2BANB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase P66 subunit
total genus 98
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB03
2VG7B 4K4ZA 1HNIB 4QWDA 2IJFA 3OL6A 5J2MB 2OPQB 4J9KA 3OLAA 1BQMB 1HNIA 3C6UA 1NHVA 5DQIA 5KT2A 1JLCB 3I0RB 3DOLA 3QGHA 5KFWA 1EP4B 4WYLA 4WXWA 5J2NB 4FS1A 4TQRA 1RA6A 3IGNA 5HP1B 2ILYA 4RUAA 1XR5A 1ZTTA 2FVPA 3LP1A 1RT4A 2IM3A 5EWEA 1JLAB 4NLDA 1N48A 4IFVA 3I0SA 3NBPA 5KFTA 4I2QB 2E9ZA 4TY8B 1JLGA 4IDKA 4KKOB 3NAHA 2FVRA 4RUCA 2HMIA 4Y3CA 2WCXA 1T03A 3KLHB 3T1AA 4PWDA 4J9PA 2I1RA 4TLRA 3DRRA 1TKTA 3SI8A 1LW2B 4FBTA 4MIAA 1LW2A 5D3GB 4Y2AA 1FK9A 3LP2B 3MEGB 4DEZA 2DPJA 3T5LA 1K1SA 2XCPA 3D28A 4O3PA 4ECQA 4ECUA 4WFXA 2XI3A 1S6PB 2BE2A 3BGRA 2UUTA 5EDWA 1BQNA 5KFIA 3IG1A 2YKMA 1S9EB 3PW2A 3C6TB 3RBDA 3Q8SB 3C6TA 3ITHB 4ED1A 5KT3A 3T5JA 2UVVA 4ZMMA 5DQGA 2D3UA 3OL7A 2VA2A 5KFDA 4X2BA 1HYSB 3H40A 3H2LA 3D5MA 3QGGA 4WE1A 2HWHA 4G3IA 1C0TA 5HBMB 3V4IA 3GYNA 2GC8A 4O3QA 3KOAA 3QLHA 3FFIB 5J2QB 5L9XA 4HYKA 5F9LA 1IKYA 2IJNA 5KG6A 4J9RA 3V81A 2ZD1A 5KFGA 2ZE2A 3KK3B 1JLBA 5I42B 4ZVEA 3DM2A 1RT3A 4KV8B 4RW6A 2HMIB 4IG3A 3RB6A 1JLEB 1HMVA 3PZPA 1RT2A 2BANB 2IM0A 2RKIA 2AU0A 4IR1A 4KFBA 3V6DA 1CSJA 3V6DB 4U6PA 2RKIB 1S9GB 4RNMA 4RNNA 4F4XA 2ALZA 1RTJB 2B43A 5KFQA 5KT7A 3KLVA 2R8GA 4RW6B 5HP1A 1TKXA 1RT1B 4HKQA 3QO9B 3KJVB 5J2NA 3MTKA 3GIIA 5CYQA 2I5JA 4RW8B 5KG7A 4J9SA 2BR0A 3FFIA 4J9MA 1S9FA 3HKWA 3MEEA 1IKXB 2B5JA 2J6SA 5DGBA 4K4YA 4URSA 4MIBA 2UUWA 1HQUB 4RW9A 3BSNA 4Q43A 3OHBA 4ZVFA 3M9NB 3BSOA 4H4MB 4DL6A 1S49A 2V9WA 1XR6A 4MFBA 2B6AB 4NRUA 4DL2A 3DLGB 2HNYB 2QE5A 3UPFA 3QIPB 5KG4A 3GIKA 4ID5B 4MK8A 3Q8PB 3PW4A 4RW7B 3CJ5A 2JEJA 2YKMB 3TQ1A 4QWCA 4ZHRB 2IC3A 3MEDA 4ECXA 3DLEB 1S1XB 2BE2B 3LP0B 3MF5A 5KFLA 3LANA 4K4SA 1TVRB 3KLIA 1IKVB 2W9BB 2FLLA 3BQ2A 3ISND 1S0MA 3UDLA 3PVXA 4LSLB 2R2TA 3V6HA 2GIQA 4MK7A 5KFMA 3EPIA 2FJXA 4GC7A 4H4OA 4NYZA 5F8JA 1D0EA 1RTDA 1ZTWA 1S1WB 3KLGB 4R0EA 4K4WA 3PW7A 4IDKB 5KFHA 3NBPB 4ICLA 4NLVA 4IFVB 4U7CA 4RNOA 3DLGA 2XGPA 2CJQA 2YNGA 4ZP8A 4MFBB 4TY9A 4WZQA 1RT6A 4H4MA 5J2PB 2IM1A 3DOKA 3PHEA 3E51A 1EP4A 3I5AA 4B3OB 1JLCA 1JXLA 1RYRA 1S1VA 2HNDB 1NHUA 1BQMA 5KFEA 4J9LA 3T19A 3MFIA 1RT5A 5HROA 4KO0B 4B3OA 4ECTA 4TXSA 1T94A 1N4LA 1RT1A 3DMJB 3DLKA 3TAMA 1I6JA 1IKWB 3FQLA 4WYWA 5JXSA 4TN2A 3M8PA 2VG6B 2W9AA 3KHRA 1FKPA 2AGQA 1MU2A 3PR5B 4IH7A 2YNHB 5KFJA 3ICLA 3DYAA 4IKAA 1T05B 5DG9A 1JLEA 2BRKA 5KFKA 2JEGA 4LSNA 4NLUA 2AQ4A 1RT3B 4KV8A 2AX1A 4IH5A 4NCGB 5DG7A 3DI6A 1R0AA 4Q44A 4IQXA 1JLQB 1TV6B 5K14A 3BREA 3KHGA 5KT5A 4EEYA 1IM4A 2ZD1B 4YR0A 3M9MB 5L1IA 4KO0A 3BQ1A 3UR0A 1N6QA 1DLOA 1S1TB 1U09A 4YQWA 2GIRA 3SFUA 3KHHA 1S1VB 4URQU 1LWFB 2IBKA 4IR9A 3FQKA 3NKYA 4NLXA 3OL9A 1RTHA 2BRLA 1S1XA 3LP0A 3KK1A 4H54A 4TYAA 1VRTB 2W8LA 4RNFA 2YKNA 1SV5B 1HPZB 2WTFA 2VG5A 4NRTA 2IA6A 1HQEB 4ECZA 3NL0A 4NLQA 4ZP7A 1RTIB 2J6UA 1HPZA 3EPGA 1NNDA 1S1WA 3RB0A 3M8QB 1LWEB 1SH3A 3H5XA 1FKOB 4Q8EA 3QZ8A 4G1QB 1HQUA 4NLSA 3RAQA 2C2DA 4O44B 4QW9A 3LP2A 3MEGA 4ZVHA 2YNIA 2OPSA 1XR7A 2B5JB 2V0NA 3G6VA 1S0OA 1TKTB 4MH8A 4IFYB 3BR9A 5KFAA 4ED2A 5I3UB 1C0UB 1C1CB 2WB4A 4K4UA 1S6QA 2IAJA 3DI6B 1R0AB 5KT4A 2IC3B 3MEDB 5C5JA 4ZHRA 1RTJA 1GX5A 4JV0A 3PW0A 2WOMB 2XI2A 5KFPA 4KFBB 3G6XA 4QPXA 1FKPB 2FJWA 3H5UA 2VG6A 3LP1B 5HLFB 1HMVB 4EYHB 2UVRA 4WFZA 1IKWA 3H98A 4TQSA 1JLFB 3DLKB 3DMJA 3TAMB 3MR3A 4IRDA 1HNVA 3OLBA 3LAKA 5C25A 3OHAA 5F8NA 1UWBB 1IKYB 4DL7A 3QLHB 1C1BB 5J1EB 1IKXA 4R5PA 5J2QA 5KFYA 4F50A 3LAMA 4I7FB 4O3OA 3KLFA 5C25B 5F8LA 2E9TA 1J5OB 3DRPB 2R8IA 3DOKB 1QUVA 4Y2CA 5EUHA 1S4FA 4RZRA 2BQRA 4PQUA 1RDRA 2FVCA 5T14A 3MR2A 1S97A 4ECSA 3KMSA 4MK9A 2BQUA 1TL1A 2WOMA 4NLYA 4YR2A 2C2RA 3N6NA 5DGAA 1RT2B 2BANA 3IG1B 4JV1A 4YR3A 4IG3B 1BQNB 2IM2A 1YVFA 3QYYA 4WXOA 3DM2B 1S48A 1S6PA 3BGRB 3PJXA 4M95A 5I3UA 4O4RA 1TKZB 3LALA 4MKAA 1DTTA 1WNEA 4LSLA 4Q45A 3GIMA 1SH2A 2W9BA 1SUQB 1Z4UA 2YNIB 5KFUA 3HHKA 1TVRA 4XPCA 5C42A 4EBEA 4NLGA 4WE1B 3BSAA 3NGDA 5F8IA 3KLHA 4PWDB 1LWEA 1T03B 1TP7A 3CDWA 1C2PA 3HVWA 5CYMA 1VRUB 4MKBA 3KNAA 4KKOA 1JLGB 3VQSA 4RW7A 1TQLA 1N5YA 3I0SB 2D3ZA 1TL3B 5KFNA 5KFXA 4QW8A 1EETA 5EWFA 2D7SA 1N5YB 4EBCA 1KHVA 2UVUA 1HARA 4PQUB 3TVKA 3E01B 1VRUA 2XGQA 1VRTA 1QE1B 2JC0A 3CJ2A 1S0NA 4NLPA 4IG0A 2R2UA 2FVQA 1MMLA 1LWFA 3V6JA 4RW4A 5C42B 2V4QA 4F4YA 4ECRA 5D3GA 1GX6A 4ED6A 1SUQA 3H59A 2RF2A 2EC0A 3PW5A 3MEEB 4TYBA 2OPQA 3JYTB 1DLOB 1S1TA 1SH0A 3QZ7A 1UWBA 4RW8A 4ZP6A 2AWZA 2I5JB 4EBDA 4DL3A 3KMQA 5CYQB 2ATLA 3BSCA 3PR4A 4ZP9A 1HNVB 3QO9A 3KJVA 3CDUA 1JLFA 4NCGA 4OL8A 5KFSA 5KFRA 4LSNB 4J9QA 2JLEA 4NZ0A 3QGIA 4TY8A 3DYAB 4I2QA 1S1UB 4I2PA 2RDIA 3QIDA 2FLNA 1MU2B 3I5BA 5KT6A 3OSPA 3MR5A 4O4GA 4M94A 4KHRA 1S6QB 2IAJB 3HVTB 3SFGA 3FRZA 1C0UA 1C1CA 5I42A 4RNHA 4I7FA 2ILZA 2ZE2B 3I0RA 3KK3A 3V81B 5KG2A 5KG3A 3Q8QB 2C28A 3C6UB 4IRCA 4O3RA 3JYTA 3FSIA 1K1QA 2RF2B 5F8HA 5J2MA 2OPSB 2HNDA 4Q8FA 2C22A 2VG7A 4RW4B 4YP3A 4K50A 3G6YA 4ZPDA 4NLOA 4IH6A 1REVA 4IG0B 4R8UB 2YNFA 1HYSA 3OL8A 3N6LA 2V4RA 1QE1A 1QAJA 5L1JA 3BQ0A 4JV2A 4DL4A 