2BANB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 subunit
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 98
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2banB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2banB03
4WE1A 2OPSA 3NBPA 4NRTA 2XCAA 2FVCA 4ZMMA 4TY8A 3MECB 3DLEB 3DLGB 1K1SA 2WCXA 1DTQA 2V0NA 2YKNA 5KG2A 5D3GA 1WNEA 4KKOA 3C6UA 1S9GA 3KLHB 1N6QA 1BQNA 1C2PA 4KB7A 4RNNA 4O44A 3LAKA 2VG7A 4IDKB 4TLRA 1EP4A 4H4MB 5CYQA 3TVKA 4ECZA 5HROB 1R0AA 1DTTA 1HPZA 2ILZA 4ECYA 3M8PB 5KT2A 4NLGA 5KFAA 4RW9A 4NLVA 1FK9B 3H2LA 3KLGB 1S0NA 2C22A 2I5JB 3DMJB 5C24B 1TKXA 4MFBB 3DI6B 2WOMA 2R8GA 2E9RX 2WB4A 5F8MA 2ZE2A 2JEIA 1HNVA 4B3OB 2XCPA 3G6YA 1JLAB 1KHVA 3D28A 5J2MB 4KFBB 1RT3A 5KG4A 1C0UB 3V81A 3H98A 4RNFA 4XO0A 5DQGA 5FDLA 3OL7A 3RAXA 2B5JA 4K4TA 4LQ9A 4RUAA 4X2BA 5KFLA 4EYHB 5DGAA 3OL9A 1RT5A 1T03A 2BRLA 3IG1A 3DLKA 4IH5A 2EC0A 3FFIB 4O4GB 2OPQA 4IG0B 4F4WA 4H54A 3UQSA 4ICLB 1RTIA 1FKOB 2UVVA 4MK7A 3MEGB 4NLDA 4ZHRB 1JLBB 4ED0A 4KHMA 3GV5B 3MEEB 4URSA 2IM2A 3KJVB 4DL3A 4KAIA 4ZPCA 3SFGA 2WONB 1QE1A 2HNDA 3JSMA 3TQ1A 2YNHB 4KBIA 2BQUA 5F8JA 1JIHA 1HNIB 2RF2B 5F8LA 5CYMA 1S0OA 3MTKA 3Q8RB 3IS9A 4Q0BB 3BSCA 5KFOA 2HMIB 3JYTA 4J9NA 1RT1A 4O3PA 1IKXA 2IC3B 4ED8A 1S6PA 3LAMA 2R2SA 1S49A 5J2PB 1SH2A 3ITHA 4LSNB 4JV0A 2DPJA 4O3SA 5KFCA 1S1WA 5HBMB 2WK4A 3CJ3A 3MF5A 3DRSA 4LSLB 1LW0A 3HHKA 1JLCB 1FKPB 2AX1A 3OL8A 4U7CA 4ECQA 2UVRA 1IKWA 3MFHA 2AGPA 3C6TA 3V6KA 3TAMB 4NCGA 4ECRA 3CJ4A 1LWCA 2B6AA 4KV8B 1XR7A 2UUWA 5T14A 1C1BA 4ZP7A 5EWFA 1ZTWA 1MU2B 4Y3CA 1RT6A 2WHOA 4IG3B 4J9SA 5KG1A 2HNZA 3ISNC 5J2QB 3KLIB 5L1KA 4U6PA 2OPPB 2HNYA 1RT4A 1REVB 3KLEA 4DL2A 2BRKA 5L1LA 2V4RA 3H5SA 1CSJA 1N4LA 3IRXA 5KFWA 5C42A 2ZD1A 2W9CA 1RTDB 3D5MA 4K4WA 3DRPA 2IM3A 3NKYA 3KK2B 4IRDA 4NLPA 4WYLA 4G1QB 2ZKUA 3H5UA 