4TA 4FS1A 2IJFA 5HP1B 2ZD1B 1TV6B 2FJWA 4ZVFA 4K50A 1RTIA 4EBDA 2OH2A 1HARA 2OPPB 1JLAB 4IFYB 4TY9A 2C2RA 3MR5A 1S48A 1QE1A 3CDEA 2UVWA 4Q43A 2I1RA 5KFBA 5K14B 3Q8QB 4YP3A 5L1IA 4ZPBA 4O44B 5KFOA 3NAIA 3MR2A 3BSCA 1HYSA 2BANB 4RNNA 3MECA 5J2PA 1TL1A 3T19A 1RDRA 4ED1A 3KLEA 4ECSA 1S6PB 1IKYA 4IDKB 4EBCA 1N4LA 3T5LA 2JEGA 1LWFA 4Q44A 5T14A 4IRDA 1JLBA 5KFXA 4ECXA 4O3QA 4GC6A 2DPJA 3FFIA 4Q45A 3M8QA 2R8HA 4NLGA 4RNOA 1TL3A 4JV2A 4IRCA 4NLOA 3RBDA 1TKXA 1IKVA 3QGIA 1MU2B 2HWHA 5CYMB 4DEZA 1SV5B 4I2PA 2W9AA 3PW7A 4NLVA 1RTDA 5EWFA 2VG6B 5J1EA 4K4SA 3IN5A 2JEJA 3BSNA 3HVWA 1RTJA 3GV8B 3DI6A 3BQ1A 3ICLA 3KK2A 3M9NB 1QAIA 4U7CA 3RBEA 2OPRB 5I42A 1S1TB 2F8EX 1DLOB 4XO0A 3CWJA 3QZ7A 2BQ3A 3KMQA 1K1SA 3MFIA 3V6KA 4J9RA 3TAMB 3PR4A 3MEEB 4EO6A 5DGBA 5KFIA 4NLXA 1C0TA 2JC0A 5CYQB 3I0SB 4ZP8A 4ZP7A 2BRLA 2W9CA 3HHKA 4TY8B 4MKBA 4RZRA 3N6LA 2UVUA 1JLQB 4KO0A 3V6DA 2WONB 3H98A 5DG9A 2ASLA 2YKMA 1JLGA 4WFYA 3I0RA 4LSNA 1LWEB 4ZVEA 3CO9A 2IAJA 4KHMA 1U09A 1TKZB 1UWBB 4RW4B 3KLGA 1EP4B 4G1QB 3DOLB 4ZPCA 5C25B 4TQRA 3NBPA 3G6YA 2OPPA 4O3NA 2VG5B 3DRSB 1QAJA 1C1CA 3NMAA 5KG6A 4IG0B 2ASDA 4J9OA 4QW8A 4ZMMA 4B3OA 4ECTA 1VRTB 2ILYA 4MIBA 5L9XA 4YR0A 1W25A 3CJ2A 2CKWA 3BR9A 4ECVA 2YNIA 1GX5A 4R8UB 2FVPA 1D1UA 3UQSA 4KV8A 4LQ9A 4H4OA 5DQGA 2RKIA 5F8HA 4ECWA 1LWFB 2XC9A 3JSMB 2YNFA 5DLGA 2VG7A 2HNZB 1EETB 3PW5A 1RTHA 4ICLA 3KLHA 4Y3CA 1FKOB 3DMJA 5F8GA 3PR5B 3PZPA 3H2LA 4KE5A 3DM2A 4J9QA 2I5JA 1MU2A 1VRUB 2B6AA 5J2NA 1DTQB 3IS9A 3M9MB 3T5HA 3LP1B 4IFVB 5C24A 4Q0BB 5KG7A 4XPEA 3DRRA 4OL8A 1JLFB 5KG0A 3KLIA 3TVKA 4K4YA 3H4DA 2RF2B 1YVFA 3LP2B 2W9BB 2J6TA 4URQU 1JLEA 3CJ5A 1T05A 3D28A 4YQWA 1HNVB 2WK4A 4ZVHA 4PQUA 4IG3B 2JC1A 4QWCA 1ZTTA 1NHUA 5KT5A 3OL8A 5KFEA 4KFBB 4M95A 2FLNA 3DYAA 3Q8PB 3IGNA 3NGDA 4GC7A 1BQNA 3V4IB 5KFLA 2OPQB 1XR6A 3OLBA 4ED2A 2AU0A 4ED3A 3C6TB 1S6QA 4DG1B 2AGPA 1MMLA 1HPZB 4IH5A 1TKZA 3KLGB 3UPFA 1SUQB 2UUTA 5L1JA 5C42A 3LAMA 4RNFA 2EC0A 3DLKB 2FVRA 4QWBA 2OPSA 2CJQA 3DOKB 1N6QA 4O3SA 1S1WA 5KG3A 3FSIA 4O4GB 1JLCB 1LW2A 3PHEA 3GIIA 1N56A 1HNIA 3MF5A 4NLDA 3GIMA 1S9GA 5KFGA 5J2MB 2UUWA 2HNDA 3C6UB 1KLMB 1RYRA 3KHGA 4KV8B 5K14A 2IA6A 1REVA 2IC3B 2HNYA 1S0MA 1JXLA 1S1UB 3IGVA 5KFAA 3GV5B 1RT4A 4F4WA 2OPRA 4DL2A 1N48A 1LWCA 3DLEA 1HQEA 1JX4A 3QYYA 5KFKA 1WNEA 4NLSA 2W7OA 1RT5A 2V0NA 2ZE2B 3T5KA 2YNHB 3MEDA 4IR9A 1RT2B 4KSEB 2GC8A 1RA7A 3KLFB 4QWEA 1SH3A 1LW0A
chains in the Genus database with same CATH superfamily
3THTA 1TQLA 4WXOA 5DLFA 2V2ZA 1DQ8A 1RLCL 2HAFA 3DOMB 5IC6B 4CO0A 4Y28C 4RW9A 2MKJA 5A8RB 2Z57B 2MZJA 2YPZA 4A8YA 3P5BP 1E6VB 3PRBA 5E33A 2H51B 1IKXB 1HD0A 3EXYA 5D78A 2PGCA 3MR7A 4HHHA 5KFWA 3HDSA 1GK8A 3QRPA 4I7FB 3C19A 2W7PA 4USWA 4U9RA 5B0BA 3I9V9 4QQBA 2MB0B 2VFSA 4K5SA 3E2EA 1Y10A 1U25A 4WPAA 3IFEA 3K8WA 3LW5C 2EFVA 4F4ZA 2DRBA 2MKCA 4F3QA 1TKTA 4CT8A 3SBMA 3OTOJ 2ASYA 1FJGJ 2AX0A 2IM3A 3LOUA 4AYBD 2R7OA 1VQSA 2DNMA 2FJAB 3NY0A 4AD6A 1Q95G 1WJ9A 1HQUB 3I4HX 1KKHA 3MWBA 4NLRA 4UW2A 2DD8S 3R7SB 4ATNA 4Z7CA 3IRWP 1NH8A 4MKVA 5DRKA 2ZHBA 2WZ1A 4PG8A 4ED5A 4LF9J 1U8WA 1N6QB 1X4CA 1HBOA 1N5QA 1V5IB 2DY9A 3HSGA 5GVQA 5KFRA 5LMUF 3ZNJ1 1ZZNA 1N8RT 3DDIA 3MOZA 1RACB 3BH7B 1C1CB 1UCNA 2JZ5A 4LRDA 3RRKA 3ZO7A 2J8SA 4U8VA 1FKAF 1YHQS 4DQIA 4DSJA 2BJDA 2FB0A 4ALZA 2W9BA 2BV3A 3M4XA 4J9NA 2CQHA 3H42A 3MMAB 4B3SF 1P9QC 5J1EB 2GIFA 2KRRA 1RTDB 1RSCA 2YWEA 4J37A 3OTDA 3CJ0A 2PFDA 3MD3A 3EZOA 3VQTA 4ZVPB 2ALZA 1FI4A 1RCOB 1UAWA 2NSCA 3ISNC 4HTIA 1SL2A 2VHGA 1S9EA 1YZ7A 5F8MA 1FFGB 4DPYA 2JVOA 4L75A 3HJFA 1S1TA 2FJXA 2E1MC 2JDJA 2MZRA 3A8KA 3GPAA 1CEZA 2JJ4D 2NXJA 3VTIA 3Q2SC 1C0TB 4TYAA 3I0SA 4ZN3A 4K2JA 3DU6A 1ZAWA 1SJ4P 2FVQA 4ZKAA 2G2ZA 1XEZA 3DXBA 2AWZA 2FQQB 3OQ2A 2M7SA 5BXIA 3H2VE 2UV8G 1SH0A 3QO9A 4HLBA 3KNAA 3CDAA 4I6WA 2QZ8A 1RAJA 1IUJA 2IAJB 2G0JA 4X65J 2W8KA 2DCUB 4HHUA 1YRTA 2RDDA 1YBAA 4K4XA 2QL5B 3CJKA 2OD6A 4UF4A 2VA3A 1RT7B 3AFGA 3CVKA 3A4TA 3K5MA 4LFCF 1QUVA 1TKXB 2Z4PA 4OZ5A 2BKOA 4ZLNA 2E5IA 4DUYF 5ETRA 1CJKA 3J80Y 4RX6A 3VGVA 1W2IA 1GTHA 5E2QA 1JJCB 2J9EA 2HW3A 1D0EA 1RYSA 5IT9Y 1A6LA 1RWOB 3QGPA 4QR2A 4YEAA 2QA2A 2QA4G 5E7OB 5DJBA 3G6XA 2BA9A 1X4AA 2B6AB 1QTNB 1NK6A 2GJFA 4NXNJ 2DNLA 2DTJA 3BGFA 4PPDA 4KPYA 3QRRA 3R9LA 1EETA 2ADBA 4WP8A 2FC9A 2WBRA 3R2CJ 3E8OA 1VJQA 2R4FA 3D67A 4JI2J 3ZC4A 5A8KA 1K9MT 4X65F 4DV5J 2RS2A 1M5SA 2DYAA 2QMXA 3M6UA 1HBNB 4IH6A 4ES1A 2HPUA 4JV0A 2VBZA 2QT7A 3R5GA 1TAQA 3HD2A 2VQFJ 2R7XA 2GIRA 2N3LA 4I6AA 2HRTA 1SC6A 3D3BJ 