3RAXA 2HNZA 5HLFA 2FVSA 4O3NA 4ED3A 3Q8RB 3T5KA 4DL5A 3ITHA 5KG0A 1RTIA 1KHWA 4FS2A 3NAIA 3GV7B 5F8MA 4JUZA 2AGOA 2R8KA 4FBUA 1SV5A 4RU9A 2WHOA 3KLGA 2ASJA 5CYMB 3IGVA 4O3SA 1W25A 1RTDB 2F8EX 4QWBA 3IS9B 3PJWA 2WONA 4ED7A 5KG5A 4PUOB 2XWYA 4IFYA 1LW0B 3GV5B 1FK9B 1DTQA 4Q0BA 2IMWP 2FLPA 1KLMA 5FDLA 5L1KA 1KLMB 5FDLB 5KFBA 1N6QB 2XCAA 2O5DA 3DRRB 1LWCB 1OS5A 4ECYA 3G86A 3V6KA 1TKZA 3RB4A 3KK2A 2W9CB 4K4XA 1ZETA 4IRKA 1JLQA 1TV6A 2OPPB 3DRSB 5KG1A 2ASLA 3CO9A 2W7PA 3DLEA 3IRXB 5KFZA 3BJYA 1T3NA 4WZMA 3JSMA 3DDKA 4LQ9A 4URGA 4DG1A 5F9NA 4J9NA 5C24B 1TL1B 1JLAA 1HQEA 2UVWA 2D41A 4ED8A 5KFCA 2VG5B 3M8PB 2HNZB 3GV8B 3CVKA 2YKNB 4KSEB 2WRMA 4EO6A 5DG8A 4F4ZA 3KK1B 2DPIA 1RTHB 3DRPA 1JX4A 4KHMA 3KLFB 1S10A 3DOLB 2W8KA 2E9RX 3RBEA 2HWIA 4K4VA 1C1BA 4R5PB 5J1EA 4XPEA 5K14B 5DLFA 2WK4A 3HVTA 3KHLA 3M9OB 2AGPA 5J2PA 1JKHB 3H5SA 3MECA 3H4DA 4O4GB 5DQHA 1S9GA 3KLEB 3CDEA 1RT7B 4K4TA 1RYSA 5KFFA 2OPRB 2BQ3A 2OPRA 5C24A 3KLEA 3IN5A 1RAJA 4DG1B 2XC9A 3MECB 1QAIA 3H5YA 2RDJA 3CJ0A 2R2RA 2C2EA 3CJ3A 4H4OB 5DLGA 1RT5B 5HROB 4QWAA 1IKVA 5F8GA 1DTQB 4Q0BB 1C0TB 5HBMA 3V4IB 4ZVGA 2CKWA 1LW0A 4O44A 2OH2A 4XO0A 1RA7A 2QV6A 4EO8A 4ZPAA 3MR6A 4G1QA 3H4BA 5L1LA 4GC6A 3T5HA 1FKOA 3MFHA 4YMEA 3CIZA 3M8QA 3GILA 3GIJA 3E01A 1RT6B 3CJ4A 2YNGB 3ISNC 3RB3A 1EETB 4ID5A 4LQ3A 3QIPA 1TL3A 4ICLB 2J6TA 2HNYA 2AX0A 3GQCA 1S9EA 2R2SA 4ZPCA 3JSMB 3HVAA 4KAIA 5KFVA 3IRXA 2R8HA 4KE5A 2OPPA 3DRSA 3FDSA 4Y34A 1REVB 4R8UA 3UQSA 3EZUA 4ED0A 2ASDA 3KK2B 2W9CA 4J9OA 4ZPBA 1LWCA 4F4WA 1D1UA 5EWGA 2ZKUA 3KLIB 1JIHA 4ECWA 3NMAA 1DTTB 5JUMA 4KBIA 4WFYA 4PUOA 2WONB 3CWJA 3IS9A 4QWEA 4NLTA 1TKXB 5KFOA 1T05A 2W7OA 4NLWA 2YNHA 3N6MA 2JC1A 4EYIB 2VA3A 2R8JA 1RT7A 1S1UA 4I2PB 1RT4B 4IOBA 2B6AA 3OSNA 1N56A 1JKHA 2JEFA 2HAIA 3I5CA 2YNFB 2FJVA 1J5OA 4RW9B 1JLBB 4ECVA 4NLRA 2JEIA 4KB7A
chains in the Genus database with same CATH superfamily
2Z56B 2IRUA 1NK7A 4DR6J 1B64A 2AYEA 3HSJA 2LU1A 4GVBA 5DQIA 2VICA 2AEJA 1CPZA 1CJUB 4OI0A 1QVFR 3VGSA 4EGLA 1UW9A 5EHHA 2XY7A 5J2NB 1FDNA 3OR1A 3T6BA 3J7YI 4AL6A 1RA6A 2VBYA 2VC0A 1HBUB 4QYRA 1FO1A 5IWAF 4RUAA 2FZKB 3K89A 3ZZOA 1TZ0A 3PX0A 1RT4A 3THTA 2DCLA 2C3PA 3ZXWA 3CJSA 5IM0A 2FJAB 1Q8KA 4I2QB 4KH1B 3TQEA 4TY8B 4IDKA 1RWNB 3GLJA 1RWVB 4RUCA 1VOMA 4Y3CA 5K8OA 1K47A 1VJQA 1YZ6A 1LFWA 2QA2A 5G0RA 4X4QA 5CD4A 2I1RA 4DF8A 3G82A 4TLRA 4WBFA 3DRRA 1TKTA 3MAAA 2RUGA 5H9FJ 3SI8A 4K8RA 4RPFA 2VASA 1VGYA 3FCHA 2FJBB 3LP2B 2DEIA 1DZ5A 2VQFJ 4ECQA 3NNAA 2BE2A 1Q8IA 5EDWA 1U1QA 1YZ7A 3CJQA 3IG1A 5H9EK 5HAOA 3GMGA 4J37A 3C6TB 3J7Z5 2DJWA 4YHHJ 2ZJRQ 1FHTA 1RXOB 3K5MA 2HZAA 2PEBA 1LV5A 4BC9A 2BJEA 2Q43A 2N7YA 4ZMMA 2VOPA 5ETQA 2VA2A 2ZVSA 2GQ2A 1NSQA 3H40A 3J7ZT 4Y2MA 3Q23A 3D5MA 2DGTA 2WSCC 3DC2A 4G3IA 5LT5A 3PX4A 1WF2A 5C7PA 1YRTA 1FNMA 4O3QA 3ZZUA 1GMVA 5A8KB 1UVIA 2NUHA 1H2UX 1HHQA 1QDUB 1XWLA 2I2YA 2D3O1 3KK3B 2QJ3A 4TKTA 5IQ6A 5I42B 3G9CA 2VDHA 2H5IB 2UU9J 2C42A 3M30B 3HKZD 1RT3A 2HMIB 2Z58B 3CPWR 3AB4B 2YWEA 3HFZB 4UZBA 2IM0A 2X7IA 5B0FA 1IVZA 5HVHA 2RKIA 1FXLA 3V6DA 4NX9A 4OYXA 3Q0AA 2ZH8A 4KTQA 3D6FB 3MM5B 5LM7E 3NGTA 5HN0A 5KFQA 4FVMA 2ZFHA 5HP1A 1TKXA 4NYPA 3CJKA 4QIWD 1MROB 3TI0A 4HKQA 3KJVB 4UT4A 1J2VA 2DEJA 3CCES 2ZHAA 4RW8B 5KG7A 4J9SA 1CJVB 2RB7A 2BKPA 4J9MA 1S9FA 3M05A 1UTAA 1AUDA 4WF9Q 4FYYB 3CUNA 3B4DA 3R2CJ 5CYJA 3ENWA 4AQYF 3CJRA 1KRPA 3NOGA 1HD0A 2UUWA 2MQPA 4YB6A 2C2ZB 3BSNA 3C15A 4ZVFA 1VQKS 2DRDA 3GZ7A 1U02A 3W9IA 3M9NB 4JI0F 2V68A 2IHR1 1M5PC 1C4AA 3J7AN 4EUVA 3BKUA 4NRUA 5A0YB 4F02A 4B9LA 3D6TB 3U02A 2ALYB 2CJKA 4JI1F 2QE5A 5CQGA 4ZVOB 3QIPB 2B4PA 2W7AA 4MK8A 3N5BA 2NLWA 3I9V9 1WWHA 4RW7B 3P96A 2YKMB 4BHQA 3TAQA 2Q1LA 1WF0A 5HQ8A 2MKJA 2VUGA 3LP0B 5AXLA 2CG4A 4Z7CA 3MF5A 4JI1J 4ER8A 1IUJA 2P9GA 2V2ZA 5CXTA 4K4SA 1PJ6A 3UN3A 1L3TA 1IKVB 5ETTA 1WTFA 2HVIA 1CEZA 2IMWP 2N3OA 3NY0A 1VLYA 1RAIB 4LSLB 2JWNA 3RRKA 5AE2A 1XIQA 5KFMA 2DNHA 4MK7A 2XS5A 4DR7F 2DB1A 4H4OA 3M8WA 4GC7A 4U96A 2NXCA 4NYZA 2W4DA 4LFAF 4F4AA 2GJ2A 2DNKA 3D67A 2DGQA 3GFHA 4QIFA 1FVQA 3AH6A 4A47A 3W9JA 1RWOB 1TTHB 4R0EA 2CPDA 1BLUA 1T02A 4USMA 5ETLA 5KFHA 4M5DB 1N52B 1BY9A 4NLVA 1Z2ZA 2VPYB 3PIOQ 1RLCL 4FF1A 5IZHA 4RNOA 3NNCA 2CJQA 2GCFA 3NGRA 5A0YA 4X4VA 4V19J 1RT6A 1F6TA 4QR0A 1OWXA 4ZPWR 3QJJA 1UZHA 2IM1A 1BUXA 3DOKA 4CO0A 9RUBA 2JVRA 4Y65A 1EZZB 1I94F 4OJHA 2HHWA 1HFEL 4B3OB 3JXOA 2CJYB 3U1MA 1Y11A 2HNDB 1NHUA 1BQMA 3R7NB 3OVSA 4J9LA 2GVZA 1M90T 3T19A 2DH9A 1CJVA 2JDJA 4KO0B 2PN6A 3AAWB 2VD3A 2VFUA 3M2VA 2ZUAA 1R89A 1KQFB 1U1NA 1U47A 1UVLA 4CLYA 2CPYA 4RUBA 4ES2A 3DLKA 1MROA 1I6JA 1F9EB 1IKWB 3RAMA 3NOCA 4WYWA 1Y10A 3MM5A 2B8QA 4OZ3A 1Q82T 1FEHA 3B78A 3BPSP 3GIRA 3WZ0A 4DCJB 1KLNA 2FHMA 2IPOB 4IH7A 1FFWB 1TR0A 3OXLA 1M1HA 1WC6A 1X4DA 2IRYA 1T05B 2CAJA 2J7KA 1I5OB 4HDGA 4MT1A 5A8RA 1R8HA 4LSNA 1SIZA 4AXJA 1RT3B 5LSLA 4UY85 2EBEA 4WTYA 2XNRA 3QJPA 2Y9HA 4ZVRB 4Q44A 2D1CA 3AOBA 1BC6A 3KHGA 4EEYA 2KDOA 4ZOSA 1Q5YA 2JX2A 4DCOB 2DT9A 1U09A 4B3MF 3VAJA 2BW7A 3NG8A 1RK8A 1S1VB 1LWFB 3OL9A 2XHWA 2EG2A 1NM2A 2V2VA 3FQKA 4NLXA 4C0OC 