1SUQA 3VQSA 2QV6A 1T3NA 5J2NA 2D3ZA 5KG3A 3E01A 4ID5B 4QPXA 1TKTA 3QZ8A 3MFIA 4J9OA 1VRTA 4NLYA 4I2PB 5KFEA 3KMSA 3MECA 3LP1B 3G86A 4F4XA 3CJ0A 2VG6B 3DLGA 1TL1A 4QW9A 2FLLA 1HQUB 2YNIB 4YMEA 3PVXA 1JXLA 4RNMA 4ECWA 1HMVB 2J6TA 1NHUA 5KFTA 2E9TA 3QZ7A 1C1CB 1T05B 4QWDA 3V6HA 1VRUA 4WZQA 4H4MA 3KMQA 4TN2A 1S9EB 5HROA 3QGHA 4EBCA 3M8PA 5HLFB 1RT2B 3GIKA 2UUTA 4K4YA 4O3OA 3IGNA 4QWBA 3N6LA 2I5JA 1UWBA 1J5OA 2IM0A 3H59A 4MFBA 3DI6A 2GC8A 4Q43A 3V6DB 1GX6A 2E9ZA 1RT7B 4J9MA 4DL4A 2R2UA 4KFBA 4M94A 2BANB 4ZP6A 5JXSA 4YQWA 3GIMA 3I5BA 4KHRA 4DG1B 5KT5A 1TVRA 4WXWA 3I0RA 4IFYB 3MR2A 4ECVA 1IKYB 3QO9A 1HYSB 4QWCA 5KFNA 4R8UB 4O4GA 1LWEB 5DQHA 4RW4B 5I3UB 4TXSA 4EYIB 4IG0A 5HP1B 2VA3A 2WTFA 4ICLA 4I7FB 1JLEB 3V4IB 1FKOA 5J1EA 4ED3A 3MEGA 3QYYA 5DGBA 1KLMA 1JLBA 1S1UB 3DOKB 4RW7B 4Y2CA 3MR3A 4TYBA 2YNFB 3MEEA 3V6JA 5F8GA 5KFZA 1S0MA 4ED2A 4IQXA 1D1UA 3EZUA 4EBEA 4K50A 3BSNA 5KFFA 4J9QA 1S9FA 3RB6A 1LW2B 2YNHA 4RW8B 5EUHA 5KFBA 5KFIA 3NGDA 4MH8A 1HNIA 1TKZB 2OPRB 3CJ5A 3FQLA 3PR4A 3M9NB 2J6UA 3KLFB 2JC0A 1S1VB 1K1QA 4K4SA 1TV6A 3KK1B 3LP2A 4RZRA 5K14A 1DLOB 3DRRB 3OHBA 2HMIA 4RW6B 3BSAA 4YP3A 5KFQA 3Q8PB 3MR5A 1RTJA 4F4ZA 3UR0A 4NZ0A 2FJWA 5J2PA 4GC7A 3KNAA 4TY8B 2ALZA 3BGRB 4LSNA 2RDJA 2ASJA 4O3RA 1SV5A 1DTQB 5HBMA 3UDLA 2W8LA 4KKOB 4LSLA 3NAHA 4URGA 1N6QB 1FKPA 5I42B 4ECXA 2YNGB 4JV2A 4O44B 1D0EA 1JLFB 4IFVA 4O4RA 3HVWA 4I2QB 4JV1A 1EP4B 2R8HA 4KV8A 2W7PA 1DTTB 1IKVA 5KFJA 3KHRA 1MU2A 3CO9A 4K4VA 4PWDB 4IG3A 1HQEB 1QUVA 4RW9B 1MMLA 3QLHB 2VG5B 4G3IA 3EPIA 1NHVA 4Q45A 1TL3A 1ZTTA 2OPPA 1RYSA 3CWJA 2RKIB 1C0TA 4O3NA 2XI2A 4IRKA 2HAIA 5L9XA 3DOLB 1N56A 5F9NA 1RT3B 3V81B 4IOBA 4JUZA 3GIIA 2BQ3A 2R8KA 5FDLB 5F8IA 3FSIA 1RTDA 3DYAB 1BQMA 3KK2A 5C5JA 4F4YA 4G1QA 2D3UA 4NLWA 2FVRA 1RT5B 1T03B 3E51A 3IG1B 3DLKB 5DQIA 4WXOA 4ZPDA 4NLUA 