3PTWA 3EGWB 5I3UB 4B3OB 3QBCA 2YNGB 4EUVA 1UZDA 2CPZA 3SCLE 4HT5A 3TP2A 3TRGA 4YMEA 4I6YA 4KAIA 4KT0C 2C2OB 4WIQA 1S97A 4C8LA 1S12A 4L3NA 4C0BA 1S9FA 1UTAA 4R8UA 4EMDA 4WFXA 4ECUA 4CLUA 1S6QB 1QSYA 2JL9A 2WAQD 2NR0A 3Q8UA 2Y9HA 2MKYA 5SUHA 1TV6A 3IR7B 3UVJA 3M8PA 3FRZA 3KJVA 1Q16B 4OX9J 1FNMA 4O3OA 5LSLA 4QWDA 3MMCA 2I0XA 1TMMA 1PC5A 2B5JA 5ETQA 2V94A 4JI2F 4CM0A 4ZIWA 2GJIA 1VQ7S 3GV7B 1U2FA 1W2BR 3O5TB 5L1KA 2UXDF 2H4WB 3OLAA 3JYTA 3CCSS 2J0XA 1VISA 4QIGA 1AT1B 2PFFB 4EZ6A 2MJNA 2Y1LB 2CDRB 3M8QB 1RBAA 1YJVA 3PJWA 1SJFA 3DLKA 2VBWA 1V6HA 2X1GA 3HLUA 2KI2A 9RUBA 1JLBB 3DLGA 4HHJA 4JV1A 3CDUA 3M30B 3NCPA 1FFSB 3KMSA 1RT6A 3B4MA 1LK5A 2Z2YB 5EX3A 1SJ3P 1YZ6A 3CCRS 2ZUGA 5H1SV 3HPOA 4HVZA 1R89A 3KLIB 2OELA 4RR5A 1VBYA 4ILLA 4OHXA 1RISA 1A7GE 2LFVA 4I68A 2DGQA 4KGZB 1VK3A 2B4VA 4WFAQ 2GFFA 2MTLA 4BWJA 3RB0A 2D3OR 2ZEJA 4HDGA 4P2FA 1K0TA 3I5CA 2OP5A 3KK1B 4USKA 1Q1KA 4U67Q 4JI7J 3VVUA 1T11A 2N82B 2CQCA 1KC8T 5CYQA 3RGIA 3MI7X 5KFVA 2W9CB 2RMLA 5GAHI 3Q24A 2V9KA 1DTTA 2R8KA 2NCKL 1WC1A 5CHCB 2DHXA 2BANA 2LU2A 1LW0B 1FTRA 4FP9A 4BCAA 4DFPA 1HMVB 2OPSB 3OSNA 3GCXP 3KHHA 1OYEA 2ZKTA 3B82A 3I96A 1ULRA 2WHOA 4DL6A 3T1HJ 2IJNA 2Q3PA 2XZDB 3JSYA 2AX1A 4ID5B 2BE2A 2DH8A 3GG0A 2CNOB 4A48A 3F73A 4USTA 1UFLA 5CCMA 1JMTA 2H9ZA 1IBMJ 1WOOA 4I67A 4QU7A 3KUHA 1YJ7A 2G0CA 4TLRA 2ZH2A 2XCPA 2QYCA 2RH3A 5KG4A 4F26A 2DGSA 4ES3A 4MK8A 2F8HA 5AE1A 1TK5A 4QU6A 3EGVA 4H4OB 1TL7B 3MCOA 3Q23A 1ZZFA 3FZ2A 4LIWA 4DDFA 3CD6S 1T9TA 3M9OB 1TAUA 2J9DE 2YX7A 2K2PA 3CCLS 4YN3B 2UUAJ 3F0NA 3RAQA 1IKYB 1B0TA 5J2QB 4DWIA 1W7WA 3FMBA 1FVQA 2AEJA 2BKPA 3OD2A 4AXJA 2LQ8A 1NSKL 1X4DA 2XULA 2F5GA 1QM9A 4LRAA 4IUFA 2C1EB 2PC6A 1RBLA 2RRNA 2RVJA 4A8OA 1HHSA 2HS4A 4F4XA 4ECQA 4IFVA 1S4EA 3QIPA 3DN9A 3KTQA 3SI8A 4G6VB 3L95X 2GNKA 3D1QA 1BGXT 1LFWA 1NAQA 4HI1A 1RHJB 3A3PB 3MEGA 1KQKA 4A8XA 5B0DA 2Y8WA 2XMAA 1RHUB 4RUCA 4I1TA 4WU3A 3MOJB 1NXIA 2WSEC 4FF1A 1MWQA 1KD1T 1EP4A 2OTJS 1RWXB 1QAYA 1R8CA 4USIA 3H4BA 4HR2A 3IP0A 1HLWA 4KHRA 3MAAA 2ERRA 3GONA 2PI4A 2VODA 3EMTA 3HKWA 1WC0A 2RDJA 3J7AN 4X4SA 1FRIA 4P52A 5EDWA 2ZITA 4LF2A 1WHYA 3T9NA 3IG1A 3MTJA 3U1NA 4DR6F 2FPHX 4J9PA 5KG5A 2UUCJ 2BACA 2NQPA 3MM9A 4I56A 2IYGA 2J5AA 3C6TA 2B5JB 3SQGB 5E41A 2WBMA 3HD1A 1CJUA 5ETMA 2CIMA 2J7KA 1SBRA 4ZS6A 1KOHA 3AB2B 2B7BB 8AT1B 2DBBA 3CCUS 3SV4A 2Z0GA 2UXBJ 4LF1A 1SB6A 2ZH3A 3R7BB 3W9JA 3OHAA 4IQXA 5IOLA 1LQ9A 3M6WA 3RW6A 3U1LA 1BQMA 3LPEA 1N5YA 1R8PA 2YH0A 5JJBA 3I56S 3JAMY 3BV8A 3AOBA 2VZ9A 2C3MA 3T6BA 5J2MA 3CE8A 1NZAA 1RT6B 2HMIA 5F41A 4WCEQ 5F3ZA 1OPIA 1SQEA 2BQRA 1S6OA 1RU2A 1LWXA 3G82B 3W63A 4JV5J 4AQYF 3MAHA 4DSLA 3MD1A 1GFWB 2WVFA 3OR2B 4FYXB 4JI8F 3UCUP 3FC9A 4PRFA 1T9YA 2HNYB 2BM0A 3MCNA 1O5JA 3IMQJ 1RWKB 4NLTA 4A8QA 5JUMA 3ZZRA 1N52B 5KFYA 3BDEA 1PILA 2BX6A 3HFZB 3DMJB 1LWCB 4OZJA 3D1OA 4WWSA 4YDDB 5HLFB 2IY5B 4MKAA 2BEFA 3CCVS 2HKEA 2O1PA 2WRMA 2G9OA 5D3GB 4Y34A 1G3OA 2GQQA 2E9RX 4TKTA 5IQQA 3B54A 1VC5A 2HAIA 4DV0F 1SL1A 2CJKA 2DCLA 2DHHA 3CC4S 4B9UA 5AJ3F 4DPOA 1H74A 2F40A 4JI3J 2CFXA 3N0VA 5E5NA 1C2PA 3TVYA 5KFCA 3QAUA 3FGVA 1X8DA 4ZPWR 3RG6A 4CM2A 5B0CA 2NXCA 2ROPA 3CD0A 5HP1B 2V69A 4AQYJ 1L3VA 4LF4J 1Y0HA 4K50A 4EBDA 2ZOFA 1HARA 4IFYB 2IRUA 3FBEA 3ZTQA 4LFAJ 3HFKA 5MLCV 3MR5A 3BO4A 3F44A 2UVWA 3CO0P 4Q7AA 2QIFA 1PBAA 1SXLA 4DN9A 1WKJA 2ZFHA 5KFBA 2OFGX 3D7SB 5L1IA 1M5HA 2VPXB 1JNRB 3NAIA 4UZCA 3BSCA 4JBCA 3SSQA 5H9FJ 2FYXA 2YWWA 1TL1A 1BWVA 4C8KA 1KP6A 4OYXA 4NA2A 2JOQA 1IKYA 4IDKB 2A3JA 4K5RA 4ZA1A 3AAWB 4ZCMA 2MHNA 1CS4A 2YTCA 3UD4P 1Z1ZA 3GJRB 2QN6B 4O3QA 4WBFA 3ZZZA 4OYWA 1KBRA 5CD4H 3M8QA 1KOOA 1Q8KA 2LECA 4IRCA 4O0IA 2AYGA 4K59A 3QGIA 3VZIA 3TZYA 2N7CA 1X4BA 5AJ3J 4I2PA 2W9AA 3UDVA 4NLVA 1U1MA 1KONA 5HQLA 2QA4S 2HIQA 3HSJA 3DI6A 4DCJB 3H8YA 3KK2A 4U7CA 2L41A 5A2QU 3K5PA 2F8EX 2XSJB 1U7LA 5THWA 2X1AA 4J9UE 1IJFB 3OTEA 2ZJPQ 1K1SA 2OKQA 2EKNA 2C3PA 4N77A 2H5EA 3TAMB 4C0OC 3PR4A 2Z58B 2JX2A 3QT7A 4CZCA 4G1PA 2JC0A 4NLXA 2CPJA 1RGVA 2GMHA 4F4KA 4LT6A 1NB2A 2DGTA 4XIUA 1N32J 3HHKA 1GT8A 4MKBA 2AZ3A 3T41A 2WONB 2XYHB 2CQ3A 3GJSB 4I64A 4DR4J 3PO5A 4WFYA 4ZVEA 4QR0A 4LSNA 3NCQA 4ZITA 3CO9A 1ITPA 1VI7A 3PFEA 4X64F 4X4PA 5C25B 5LOQA 4TQRA 2PN6A 3VR1A 3CNQP 3HI9A 1P6TA 1C1CA 1X5SA 2V2VA 5KG6A 4C3LA 5DZ7A 3O2IA 4B08A 2ROEA 4F0MA 4ZMMA 2KM8B 4ECTA 1HIYA 2ILYA 4ZPTR 4UQTA 2HLTA 1KEKA 4JI6J 3GYXB 1RHKB 1WKKA 3BR9A 4DPTA 2AHOB 2MJUA 2BJ1A 3AA9A 1FXLA 1NHKL 2LXUA 3AA8A 4M5DB 3UQSA 2RKIA 1H7WA 2PSZA 1MROA 1VIXA 