4LIWA 3G96A 2ZH5A 2ABYA 1X9WA 1S1XA 1SC3B 1WKKA 3WHIA 4TYAA 1GT8A 1UETA 4ITSA 3VGVA 2YKNA 4RNFA 5AXNA 8ATCB 4TU9A 3QATA 3NL0A 1SPBP 2YX7A 4ZP7A 1RTIB 2P9CA 4JI6J 1H98A 2BJ9A 4BDPA 3VF0B 3K5LA 4H4KA 1U0SA 3RG6A 3O2IA 4F0MA 2HFZA 2HHVA 3M8QB 4AL5A 1VQ8S 1SH3A 1WKJA 2LDYA 3H5XA 2B0GA 2BDPA 2N4DA 2WVDA 1HQUA 2X1GA 4N47A 2WVFA 2LEAA 2C2DA 4PQAA 3LP2A 5IWAJ 1VBZA 4PYAA 4MKVA 3IBWA 1TKTB 3LGMA 2D74B 4XK8C 4PG7A 1C0UB 1C1CB 2ROEA 4JI6F 4A8OA 4ZKAA 3NS6A 2PI5A 4G1PA 2IC3B 3MEDB 2DNOA 1Y5LB 4W98A 2LFVA 2K3KA 4LFCJ 1GX5A 3VVTA 5LXRA 2W4CA 4C2MA 5L39A 4K0KF 4I6YA 4DR1J 4QIVA 1NRKA 4ZS6A 3G6XA 4GRSA 2RJZA 2VPXB 3KG0A 3H5UA 5FJ4A 3OTEA 1E6YB 1HMVB 1EKSA 2JVOA 4EYHB 1VHIA 1IKWA 1UA0A 3OUYB 3DLKB 4KT0C 3MR3A 4W90B 2HRUA 1PYOB 2XMWA 2F8MA 3S01A 2NR0A 3M2VB 3OFFA 5F8NA 1UWBB 3TVYA 2F4VJ 1IKYB 1Y3KA 2RRAA 3TP2A 1IKXA 5KFYA 4WP3A 1FTCA 4G6VB 4P7TA 4ALZA 4YDDB 3OVBA 2UXBF 4HI1A 2FGOA 4O3OA 1PBAA 3FZ2A 4F3MA 3DOKB 4Y2CA 3W65A 3AOAA 1A7GE 1WHVA 2FY1A 4DU7A 1M5VC 3MR2A 1IBCB 4C8YA 1GMWD 2R7OA 2PIIA 3POTA 4ECSA 2BQUA 4MK9A 1IXKA 1TL1A 2WOMA 2XHCA 1JJ2R 5A76A 1CULB 2C2RA 5DGAA 1RT2B 4NA3A 2Z57B 4JV1A 1HA1A 4IG3B 5GAEU 2ERRA 3DM2B 1S48A 4USHA 1VIOA 2CQGA 1Q7YT 3H2VE 1HR0F 2X1BA 4M95A 1YQHA 3QMQA 4PR6A 1G2EA 4O4RA 1TKZB 2CNOB 3SCIE 3CB4A 3ZTPA 2GMHA 3ZNJ1 4ANDA 4CLPA 2CA9A 4LSLA 3DKDA 3NGKA 1I94J 1QSYA 2DGVA 3GIMA 2HZVA 4ELVA 3S6EA 4EBEA 3HHKA 4XPCA 4DUZF 2CQ3A 2CVEA 2MQOA 1LOUA 3MAHA 3MCMA 4L73A 4ZLLA 3NGDA 4UF4A 3TRGA 3CDWA 3AJ1A 1T03B 2H1YA 1TL5A 1C2PA 3DNCA 3HVWA 4AD6A 1T9WA 1VQYA 1IWAA 1WUUA 1IWGA 4RW7A 5J1NA 1UW4A 1A9NB 2RMLA 3OTBA 4RKUC 4QW8A 1CQMA 1HI8A 3QSYB 1VYAA 2D7SA 3PRVA 4HH1A 2BM1A 3W5ZA 4EBCA 3CCTA 2VPWB 4ES1A 2GAGC 1NDCA 1Q95G 3N5FA 1H0HB 1PBUA 2L9WA 4DV5J 2FVQA 3HHLB 3BF4A 5FLXU 2CFXA 4ECRA 4ZCLA 4C11A 2AMCB 1RJJA 4TYBA 3R1LA 2ZDOA 1KFSA 1JJHA 2E44A 1RABB 3T6JA 2JLGA 4RW8A 3CC7S 4E0DA 2E66A 4OYPA 3KMQA 2DHSA 2GVDA 3BSCA 3CW2C 1M5KC 1HNVB 3KJVA 3EZOA 3CDUA 4LRBA 3VZHA 2Y1JA 4OL8A 2LA6A 2MHNA 2QGFB 4EU0A 6AT1B 2OEMA 4DFMA 1SL2A 2BEFA 4DHVA 1KTQA 1OQ3A 4NZ0A 4J9QA 3DYAB 1YBAA 3W2WB 3CD6S 3IXQA 3ZZTA 1OSCA 3IMQJ 3QWUA 4RO0A 3S1TA 4L3KA 3OSPA 2UZAA 1G1XA 1V5IB 1WHWA 1S6QB 2IAJB 2YWKA 4ZVPB 3NNHA 2QMUB 3FRZA 3LTOA 5I42A 1K0TA 3KK3A 2O3DA 4KR0B 5D0HA 3W64A 5KG3A 4IRCA 3AD7C 4O3RA 4FNHA 2XMMA 3K8VA 1SJQA 2RF2B 2DY9A 2HK2A 2CXEA 3M32A 4B02A 1YX2A 4LVOP 5F8HA 4IOCQ 2NZCA 3M8YA 3QGPA 3WDOA 5B0DA 5H9EJ 1S4EA 4IG0B 2E29A 2Z2MA 2ZUGA 1QE1A 1QAJA 3MCNA 2VFVA 1TFYA 3GR1A 3BQ0A 3EGWB 2XMAA 1BXNA 1E6YA 3DXBA 1V3SA 2H54B 1U26A 3PYEA 2UU9F 4CM2A 4OX7A 3NAIA 4KHPJ 4A8MP 3S7RA 1F0XA 4CRJA 1EARA 1QTNB 2P8IA 4DMZA 4RU9A 3VAIA 2V4JB 4OYMA 1WC5A 5CYMB 3IGVA 4O3SA 1U6ZA 2V6AA 2GMLA 3RTVA 3T1YJ 1NBEB 4YN3B 3PJWA 1HQ2A 3SYZA 1HWKA 1UVJA 1U8SA 1Y4ZB 3EDQB 1E6VB 2XWYA 1LW0B 3D68A 1SJ1A 4QR2A 4A8YA 1FRMA 1U45A 1T95A 1KLMB 5FDLB 5KFBA 3DRRB 1OS5A 1RAEB 3CJTA 3MAAB 2ZKTA 2DD8S 4CM0A 2YX4A 4K4XA 2H9ZA 3JS9A 2KT3A 4U7UD 2KFZA 3DRSB 4JI5F 2GO9A 4OZ0A 3DLEA 5E33A 7FD1A 1T3NA 2BV3A 3OTDA 3JSMA 1KVJA 2F3JA 4URGA 4DG1A 5F9NA 4DR4J 3DOMA 1TELA 1HWIA 4CYUA 1KEKA 4DQRA 3R3TA 1SL0A 2HLTA 2VPZB 3PYGA 3D3CJ 5DM7Q 1UFKA 2D41A 2CWKA 2MSSA 4ED8A 4IRKA 4JV5J 4WKYA 5KFCA 3M8PB 1N5QA 2VQFF 2YKNB 2R7QA 1HBUA 1FT8A 4EO6A 4F4ZA 3DRPA 1S6OA 3TW0A 3KLFB 1U7LA 2YH0A 4K7QA 1S76D 2GHWA 4DQQA 3L3CA 4BLGA 5ETRA 5EX0A 4DV4J 2R42A 3PRDA 4C3LA 1L5UA 3RJMB 3PJ9A 3WIUA 3CMAS 3MDFA 5D4LA 2P6SA 4QBUA 3I9ZA 1Y0HA 4U8YA 4AFFA 1YSJA 1I51B 3U1LA 2XLJA 1WF1A 2AGPA 4NA2A 5J2PA 4X4PA 3IAS9 1V9OA 1Q4RA 2APOA 3GG0A 4N76A 2I8EA 4U95A 2KH9A 1FERA 3L4BC 1S9GA 2QTWA 4ANCA 3MMCA 1RYSA 1G3OA 2OPRB 2AJFE 2RIJA 1VIXA 5C24A 2HLUA 1NKCA 2AHOB 5CCMA 3EXCX 4A8WA 3ELHA 3T9NA 4M5HA 1VQNS 4MAKA 1T9TA 2DO4A 2K2PA 3Q86A 2EK6A 3DRYA 2K3IA 3CJ0A 4DS5A 4DR6F 2R2RA 1O51A 2A2CA 2BVZA 5HMYA 4PPZA 4A8SA 3F73A 1JK9B 2LQ5A 1RHRB 2YH1A 1WDTA 2W2NP 2GVZB 2AIRB 2WW8A 3W62A 1KQKA 1DTQB 1C0TB 4LUBA 2VFRA 5BJRA 2CKWA 5SZTA 1RA7A 4DN0A 3MR6A 1TL7B 2B4UA 2XMKA 4Y28C 4I56A 4OLPA 4P52A 4DFJA 4F2SA 2KRBA 3MFHA 4KHPF 3CIZA 4B3SF 1MN7A 3E01A 1RT6B 3CJ4A 4MYTA 3ILLA 1YJNS 4C8OA 2GMJA 2V94A 3HHLD 1EETB 3KG4A 4ID5A 4H4KC 1YHQS 1L3UA 4DFPA 2LQBA 1FFGB 2OFGX 1WTBA 4KAIA 3HVAA 4HHJA 3PHTA 4P75A 5KFVA 1K44A 3LO3A 3ZZZA 1FWLA 4KE5A 2HBYB 3FDSA 1EAYC 1QAXA 2EFQA 1R6YA 4M5JA 5AXKA 3ZZ0A 2W9CA 1RKJA 4BBYA 3PXGa 5KAKA 4X62F 2MKIA 1UEKA 3QSIA 2ZOGA 4A46A 3NMAA 1X5SA 5JUMA 4KBIA 4JI2J 4KGMA 3OD2A 4PUOA 2G4BA 2XWXA 2PT0A 3B82A 4OLOA 4F7VA 3THVA 3QQCD 2CNLB 1Q0NA 1PO6A 4NLTA 3PKMA 2MKHA 2WVCA 3IRWP 2W7OA 3ZC4A 3W66A 2H3EB 2O66A 2ZEJA 5K8MA 4FKXA 2DXFA 1KD1T 4QYZK 2DHAA 2BM0A 2EPIA 3BBFA 4DUTA 2DXEA 3DU6A 1XMQF 1FJCA 1PG5B 1AFIA 4ELTA 2DGWA 3V5RA 1J5OA 4C7QA 4CT8A 3K0JA 2M3DA 2JEIA 2YKQA 3HP6A 1VC5A 4RWWA 2B3TB 1HNIB 1BD6A 3G8QA 5J2MB 3D1OA 3GP9A 3EX7B 3BGUA 4OX8A 1VK3A 3CDBA 3HX9A 2KXNB 3SDEB 4DR5F 5KT2A 2YKOA 3D1QA 4PXCA 1JLCB 1H72C 1EP4B 1VQMS 4ZITA 1D09B 2FD2A 3IC1A 2K7JA 1NB7A 1M5SA 4DPYA 5HP1B 2ILYA 3GTYX 