3LP0B 2R2RA 4ID5A 4MKBA 1QAJA 2IJNA 4NRUA 2BE2A 1OS5A 2O5DA 3RB0A 2ASDA 2IBKA 5KFKA 3QGGA 3GILA 4ECUA 4DL7A 4I2PA 3M9MB 2AWZA 3LP1A 5C25A 4WYWA 4ED7A 1HQUA 5EWEA 2HWIA 3RB4A 2V4QA 4TY9A 1S97A 1S10A 1N5YA 4TYAA 2QE5A 1S1TB 2RDIA 1RTHB 1HMVA 4IKAA 2XI3A 5DG8A 4MIBA 4RUCA 1JKHB 2HNDB 3LANA 3JSMB 4NLQA 4FS1A 1C1CA 4R5PB 4EO6A 2V9WA 5KFYA 3PW7A 4PQUB 1S9EA 3FRZA 4J9PA 5KFMA 4KSEB 5HLFA 4DL5A 3H5XA 3MEDA 4WFYA 3NMAA 3IS9B 3GQCA 2YKMB 3V6DA 4O3QA 5KFRA 1RT1B 3DLEA 1IKXB 1RT7A 3OSNA 3H4BA 4IR1A 1S6PB 4QWAA 5KT7A 2XC9A 2GIRA 4IH7A 5KT3A 4WFZA 4HKQA 4Y34A 2BANA 2FVPA 5KG0A 3ITHB 1S4FA 3RB3A 3BREA 4Q44A 1RDRA 2VA2A 4FBTA 3KLHA 3LALA 3PW5A 1S1WB 3FQKA 2FJXA 4IFYA 3PJWA 2B43A 4NLTA 3SFUA 1JX4A 2JLEA 4DEZA 4IDKA 4ZP9A 4R8UA 2XGQA 4RW4A 5I3UA 2I1RA 1IKWB 5HP1A 2D41A 3CIZA 1JLGB 3QIPB 4F50A 4NCGB 1JLEA 4KO0B 3H4DA 1XR5A 3M8QB 5KFDA 4ECSA 1C1BB 1I6JA 3I0SB 3OL6A 4YR0A 2JEFA 1FK9A 3KLGA 5KFUA 3DMJA 1RT6B 1S1UA 4RW7A 5C24A 3Q8SB 1YVFA 4EO8A 3T5HA 2BQRA 2YNFA 1LWFB 3OLBA 3T5KA 4B3OA 1JLAA 3KHLA 1IM4A 3PZPA 1RT4B 5J2MA 2IM1A 4ECTA 5EDWA 1C0UA 2UVUA 1S6QB 1LW2A 1TQLA 1S48A 5KT6A 1SH3A 4NYZA 2JC1A 4K4XA 4FS2A 4XPCA 1TKZA 3G6VA 2OPRA 3NL0A 3IRXB 4ZPAA 2ZD1B 3KLFA 4RNHA 1S1VA 3DRPB 3PW2A 3FFIA 2FLNA 1SH0A 3KK1A 3GIJA 3IN5A 3H40A 3RAQA 4XPEA 1SUQB 4QWEA 4RW6A 5J2NB 2IAJB 1RAJA 1ZETA 3CDEA 1TKTB 4ZHRA 4MKAA 4ZVFA 3OHAA 1VRTB 4WZMA 3DDKA 3T1AA 5KG7A 4J9LA 3BGRA 4MIAA 4DL6A 3DM2B 3T5JA 1EETB 1TL1B 5F8HA 4H4OB 3H5YA 3KJVA 1TP7A 2C2DA 1HARA 2WONA 4TQRA 1S1XB 5I42A 2YNGA 5DLFA 3CDUA 3HVTB 3EPGA 2RF2A 2FJVA 1JLFA 3UPFA 1JLQB 2W9BB 4I2QA 1VRUB 4URQU 3KK3B 4ZVHA 4Q0BA 4PUOB 2R2TA 4PWDA 1HQEA 3QLHA 1XR6A 2IC3A 2CJQA 2VG5A 2OPSB 4WE1B 1UWBB 1J5OB 3GYNA 3NBPB 1GX5A 5DG7A 2RKIA 3CVKA 3N6MA 4IR9A 3IGVA 2W8KA 3DOLA 1RA7A 5KFXA 3GV8B 3I5CA 2ATLA 3KHGA 2YKNB 