2IBOA 3IWLA 4NA1A 2FZGB 2KFYA 2UUBJ 4TVAB 2YNFA 5DLGA 2VG7A 1N32F 4FVCA 2HNZB 1VFJA 3TEGA 1RTHA 4ICLA 3TOQA 1U1PA 2KZMA 4LR8A 3W3SA 3PR5B 3R97A 4KE5A 1VHIA 3DM2A 3RU0A 3BR8A 3N5BA 2B6AA 5J2NA 2D9OA 6FD1A 1RAEB 2MQPA 3P4UB 3MHYA 5ETOA 4Y0FA 2HWTA 1AA1B 2Z2ZA 2DO4A 4WP3A 3PIPQ 4NZ6A 5KG7A 4XPEA 3VAFA 3TVKA 1HWIA 3MMBB 5FLXY 1YJWS 1N88A 4ZJOA 1OMSA 4URQU 3WIUA 1ACMB 2DR5A 5ETLA 3BF4A 2ZH8A 1RJJA 2HFOA 4DQRA 1KDNA 4PXBA 4C7QA 2HGMA 1V3ZA 1HNVB 2HQFA 2G0IA 4ZVHA 3N5FA 2ZDOA 3G71S 1HI0P 2B0GA 4M63A 4IOCQ 3EVWA 3OXLA 1NHUA 1NK5A 4L76A 1NK9A 5CZXA 5KFEA 3CC2S 2FLNA 3DYAA 3Q8PB 3GSIA 5A8WA 1GMWA 4DR5F 2OD4A 5BJRA 3IGNA 1G2EA 2ACMA 2IRXA 3WDOA 3P96A 4PG5A 1GTEA 5KFLA 4F2RA 2KO1A 4AUKA 3J81Y 3GFHA 5B08A 3C6TB 3GSDA 4WP9A 3SQGA 5B7WA 1WI8A 5IV4A 2E1PA 4IH5A 3K59A 3D6MB 4OYOA 4NYOA 2UUBF 3UD3P 4E2FB 1KS2A 3LA0A 4DR1F 4C4WA 1Q5VA 2X3DA 1LEOA 3W65A 4CTAA 4RNFA 1WI6A 2OTLS 2EC0A 2XTJP 3QATA 3UDEA 2OEKA 4UTGA 5DDRC 3DOKB 2C3OA 2MQMA 4YUDA 4LR7A 1S5ZA 4CO5A 5KOXA 4CYUA 5KG3A 2HQ3A 2KYZA 2CG4A 1FEHA 1U1LA 3D1HA 2XO7A 2UUWA 4X66J 2MLYA 3SSSA 2DGVA 2V6AA 2VIHA 2LLZA 5GAGI 1GXUA 1X5TA 4KV8B 2VBXA 4NL5A 4OYMA 1YBUA 2CJBA 4YB7A 1S0MA 2IA6A 2KFZA 4DR6J 1FRMA 3TUJC 2MSTA 1I1GA 4GVBB 2V2QA 3D0IE 3QPIA 2NZCA 5M2RA 2HFUA 4F4WA 4M5NA 4DR5J 1M5PC 4LFBJ 1ZH5A 2DNPA 1M1HA 1NK0A 2B8QA 3HZEA 1JXEA 3DLEA 1RLDA 4Y2MA 2YVSA 4NLSA 4HEA9 1FNOA 3I32A 1KFSA 4ZVRB 3CMES 3QFWA 3MEDA 3DHXA 4LF6J 4KSEB 2YWGA 1SQGA 2N4CA 2HFSA 4DV4J 1LKZA 1SH3A 1PYTA 3EDRB 1U26A 4H4KC 3LP2A 3R6LB 4HL9A 4UZBA 2GIQA 2D9PA 2UXBF 1F1BB 3W7BA 1WOPA 4RO0A 2HG4A 3R3TA 1S1XB 2JWNA 1NLKL 4ENOA 3ADAC 5EWEA 2N4DA 3NKYA 3CCQS 4M5IA 4PQUB 1PYSB 5HBMB 1YLXA 4JP8A 2ZJRQ 3M6XA 1HQ2A 3NS5A 1KN6A 5B0EA 3GIJA 4H4MA 4NWBA 2BJEA 3BQ2A 1NKEA 4C9DA 4O44A 3RTVA 2R7UA 1BQMB 2C2KB 4CQ1A 1RT1B 4UY8T 1JLAA 2J0SD 5H9EJ 4JV5F 1EJ7L 4DUTA 2HK3A 1CJTA 1VLOA 3MDFA 4OZNA 3KLVA 2XMKA 3SFUA 4NXNF 3PHTA 1Y4ZB 3JS9A 2ZH6A 1S7IA 4EO8A 4WE1A 1GXLA 2KHCA 4KH0B 1S49A 1IBCB 2VG7B 1O51A 1WDDA 2O5DA 2RB7A 2XG8A 1PAEX 3EZUA 4MAKA 4N8NA 4J90A 4QJVA 3I9ZA 4DU7A 9ATCB 5F9NA 3H5SA 4FDFA 4ED8A 1UVJA 1N5YB 5F3TA 1OQ6A 3UN3A 2LQ9A 1RA6A 2F4VJ 3GJTB 3LH2S 4EYHB 1AROP 2RSQA 1KVJA 1DTTB 3TUPA 1S1VB 3LP0B 2UVVA 3DRRB 1RTJB 4A8KA 1TU0B 3NL0A 4DV0J 3HHNB 1O8BA 2Z2MA 4IH7A 4ZPAA 1VQYA 5D0RA 2VG6A 2YWKA 4OYIA 3OL7A 1HNWJ 2YQ0A 4ID5A 2DKOB 3R5JB 4WYWA 3ZZ0A 5DG8A 1R6YA 3PX6A 5A76A 2MQLA 4OFZA 1OIAA 3NWGA 3KG1A 3LO3A 2M3DA 1XNQJ 2P9GA 3MFHA 2J7UA 2HQCA 1QVFR 3KKFA 1U1NA 2XSJA 4V19J 4YHHJ 2A2CA 2NXUA 5LSRA 3FK4A 4KO0B 4OHZA 4ILMA 3CJ8A 4FKYA 3TJAA 3GIKA 2C2DA 3W5ZA 4A8MP 4BC9A 5D3GA 2KFNA 3M2VA 3JSRA 4DR7J 4RW4A 4PUOA 1F9EB 2BKNA 3C15A 3CIZA 1PSDA 5KT4A 2MY8A 3DRPB 4RW7A 2HURA 1BQXA 2L48A 3MZIA 2OI2A 3TO8A 2C42A 3OUYB 3FBBA 5HP1A 3GR1A 4F3OA 2RQCA 1RTIB 4GVLA 4IOBA 1NBEB 1XMQJ 1KRPA 2HYIB 5KT7A 4OI2A 5C25A 3NCRA 1BXNA 1FKPA 2K1RA 2LA4A 1RWUA 4CRJA 2J6UA 3OJSA 2QLWA 3V81A 3Q89A 4CLSA 1GAOA 2R8IA 3I5AA 1BY9A 4M5MA 1XNQF 3ITHB 4NYZA 1Q86T 2MQOA 4B02A 1A0OB 4O0NA 2AJ4A 3PYFA 4N7TA 5ETKA 1BWEA 1VDHA 3MAAB 4NRTA 3QAEA 5SZTA 3OTBA 1K1QA 3G96A 4DS4A 4FPRA 3ETMA 2COLA 4NE9C 4DL7A 3RR8A 1WHVA 1GXTA 2XMUA 1H3DA 1Y7PA 5KFUA 2R9LA 4Q0BA 2FLLA 1U48A 5AXLA 4ELTA 3L7OA 3RAXA 3KJQB 1X31C 4MK7A 2AD9A 3HSDA 2VH7A 4QYZK 4RPFA 5FIIA 5EN1A 3DM2B 4IO1A 1JB0C 3CJQA 3E01A 1KLMA 2HFZA 2XLIA 3GYNA 2CDQA 3TZXA 4ITSA 4ER8A 2E1CA 2PE8A 3D66A 3UD5A 5CYMA 1CULA 4JI6F 1IKXA 1T9XA 4PWDB 3VV2B 1UWAA 4JI1F 2LKZA 1JLEB 4NLWA 4U95A 4NLQA 1X5PA 4DLGA 3HXMA 2AYBA 2VDHA 3ZTPA 3GILA 4CO1A 4GKJF 3OSPA 1HBMB 4LF8F 1QE1B 4LFCJ 1RT5B 4DUYJ 4LREA 1TKTB 4LBIA 4F25A 5D0EA 1MWZA 1VRTA 5HSPA 5F8LA 4NXMJ 1U4BA 5HVFA 5GAGU 2GS8A 5ETSA 3V4IA 2PDAA 4B17A 3GR0A 5HK4A 4FYWB 1RT3A 1I6JA 1TR0A 3MUTP 1S79A 2RKIB 4G1QA 2GJ2A 2KYXA 3R7NB 5GADU 3RJMB 4DV7J 3M2RB 4K4UA 3DXSX 1FJCA 2JLEA 3B78A 3M1VA 4B9TA 1TL3B 4XPCA 2YX1A 1T3NA 4B3MF 4YR3A 3KMQA 3NGSA 4TU9A 1MLAA 2F9JA 4B9NA 4LF7J 1N33J 4DV5F 3RB4A 5IT9U 4ELVA 2L9NA 4DV6F 2ZWOA 4RU2A 3NS7B 4NRUA 4ED0A 3P45B 2LEBA 4R0JA 3PJXA 2XS2A 1DRZA 3QJJA 1MW7A 4DQSA 3OT9A 3O1LA 2QLFB 2GVZA 2DH7A 1F3VA 2Z8QA 2FZKB 3M8WA 3TX0A 4C8ZA 3IBCB 4USMA 3MPUB 5I42B 1VC0A 3GZ7A 3PM9A 5JVGQ 4I4BA 4HYKA 3TI0A 2EXUA 1T8EA 1ZTWA 3MURP 1VQ8S 3HVAA 3KK3B 1DURA 2I9SA 4C11A 2Y1IA 1VJWA 3M32A 2XNQA 1TUVA 2DY1A 3WQPA 3JB9k 4QBUA 1UVLA 5AE3A 3H5UA 1S4FA 1B0PA 3H5XA 1YDLA 3CDBA 4DV3F 1PBUA 1IVZA 1S10A 4MMOA 4EEYA 4DR1J 3PX4A 3WBZA 