3CJKB 1XR5A 1R31A 2CDRB 2JFDA 1SL1A 3LP1A 3H2UB 2W01A 3HSGA 1URNA 4FXDA 3SIPB 1SQEA 4CP5A 5EWEA 1JLAB 1N48A 7FDRA 1S6UA 3NXZA 3PFEA 2KXFA 3NBPA 2D69A 4YDXA 2E9ZA 1JLGA 4KKOB 5B0AA 2XLKA 2E1RA 2HMIA 4Q5VA 4X4NA 2MQMA 4PG5A 3KLHB 3D54A 1WI6A 1WHXA 1T9VA 1LEOA 3CGIA 2B7CB 3L9ZA 1FCAA 2GJIA 2J7WA 3A1YG 4ZIVA 3Q89A 4MIAA 2BXJA 4PG4A 1LW2A 5D3GB 2ATCB 2DPJA 2R7WA 2RUSA 5D0EA 1U1RA 1K1SA 1WOOA 4Y2IA 4HT7A 3TEGA 4ECUA 2XI3A 1S6PB 3BGRA 3GB0A 3MM8A 3N0VA 2XULA 4NYOA 5B09A 1UEUA 4IUFA 1BQNA 3SCLE 1IBLJ 3R5DA 3PW2A 1IBMJ 3BN4A 4WU2A 1NKBA 3RBDA 3TUPA 4EMDA 3C6TA 4ED1A 1B7YB 3T5JA 2UVVA 5DQGA 2G1HA 2UXBJ 1KSPA 3MI7X 3QFWA 3DDIA 4X2BA 1RE1B 2R9LA 3CCWA 3M6XA 3QGGA 2Z4PA 1HL6A 2OUGA 1EHWA 2MHEA 5HBMB 1U0HA 2HIQA 3A8JA 2ZDPA 3N9UC 3OQ2A 3NRBA 4IYQA 3X3UA 3K17A 5CD4H 3QLHA 5J2QB 1G4CA 2DH8A 3SMZA 5LJ3Y 4HYKA 5KG6A 4J9RA 1T11A 2BUNA 2RNEA 3LW5C 5KFGA 2V5HG 1JLBA 3GSDA 4PPDA 4P2XA 2PFDA 1MWYA 5SUHA 3KYLA 1D9DA 3CO0P 3RB6A 4LFCF 2BW2A 3PZPA 2QSFA 1K9MT 2BANB 3I32A 1YJRA 2G0JA 1MLAA 4G65A 4WP8A 1V3ZA 2X3GA 4ZLNA 3AJ2A 1XK8A 4I0WA 3KLVA 1AUSL 2R8GA 3W63A 4B9TA 2DYAA 4C8KA 2E7WA 2XLIA 3TJ9A 4KPYA 4GMKA 3QO9B 2UUCJ 5J2NA 2FJDB 3TA0A 1KS2A 2B9YA 1DBDA 2RQCA 2RS2A 2M9KA 3M7VA 3HKWA 3MEEA 3VAGA 4F3QA 1RHKB 3OXFA 3M8SA 4K5SA 2PC6A 3CCJS 4RW9A 3OHBA 1T9UA 2R7SA 2V8DA 2F63A 2G2OA 3BSOA 4WP9A 3VGUA 2Q6BA 4MFBA 2B6AB 3R7BB 2J5AA 2HNYB 2HHPA 3UPFA 3GIKA 2PA3A 4Q2MA 3Q8PB 1O0PA 3CJ5A 4NXNJ 3HCXA 4O0NA 4FPRA 2OEJA 4QWCA 4ZHRB 1SJRA 3K5PA 1W2IA 4ECXA 1SJFA 2MYFA 4OI6A 1NZAA 1P1TA 2LYVA 1BGXT 4X84A 2V2KA 4PAAA 2XMUA 1U8WA 2BYCA 2IJRA 2RS8A 1LXNA 2CWXA 2AT1B 3DLJA 5C2GA 2FLLA 2CADA 3D4JA 4KPCA 2OD4A 3J7YU 3V6HA 3EPIA 6FD1A 2F9DA 2FJXA 4E2FB 4DR3J 4LR8A 3MPWA 4ENOA 5F8JA 1W26A 3ULHA 5IV3A 1VRQC 1RTDA 2XO7A 4I67A 1S1WB 5F3TA 2IIHA 4USTA 4OJGA 3FSXA 3MM7B 4LF5F 3NBPB 1V3RA 3TEHB 5IT9U 4ICLA 4WIQA 3D9BA 4M8LA 4ZDNA 3F0NA 1NUEA 3CCRS 1N32J 3CSKA 4WZQA 2AZ1A 1VC6A 5HJYA 2P5VA 3UE2A 1WSRA 2HGMA 2QSWA 4HTJA 4UOGA 5I3QA 1KBRA 1ZH5A 4QIEA 3OFEA 2A3JA 1EP4A 3FBCA 5IS2A 1N0UA 1JLCA 3LPEA 1JXLA 4DDFA 2CNNB 1RYRA 4LRFA 2ZHBA 2PA8D 4I6WA 5KFEA 1H7WA 3Q8UA 4NEYA 3JB9k 2MZSA 2Q3PA 2UXDF 4ECTA 1GQEA 3D7SB 2ZITA 4DF4A 1N4LA 1RT1A 4N56A 3DMJB 4LRDA 4M5GA 3FQLA 3CDAA 1SKWA 5JXSA 4TN2A 4K2JA 1BQXA 2VG6B 5GVQA 3MMAB 2W9AA 1FKPA 3E8OA 5KFJA 4USVA 3ICLA 3L7UA 1TU0B 3MMAA 4LFAJ 4IKAA 2QYCA 4OZJA 2VJVA 1JLEA 2BRKA 2JEGA 1NSAA 1Q5VA 2XSJB 4KV8A 4USKA 2AQ4A 3C19A 4KGZB 4OHWA 4JI7J 2DVIA 3F44A 4QYZJ 1YLXA 1JLQB 1HNWJ 3KG1A 3ENQA 3BREA 3FSYA 4RLEA 5KT5A 3I56S 2H4YB 1VC0A 1DLOA 1S1TB 2DY1A 3M1VB 1OMSA 2DNPA 2GIRA 5ETSA 3MPDA 3CC2S 1X0FA 2XO6A 5LMNJ 2CZVC 1SCJB 3NKYA 4JI3J 2EVZA 1H38A 3KK1A 2DGSA 5E2QA 3D2WA 1SC6A 5HJXA 3ONQA 1X4HA 3W9HA 1SV5B 1HPZB 2IYGA 2VG5A 4LIRA 2WTFA 2IA6A 1RB0A 1Q8BA 4B9VA 4JI0J 2AEFA 1WOSA 1RAAB 1U2RA 1RWMB 1FD2A 2WVEA 2QA4G 1APSA 3PV8A 2HVEA 2H4WB 4AQYJ 4C8LA 1S1WA 4PXBA 2MQLA 3TUZC 1LWEB 2WAQD 4ETZA 3QZ8A 2NPIA 1X4GA 2HRYA 2VBXA 2YWWA 4NLSA 3HHDA 2EI5A 5E0OA 3RAQA 5HANA 3H25A 1TK8A 4DSJA 1Q53A 3FVYA 4OI4A 1H2VZ 1UZDA 2J8AA 2LQ9A 2ZZNA 4OIXA 4PYDA 1Y7PA 2WB1D 4MH8A 1VS3A 2H51B 2X3DA 3BR9A 2V9KA 3DHWC 3QNWB 3TARA 1L3SA 5D0GA 3LH2S 2HW3A 3Q2SC 5B7WA 3DI6B 3D6HB 2LECA 1UFWA 1PAEX 4QIGA 3GJTB 2P2CB 4ZHRA 2HQFA 2AKWB 1OSDA 4Y00A 3MOJB 2HIYA 2HURA 4JV0A 1FXRA 1Q8LA 3UR3C 1UVNA 4KC5A 5KFPA 1H6KX 1GEHA 2OLWA 2KZZA 4CLTA 2FJWA 1QY7A 1SXLA 4P2FA 2UVRA 3M8ZA 4WFZA 3MUVP 4F2RA 1N36J 3HFKA 3JTNA 1RU1A 1RHUB 3SQGB 2UUBF 3I96A 3FK4A 4IRDA 3RBZA 5C25A 3EVMA 2MB0B 1F9HA 1ZPWX 3BH6B 3FEYB 2AJ4A 2VU5A 1FKAF 2PO4A 2W2QP 3MR7A 4FYXB 5E7OB 3QLHB 5J2QA 2CQPA 4WCEQ 3MCSA 5GMEA 2YQ0A 1UMJA 1J27A 2VH7A 4I7FB 1RKIA 3KLFA 5C25B 3E3XA 4MYUA 5I3PA 5F8LA 5LMUF 3DRPB 4N77A 1GNKA 1IQZA 1AZSA 1QUVA 5EUHA 5CHCB 4YHHF 3FMBA 1C4CA 1U24A 4PQUA 2DO0A 2FVCA 3CCZA 5T14A 3SV3A 1S97A 2MMYA 4UOHA 3US5A 1VHFA 2JLFA 4ZIWA 3KMSA 1NJXA 3EYZA 3UCUP 2I6WA 3DOMB 3DLHA 1NLKL 2BANA 3UW1A 3MPVA 3AOCA 1BQNB 2IM2A 1YVFA 3IWXA 1U4BA 2YQ1A 1A0OB 1S6PA 3BGRB 3MM8B 2UP1A 3A8KA 4OYIA 2RHQB 1PILA 2CYYA 2QT7A 5A8WA 3CD0A 4LT6A 4MKAA 3CC4S 1SI9A 1NK8A 3AXMA 4LF4F 7AT1B 4X64J 1SH2A 4P9SA 1SUQB 5E41A 1MW7A 3LWMA 4DFKA 4USIA 4M5IA 5IC6B 2LVWA 2ZOFA 2Z2YB 3WQPA 4ZK7M 1KVIA 2RU3A 1RAHB 5F8IA 3KLHA 1X4EA 1LWEA 1TP7A 3BN7A 3LPYA 5F3ZA 3KNAA 5CYMA 1VRUB 2YKPA 2V4JA 1XTZA 4KKOA 1JLGB 3NEKA 3VQSA 3W1YC 3MAQA 1N5YA 5GADI 2D9OA 4J90A 3WC2A 1X4BA 5EX3A 5KFNA 2MEWA 4OX9F 2Z2LA 5L8RC 5BR8F 3J81U 1F2HA 1KHVA 2UVUA 3ZTRA 4LF6F 3G8SA 1WEZA 3HULA 2XGQA 3W8PA 3HSZA 4Z7YA 1QE1B 1S0NA 3CJ2A 5A6WA 4IG0A 3D6MB 2R2UA 3LQVA 3W7BA 2CIMA 2NZ4A 1N54B 2A2DA 1LKZA 1YBTA 3NS7B 1MMNA 3V6JA 1X7VA 5C42B 3NGUA 3WBZA 4ED6A 5D3GA 3SDEA 1HHTP 3H59A 2RF2A 3M1VA 1L3VA 1DLOB 1S1TA 1SH0A 3KJQB 1Q16B 2AV5A 4DL3A 5CYQB 1X60A 2VKRA 1REGX 4LF1A 3K58A 2EKYA 1JLFA 2C1EB 2DHGA 1NSPA 3LGNA 2XSJA 5KFRA 4CLKA 1NZ8A 2JLEA 1RCXB 2QRRA 1FWPA 1FRLA 2KJVA 2RDIA 1RP5A 3BYRA 3QIDA 5ETPA 2J76E 1RQ0A 4O4GA 3CE8A 2BJ1A 5HK4A 1JJ4A 1JMTA 3O1LA 