4FBUA 2BR0A 5D3GB 5F9LA 3C6UB 1S9GB 1JLCA 1BQNB 3I5AA 3DYAA 1TVRB 3M9OB 1RA6A 4J9KA 3I0RB 3QO9B 5L1JA 2VG7B 1NNDA 3TAMA 2W7OA 3KHHA 5CYQB 3LP0A 4J9RA 4EEYA 1R0AB 1HPZB 4EBDA 5J1EB 2JEGA 4Q8EA 2F8EX 4MK9A 1KLMB 5J2QA 3KLIA 1TKXB 4R0EA 2WOMB 4YR3A 2ZE2B 1HNVB 1REVA 4ZPBA 3CDWA 2ASLA 1S1TA 1RTHA 3N6NA 4ZVGA 5KFPA 4TQSA 1JKHA 4R5PA 2B5JB 2D7SA 5KG6A 3BQ0A 3ISND 2R8IA 2FLPA 4PQUA 4NLXA 4YR2A 4GC6A 4K4UA 5KT4A 1RYRA 2IA6A 1TV6B 2FVSA 2OPQB 3LP2B 4MK8A 5K14B 5DLGA 3QGIA 4KE5A 4IRCA 1RTIB 2YKMA 3KLVA 1RTJB 3BJYA 3BQ2A 4HYKA 2C2RA 2R8JA 3G6XA 3NAIA 2VG6A 2FVQA 4ED6A 2C2EA 2YNIA 2W9AA 1SV5B 3OSPA 3T5LA 3BSOA 3PJXA 2C28A 1N48A 2GIQA 1QE1B 3PW0A 2JEJA 4NLOA 1T05A 2HWHA 5KFVA 4IFVB 1JLGA 2ILYA 3QIPA 5CYMB 3OLAA 4KO0A 1RT2A 3M8QA 3I0SA 4NLSA 5KFSA 1IKVB 4OL8A 3HKWA 4RNOA 2CKWA 4K4ZA 3FDSA 3PHEA 4NLRA 3JYTB 1LWFA 2XGPA 1TL3B 1C0TB 3RBEA 1S6QA 4ED1A 4DG1A 5KFHA 3DRSB 3ICLA 1LW0B 1IKYA 1HYSA 3PR5B 4Q8FA 2XWYA 1BQMB 1LWEA 5JUMA 4RU9A 4ZP8A 1Z4UA 2J6SA 3SI8A 2UVWA 3C6TB 2AX0A 4I7FA 5KFGA 3V4IA 1LWCB 2B6AB 2AQ4A 2IAJA 4QW8A 5F8NA 2BE2B 2AGOA 1U09A 3BR9A 3DOKA 2IJFA 5KG5A 1KHWA 3DM2A 2HNZB 5C25B 3HVAA 1EETA 2DPIA 4ZVEA 4H4OA 2HNYB 3Q8QB 3KLEB 1T94A 3RBDA 1N5YB 3T19A 4IH6A 1W25A 1S1XA 4RW8A 3BQ1A 2AU0A 3KOAA 3MR6A 2WRMA 3HVTA 2OH2A 5L1IA 3PW4A 4WFXA 1JLQA 5C42B 2W9BA 3CJ2A 2W9CB 3QIDA 3KK3A 3GV7B 4LQ3A 1QAIA 4M95A 4PUOA 4Y2AA 2IMWP 1DLOA 3DRRA 3MEDB 5DG9A 2AGQA 5EWGA 3E01B
chains in the Genus database with same CATH superfamily
1FXRA 1XERA 4P74A 1JNRB 2XNRA 1FE0A 3Q8UA 2KYXA 2A3JA 1DTQA 2DD8S 4FKYA 1FJCA 3C6UA 2MGZA 2VB6A 4O44A 2RVJA 3GJRB 1DTTA 1YJUA 4LR8A 3GYGA 2JEIA 4OZNA 2HW3A 4JI1F 2HRYA 3V81A 2HHSA 4CLYA 3TVZA 2EC0A 5A76A 3ET6A 3UN5A 2RD5C 3RR7A 4KHMA 3GV5B 3MEEB 2WAQD 4URSA 4UY8T 3DGPA 1UVLA 1WC3A 1HNIB 5DJBA 4F3OA 3EM1A 1U6ZA 4FP9A 