1GMVA 1OY8A 2OUGA 1FD8A 3DOMA 3KG0A 1S7HA 3QO9B 3UN5A 4X66F 2MHEA 5IT0A 2LEPA 2BVZA 5LJ3Y 3EE3A 2OGUA 3MM7A 4BHQA 2HZAA 2W24A 5D4PA 3PYEA 3THPA 3UDCA 4XK8C 5IT4A 4LVOP 1Q81T 1AW0A 3CJKB 4U6PA 2LDIA 3CF5Q 4K4ZA 2YKNB 1LK7A 1KQFB 2E5JA 3HVTB 2MKSA 2XWXA 3HCXA 1OQ3A 4FPIA 3TQEA 1QTMA 4KTQA 2VPZB 4DSKA 1U6ZA 2A18A 4DL4A 3UVJB 1JLCA 1LW2B 1O0PA 2DGUA 1VQ4S 1YQHA 1Q78A 1WG5A 3D9BA 3G86A 4DX7A 1CBKA 1WF0A 2O01C 4RBUA 3BB5A 5EUHA 3I6PA 2E9ZA 2CQDA 1TTHB 1OY6A 3JSMA 4LBPA 4DX5A 4X62F 5HVGA 4ZP6A 2EFQA 1KQGB 1FRHA 3FMWA 4A4JA 4RNMA 4WE1B 3O8WA 3HP6A 4FZVA 4QW9A 3MCMA 1HQUA 3GIRA 4GO7X 1UZHA 4NA3A 3DOKA 1X7VA 1SL0A 3UDLA 2Q66A 1L5UA 3CCZA 5AXMA 2RNEA 2DIUA 4OYPA 4OZ0A 5CH7B 3LWMA 1J5EJ 1HFEL 3ZTSA 4KPCA 2KM8C 1FEEA 3BYRA 4JI3F 3HO1A 2G1HA 3T9ZA 4ZLJA 1Q53A 2VB6A 3MMAA 3R27A 3SXLA 1U1QA 3FVYA 2NPFA 3G8QA 4LFAF 4P6QA 1VOMA 1T03B 2HFVA 3EJMA 3BJYA 4FF4A 3K0JA 1ZA2B 1EARA 1Q5YA 3AT1B 3ET6B 2M52A 5B09A 3E51A 3JQMA 5K5MA 3UI3A 1P1TA 1S9EB 2K8GA 3MM6A 4ECZA 3UWTA 2HS0A 1XR7A 1HNVA 3UCGA 4CLFA 4JI0J 3TWZA 3Q8YA 3H0PA 1EAYC 3PKYA 2K3KA 2VDIA 3UR0A 4IOAQ 3DU5A 1EQMA 2F4VF 2R7WA 1C1BB 4KRWA 1MN9A 1X4FA 3MMCB 4G65A 4EGLA 3KXDA 1RT3B 2YNHA 1NMEB 1NZ8A 2MY7A 1UA0A 1HBUB 2ZBCA 5KFZA 4DU8A 1HYSB 2CZ9A 3BBBA 1SVDA 3A3NB 3CJTA 4DV2J 2HHUA 7FDRA 2ATCB 2RAQA 3CCMS 3IO1A 1SKSA 1NKBA 3AOAA 3NOGA 1LWEA 2FLPA 1FTCA 3T5HA 2LXFA 4H4MB 5DDOC 3TA0A 4ZHRA 2MLZA 3HK2A 4I2QA 3M7VA 3N9UC 4JB8B 5A0YB 5E3RA 2HHVA 1A9NB 1S9GB 1VBKA 1V9OA 3BPSP 1VIOA 4P71A 1VQ9S 1B3TA 2V63A 3BGUA 1RT7A 4L74A 1IBLF 2Z56B 3V81B 2W25A 4ID8A 4M94A 1HNZF 5FDLA 3HKZD 3FQLA 4FNHA 1FDAA 3PG9A 3QGGA 3ZTRA 1JJ2R 3EXCX 3EPGA 2C22A 2UP1A 5E0OA 5KFDA 2F1FA 1HW8A 3DLJA 1CJVA 4X4NA 2ZE2A 1AZSA 4HACA 1RBOB 1IM4A 3TR5A 4OYBA 4KHPF 1Y3JA 4ED4A 4FBTA 4FXDA 4NMLA 1S6UA 1YG0A 3IRXA 1T94A 4KH1B 2XGQA 2VQEF 2M2BA 4PZVA 3VF0B 2DNZA 2R2UA 4MIWA 1LXJA 5JXSA 3EDQB 1JKHB 2R2RA 1VR6A 4RW9B 3K2YA 3MAQA 2HQDA 2QJ3A 1HL6A 1DY3A 2EI5A 3D5MA 2BE7D 3KLFA 5ETVA 3OV7A 3G6VA 4ECRA 1DZ5A 4NCBA 4OI6A 4MFBA 5H9EK 1FESA 1YBTA 1UEVA 1T05B 4KB7A 1MSWD 4DR2J 1SQFA 1D9FA 4ANCA 2FJBB 3HVTA 3AY0A 1OY9A 1S99A 3EUNA 3AD9C 3JTOA 4DN0A 2AJ1A 4K4TA 1XWLA 1RTIA 1DQ9A 3DDNA 2OPPB 1UEKA 2E1AA 4TY9A 3W60A 2C2RA 1K8AT 3NNCA 1S48A 3CDEA 5IFMA 4USVA 5DM7Q 4ETZA 3OTOF 4NCAA 2HHXA 3HFVA 3A8IA 7FD1A 5K14B 4YP3A 2CQGA 5KFOA 3JTNA 3NP5A 3MECA 1TUWA 3S8SA 1AXQA 1UVMA 4ECSA 4EBCA 3A8EA 3T5LA 2J0QD 1LWFA 4Q44A 5T14A 4USJC 1AFJA 3R1LA 1JNZB 3W64A 2HVZA 1X60A 3K8VA 3N28A 2IMOA 4LF6F 4OJ3A 3RW7A 7AT1B 1W26A 4ZVTB 1MMDA 1ZM4A 1RWMB 2NLWA 2V4JB 2WSCC 3GP9A 1IKVA 3PACA 1MU2B 1YRUA 5G4DA 2HWHA 2Y0SD 3W2VB 1SV5B 2GW8A 2EC2A 3CIMA 1J2VA 5CAAA 1UJ4A 3PRVA 1XJWB 3SDEB 5J1EA 4FN5A 3BO3A 3PX0A 2Y0BB 3HHLA 2ZWPA 2FY1A 2M0GB 3OR1B 4RKUC 3M8SA 2FHJD 1E6VA 1UW4A 3BQ1A 3ICLA 3O6QA 3K7RA 2YKPA 3M9NB 1KTQA 2E5HA 3MPYA 2QGFB 2Q6BA 2BJ9A 1DLOB 4XO0A 3MM6B 4PYDA 2BQ3A 2P2CB 3QT6A 1KR4A 4DPUA 4ZIVA 3MEEB 2ZOMA 4C8NA 5DGBA 4Y2IA 5KFIA 4N5SA 3MUVP 1RKJA 1SCJB 2ZBPA 1C0TA 2V50A 1FDNA 2QG9B 3SYZA 6AT1B 2UVUA 4KO0A 3V6DA 4DV6J 3NLCA 2H65B 3H98A 5DG9A 5I3PA 2V9WA 4C6AA 2YKMA 2BE9B 1U6BA 1UFWA 2B3TB 2LCWA 3V4MA 2ZDPA 2B56A 4G1QB 4OZ2A 3DOLB 1D09B 2N7YA 4ZPCA 4ZDNA 5T41A 1FVSA 2VOOA 3RUBL 1HWLA 3IAM9 2UZAA 4PKDB 2VG5B 3DRSB 1QAJA 2V8PA 3RRGA 4U8YA 1FDDA 3ELHA 1VRTB 4YDXA 4S0MA 4ZJLA 1SIWB 4ZCKA 4MIBA 2D69A 3QQCD 2AEFA 1W25A 3AODA 3W9HA 2V8HA 1IR2A 3I4PA 2CKWA 3KG4A 2MKKA 2YNIA 1HHQA 2GA7A 2YH1A 5DQGA 4PQAA 4LQ9A 5B0AA 3CW2C 4PR6A 4PXDA 1FERA 1NDCA 3S01A 2IDLA 3CCWA 1FCAA 5A2QY 1YTYA 2A10A 2DNOA 2NREA 2DNRA 5I4MA 3PW5A 2F9DA 2E7XA 5F0UA 3VAJA 2QYGA 4Y3CA 5K8OA 3DMJA 1VGYA 3FBFA 4OHWA 2HHSA 3G8SA 1S59A 4ZVQB 3CPWR 1DTQB 3IS9A 2KXFA 1WSRA 3LP1B 1PAUB 3IM8A 4OL8A 1LXNA 4LSZB 5KG0A 1NCLA 5A6PA 4F36A 2OSRA 4N76A 1Y5IB 4CO3A 4Z2XA 3GYGA 2J6TA 3G4SS 2CQ4A 2CJ9A 2R42A 1K47A 1RCXB 1T05A 1Q4RA 1UETA 2ZBIA 2ZVSA 3CJ5A 3D28A 3HHLC 4UT4A 5J1PA 3Q22A 2WK4A 1AUDA 3J7A1 1NJXA 4QWCA 2HHTA 2GHPA 1N34F 2P9CA 2WB1D 2QFJA 2XLKA 4BLGA 4AL7A 4AL6A 4QYRA 1X4GA 1WG4A 4XDDA 2CZVC 4N56A 1F5CA 1BE4A 2FDNA 2XHWA 2HHQA 2MZTA 5G0RA 4GC7A 1BQNA 3IR6B 5GAEI 2OPQB 1RHRB 3OLBA 3MM9B 5BR8F 1UVIA 4WF9Q 2AU0A 1NJWA 5EX0A 2LQJA 3FEXB 2DK2A 1S6QA 3H7HB 3QWUA 2AGPA 3MM7B 1CJUB 2AT1B 1TKZA 3KLGB 4D3HA 4K8RA 1PYOB 1N5TA 5L1JA 2IHR1 1U2CA 4NOHA 2HHHF 4GKKF 2FVRA 1U0HA 1H7XA 1Z2ZA 1N6QA 2KVQE 2JLFA 2QTWA 2E1RA 3TJ9A 3FSIA 2LU1A 2QLJB 4O3SA 1JLCB 1LW2A 4TNOA 