4F3OA 4FYDA 3DGPB 1NJYA 1Q86T 2RU9A 3SFGA 3HVTB 1UL3A 1VMBA 1RLDA 1BE4A 5B0GA 4X66J 2YPYA 2IMOA 2ZE2B 1WACA 2MGZA 3V81B 3PNIA 1TL4A 1LK7A 2BACA 2E7VA 4I6AA 3QRPA 3GCWP 1EX8A 5J2MA 2OPSB 2PD1A 4Q8FA 2C22A 4WFAQ 3OTOF 4AUKA 4CLZA 2ZH9A 4DV3F 1HBMB 4OI3A 3HHLA 4USJC 3MEKA 4IH6A 2VJUA 4U8VA 2V4RA 4JI4J 1HYSA 1R27B 3N6LA 5L1JA 4DV2F 2LCWA 3O44A 2HNZA 3Q8RB 4DL5A 3ITHA 2E1MC 3RGIA 3ZTQA 4RUHA 4FS2A 5F8MA 1YWXA 2E5HA 4ID8A 2AGOA 1IBKJ 2BBEA 2WHOA 1T9YA 1IQTA 5HL7Q 1W25A 1RTDB 2F8EX 2I38A 3WC0A 2PFFB 4GKKJ 1NMEB 2KXHA 2NXJA 1TL7A 2CQ0A 5KG5A 4PUOB 1H2TZ 4OZ5A 4MKYA 3ISZA 3GV5B 5AE3A 1DTQA 2XYHB 2CPJA 2IA0A 1JNRB 3MM9B 1NH7A 1N6QB 4NOHA 4FF4A 3V6KA 2M2BA 2B7BB 2B9EA 2H5JB 1TKZA 3D0HE 3G86A 2W9CB 4ECYA 1NCLA 1ZETA 3KKFA 2O67A 5IC4B 1TV6A 3NLCA 3GJRB 4LR9A 4QJVA 1YDLA 1YK9A 5KFZA 5HMZA 1ROFA 4DV1F 2VBZA 3DDKA 2ZH4A 4Y0FA 1QTMA 2CQCA 4J9NA 4ZVSB 3AA9A 2N7CA 4NCAA 1H73A 1LWXA 5C24B 1TL1B 4PXEA 2QLBB 3P45B 1UVMA 1GH8A 1FRIA 5DO2A 1OO0B 3PVXA 1U6BA 1RTHB 1JX4A 3H8YA 4KHMA 1FJGJ 1ZAXA 3DOLB 2E9RX 2YKAA 2F9JA 3FC9A 2B4OA 2LLZA 3TA2A 3LOUA 3ENVA 3CJ8A 1B0VA 2LQ8A 4B3TJ 1LK5A 3RZAA 4P7VA 4XPEA 4FF2A 2CUYA 4YY3F 2B9XA 2GQCA 2DIUA 1HBOA 5F41A 2N82B 3PCOB 2VC1A 1VQ6S 1N34J 1KNZA 2DXDA 2C2MB 5DQHA 3CDEA 1GXTA 1RT7B 2AYMA 3TO8A 4HLBA 3VR1A 4CTAB 5C2CA 2WZ1A 2OPRA 1PKUA 5KFFA 3Q22A 2BQ3A 2OIHA 2ZJQQ 2EFOA 3KFWX 3IN5A 4B9NA 4DG1B 1M0SA 3I82A 4FXWA 2HS4A 2I9SA 3TJAA 1HWUA 2RRBA 1VQ9S 3H5YA 8RUCA 1PJ5A 4KH0B 1MWQA 3D66A 2C3YA 5T41A 2HS0A 4JYAJ 5GADU 4M5NA 5HBMA 1U0HB 2NUUG 3EJMA 3P3DA 1LW0A 4ZVGA 5RUBA 4JI8J 4WKRA 4OZ2A 2YWFA 5G4DA 5CCLA 2XQCA 3H4BA 1ZAVA 3DDNA 4GC6A 4B3TF 4JI5J 4NXMJ 4N8OA 3M8QA 3TA1A 4ZLJA 2V67A 3GILA 3RR8A 1GXUA 1ICEB 3ISNC 1UJ5A 1UWAA 4Q7AA 3J80U 5GAHU 1FJGF 1GXLA 1AA1B 1XQIA 1TL3A 3R5GA 3OPKA 3Q83A 5AJ3J 1QM9A 3TANA 3GQCA 2SXLA 4DX5A 1ZYQA 3JSMB 2IVYA 3J80Y 3BM7A 1VR6A 2OTJS 2HGLA 5GMKa 4ES3A 2R8HA 4HHUA 2GW8A 3DRSA 5HVFA 2X1AA 3UQSA 2HHHF 4DI6A 1DHMA 3CD5A 4CO5A 9ATCB 5IT0A 4J9OA 3G2XA 4ELUA 4NL5A 2U1AA 4AT1B 5GAGU 1NH8A 2ZM6J 5EWGA 4F4WA 3BH7B 3KOAA 1KOOA 4K2XA 1JIHA 3R9LA 2DGOA 4ECWA 1DTTB 3N01A 2B51A 4WFYA 4NI2B 1HI1A 4EWTA 2BJ3A 3PRBA 2OAUA 5K20B 4RL1A 2KM8B 4DLEA 4F8RA 2JHEA 3W61A 3F41A 3U1NA 2DNZA 1T05A 4LRCA 2R7VA 2HBQB 1FRXA 4FKYA 4GKKF 4EYIB 3ADAC 3W2WA 4DBQA 2G13A 4ZN3A 1J5EJ 3JQJA 2JNJA 2QN6B 4DSIA 5DDOC 2OSRA 1JKHA 2K1RA 1V6HA 2Z2ZA 3OR2A 4B3RF 3I5CA 1Z1ZA 3C2PA 3HD2A 4OYWA 4D3GA 1O5JA 2LXFA 2XZDB 4ECVA 2KI2A 2VDIA 3VHQA 4KB7A 4XTTA 2MZQA 1ELOA 4WU3A 1R8AA 1RAGB 3GR0A 4QWDA 4DQPA 1UPPA 4J9KA 2KYXA 3OLAA 1SQGA 2PMZD 1MNEA 1BQMB 2M52A 3FZBA 1P27B 1HNIA 3TUJC 1OPIA 4JI4F 3ZTSA 2Y1RI 2XMJA 4DV3J 3LA0A 3T3FA 1RWPB 1W7WA 2PE8A 4GO7X 3FBEA 1SKUB 3IGNA 2CJXB 2DR9A 4N41A 2FVPA 2E5LJ 5IT4A 1D9AA 4X66F 4YB7A 4UOFA 3SBMA 4X65F 4M5DA 3VCDA 2RHSB 3CT9A 1AYEA 3A3OB 4AYBD 3VAKA 1HNZF 4GKJJ 2WCXA 1T03A 1NHKL 2MSTA 3T1AA 3BS9A 5E5NA 1YI2S 2V50A 4J9PA 4LFBF 4OI2A 1GK8A 1GMUA 2G1DA 3ET6B 2R7RA 2ASYA 4J7CA 2KO1A 3I4PA 2Z8QA 4FBTA 5IFMA 5HQMA 4DV0F 4DSEA 1MSWD 2HVHA 4C11B 1FK9A 3MEGB 3KUGA 5DDQC 4DEZA 3T5LA 2AP6A 2HBZB 3D28A 4WFXA 2FJEB 3W60A 2HFSA 1VFJA 3UD5A 3GONA 3F56A 2YKMA 2MLZA 2LU2A 1CJKA 1PGZA 2XY6A 2HFVA 2NXEA 3NCPA 2XTJP 4WWSA 4QQBA 2D3UA 2L3MA 2NCKL 1RWXB 2F7VA 3IO1A 3NWGA 5KFDA 3BR8A 3CCUS 4LF6J 3H2LA 3C15B 2BX6A 1H7XA 3UWTA 4LR7A 4LF9F 2KTQA 3CF5Q 4BS2A 4DUYF 4PG6A 1C0TA 2KN4A 2GC8A 3RU0A 4LBIA 2KT2A 5HMWA 2XS7A 4U7UK 3KWMA 1AFJA 3AT1B 2R7XA 4CDIA 1IKYA 3LGHA 5K5MA 2CNKB 4QZVB 2ZD1A 1B70B 4LREA 5F9LA 1NDKA 5D6GA 2R7TA 3EWGA 2ZWOA 3B8HA 5H1SV 1VBXA 5GAGI 3C46A 4ZVEA 3DM2A 3RR7A 1N33F 4IG3A 4LF4J 1HMVA 2VFTA 3RW7A 1RT2A 4FF3A 3TZWA 2L08A 4OZLA 2AU0A 4DU8A 2W24A 1CSJA 3V6DB 3PDNA 3R97A 2RKIB 1S9GB 4RNMA 2B43A 2DHXA 2ZHOA 1WORA 5KT7A 2DGUA 2G9OA 3J81j 2C3UA 2VQEF 2FUG9 2LQJA 1Q7LB 1S99A 4HACB 3TX0A 1FEEA 2MZ1A 2AYGA 2QFIA 3MTKA 4KIAA 3GIIA 5DETA 3HT3A 4KGXB 2I5JA 3ZZPA 4NI2A 1OIAA 3RRHA 4ANEA 2C2NA 2BR0A 5L9NA 3D0IE 1IKXB 3UFCX 5L46A 4DV6F 2OSQA 4MIBA 3W8GA 3HI9A 2NYIA 1HQUB 1M5HA 1UJ4A 3D0GE 4Q43A 3IAM9 2QEXS 5HO4A 4LF2A 6FDRA 4H4MB 2V9WA 2DNYA 4NZ7A 5IOLA 3ETOA 2ZBQA 2VKZG 1WI8A 3VGTA 4DL2A 1U49A 3DLGB 3OFGA 5KG4A 1L3KA 3CCLS 1YJWS 2UUBJ 4CYUB 3HZEA 1U1PA 3TVZA 2XMTA 5HSPA 2DITA 2IC3A 3MEDA 1TMJA 3RBXA 5CA5A 3DLEB 1S1XB 2BE2B 2CJAA 2XYPB 3PYFA 3JAMY 5T7LA 2M70A 4XAKA 4KJIA 3UDVA 5KFLA 1KR4A 2V69A 1DJ0A 2F65A 3MHYA 3V4MA 1TVRB 3IBCB 3KLIA 1QJHA 2W9BB 3QAEA 5HATA 3BQ2A 2BA9A 1S0MA 3R8YA 3UDLA 1PAUB 2R2TA 4J9UE 4ZJOA 1NJIT 5DS7A 3ZTOA 2KG1A 3DLLQ 1KC8T 2QG9B 3EICA 1ZTWA 4PWWA 3U7JA 2KHCA 3QBCA 3PW7A 4IDKB 4QPTA 2DNNA 1IM6A 3BGLA 3N4WA 2D3OR 1BWEA 5D0RA 3K5NA 5HI7A 1OYDA 2PEHA 2YVSA 3V2UC 4RWXA 3DLGA 2XGPA 2VQEJ 2YNGA 4HL9A 3OBIA 4ZCMA 4K5RA 2PMHA 2DRBA 1HBOB 4X4UA 4H4MA 1SJ3P 2E5JA 1I1GA 3LWLA 1CQNA 2POKA 3I5AA 2MY8A 3VZIA 4X4OA 1S1VA 1MWZA 1N33J 3M32B 2DBBA 5IT9Y 1S5ZA 4OMFG 1RT5A 5HROA 3DXSX 1DRZA 4B3OA 4JI3F 4RR5A 4OYZA 4N8NA 1CS4A 3G87A 1T94A 1F5AA 2W1BA 2XSFA 3B6BA 3CNQP 4WFBQ 