2OTLS 3GR0A 1YX2A 3JSBA 1RT1A 1L3TA 3LAMA 1U4BA 2L41A 3MF5A 3PYFA 1TL7A 2UUCF 4OI4A 4A8MP 4IG3B 1X60A 2HNYA 2ZUAA 2BRKA 3JQMA 1ULRA 3H5SA 3IRXA 1AXQA 2RMLA 1LK5A 1EARA 3N0VA 3CJTA 5ETRA 1F0XA 1U25A 2YWHA 3QPIA 3NOGA 3PVXA 3PYDA 2OHDA 5B08A 1C1CB 3KMQA 4O3OA 1C4AA 1UPPA 1RT7B 4HEA9 5JMNA 1HW9A 1OYEA 4RWWA 5FD1A 2XMVA 3UO0A 3FVYA 3CNQP 2EG2A 1JLBA 1S1UB 4RW7B 1A7GE 2DNPA 5HVFA 2F4VJ 3QATA 4K50A 4J91A 3DLHA 2F65A 2QO3A 1GH8A 1VIXA 3J81U 1N34F 2HMIA 2RQ4A 4JI0F 3Q8PB 1U1QA 1RHJB 1VQLS 3J81j 1B7FA 2M8HA 1DTQB 4K0KJ 2C42A 2W8LA 2MGZB 4O44B 4PPDA 4O4RA 1DTTB 3MM9A 1H2TZ 1NHVA 2OPPA 3CWJA 2HQCA 2HAIA 3CCUS 3V81B 2GHPA 2BQ3A 4DV4J 1MMNA 2NZCA 1BQMA 4G1QA 2FB0A 1D9AA 3RB0A 4HT5A 2O5DA 2LU1A 4OX9J 2NQPA 2OD6A 1WDDA 4U67Q 3KXDA 4TY9A 4F2RA 1IN0A 2HIQA 2IBOA 4PZVA 3VGUA 3ZZYA 2IY5B 2CVIA 1RT1B 3W1YC 2W4DA 1O8BA 1KQSR 3RU0A 1LEOA 1TL7B 1UVMA 1K0VA 4F50A 1S76D 1FK9A 3VWSA 2BQRA 1YJ9S 2DNHA 1LWFB 2HFUA 2HFZA 5G0RA 2W01A 4LBHA 1S6QB 1TQLA 2ZZNA 5H9EK 3MD1A 2A2DA 3IRXB 4ZPAA 1NPPA 3RG6A 1OY8A 3LWLA 2E5LJ 3A8EA 3DDKA 4NI2A 5LJ3Y 2WONA 2LCWA 1IUJA 2XNQA 3CDUA 2F8MA 4I2QA 3F41A 1U1NA 5E5NA 2I38A 4L72B 4Y00A 3NBPB 2BV3A 4LVOP 4IR9A 3IGVA 1PG5B 2ZWOA 5D3GB 4KHPJ 4BS2A 2DR6A 2ZM6F 4EEYA 4ANDA 2J9CA 3HI9A 1S1TA 2F9DA 2V5HG 4P2MA 5KG6A 3BQ0A 3KG1A 4KRWA 2DT9A 4PXCA 1RHUB 4P7TA 2FVSA 5GAEI 4MK8A 4AL6A 5DLGA 4IOCQ 3O6QA 4HYKA 2R8JA 2CFXA 4ZIWA 4ED6A 2GIQA 1CG2A 1R8CA 4X64J 5KFVA 5DM6Q 2ILYA 3CCWA 3N9UC 2CKWA 3MM9B 3GFXA 2FQQB 2K1RA 1NSAA 4EK2A 1FWLA 3CJ8A 3CCRS 2KM8B 5IT9Y 1FE4A 2BYCA 1HYSA 1F9FA 2A0FB 1BQMB 2J6SA 4WIIA 1TAUA 4I7FA 4NXNJ 2HAFA 1U09A 4NA1A 2DNZA 2G1HA 3S8SA 5K8PA 4PKDB 2PD1A 3NGRA 1JLQA 4LQ3A 2X1GA 2V8GA 1NKBA 4UTGA 2V0NA 3R3TA 2DIVA 4FF2A 2DH7A 1IR1A 1H7XA 3FEYB 4ZVPB 1EP4A 1M5KC 3VTIA 3NCRA 1FK9B 4QJVA 5F8MA 2JRSA 3N5BA 1UWAA 