3GIIA 4OJGA 1XMBA 1WF2A 3C6UB 3L4BC 3AJ1A 1ZM2A 3KHGA 3FBCA 3QJLA 3LUYA 1X9MA 1B7YB 1N54B 5KFAA 1RT4A 2BBEA 3UN2A 1UA1A 1T7PA 2L3MA 4C97A 2CPIA 3N4WA 5IWAF 4DL2A 1PJ6A 1CQMA 1HQEA 1IR1A 3GCWP 5AXKA 1HBMA 3QYYA 5L46A 1F60B 1JX4A 2W7OA 1RT5A 4DV2F 1WD6A 2V0NA 3SSRA 4DX8H 1H72C 5LXYA 1CJVB 1FJ7A 1RI7A 1XMOJ 1VBXA 1PO6A 1OSCA 2B4PA 4M5KA 2J76E 2BOAA 2GC8A 3K5OA 3QNWB 2DR9A 1M90T 1URRA 2MKHA 2IM2A 2H3EB 3LF0A 4F4AA 3V6DB 3LQVA 4CLPA 3KHLA 4GKKJ 3OFEA 2M9KA 5D15A 4DQQA 1TVRA 1Q0NA 3MM5B 1JKHA 1QD1A 4IRKA 3BGOP 3T1HF 2ROGA 2DR7A 3DFEA 2C3YA 4V1Ak 2N3OA 4LF5F 2XMMA 4QPTA 2ASJA 2ATLA 3CD5A 2CADA 1HNZJ 3V5RA 4DL5A 2VG5A 3DRSA 1OJ4A 3BGRA 2GV1A 2I8EA 3MR6A 1GX6A 1B4SA 2AZ1A 3M6VA 4ZHRB 5HN0A 2MZSA 4P2XA 4P2MA 4I2QB 2LA6A 3PCOB 5A0YA 5DQIA 1FF2A 2A6OA 5DG7A 1C0UB 3A1YG 2NSBA 4DQPA 1R0AA 1WC6A 3OR2A 3QMQA 2VFUA 1G7CB 3D6HB 4LFBF 4WZQA 4Y65A 1JQGA 3IAS9 1XMOF 3FFIB 2LQBA 2NZ4A 2D3UA 1QUPA 2FLOA 3QSIA 4RBVA 4JI4J 1X9SA 4NLYA 1RTHB 2XYGB 5A6WA 2E66A 2X3GA 4YR2A 1RU1A 1CS4B 2FZCB 2KVIA 1S76D 2FHJA 4V19X 2C3UA 2ZOGA 4B3TF 1TL4A 2QMWA 2VKRA 2CVEA 2GQ2A 3FUYA 3P3DA 4CO2A 2FJVA 4LF5J 1MN7A 3MPDA 3N79A 4NI2B 1QVGR 2XMJA 3IRXB 1XIQA 4UOGA 3Q8VA 5C7PA 3PY8A 1YJNS 2IM0A 3AD7C 1AUSL 2KZZA 1WG1A 2IM1A 2IIHA 4DI6A 3QIDA 3WX8A 1XTZA 2ZBRA 3VAIA 2KT3A 3NOCA 4F4YA 4B3SJ 4GKJJ 3Q86A 3T1YJ 3DLEB 2E7VA 4MFBB 4W4MA 3SIPB 3MR3A 4K0KJ 2D74B 4P72A 1KQSR 2YNGA 1TMJA 2IMWP 1FRJA 3IXQA 2OIHA 2W1BA 2G4BA 1NK8A 2V4QA 5ADZA 2NXEA 2VC1A 2PD1A 5IM0A 1HKAA 2GVDB 1TK0A 1SJ1A 1WSVA 4EI2A 3FQKA 1U24A 4BWMA 5F8NA 1NM2A 4B3MJ 3A13A 1Y00A 3RB6A 2A0FB 1YX2A 2RE1A 2RUSA 3M2UB 4KC5A 5KFQA 1FX2A 3HX9A 4CIOA 2M88A 2XNRA 3HHEA 3I0RB 2YKMB 5MAOA 1R3NA 4I7FA 2ACYA 3H5YA 2W7AA 1IWGA 2J0WA 2X1BA 4QOTA 4WFBQ 2EVZA 4RUAA 4X2BA 4IG3A 4MK9A 4YY3F 1OS5A 1VRQC 2CA9A 5HROB 2QMUB 2DXEA 5AT1B 3ZZPA 1FNXH 3T1YF 5E3QA 2DR8A 2HGLA 4F04B 1EB0A 2GO8A 4X4TA 2WTFA 5HMWA 4L72B 1HNWF 3GB0A 5E3CA 4KIAA 5IQ6A 3MECB 1WEYA 3P8BB 4R0EA 3VZHA 3BQ0A 2R7SA 4MTPA 1JIHA 5HAOA 2K7JA 2QE5A 4NPOA 3DKDA 2EFGA 1T03A 4MT1A 5KG1A 2E5LJ 4JI5J 4KR0B 2XMWA 2I5JB 2R8GA 4ZLPA 1MMNA 1EZZB 3EWGA 3ZZOA 2VUGA 4CLTA 2H48B 2D3ZA 1R8HA 4WTOB 2W2QP 4NLUA 3KLHB 2F4FA 1F2GA 1DLOA 1VQ6S 1JLFA 3G8TA 5CQGA 4KGVB 2B4OA 1WEZA 1U47A 4KJIA 4LSNB 4RW6A 2C2ZB 3T1AA 2EBEA 3W2WB 2DNNA 2KB2A 2RD5C 4EZ9A 4LQ3A 3PW4A 1AFIA 1S1XA 1RABB 4PWUA 2ZH7A 4FS2A 2DPIA 4TY8A 2XS5A 4MYUA 1FT8A 2QV6A 4J9SA 2WCXA 4W90B 2GGPA 3CD7A 2XM3A 3CCJS 1OSDA 4PYAA 2ZHAA 3EVOA 4LRCA 1VQLS 1V5VA 1TFYA 2VPWB 3I31A 2PMWA 8ATCB 4YFUA 3VVTA 3RB3A 4LRFA 2H4YB 3MEEA 2RJZA 3KUGA 4O23A 3C46A 2DB1A 2FJEB 1TELA 1WEXA 2E29A 2XY6A 1F3FA 1NU4A 2G2OA 1R0AB 4HDHA 4X84A 3IC1A 4HH1A 4JI5F 3JTPA 4GRSA 4H54A 3THVA 1IBLJ 3P6YC 4K7QA 2FVCA 3S7RA 5FDLB 1T02A 2WVDA 5I3QA 4MIAA 3HT0A 2DXDA 2PEHA 8RUCA 2HWIA 3HHLD 1HI8A 1XNRJ 5IC4B 1XERA 4CDIA 1Q8IA 1S1WB 1E6YA 2HHPA 3EICA 2Q79A 1FK9A 1R7IA 4CLYA 1ROFA 2MZQA 3JSBA 3WZ0A 4DR3J 5HMXA 4F50A 3VCDA 3CXCR 1RAGB 1HW9A 3I5BA 5L1LA 1L3SA 4LSLA 5C5JA 3EGNA 2BRKA 1WC3A 2CNKB 2VQEJ 1WTBA 2BUNA 4Y2CA 5GAEU 5D4OA 1NNDA 2VASA 5LJ5Y 4O4GA 2V67A 1FHTA 3VAHA 1P27B 4Z7YA 3NBPB 1Y5LB 2HBZB 4BC7A 1D3WA 2I38A 1TZ0A 3MCSA 2EFOA 1NHVA 2RF2A 2EKYA 5M2PA 2MGZB 4PG7A 4I2PB 1FWKA 3M8ZA 5DO2A 1N34J 3D6FB 2YKOA 4GVBA 3Q0AA 2H1YA 3PYGA 1YGYA 3LAKA 2XMTA 3CJRA 5A8WB 5KT6A 4QIWD 4UY85 1ICEB 5LMNF 5HMYA 4X4VA 4DHVA 4F8RA 2XWYA 2RIJA 3X3UA 5IM0B 3ILIA 3L7PA 4DFJA 2F7VA 3LWLA 2HNZA 4Y2AA 5IXUA 3TVZA 3E01B 4TYBA 3TAMA 2K3IA 2Q43A 2BQUA 2QSFA 2LMIA 5KG2A 1DFDA 4XDCA 4CH1A 3AOCA 2M5YA 2PT0A 1UEUA 4JOUA 4X64J 5K9FA 1XR5A 5KT3A 2H54B 1OYDA 4R25A 4L3KA 3I55S 3TARA 2DNKA 4ZVUB 5KFJA 4PG4A 3AD8C 2QFIA 2Q6CA 2VC0A 3K17A 1H73A 3BKUA 2D7SA 4NZ7A 1Q79A 2CQIA 1ZOTA 3SEOA 1Q82T 1VC6A 1I51B 5D0GA 2LQ5A 2XY7A 2KRBA 3S1TA 1RT1A 2HQIA 4EK2A 1SH2A 4R5PB 1ZAXA 3AQPA 1ZPVA 2EFPA 1FJGF 2V4RA 2ZH5A 1PCAA 2HVDA 2KKHA 1J5OA 3PO4A 3HJVA 4NX9A 4RW8B 2DEIA 2B43A 2LDYA 2RRAA 3MMJA 4ZPDA 3PYDA 3KLEB 5CCLA 2MLXA 4C3KA 4NEZA 2M8HA 5BYQA 3PNIA 4DS5A 1VQOS 1U0HB 1HNXJ 2UUAF 4E0DA 2B51A 2FGCA 2AQ4A 1REGX 5IZHA 4OHVA 3DC2A 2CPDA 4CLZA 5LMUJ 4J9MA 3L3CA 2RUGA 2GAHC 4UOHA 3C8YA 1SUQA 2CJAA 2CQ0A 5D4NA 5C24B 4DV3J 4CTAB 3J7Z5 2CWKA 1HWUA 1KSPA 2XS7A 2FTRA 5DGAA 1RWPB 4P75A 2J9DA 5FJ4A 4ZVGA 1CLFA 1VQPS 3DGVA 4DR2F 5K8MA 4F0KA 1XK8A 3LALA 4Y6IA 1VQKS 2QC3A 3BREA 4RBTA 4CH0S 5KFFA 3MEKA 2R7RA 1L3UA 4WYLA 1HHTP 1VQ5S 4KQZA 1FRKA 2HS3A 1SKUB 3EYZA 3HMJG 4DSEA 