1VDHA 3TAMA 3VWSA 5M2PA 3A8EA 4NZ6A 1TFWA 2QA4S 5A8RB 3ZZYA 1WEYA 4K59A 3KHRA 1K73T 2AGQA 4NE9C 3PR5B 4C4WA 2YNHB 4BC7A 3A3PB 5A2QY 1F60B 3DYAA 3JSBA 5KFKA 1AB8A 3MGJA 4Y2KA 3KDNA 3GJSB 3O5TB 4IH5A 2AX1A 2DGXA 2EWHA 2QLFB 1R0AA 1RAOA 1FA0A 1UFLA 3MMBB 3QT5A 1TV6B 5DG7A 4IQXA 5K14A 4AE5A 3M9MB 2ZD1B 3RUBL 4YR0A 5L1IA 4KO0A 2CPZA 5ETOA 4DJBA 3UR0A 1N6QA 1RADB 2DHHA 4OHXA 4YQWA 1M5OC 3OFHA 5D15A 3KHHA 1UA1A 2V2QA 2OKQA 2Y0BB 1IJEB 2XBPA 3B4MA 5K8NA 4IR9A 3BBBA 4LF7F 2CJ9A 3X1LB 2JL9A 2V8VA 2BRLA 3A13A 2DNGA 1TK0A 3LP0A 2CPIA 1ACMB 2FYXA 4NRTA 3RW6A 1U25A 1YJVA 2DNQA 4LFBJ 1RCOB 1HQEB 2ROGA 3A4TA 3SCKE 4ED5A 2IFXA 2UV8A 3GU0A 4KGVB 4DX6A 2KFNA 3SZ2A 2AJ2A 2VHGA 3LUYA 2OMOA 1NNDA 2QA1A 3EPGA 3GCXP 3RB0A 1N32F 1FKOB 4DOZA 4Q8EA 1N0VC 4QR1A 4ZLPA 4G1QB 4X4SA 4LF5J 4JBCA 1S77D 4PRFA 4O44B 4QW9A 1U6FA 2ZNYA 3MEGA 4ZVHA 3UD4P 2E5LF 4NCBA 2OPSA 3W3SA 1T9XA 3G6VA 1U1OA 2HQ3A 2X51A 4IFYB 1VQPS 1ZA1B 3JTOA 2LP4A 3R5CA 1FVSA 4MIWA 4DR3F 1X4CA 2XMVA 1CG2A 1R0AB 3MMBA 4OX6A 1QLNA 3G6ES 2O1PA 1FXDA 1NSKL 5BYRA 3AXKA 5C5JA 3BZQA 3JQKA 2JFKA 1ZA2B 3P8BB 1CULA 4HT5A 4DL7A 2WOMB 1EKRA 1S57A 2RVJA 2J9DA 2UV8G 3R5JB 2ROPA 3POTB 4L75A 5AT1B 4QPXA 2VONA 4B3RJ 1IR0A 3ILIA 5HLFB 5ETNA 3W5XA 3H98A 4UUXA 2GNKA 4YFUA 4NXNF 4DWIA 1JLFB 3TAMB 1GFWB 5LXYA 1OY6A 1ZS6A 2FQQB 3LAKA 1NAQA 4R25A 4NMXA 3OHAA 4DV7F 3BO3A 2GQQA 3O8WA 3PTWA 1F9FA 5E3PA 2UUAJ 1PCAA 1EQMA 1G6BA 4DPXA 1C1BB 5J1EB 4R5PA 2AW0A 4ZCKA 4DL0C 5A8KA 3FCWA 2UXCJ 1XN9A 1FE4A 1G7CB 3LAMA 4A8KA 1CC7A 2W2MP 1NXIA 2R8IA 5K8PA 3K59A 1S4FA 4RZRA 2EKNA 1S7IA 5BYSA 5JVGQ 2QLXA 1RDRA 4YUDA 1LXJA 4IO1A 2LA4A 2ZM6F 3H7HB 2L9DA 2KKHA 2HHHJ 1B0TA 2KHDA 3M2UB 3NWRA 2JOQA 3ILOA 3KJFB 3MPYA 3IG1B 1HHSA 1R0BG 2FC9A 4YR2A 1D9FA 4JI2F 3QYYA 3T1HF 1FTRA 3GYXB 1S7HA 1ZM9A 5AJ3F 1XNRJ 1PC5A 2IBOA 1X0PA 2V8GA 4A8FA 1DTTA 4Q45A 2PI4A 2EC2A 1IR2A 1RGVA 1Z4UA 5KFUA 4ZN1A 5J1PA 2K8GA 1TVRA 4HH0A 5CAAA 1HI0P 4NLGA 4FNIA 4M5LA 2LEPA 3PW5A 4MKBA 1WG4A 4V1Ak 3OW2R 2M88A 4JYAF 3TOQA 4IQMA 2B8PA 2YBVA 3AQOA 3AODA 1TQLA 3KXDA 2ACYA 4LF8J 2MLXA 1TL3B 1WHYA 2GHVC 2HEKA 5KFXA 2CJBA 3KDOA 4EFAC 2NPFA 1RSCA 4WFNQ 2DR5A 4PQUB 1KFDA 1RBOB 1ZAWA 1WC3A 2ZBCA 3EGVA 3TVKA 5ITHA 1EIYB 4IO9Q 3OR1B 4FDFA 4B9MA 3DFEA 3QT7A 5AE1A 2VODA 5IV4A 1NK5A 1LWFA 2EFPA 2MLYA 4RW4A 2M4MA 2V4QA 1IBLF 1B3TA 1GX6A 2ZH7A 5A2QU 4DZ6A 3GFXA 3OV7A 3NMRA 4ZP6A 5B0BA 2I5JB 2ZZTA 4TNOA 4KQZA 1OY9A 3PR4A 3QFHA 4ZVQB 2LKZA 3CMQA 5KFSA 2HHTA 1URRA 2KFYA 3PY8A 4LSNB 4NWBA 4TY8A 1RHJB 4I2QA 1S1UB 4I2PA 2RDDA 4FP9A 5IM0B 2BMBA 2FTRA 2QYGA 4I68A 3W2VA 2FLNA 1WEXA 2CRLA 3CTRA 3I5BA 4A8QA 1KONA 1FDAA 1GMWA 1UEVA 5M2UA 4DV6J 1KWMA 1DURA 4NPOA 3E2EA 4P73A 4C48A 1IN0A 3EM1A 1N5TA 2OGUA 4WK3A 2DISA 5BYQA 2ILZA 5KG2A 1CJUA 2C28A 2RQMA 3Q8QB 1D8YA 2E5IA 3Q24A 1N88A 4Q2LA 3JYTA 4KGKA 3FSIA 2C2OB 1TAQA 2HNDA 1UPMB 2GZOA 1VJWA 3H20A 2A0FB 4YP3A 3G6YA 3OL8A 3BGOP 4NLOA 1REVA 2ASJA 2QMWA 2YNFA 1OY8A 3BYPA 4L74A 2QMXA 3UNYA 4JV2A 4DL4A 2ZNZA 2HHQA 3RAXA 4ZJLA 5HLFA 2FVSA 2CQBA 2BE9B 3TUIC 2CG8A 3T5KA 1YITS 3MXHP 5KG0A 2ZBRA 2HQIA 1KHWA 2CQHA 4QU7A 2FHJA 3GV7B 3Q2TC 2HAFA 1CJKB 1ZPVA 2GIFA 1T0TV 5E3AA 1SV5A 2Q79A 3C16A 4X4TA 2L9NA 1NJWA 4QWBA 1HLWA 2H5EA 3JAMU 1H3DA 4DUYJ 3DGVA 4MTPA 3M6VA 4OJ1A 1X31C 4IFYA 3NCRA 3AD8C 4UW2A 2X1FA 1FK9B 1S0VA 3HPOA 4QCLA 4OZNA 1HNXF 2WSFC 2AJ1A 1SKRA 2CZ4A 1I3OB 2WBMA 1NO8A 5IQQA 4DV2J 2O5DA 3NGSA 1LWCB 2KL8A 1DAXA 4CH1A 4J9VA 1WC1A 3KK2A 3VAFA 2FGCA 2HGNA 2HK3A 1S59A 2HQDA 1NEEA 1JLQA 2GGPA 2OPPB 2IRXA 3PFOA 5KG1A 3DU5A 3NS5A 3AQPA 3T9ZA 5JJBA 1ZBTA 3I6PA 5I4MA 2AJ0A 2W7PA 4UUWA 2QFJA 2AD9A 1U1LA 4OHYA 4LQ9A 4DPTA 1AXQA 1KP6A 2G2YA 3HM9A 3QRRA 3C3LA 1HQEA 3EUNA 3BEGB 3K2YA 2HNZB 5ETVA 4CLLA 3CVKA 3TZYA 4KSEB 1QUPA 2WRMA 2Y3YA 5DG8A 3KJNB 1UJ6A 2BKOA 2CPEA 4L76A 3TR5A 2BOAA 4ILMA 2YQ3A 2W8KA 3IFEA 4QOTA 2MQNA 1U1MA 2GS8A 2HWIA 3GE9A 4YB1P 4K4VA 3ILJA 3SQOP 5HMXA 3QJLA 1HNZJ 1XNQF 1VQ5S 5JVHQ 3HDSA 3GSIA 4C8NA 2RE1A 3WX8A 1XERA 2FHKA 5K14B 3EMTA 2MGZB 4A8XA 4X65J 3HVTA 3HLUA 2DTJA 1Q1KA 2FZCB 4TLQA 4CNYA 3DGPA 3KHLA 5DJBA 1JKHB 2K1RB 3OR2B 3H5SA 1R8BA 3SSRA 4F04B 2HG4A 3H4DA 1HD1A 4O4GB 3R27A 4JP8A 2CZ9A 3KLEB 2GFFA 1X4FA 2NREA 1XNQJ 2EFGA 1B7FA 1LNQA 2D9PA 2KVQE 5EN1A 2J0SD 2KU7A 3PEHA 1RAJA 4N7TA 3OVAA 2XC9A 3MECB 3ENAA 1U48A 1RHMB 4JOUA 3M30A 1HNXJ 2R4FA 2U2FA 5BR8J 4OX9J 1NDPA 5DZ6A 3R6LB 4F67A 3M6UA 3CJ3A 1CS4B 2DK2A 4Y6IA 5DLGA 2C2EA 2NYHA 2QLJB 3K8WA 1KTVA 2VZ9A 1RT5B 5HROB 1DQ8A 3HD1A 3MWBA 2HYIB 2C3MA 2W4PA 3AB2B 2QL5B 4Q0BB 2I0XA 4P71A 5F8GA 1HW9A 2OH2A 1WG1A 3MPUB 4XO0A 4I69A 2MZJA 2QV6A 4PG8A 2N4CA 3N79A 4ZPAA 2YXLA 4CI0B 1FWKA 4X64F 3GIJA 4DV4F 3FEXB 1X5OA 4E8UA 1N5SA 4W92B 2IVFB 4HHHA 4OV1A 2VV5A 2YNGB 1RBLA 4F0HA 3L7OA 3RB3A 2Q66A 2DKOB 3SEOA 1RUSA 4LQ3A 3PM9A 4F26A 1UCNA 3MZIA 2J6TA 2HNYA 2AX0A 1HWJA 3EVWA 1TUVA 1B0PA 2COLA 2R2SA 3EXYA 5MAOA 1Y5IB 4CH7A 3IRXA 2DNRA 3OTCA 4LRAA 4P2MA 4WPAA 4Y34A 1CLFA 3H90A 4R8UA 2ASDA 4LJMA 2AZ3A 4ZPBA 2HQGA 3I55S 2ZKUA 1UAWA 3KLIB 3GG1A 1YIJS 2BKNA 