2BMBA 1UFWA 2NSCA 4EYHB 2HQIA 2YPZA 2MJUA 1R8PA 1FKOB 4MK7A 1FRLA 2DNOA 5IV4A 2NS1B 3G9CA 1HL6A 3SFGA 2WONB 3TQ1A 2Q79A 4HI2A 2ERRA 1JIHA 1TELA 1H7WA 3MM6B 3CJRA 3SSQA 1X4DA 3NCPA 2ZH2A 1VQ8S 2IVFB 3DN9A 4LSNB 1Q53A 5HBMB 4LSLB 1LW0A 1VS3A 4IO1A 4K8RA 4DQSA 3ZTOA 4USMA 4F3MA 3W63A 3M8WA 2MJNA 4USKA 2MSSA 1RTDB 2GAHC 1F2GA 3ZXWA 3VQSA 2EFGA 3MECA 1SJQA 2P9CA 2GAGC 2LXUA 4I6YA 4P2SA 2DK2A 4FNIA 3UCGA 2VONA 2MXYA 1UWBA 3VGTA 3V6DB 2CAJA 4J9MA 1U0SA 4MYUA 1U1MA 1HYSB 1V3SA 2ZEJA 4I7FB 4JI6F 5DGBA 4TLQA 2LQ8A 4U8VA 3V4MA 4NEYA 2CQHA 2XS2A 4RL1A 1X4AA 2DGQA 1FEEA 4P71A 3M9NB 5K14A 1U8WA 5CZVA 3Q8VA 1SV5A 3Q83A 4NX9A 2BKOA 4Y65A 2MHNA 3RZAA 1EP4B 1IKVA 1WG4A 2AHOB 2RJZA 3O1LA 1MMLA 4W4MA 2RQMA 4NA2A 3AOBA 4O3NA 3OQ2A 5I4MA 4B3SJ 2D3UA 3MCOA 2KZZA 4MKBA 1L3KA 3PRBA 3M9MB 3BBFA 5C25A 2L3MA 1N5YA 2VUGA 2J7UA 1TUGB 1OPZA 4FS1A 4C8YA 3IBWA 4J9PA 1A6LA 1U49A 4OYBA 3AD9C 5HMXA 2KHCA 4LIWA 2FHMA 1GXLA 2GIRA 1VQYA 4IH7A 5AE3A 1RAAB 2XMWA 2E5JA 3KLHA 1JQGA 3LALA 3GFHA 1Q86T 2HQGA 3PJWA 4IDKA 3HO1A 3R7BB 1I6JA 2G4BA 3OL6A 1JLAA 4ECTA 3DGVA 2UVUA 3K58A 2R7SA 1SKWA 3MAQA 3S6EA 3W7BA 2CG4A 4HH0A 4MKAA 2NUUG 1CJTB 1HARA 2IMOA 1RHQB 1JLFA 4PUOB 3CDAA 1HQEA 4S0MA 3QLHA 1UWBB 3CVKA 4K59A 3MUTP 3G4SS 3DOLA 4MKVA 2VODA 4ZVTB 2HGNA 4JI8F 1V5VA 3IWXA 3VZIA 4DN9A 3RW7A 3KLIA 2BACA 3CDWA 2PMZD 4RLEA 3HZEA 1Y00A 2APOA 1PO6A 1XEZA 1WEYA 4Y2MA 2D3O1 5K14B 4KE5A 1RTIB 4TKTA 1VBYA 3BQ2A 5HJXA 2BEFA 2XULA 3CCSS 1SV5B 1IWGA 1YBUA 3F56A 1KVJA 1IKVB 1H0HB 4DG1A 3N79A 3ICLA 2P8IA 3OTOF 2UVWA 1X4EA 1E6VA 4F0MA 2AYEA 2IAJA 4JB8B 2KVIA 2E1CA 4BWMA 5C25B 1R3NA 1N5YB 3T19A 2YH0A 2W9CB 5MAOA 1R6YA 1Q16B 5HMZA 1AUDA 2WCXA 4HVZA 3ZZRA 4DXLA 3KLHB 2HBQB 1H2UX 4Y2KA 1AB8A 4IDKB 5DDPC 4DBQA 1ITPA 3EGWB 1B3TA 3P49B 4FYVB 4DL0C 2HQDA 1S6OA 5B0FA 4B17A 4F0HA 1JLAB 3D28A 