2WOMB 2VBYA 2WVCA 3C16B 3FSYA 4NZ0A 1K44A 2ZHOA 3M8RA 2EK1A 1HD1A 2CYYA 2ILZA 1B0VA 2MQ8A 1KFDA 2EWHA 3K5NA 1KVKA 1UVNA 2OFHX 2O3DA 1LNQA 2HSEB 3CEDA 1IJEB 4DG1A 1H2UX 3MEDB 1HPZA 3BM7A 2DH9A 4DV1J 2ZJQQ 4E98A 3C2PA 4OI0A 2MSSA 4KKOA 4HT7A 2XI2A 4NCGA 2BE2B 3FDSA 4PAAA 2OPQA 1FD2A 3M2UA 5DQHA 3DRPA 3K5LA 2LP4A 3EVMA 3KWMA 2UXCF 5F8IA 2YKNA 2AMCB 3A8JA 1J5EF 1IKWB 1BHNA 3DGPB 4DF4A 1HI1A 3C66A 3DDKA 3V6HA 2OMLA 5HBMA 3GWCA 1HR0J 5L39A 4K0KF 4NLPA 2R7VA 1UJ6A 4TQSA 2BMBA 1NUEA 4YS2A 2OLWA 5T7LB 2ZZTA 4CYUB 2XZWA 2ZZMA 2CZ4A 4KGXB 3ITHA 2ZM6J 3LANA 3LPYA 1SI9A 3OXFA 2VICA 2VFRA 3BPDA 1RTZA 4IR1A 3OPKA 3AQOA 4KBIA 2PO4A 4RL1A 1TFWA 5KT2A 3JYTB 1CC7A 2D1CA 3KK3A 2LVWA 3GTYX 2FVSA 4C98A 3OVAA 4DSFA 3OL6A 2ZZNA 2XB2D 4RWWA 1FKOA 3ILLA 2XSFA 4FYYB 2F65A 4GMKA 2IVFB 3W62A 4DJBA 5DETA 1VYAA 1WACA 3TUZC 1OWXA 2DXFA 4OQJA 3J81U 1YIJS 3DLGB 4RW7B 2NXNA 1HBOB 2QX0A 1RB0A 1WC4A 3M30A 5HQ8A 1T95A 5I3UA 4KYZA 5A8RA 3EPIA 2CXEA 3GFYA 3R8YA 3W5YA 3H59A 2HRYA 1FJEB 1H2TZ 1R8AA 2RT3A 3QT5A 2WONA 2VONA 4AFFA 5B0FA 1FKPB 4NEYA 4PXCA 4O3PA 4AXIA 4PWDA 2NUUG 5HL7Q 4WFNQ 2M8DB 4B3RJ 4Y2KA 4EBEA 2G1DA 1RAIB 4M5JA 2IJFA 4FS1A 2ZD1B 2FJWA 2QL7B 2DEJA 4NMXA 2HLUA 3RBZA 2OH2A 4C2MA 1PIEA 5GMDA 1BC6A 4FYVB 4CT9A 1QE1A 3GFXA 4YOEA 1CJTB 4Q43A 5DS7A 1U1OA 3Q8QB 1EKRA 1NH7A 4O44B 4ZPBA 2E5LF 2H5JB 1IBKJ 2L9DA 2VV5A 4RNNA 5J2PA 5D6GA 4ED1A 1RDRA 1H98A 4FVMA 1ZBTA 3BS9A 2V68A 1S6PB 4USHA 5IWAJ 1EQ0A 2FHOB 4HH0A 3J7YU 2JEGA 2FD2A 3MM8B 4LJMA 2E5GA 2WW4A 4C3MA 4U7UD 4ECXA 4GC6A 2HBQB 3BDPA 3FFIA 3UO0A 3M1VB 3WX4A 1F2HA 2R8HA 1RAHB 4JV2A 1TL3A 4NLGA 2BXJA 4NLOA 3RBDA 5CABA 1DHMA 2P9EA 4DEZA 5CYMB 1CULB 4FNIA 3RZAA 3UE2A 3PW7A 3BO2A 1UP1A 4P2SA 3IN5A 3BKTA 3W8GA 3PJ9A 4ILRA 3BSNA 3WC2A 1RTJA 2MEWA 3GV8B 1SKWA 2CRLA 3R1HA 1HWKA 2GVZB 2UV8A 3RBEA 2OPRB 2YX4A 3B4DA 5F0WA 3NWRA 2YKQA 2KXNB 3US5A 3CWJA 4J5OA 4YHHF 1RWWB 3I82A 3OJUA 4J9RA 3OVSA 3ONQA 5LSOA 1SIZA 2AEMA 1M5KC 2KTQA 2G13A 2CNNB 2RQKA 5CYQB 3I0SB 1RAOA 3DHWC 4CP5A 1FX4A 2BRLA 2W9CA 4ZN1A 1X9WA 4MKYA 2AYMA 2QSWA 4TY8B 2CNLB 4KGMA 3N6LA 4CO4A 4RZRA 1NSQA 4DR4F 2GQCA 2DRAA 3CC7S 2GX8A 3PDNA 5A8KB 1LWEB 4MYTA 4B9SA 2IAJA 3A3OB 1U09A 4KHMA 3QSYB 1UWBB 4RW4B 3C15B 1EP4B 4OV6A 4P74A 2KT5A 3FNNA 3NGUA 4PABA 2CAJA 3TX8A 3G6YA 2OPPA 2FHKA 3ZZUA 3DRYA 3FCVA 2CG8A 2RQ4A 2RU9A 2Y1RI 1ZA1B 4QW8A 4B3OA 4A46A 3BN4A 2WSFC 4DBQA 1LV5A 2AJ0A 2Y3YA 1U6FA 3KYLA 1TUGB 2VKZG 4W98A 5DZ6A 5L9NA 2APOA 2CPHA 4ECVA 1R0BG 2FIUA 1YJTA 3D68A 4R8UB 2FVPA 4KV8A 4H4OA 1TL7A 2VFVA 5F8HA 3D4JA 2XC9A 1XQIA 3JSMB 1OPZA 2DITA 4LBHA 1ZYQA 2AJ2A 1YJRA 3CB4A 4ZCIA 2L9WA 2QL9B 1S72S 5F8GA 3M8YA 3LTOA 3OFFA 1Z2LA 4J9QA 4HTJA 5M2UA 4ZPVR 3CCES 1FA0A 4IFVB 4L6V3 5C24A 4Q0BB 2FGOA 2DVIA 3TYTA 4WKYA 3D2WA 1RP5A 4K4YA 1PJ5A 1V3SA 2RF2B 1YVFA 3O44A 3TA1A 3LP2B 2DT9A 2U1AA 2NS1B 4AT1B 2MGZA 4UOFA 1XN9A 4JI1J 2BJ3A 2B9WA 1RZMA 1YK9A 4YQWA 5GADI 5BYRA 1YKWA 2JFKA 1URNA 1D9DA 1GQEA 4LF8J 3ET6A 1NPKA 4CI0B 5KT5A 1N0VC 2LEAA 2YWHA 1IQZA 4KFBB 1IR0A 1SJQA 1K73T 3AJ2A 3OXGA 4RLEA 2FC8A 2UUCF 3V4IB 1XR6A 3BYPA 1RHMB 4M1KA 1MG7A 4DUZJ 4ED2A 2KXHA 4ED3A 4B3TJ 3DRXA 3RR7A 2V8VA 2JRSA 4DG1B 4ZJQA 1K0VA 3UNGC 1Y11A 4RUHA 3NG8A 2XQCA 3R6GB 3UPFA 2G2YA 3HZGA 2V5HG 3PRDA 2DO0A 5L8RC 4AE5A 3DLKB 1QAXA 2MDAA 4QWBA 2OPSA 4RWXA 3C3LA 3TAQA 4M5HA 1GNKA 4F3MA 3R5AA 1NK7A 3AJDA 1HNIA 1RWNB 3KDOA 3GG1A 1S9GA 4RJVA 5KFGA 5J2MB 2L08A 1KLMB 1B7FA 2R7TA 1CQNA 2MXYA 3L7UA 2OHDA 4QZVB 5DDPC 2HNYA 2CPYA 1JXLA 3GV5B 3RYLA 2OPRA 5J1NA 1YSJA 1N48A 3BH6B 2XMVA 1LWCA 4P73A 2BABA 3FCWA 4PXEA 5IV3A 2V8DA 2YY3A 3G9CA 2KN4A 1WHXA 1YI2S 2EBGA 3MXHP 3VHQA 3T5KA 1F5BA 1D8ZA 3BEGB 5JVHQ 2P8IA 1I94F 5BR8J 1R31A 4QWEA 4CNYA 4A8FA 4NYPA 2PI5A 3CMQA 1HMVA 3LGNA 4ED7A 5LM7E 3AHPA 2YBVA 1U49A 3ULHA 2JEFA 2DNYA 4G3IA 3QGHA 1E6YB 2ZH4A 1O6XA 1FK9B 3GE9A 1AYEA 4KKOB 5CXTA 2P5VA 3KJFB 4M5GA 4NCGB 3E3XA 1KLNA 3BBCA 3MPVA 3MTKA 1SC1B 2J6SA 3DYAB 4ZVOB 4WIIA 1DBDA 2DISA 2CPXA 1BQNB 2Y1JA 1SKRA 2MZ1A 2GO9A 3PEHA 4OZ3A 5F8JA 5KFSA 1R8BA 3K57A 4J9LA 4L73A 2B8PA 3CULA 1WTFA 5T7LA 2GAGC 4QR1A 3GLJA 4BS2A 3GMGA 3IWNC 5J2QA 4UOCA 3IA0A 1S6PA 4DZ6A 5CYJA 5LMNJ 3TAPA 1IKWA 2D41A 4ERDA 3DGPA 2XYPB 2CVIA 1X4HA 1M0SA 3M32B 2GCFA 1YWXA 2C2MB 1WF1A 3CGIA 3HF5A 2PIIA 4IYQA 4ES2A 2R7QA 3QRQA 2IA0A 5ETPA 1N0UA 5HQMA 2ALYB 1WNEA 3J7ZT 2V2KA 2IJRA 2F3JA 3DI6B 2B9XA 1BD6A 2AIRB 2EG1A 2KH9A 2WVBA 4OX6A 3SDEA 1LFPA 4G1IA 3SCKE 3WC0A 1WDTA 4FF2A 4M5DA 1P9YA 1NSAA 