1YRXA 1AW0A 2L48A 2MZTA 2O01C 2WONB 3G82B 3MM6B 5T7LB 5G0RB 3IS9A 2F5GA 2V34A 3CIMA 5DDRC 2OP5A 3FCVA 1CJTB 3NP5A 3CMES 3BDEA 4DCPB 4I64A 3K5OA 3KNGA 3FMWA 4NLWA 4E98A 2VA3A 1HBNB 2JC1A 3R7SB 3T1YF 3QT8A 1RT7A 1YJTA 1R0CB 3HHEA 4IOBA 1RT4B 2G2ZA 4NMLA 4CTAA 3J81Y 4FZVA 2PGCA 4JI8F 3TNVA 3G4SS 3L7PA 2XYGB 2F40A 1PYSB 2HAIA 3A8IA 5THWA 4HEA9 2ZH2A 2ZJPQ 1SKSA 5F0UA 1S12A 3TZXA 1JLBB 4DS4A 2Y8YA 1JNZB 4NLRA 2HHSA 4OI1A 5D8HB 2VG7B 2E7XA 4GVBB 2FIUA 2IJFA 2IVMA 2MJNA 2OPQB 3FRYA 4R0JA 2RT3A 3OL6A 1N8RT 1K0VA 4OYAA 1NHVA 3C6UA 4LVNP 4EI2A 2YPZA 2YY3A 3I0RB 3DOLA 2LMIA 3QGHA 5KFWA 2AYBA 3FEZA 4RJVA 2HBRB 4WXWA 4WYLA 4FS1A 2C2KB 4TQRA 4HACA 2GV1A 3SQGA 4C98A 4LF8F 2E5GA 4LMZA 3L09A 1ZTTA 3C66A 2K7KA 2WSEC 2BOPA 4DLGA 2RQ4A 1W2BR 1JXVA 2IM3A 3Q8VA 3CCQS 1Y9OA 2YWHA 4NLDA 4IFVA 1ZM3A 4YY3J 1EQ0A 3I0SA 1RBAA 5KFTA 3J7A1 2IY5B 3NAHA 2FVRA 4IOAQ 3M2RA 1X8DA 2DRAA 2MKYA 4LBHA 2H48B 4PWDA 1PC4A 4CIOA 1X9MA 3CCSS 4C6AA 2GJFA 2HFNA 3TZZA 1KOHA 1ZZNA 1LW2B 3MM9A 1XNRF 4Y2AA 3T1HJ 4DQIA 4UTGA 2XCPA 2ZWPA 4P2SA 4LSZB 1YRUA 4O3PA 4EZ9A 3B54A 5LJ5Y 2CPFA 2UUTA 2XZWA 1VQ7S 3AA8A 3HSDA 1XJWB 5KFIA 4CLSA 3HO1A 1FF2A 4LBPA 1FNXH 1S9EB 4DV1J 3IR7B 3THPA 4HVZA 4ZA1A 4DV5F 4GVLA 3Q8SB 3GFZA 4JI7F 5DDPC 3ITHB 3MMJA 1H74A 1WG5A 3KUHA 1HW8A 5E3QA 5KT3A 3P5BP 1S79A 1NJZA 3OL7A 4C9DA 1YGYA 1CBKA 3JQMA 2UXCF 1HYSB 3TJ8A 4YS2A 3SV4A 2UUAF 3ZO7A 3PO5A 1HWLA 3C14A 5GAHI 1VI7A 4WE1A 1VLOA 2HWHA 4DV7J 2MJUA 3V4IA 2B56A 3GYNA 5L9XA 3FFIB 2PMWA 3ETMA 5CABA 2M8DB 4USWA 2IJNA 3ET6A 3DLBA 3V81A 1F3VA 3G71S 2ZE2A 1IBKF 2H65B 2WW4A 3PG9A 3M8RA 1TAUA 1FD8A 2CQDA 3A12A 4M5MA 2JZ5A 3JSRA 3EVOA 2HZCA 4KV8B 2LEBA 4RW6A 3BB5A 5M2RA 1JLEB 4W4MA 5L38A 3SSSA 3FGVA 1QSSA 3BPDA 2BJ8A 5E3CA 4IR1A 4KFBA 4C0BA 1OYEA 1R6VA 3UDCA 2DR8A 4U6PA 4M1KA 2CQ1A 4C3KA 4RNNA 4F4XA 2M0GB 2VFSA 1RTJB 3R6GB 2ALZA 2OELA 3TX8A 4RW6B 1X4AA 1QSLA 1RHQB 4F25A 1KKHA 1RT1B 4YEAA 2ZH6A 3RYLA 4C97A 5CYQA 4ED7A 2JRSA 1Z2LA 3VAMA 2LDIA 3UDEA 2B9WA 4I1TA 3UVJB 3FFIA 1F5CA 1DFDA 2B5JA 1Q78A 2QX0A 1UKUA 5B08A 5DGBA 2J6SA 2P6TA 4NA1A 3FUYA 4URSA 4K4YA 1DARA 1RZMA 1ULRA 1Y3JA 2RAQA 2P9EA 2IDEA 3IR5B 1JWWA 4O0IA 2CPHA 4C0HA 3D1HA 1WDDA 3HMJG 2XY5A 1WSVA 4DL6A 1S49A 5CZVA 2J0WA 3PYDA 3T41A 1XR6A 2KM8C 1Q81T 1FE0A 4WJBA 2ZVIA 2F4VF 1B4SA 1PSDA 3Q8YA 4ID5B 4K4ZA 3PW4A 1A6LA 1PYTA 4RBUA 2W2PP 4LF7J 1WKLA 3MM7A 3TQ1A 2JEJA 1CC8A 5IXUA 1PJ7A 3UNGC 4ZVUB 4DR1F 1FNOA 3LANA 1VQOS 4WTOB 5E3RA 2KVIA 1EB0A 3ISND 4A48A 1R43A 2FZGB 2PSZA 2QL7B 3CEDA 3IA0A 2GIQA 1R3NA 5A8WB 4AL7A 2KJWA 1NKEA 4KYZA 1NDLA 4Z2XA 1FJEB 4NEZA 1D0EA 2QZ8A 4PCQA 3HXMA 1FRJA 3KLGB 1LFPA 1N5VA 2PDAA 4K4WA 2CQIA 3OXGA 4P72A 1FDBA 4ETXA 1KN6A 3GJQB 5DRKA 3AHPA 3DHXA 4IFVB 2UUCF 4U7CA 1EJ7L 4DSFA 5B0EA 4ZP8A 4MFBB 4TY9A 4XDCA 2BE7D 2DH7A 4DQSA 1TK5A 1AROP 5J2PB 3PHEA 1F5BA 3E51A 2KZMA 5GAEI 2A10A 2OMLA 4OZ1A 2BJDA 3AY0A 2HS3A 3KUEA 4RBVA 2FHJD 3EDRB 1YG0A 3MFIA 3EZ5A 2XB2D 5K9FA 1VQ4S 3CXCR 2EFVA 3FBBA 3BKTA 4TXSA 1RTZA 2WBRA 3MCOA 4FPIA 2HPUA 2MXYA 3CCVS 4CO4A 4UQTA 4B3MJ 1LQ9A 1MMDA 3ZNUA 3M8PA 2IDLA 1Y00A 2J9CA 2OEKA 2VF3A 3HK2A 1JJCB 1MU2A 1P6TA 5LMUJ 1KQSR 1XMBA 5KTQA 3BV8A 5DG9A 4P6QA 2HHXA 1FESA 2EBGA 3P5TL 4UZCA 5HQLA 4CQ1A 2CVIA 4J5OA 4NCGB 3DI6A 4CLUA 1WELA 3QT6A 1U2CA 4DX8H 4CWBA 3M6WA 1IM4A 1IBMF 3BQ1A 2V8PA 2OO4A 4NLUA 4L6V3 2HKEA 1N36F 3SFUA 1SBRA 2F4FA 2KT5A 2CQ2A 4URQU 4PEOA 2IBKA 2E1CA 1GTEA 5EGYA 4RU2A 2EXUA 1PIEA 3NCQA 4ZJQA 1RTHA 5D4PA 4H54A 2W8LA 4V19X 1NU4A 1VRTB 2GAHC 2R3VA 4C8MA 1B99A 5KOXA 4MMOA 8AT1B 2Z0GA 3GWCA 4NLQA 5D4NA 4A4JA 1WOPA 3UD3P 2JH3A 1SQFA 1DQ9A 3N28A 2J6UA 3HFVA 1TUWA 4MJKA 1HPZA 4DPOA 3H42A 5FIIA 4PKDB 1T3OA 1TUGB 2ACMA 1RWKB 4CLWA 1SC1B 1YTYA 3IWLA 5HVGA 2W25A 3DCAA 1R7IA 4OYOA 2AEMA 2YNIA 1XR7A 2J7UA 2B5JB 2ZH3A 2GO8A 2V0NA 1S0OA 3UVJA 1JQGA 1NK9A 2GX8A 4F36A 5KFAA 4ED2A 2MY7A 4DR7J 5I3UB 2DIVA 1F3FA 2WB4A 4K4UA 2HVZA 2J0QD 1S6QA 2IAJA 3QAUA 2OFHX 3MURP 5KT4A 1RWWB 1P8GA 2Y8WA 2G0IA 4CZCA 4CH0S 1WC0A 1RTJA 4BWMA 2ZH1A 1MG7A 2BJ7A 3VV2B 3CCMS 3PW0A 4CO1A 1FRHA 2XI2A 2MTLA 2Y1LB 4KFBB 1D3WA 1FKPB 4FN5A 1GAOA 2FB0A 3AD9C 2VG6A 3LP1B 3UN5A 4WK1A 3ZZRA 5LMNF 3BDPA 3QPIA 4TQSA 3DMJA 1R8CA 4B9UA 5B0CA 1HNVA 3OLBA 1Q79A 1XBWA 2ZC3A 1VK8A 3GYGA 2LXIA 1AT1B 1HBMA 1RISA 4CO3A 4EK2A 3G8TA 4LF9J 4M5KA 1HNWF 4ILRA 4F50A 2FY8A 2ZBIA 1P9QC 1NK0A 5LSRA 4UY8T 2YTCA 2NSBA 2QC3A 1KDNA 1BWVA 3BKFA 3C14B 3UO0A 1J5OB 2MKSA 5DM6Q 4BWJA 2E9TA 2K06A 3HZGA 1BMQB 5ETKA 4PWUA 5F0WA 2VIHA 4OJ3A 2BQRA 4U9RA 1U2FA 2OD6A 1QVGR 3JSYA 1SC4B 3UCGA 2ADCA 2MZRA 3S8SA 2J9DE 1ZZFA 1T8EA 3TWZA 4OHVA 1WC4A 4NLYA 1TMMA 2ADBA 3N6NA 2UXDJ 2Z30B 3VTIA 4YR3A 4F4KA 4WXOA 1ZM2A 4DV0J 2QL9B 1OQ6A 3PJXA 4RX6A 4B9SA 5I3UA 3ZFVA 3LALA 2VOOA 1WNEA 1F1BB 2A6MA 1JB0C 5JMNA 2DR7A 3BGFA 2V8HA 2YNIB 4GKJF 3O3LA 5C42A 3BO4A 4WE1B 4AXIA 2NQPA 1VQSA 2GHPA 3BSAA 3KTQA 1SB6A 1SIWB 2F8HA 2HFOA 4PWDB 4ECZA 1MN9A 3M2RB 5DZ7A 5CZXA 3VAHA 2D3ZA 3I0SB 3DRXA 4JB8B 2C3OA 2MKCA 2EEYA 4Z37A 4DXLA 1EETA 1X5PA 5EWFA 1N5YB 4J91A 3BBCA 1HARA 