1VK8A 1MROB 1SJRA 4PEOA 4WFZA 2ZH9A 3TZWA 4HI2A 1JK9B 3SV3A 3QLHA 2FY8A 3AXKA 1VBZA 3NMRA 4JI7F 1H2VZ 2A2DA 2DHAA 5CA5A 4DF8A 2ZNYA 2DHSA 2RS8A 1JLQA 3FZBA 4ZP9A 2BR0A 4R5PA 1VCTA 2BDPA 4Q8EA 1XNRF 2X51A 4IDKA 1ZM3A 3NS6A 3ZFVA 1NKCA 2JNJA 1KHVA 2AYEA 5D4LA 3VGSA 4RW8A 3M8PB 4JI4F 3R5CA 3BSOA 3QZ8A 1GEHA 4OI4A 5HLFA 3Q8RB 2C2EA 5LXRA 2O67A 4ZLLA 1WELA 3UNYA 3AB4B 1QJHA 4D3GA 1GH8A 3ENQA 1HBUA 1ZS6A 4B9MA 3W2VA 1G1XA 4DL0C 3T3FA 2W4PA 4DCPB 2O66A 1R0CB 1HNIB 3HHLB 5GAHU 1NDPA 1XMQF 2HMIB 2DGWA 1BMQB 3C6UA 4JUZA 4USUA 1G4CA 3IM9A 3PIOQ 4NASA 4U7UK 3DLHA 5J2PB 3ILOA 2JVRA 4O3RA 3SFGA 2PA3A 3B8HA 4F67A 1FRLA 3ISZA 2DGXA 4C48A 4P9SA 4DMZA 1NJYA 2A6MA 3MM8A 4PG6A 5BYSA 5KFNA 3J81j 3CJ4A 2WOMA 4URSA 4MJKA 5HO4A 4O4RA 4QIVA 1MNEA 5F9LA 2UXDJ 4MH8A 1IWAA 4OZ1A 4ICLB 1JWWA 3CT9A 3KFWX 4KY3A 3MMBA 3KK1A 4I69A 2CPFA 2JLGA 4NI2A 4QWAA 4LMZA 4OJHA 3RAMA 1C1BA 2YXLA 4CLLA 2VF3A 4ETXA 5J2NB 1QSSA 4WXWA 3IS9B 4ZOSA 3QIPB 1RXOB 4LF9F 2W8LA 2ZH1A 4DV1F 1FWLA 2POKA 4URGA 5DDQC 1GMWD 2X1FA 1P1LA 1F0XA 1VMBA 1WWHA 2EFNA 1DARA 1U8SA 2HZCA 3GU0A 5KFTA 3VGTA 5EWGA 3JAMU 1KVIA 3A12A 2HBYB 2HGNA 2MPUA 5ETTA 3U1MA 4A47A 4B9LA 6FDRA 2UVRA 2FUG9 1SPBP 1DQAA 2PMZD 1U2RA 3TUIC 2ADCA 2JSXA 1T9UA 2YNIB 1TP7A 1TK8A 1IQTA 1QY7A 2IPOB 5K8PA 1XC9A 1M5OC 2QO3A 3MPWA 3PFOA 2XCAA 4DFKA 1PGZA 3M2VB 1TL1B 1M1KT 2ZM6F 1TL5A 1VLYA 1FE0A 2KG0A 1B99A 2HHWA 1YITS 2EW9A 1N5SA 3UW1A 3GQCA 3F56A 1UWBA 2PEBA 5KFMA 3KOAA 2AGQA 1T0TV 3ENAA 4YB1P 5H9FK 1UW9A 3TW0A 4ED6A 5EGYA 1QLNA 2CQPA 3U02A 2BZ2A 4M8LA 2W2OP 2AGOA 4DV7F 1KHWA 3ETOA 4QYZJ 2IDEA 2DJWA 5HATA 2M4MA 3KHRA 3SCIE 1NDLA 4OIXA 4OI1A 3ZXWA 2P6SA 2IVMA 3NGRA 1NB7A 3KJNB 3J80U 4LF7F 1N33F 1RHQB 3FCHA 2KJVA 4OMFG 4RUBA 1WORA 2BJ7A 2JH3A 3OR1A 2XGPA 3PVXA 2R8JA 3MEGB 3GFZA 5ETNA 3FRYA 1T9VA 2CUYA 3KK2B 2CWXA 3VWSA 5KFHA 4H4KA 3W5XA 3SZ2A 1SV5A 2DNQA 3OHBA 3D0GE 2BM1A 1RT4B 3IR5B 4PCQA 2E9TA 1UJ5A 1CSJA 3N6MA 2ZD1A 2ZC3A 3R5BA 4F0HA 3W9IA 1C4CA 3PW0A 4EYIB 1R43A 1S0NA 3PEJA 2ZKUA 1I3OB 2VA2A 1NO8A 2KU7A 3LGHA 1S77D 2CQ2A 3OBIA 2B7CB 3HVRA 1S0OA 4KFBA 2XEXA 3IG1B 1YRXA 5KAKA 4A8SA 1FDBA 3FEYB 4CNZA 2I2YA 2AP6A 3SQOP 1WC5A 4Q5VA 3HT3A 3VQSA 3N6NA 1UPPA 3H20A 5HMZA 2NUHA 2W4CA 2AJFE 1TVRB 3LP1A 3MM5A 4ECYA 4F2SA 4FBUA 2I6WA 2E44A 1NPPA 4P7VA 2RQMA 1HR0F 1KNZA 3Q2TC 2QLBB 5FD1A 5KOWA 3Q83A 5HANA 4IG0A 5HROA 2ABYA 1T3OA 3B6BA 3SMZA 2VD3A 2Z2LA 3G87A 3KNGA 3TANA 3V6JA 3H90A 3NEKA 3DOLA 4OI3A 4IFYA 1JJHA 1FO1A 2Z30B 3W66A 4IO9Q 1N36J 3P49B 1L3TA 2ZC4A 4OYAA 2J9CA 2RU3A 4EFAC 1ZAVA 4IKAA 1H6KX 2J7WA 3TQ1A 1S0VA 1I94J 1CVJA 2IBKA 1MWYA 2VJVA 4KHPJ 1X5OA 2B9YA 2YNFB 2IC3A 2AW0A 3BZQA 4WU2A 5B0GA 3SCJE 3TEHB 3Q8SB 2NYHA 4C8OA 3M2RA 5D0HA 1KTVA 5C2CA 2KL8A 4QCLA 1B70B 4OX9F 5DM6Q 2IRYA 2DIVA 2FHMA 1F6TA 4LSLB 2EK6A 1UVKA 3LGMA 4OYZA 1SC3B 3ZZTA 2JFDA 1EX8A 3CJ3A 4HACB 4EU0A 2GHWA 2D3O1 3NAHA 1IN0A 1U45A 4FXWA 1DTQA 2RILA 4RW6B 2IVYA 1QDUB 1RAAB 1Z4UA 3W2WA 2BYCA 4UUWA 2VOPA 1UKUA 2ZUAA 2JHEA 3FSXA 5LL6d 1REVB 2E7WA 4B3RF 2CQBA 3S6EA 1S1UA 4XAKA 1YJ9S 5E3AA 1ZETA 3BGRB 1L3KA 2F63A 2OO4A 4LVNP 2CJXB 2YKAA 2F8MA 2XHCA 3OFGA 1Q7LB 3OTCA 3P5TL 1WHWA 3ISND 5C2GA 1UPMB 1XBWA 2YPYA 3BSAA 1PJ7A 1U1RA 2RDIA 2EEYA 3D3CJ 4FXVA 1ZM9A 3D0HE 4JI0F 4JI8J 4OX7A 2AJQA 3TNVA 3QLHB 1S57A 3T5JA 4TN2A 1X4EA 1IBKF 2DNHA 2HVIA 4LR9A 3KDNA 3FJ2A 1WUUA 4BDPA 3NGKA 2HBRB 4RNHA 4TXSA 1M5VC 2Y8YA 2QEXS 3OUYA 1HBNA 3VGUA 3IWXA 1HNXF 2PA8D 5C42B 4RU9A 4TU8A 4OHYA 3H40A 1JLGB 4WZMA 2UU9J 1R6VA 2RHQB 3QFHA 1H38A 1S1VA 3LP0A 3TZZA 2MYFA 4F02A 3UR3C 1UMJA 3CTRA 2J8AA 2HRUA 1B64A 2R2SA 2HNDB 4Q2MA 2DRDA 4DL3A 1IKVB 4OV1A 3NXZA 2VFTA 3W1YC 2H5IB 5D77A 2C28A 1J5OB 2MKIA 4DPWA 3RBXA 3KJVB 4OX8A 3G6ES 5CD4A 1UL3A 4K4VA 1C0UA 2WB4A 2B4UA 1V3RA 4C0HA 2YQ3A 2JEIA 2YWFA 3OL9A 1HA1A 4CWBA 2XI3A 4PWWA 1I5OB 3ENWA 3POTA 5ITHA 2OJ3A 1RT2A 4W92B 4N47A 3D54A 1FXDA 3AH6A 3C14A 4Q2LA 1NDKA 4PUOB 2R2TA 3PW2A 2W2MP 3ZTOA 4CH7A 4Q8FA 2W2NP 1HQEB 4LRBA 5G0RB 2UU9F 1VRUA 4UUXA 4DZDA 2K7KA 5AXNA 1R27B 3CDWA 3DLBA 1P8GA 2VU5A 1J27A 1T9WA 4A8WA 4QIEA 1EHWA 4DR7F 4EWTA 1C4AA 1F9HA 4E8UA 4HKQA 4CCHA 3K89A 5L38A 3J7YI 1NJZA 4J91A 2UXCJ 2XBPA 4J9KA 5KFPA 1VQNS 4C8YA 2GGPB 2KHDA 3IBFB 3PV8A 2XZTB 1RADB 3VALA 4ZCLA 4K4WA 2CQ1A 1RAFB 2IFXA 1M1GA 1TV6B 2NYIA 3AXMA 4ZVFA 5E3PA 4K2XA 1TKDA 1JLAB 1NEEA 2KJWA 1BUXA 4OLOA 4DX6A 5K20B 5HVHA 5RUBA 2VJUA 2LXIA 3JQJA 2I1RA 5K8NA 4AL5A 1LOUA 2EPIA 4TLQA 4ZK7M 2OAUA 4KGKA 3MR2A 3TA2A 4NXMF 1HYSA 2BANB 1CJKB 3T19A 3KLEA 4ELUA 4X4QA 1N4LA 2RRBA 1DAXA 4OZLA 4IRDA 1JLBA 5KFXA 4OJ1A 1GMUA 3BKFA 2DPJA 1PC4A 3CJSA 4DXLA 4Q45A 3PXGa 1F5AA 1U02A 4LUBA 4BBYA 5KTQA 2W2PP 4RNOA 3EGZA 1RQ0A 1IBMF 5EHHA 3NRBA 1TKXA 1IM6A 2K06A 2BW2A 3RRHA 3NNAA 4J9VA 2HVHA 1RTDA 5EWFA 2VG6B 1FFWB 1X0FA 4K4SA 2JEJA 1U0SA 3G2XA 2K1RB 1WOSA 3BBFA 2MMYA 3HVWA 3PKMA 3FKBA 4JYAJ 1WKLA 2X7IA 1BLUA 1RUSA 2YQ1A 1EKSA 1QAIA 5I42A 2HK2A 1S1TB 3QZ7A 2HEKA 2ZVIA 3MFIA 2CJYB 3W8PA 4EO6A 3T6JA 1CG2A 2HZVA 3X1LB 2A1BA 2OMOA 2LYVA 3N01A 2GVDA 2CPEA 1F9FA 2PMHA 3L9ZA 3R5DA 4ZP8A 4ZP7A 3UCZP 1CC8A 2OEJA 3U7JA 1VQMS 3CSKA 4GO5X 2V8GA 2P6TA 4CLKA 1JLQB 1Y5NB 4ANEA 5HJYA 2HIYA 4CLWA 2ASLA 1JLGA 3I0RA 3EX7B 2OEMA 3DLLQ 4DSIA 5U47A 1TKZB 3KLGA 3BN7A 1NK4A 1JJ4A 3NNHA 2W01A 1CPZA 4YY3J 2VQFF 3NBPA 5LT5A 3EZ5A 3R2DJ 4O3NA 2MQNA 2W4DA 3DNCA 4YB5A 3NMAA 4JYAF 3L09A 4IG0B 4P7TA 2OSQA 4J9OA 2ASDA 4Z37A 4WK3A 4B9VA 2XY5A 1UFKA 5L9XA 4YR0A 2DHGA 3CJ2A 4U96A 4X4OA 2GMLA 4LF4F 3K58A 1GX5A 4QIFA 2RHSB 3MGJA 1X0PA 3QWPA 1D1UA 2SXLA 3HM9A 1APSA 3W61A 4ECWA 5GMEA 4DCOB 2DNGA 2ZNZA 1LWFB 2GZOA 3DCAA 4PPZA 4IQMA 4ZVSB 5HJXA 4X62J 3ZNUA 2HFNA 1FWPA 2M70A 1EETB 2C2NA 3JQKA 3KLHA 3OFHA 2EG2A 3C14B 5CZVA 1DJ0A 1FKOB 3PZPA 2GHVC 3H2LA 2NPIA 2AV5A 2I5JA 2QA1A 5IS2A 1MU2A 3VAGA 1VRUB 2GMJA 3NGTA 3D6TB 5D8HB 3M9MB 3F41A 1RK8A 4UQGA 1FE4A 4Y00A 3DRRA 2ZBQA 1JLFB 1SC4B 3KLIA 2B9EA 2DGOA 4P10A 3WIVA 3H4DA 4X4UA 3VAKA 2W9BB 1N36F 1G6BA 3M05A 4DOZA 3G82A 4LIRA 1IXKA 1JLEA 5JMNA 3HSZA 4N8OA 3V6KA 2WW8A 1U1KA 1Y3KA 2HQGA 4PQUA 4IG3B 1Q7YT 4FF3A 2JC1A 1FRXA 1N5VA 3GJQB 1ZTTA 3C16A 2XLJA 3JXOA 3ZZYA 3OL8A 1QSLA 2QLXA 4TU7A 2KT2A 4M95A 3H2UB 2R3VA 3WHIA 5GMKa 2BW7A 1NPRA 3ENVA 4C8MA 3NGDA 1FXRA 4OLPA 3H25A 1VHFA 2QRRA 3IBWA 4M5LA 2AF6A 2BOPA 2WVEA 1HWJA 2DR6A 4XTTA 1RKIA 4C11B 4DV4F 1KWMA 2FJDB 3OW2R 4WK1A 3ILJA 5FLXU 1MMLA 1HPZB 4WJBA 3FEZA 4YB6A 5HI7A 2BJ8A 4DLEA 3CUNA 4DPXA 3UFCX 1VS3A 1SUQB 2UUTA 3U27A 4DR3F 5C42A 3LAMA 1D8YA 1H0HB 1YJUA 1RWVB 2KG1A 1Y9OA 2CJQA 3BGLA 4I0WA 3I87A 3V2UC 4FYDA 2VPYB 3QT8A 2HHHJ 1S1WA 5AE2A 1NRKA 4O4GB 1RE1B 1NSPA 3PHEA 2XO6A 1N56A 1ZPWX 3HHDA 3MF5A 2V34A 4NLDA 4WTYA 3MUMP 3GIMA 1EIYB 2HNDA 2Q1LA 1RYRA 1Q8LA 4N41A 3QJPA 3VAMA 1JXVA 4ANDA 2U2FA 4DFMA 5K14A 2VL1A 3CMAS 1REVA 2IC3B 3OVBA 1S1UB 1ELOA 3IGVA 4J7CA 4X4RA 3EM1A 3O3LA 2KDOA 1Q8BA 2IYIA 3CCTA 1D9AA 3HULA 4FKXA 5KFKA 3KUEA 2MQQA 1NJIT 3TJ8A 2ZE2B 1AZSB 4QPXA 3POTB 1PG5B 2YNHB 1PKUA 4IR9A 1RT2B 2AKWB 1AB8A 4DUZF 1RA7A 3KLFB 4WKRA 4F7VA 2V4JA 2HVEA 1LW0A 1OO0B
chains in the Genus database with same CATH topology
3THTA 1TQLA 4WXOA 5DLFA 1DQ8A 4CO0A 4Y28C 4RW9A 2MKJA 5A8RB 2MZJA 4A8YA 1E6VB 3PRBA 5E33A 3EXYA 1IKXB 1HD0A 5D78A 2PGCA 5KFWA 3HDSA 4I7FB 2W7PA 4U9RA 3I9V9 4QQBA 2MB0B 2VFSA 4K5SA 3E2EA 2DRBA 1U25A 3IFEA 3K8WA 3LW5C 2EFVA 4F4ZA 2MKCA 4F3QA 1TKTA 4CT8A 2ASYA 2AX0A 2IM3A 3LOUA 4AYBD 2R7OA 1VQSA 2DNMA 2FJAB 4DR7F 3MWBA 3BQ0A 1HQUB 3I4HX 4NLRA 4UW2A 4ATNA 2DD8S 3IRWP 1NH8A 5DRKA 4ED5A 2ZHBA 4PG8A 1N6QB 1X4CA 1HBOA 1N5QA 5GVQA 5KFRA 5LMUF 1ZZNA 1N8RT 3MOZA 1C1CB 3RRKA 2JZ5A 1FKAF 4DSJA 4DQIA 1YHQS 2BJDA 2FB0A 4ALZA 2W9BA 2BV3A 3M4XA 4J9NA 2CQHA 4B3SF 3MMAB 1P9QC 5J1EB 2KRRA 1RTDB 2YWEA 4J37A 3OTDA 3CJ0A 3MD3A 3VQTA 2ALZA 1UAWA 1SL2A 2NSCA 3ISNC 4HTIA 1S9EA 5F8MA 3HJFA 2JVOA 1S1TA 2FJXA 2E1MC 2JDJA 2MZRA 1CEZA 2JJ4D 3VTIA 3Q2SC 1C0TB 4TYAA 3I0SA 1ZAWA 3DU6A 1SJ4P 2FVQA 4ZKAA 3DXBA 1XEZA 2AWZA 3OQ2A 2M7SA 3H2VE 2UV8G 1SH0A 3QO9A 4HLBA 3KNAA 3CDAA 4I6WA 2QZ8A 1RAJA 1IUJA 2IAJB 2W8KA 2DCUB 1YRTA 1YBAA 4K4XA 3CJKA 2VA3A 2OD6A 1RT7B 3CVKA 3K5MA 4LFCF 1QUVA 1TKXB 2Z4PA 4OZ5A 4DUYF 2E5IA 3J80Y 4RX6A 1W2IA 1GTHA 5E2QA 2HW3A 2J9EA 5IT9Y 1D0EA 1RYSA 1A6LA 3QGPA 4QR2A 4YEAA 2QA4G 2QA2A 5E7OB 5DJBA 3G6XA 2BA9A 1X4AA 2B6AB 1NK6A 2DNLA 2DTJA 3BGFA 4PPDA 4KPYA 1EETA 2ADBA 2FC9A 2WBRA 3E8OA 2R4FA 3ZC4A 5A8KA 1K9MT 4X65F 2RS2A 1M5SA 2QMXA 3M6UA 1HBNB 4IH6A 4ES1A 2HPUA 4JV0A 2VBZA 2QT7A 1TAQA 2R7XA 2GIRA 2N3LA 4I6AA 1SC6A 4EUVA 3EGWB 5I3UB 4B3OB 2YNGB 2CPZA 3SCLE 4HT5A 3TP2A 3TRGA 4YMEA 4I6YA 4KAIA 4KT0C 4C8LA 4L3NA 4C0BA 1S9FA 4R8UA 4WFXA 4ECUA 1S6QB 1QSYA 2JL9A 2WAQD 2NR0A 5SUHA 1TV6A 3IR7B 3M8PA 3FRZA 3KJVA 1Q16B 1FNMA 4O3OA 5LSLA 4QWDA 3MMCA 2I0XA 1K0TA 1PC5A 2B5JA 1W2BR 2V94A 4JI2F 1VQ7S 2GJIA 3GV7B 1U2FA 3O5TB 5L1KA 2UXDF 3OLAA 3JYTA 3CCSS 2J0XA 4QIGA 2PFFB 4EZ6A 2MJNA 3M8QB 1YJVA 3PJWA 1SJFA 3DLKA 2VBWA 1V6HA 2X1GA 3HLUA 2KI2A 1JLBB 3DLGA 4HHJA 4JV1A 3CDUA