3W5YA 4GO5X 3E01B 1VRUA 1RAFB 1VRTA 1BHNA 2KRRA 3K7RA 5GMDA 3WIVA 2JC0A 3OJSA 4PZVA 4FYWB 4NLPA 3MTJA 3MD3A 1MMLA 4ERDA 4ILLA 4F4YA 2FPHX 1SUQA 2EC0A 1WD6A 3UI3A 3MEEB 5FD1A 2OPQA 3JYTB 3I31A 2FC8A 4CO2A 2HQCA 1UWBA 2BZ2A 4N5SA 2AWZA 3QZ7A 4EBDA 3HJVA 2BABA 2KB2A 4ZP9A 1J5EF 3QO9A 4FXVA 4KY3A 4L72B 1X5TA 4D3HA 3OUYA 4NCGA 4FBUA 4HDHA 1M1KT 2YX1A 2KG0A 3QGIA 3VQTA 1OPZA 1VISA 1MU2B 3R1HA 4FVCA 5KT6A 4OFZA 3WX4A 3MR5A 4M94A 4KHRA 2WVBA 2Y0SD 1UVKA 1CJTA 1NK6A 4JV5F 1AZSB 2OTLS 3PKYA 1C0UA 1C1CA 4O23A 4I7FA 4RNHA 2CQ4A 3I0RA 2MPUA 2MKKA 4DR4F 3C6UB 1XEZA 2HVDA 2OI2A 4C3MA 1FRKA 1FDDA 2MQ8A 1K1QA 3EGNA 2VG7A 4RW4B 2RH3A 3EE3A 4K50A 3AFGA 4OHZA 4B08A 4ZPDA 5MLCV 4R8UB 1NK4A 5CH7B 2VB6A 5D4OA 3U27A 1VCTA 2DNMA 1YKWA 4O3NA 2M5YA 2W2OP 2CDQA 4ED3A 4DSKA 2M7SA 2A6OA 2J0XA 3MD1A 1RTIA 3TAPA 4DN9A 1HBNA 4NXMF 2RQKA 2ZOMA 5H9FK 1NPRA 4JUZA 4P74A 1FJ7A 1V5VA 4OYBA 5FLXY 2ZBPA 3MUTP 1TKDA 2R8KA 4CLFA 3KLGA 2QLWA 4PABA 3CULA 3HVRA 1HKAA 3IS9B 3HHLC 3SCJE 4USUA 2WONA 1NPPA 3I87A 3MM6A 1NPKA 1YJ9S 2LXUA 2R7UA 4Q0BA 3L95X 3AJDA 4DR2F 1IJFB 1KLMA 5FDLA 2J9EA 4ZCIA 5L1KA 2FLPA 1WJ9A 4XIUA 2XCAA 4C8ZA 1ITPA 2EG1A 1DY3A 4HI2A 2XM3A 1E6VA 3RB4A 4M63A 4DZDA 2OHDA 3I4HX 2ASLA 4KRWA 3R5BA 2QO3A 1UP1A 3CO9A 3R5AA 3IRXB 4TVAB 5ADZA 5KOWA 3BJYA 3VVUA 3PO4A 4WZMA 1N34F 4DPUA 2DCUB 3UCZP 3VALA 3M2UA 3HHNB 2RSQA 3C8YA 2XS2A 2JSXA 3PEJA 1JLAA 1VQLS 2UVWA 3JTPA 4OV6A 1KVKA 2VBWA 1P9YA 2VG5B 3LF0A 3IWNC 3GV8B 4CCHA 2FDNA 5D77A 3KK1B 2DPIA 4PXDA 4DX7A 2W9BA 4RBTA 3GPAA 4HTIA 1T7PA 1XC9A 1S10A 4ZPTR 3RBEA 3IM8A 4UOCA 2B4VA 5AXMA 2F1FA 3P4UB 1OJ4A 4B17A 1C1BA 4R5PB 5J1EA 1P1LA 2HWTA 3TYTA 1FFSB 1Y5NB 5DLFA 2NSCA 2WK4A 2VL1A 4S0MA 2HFUA 1R8PA 3M9OB 4DSLA 1SVDA 2NXUA 3P49B 4ED4A 5LOQA 1NB2A 3MECA 1XMOJ 4I4BA 4K4TA 3PACA 4F0KA 2XEXA 1YJUA 3IM9A 5A6PA 2DR6A 1SJ4P 4TU8A 3KLEA 5BXIA 4U67Q 3SSQA 2L41A 1K8AT 1IR1A 1QAIA 4DPWA 3D3BJ 2RDJA 3K57A 4DR5J 1D8ZA 4P10A 2E1AA 2V63A 2HSEB 2ZZMA 3MUMP 2GVDB 4H4OB 1O8BA 1S72S 1XMOF 2Q6CA 2QIFA 1KQGB 2EK1A 3R2DJ 4QWAA 2A1BA 1RI7A 3GFYA 1F2GA 1JXEA 1RWUA 1YBUA 1IKVA 3IP0A 1XMQJ 2XNQA 3V4IB 3M4XA 4CNZA 3IBFB 3DN9A 3H0PA 4O44A 3OJUA 3PX6A 4EO8A 4YOEA 5L1LA 4DUZJ 4G1QA 2AF6A 3T5HA 2MQQA 1FKOA 2DNLA 3A3NB 3QWPA 4YMEA 2Y1IA 5D78A 1X9SA 4NASA 3PIPQ 2EFNA 3CD7A 3FNNA 1VBYA 2N3LA 3HJFA 1DQAA 4EZ6A 1M1GA 4FYVB 1HR0J 3QIPA 2MDAA 4XDDA 4ICLB 1RU2A 3O6QA 4G1IA 1S9EA 3FBFA 4ZVTB 4ZPCA 3UN2A 1QD1A 5LSOA 3OTOJ 3P6YC 2FLOA 5ETMA 4ATNA 2EW9A 4OQJA 1CVJA 4ZPVR 2ATLA 2OPPA 2M8HA 3FKBA 2GGPB 1REVB 4X62J 1HIYA 3EZUA 2NXNA 3KK2B 4HR2A 4ED0A 1VBKA 3SXLA 5U47A 4CT9A 1LWCA 2OJ3A 3QRQA 2A18A 2ZC4A 1D1UA 1FI4A 4WIIA 4BCAA 2HRTA 2JJ4D 2FHOB 1GTHA 4QU6A 3EGZA 3MOZA 2NS1B 3OT9A 3CWJA 2E1PA 1RACB 4QWEA 4L3NA 1TKXB 4DR2J 3C16B 1U1KA 2J8SA 5KFOA 4TU7A 3FJ2A 4B3SJ 5LL6d 1ZM4A 2YNHA 3N6MA 2XG8A 1FX4A 2R8JA 2HHUA 3W2VB 4UQGA 3MMCB 1QAYA 1S1UA 4I2PB 2AJQA 3HF5A 1FX2A 2B6AA 1YJ7A 2GA7A 1ZOTA 3OSNA 3BO2A 1N56A 2JEFA 2CPXA 2IYIA 3IR6B 3RRGA 2KYZA 2RILA 3HT0A 2YNFB 2FJVA 1O6XA 2RRNA 4RW9B 2RD5C 4YB5A 4X4RA 2G0CA 4K0KJ 2YWGA 2XZTB
chains in the Genus database with same CATH topology
2IRUA 1NK7A 1B64A 2AYEA 2LU1A 5DQIA 1CPZA 4OI0A 1QVFR 4EGLA 5EHHA 2XY7A 5J2NB 1FDNA 3OR1A 3T6BA 3J7YI 4AL6A 1RA6A 2VBYA 2VC0A 1HBUB 4QYRA 1FO1A 5IWAF 4RUAA 3PX0A 3ZZOA 1TZ0A 1RT4A 3THTA 2DCLA 2C3PA 5IM0A 2FJAB 4I2QB 4TY8B 4IDKA 4RUCA 1VOMA 4Y3CA 5K8OA 4DF8A 2QA2A 1LFWA 5G0RA 4X4QA 2I1RA 4TLRA 3DRRA 1TKTA 5H9FJ 2RUGA 3SI8A 2VASA 1VGYA 3FCHA 2FJBB 3LP2B 1DZ5A 4ECQA 3NNAA 2BE2A 1Q8IA 5EDWA 1U1QA 3IG1A 3GMGA 4J37A 3C6TB 3J7Z5 2DJWA 2ZJRQ 1FHTA 3K5MA 1LV5A 4BC9A 2BJEA 2Q43A 2N7YA 4ZMMA 2VOPA 2VA2A 2ZVSA 2GQ2A 3H40A 3J7ZT 4Y2MA 3Q23A 3D5MA 2DGTA 2WSCC 3DC2A 4G3IA 5LT5A 3PX4A 1WF2A 1YRTA 1FNMA 4O3QA 3ZZUA 5A8KB 1UVIA 2NUHA 1H2UX 1XWLA 2I2YA 3KK3B 4TKTA 5IQ6A 5I42B 3G9CA 2C42A 3M30B 3HKZD 1RT3A 2HMIB 3CPWR 3AB4B 2YWEA 2IM0A 5B0FA 2RKIA 1FXLA 3V6DA 4NX9A 3Q0AA 2ZH8A 4KTQA 3MM5B 5HN0A 5KFQA 4FVMA 2ZFHA 5HP1A 1TKXA 4NYPA 3CJKA 4QIWD 1MROB 3TI0A 4HKQA 3KJVB 1J2VA 3CCES 2ZHAA 4RW8B 5KG7A 4J9SA 2RB7A 4J9MA 1S9FA 1AUDA 3M05A 4WF9Q 3CUNA 3B4DA 5CYJA 3ENWA 4AQYF 1KRPA 2MQPA 1HD0A 2UUWA 4YB6A 3BSNA 4ZVFA 1VQKS 3GZ7A 3M9NB 4JI0F 2IHR1 1M5PC 1C4AA 4EUVA 4NRUA 5A0YB 4F02A 4B9LA 3U02A 2CJKA 4JI1F 2QE5A 5CQGA 3QIPB 2B4PA 2W7AA 4MK8A 3N5BA 2NLWA 3I9V9 1WWHA 4RW7B 3P96A 2YKMB 4BHQA 3TAQA 2Q1LA 1WF0A 5HQ8A 2MKJA 2VUGA 3LP0B 5AXLA 2CG4A 3MF5A 1IUJA 2P9GA 5CXTA 4K4SA 1L3TA 1IKVB 1CEZA 1WTFA 2IMWP 2N3OA 1VLYA 5AE2A 4LSLB 2JWNA 3RRKA 3PVXA 5KFMA 2DNHA 4MK7A 2XS5A 4DR7F 2DB1A 4H4OA 4GC7A 4LFAF 3HK2A 4NYZA 2W4DA 5IXUA 2GJ2A 2DNKA 4DWIA 2DGQA 3GFHA 4QIFA 1FVQA 3AH6A 4A47A 4R0EA 2CPDA 1BLUA 1T02A 5KFHA 4M5DB 1N52B 1BY9A 4NLVA 1Z2ZA 2VPYB 3PIOQ 4FF1A 5IZHA 4RNOA 2CJQA 2GCFA 5A0YA 4X4VA 4V19J 1RT6A 4QR0A 4ZPWR 1OWXA 3QJJA 2IM1A 3DOKA 4CO0A 2JVRA 4Y65A 1I94F 4OJHA 2HHWA 1HFEL 4B3OB 3U1MA 2HNDB 1NHUA 1BQMA 3OVSA 4J9LA 1M90T 3T19A 2DH9A 2JDJA 4KO0B 2PN6A 3AAWB 2VD3A 2VFUA 3M2VA 1KQFB