3H2UB 5GVQA 4GO7X 1RT5A 3EDQB 2V9KA 4KJIA 2ROPA 4OJ3A 3MEGB 3VQTA 2IYGA 5HVGA 3K8VA 1WKLA 1GNKA 5D78A 2ZH3A 3G71S 4DV6F 1RAHB 4M5IA 3CMQA 3L3CA 2CWXA 4CO5A 1TZ0A 4FPIA 4N77A 2Z2LA 4BCAA 2RIJA 1IKXA 5M2RA 1SH2A 1TL5A 2G0JA 2D74B 3L7UA 2FZKB 2R7VA 5IV3A 5L8RC 4ECQA 5T14A 4ZP7A 4ZIVA 3HHLB 1Q0NA 4YDXA 4IUFA 3KLIB 4FF4A 2YKOA 4OYXA 1NSKL 2B9XA 1CSJA 3UR3C 1DHMA 2IM3A 3CMAS 2VU5A 1OPIA 4FNHA 2QV6A 3LQVA 5IQ6A 2DXDA 1F2HA 4NLYA 2NYHA 4KIAA 2W2PP 3G86A 1SC1B 2MQ8A 1R7IA 2BJ1A 2E9TA 1PGZA 1G6BA 1VRUA 1D3WA 4KH0B 1B0PA 1LXNA 2A6MA 2I8EA 4G1IA 1EAYC 3IWLA 4NOHA 4ZP6A 3LUYA 4DG1B 2IYIA 4HHHA 3HSDA 1D8YA 3GSDA 4G1PA 1PAUB 3TJAA 3KUEA 3V6JA 3FZ2A 4LFAF 5KFBA 3SV3A 3I32A 2Q6BA 3BGOP 2OPRB 3FQLA 2DIUA 1QJHA 4NMLA 1TV6A 4Y6IA 1N0UA 4DFKA 3OHBA 3BSAA 1WEZA 5J2PA 3VV2B 3SV4A 2DR7A 2DHSA 2ATCB 2B51A 5AXLA 2ZVIA 5I42B 4JV2A 1HBUA 3SBMA 1L3SA 3BDPA 3MPUB 5KFJA 1MU2A 3EPIA 1TL3A 2LQ9A 2RKIB 4GRSA 5L9XA 1J2VA 4P9SA 4DUTA 5H9FJ 2Z2ZA 4F4YA 1VR6A 3EXCX 1RT5B 4DR1F 4B3TF 3BPSP 4QOTA 4M1KA 5CD4A 2HWIA 2BKPA 4UQGA 1S10A 4DMZA 2RDIA 2F3JA 3MMCA 3LANA 4EO6A 3PW7A 1OQ3A 5I3PA 4DL5A 4CLWA 3PG9A 1FRKA 1IKXB 1M5PC 5LT5A 5KT3A 5EGYA 3ENQA 3P5TL 3P6YC 1H3DA 4NLTA 3K5OA 4GO5X 1S57A 5U47A 2I1RA 5HSPA 3OTCA 1S48A 3CCLS 2W2NP 3HJVA 3W9HA 4DV1J 1F5CA 3FC9A 2COLA 2W4CA 5HO4A 1BY9A 4RKUC 1P6TA 1VRUB 1QVGR 2B4VA 2L9NA 2Y3YA 5DG7A 2LEBA 3RRGA 3HHLD 2ZWPA 2BOAA 4CO2A 1BGXT 2R9LA 1RLDA 4DV2J 4X4PA 2V8HA 1WKJA 2W7OA 2W7AA 3SEOA 3WC0A 1M5HA 1NO8A 4AQYJ 2QLWA 3F44A 4TQSA 1TTHB 2DR5A 2FLPA 4NLXA 4C11A 3W2WB 4LRAA 1TV6B 5D4LA 2XMJA 2W2OP 2HRTA 4QR1A 1Y5NB 3AOAA 4OX7A 2OJ3A 1SC6A 3MAAA 1M5OC 4ELUA 3HD2A 3QIPA 4NEZA 3M8QA 2NZ4A 4PWWA 2WVFA 1TL3B 2KI2A 1LKZA 2BZ2A 4DN0A 1G4CA 5CYJA 1LWEA 3RRKA 3R97A 4DPUA 3CJSA 5HQ8A 1BLUA 4X62J 1FJGF 2HBZB 4C0OC 2HLTA 4WU3A 1G2EA 2H4YB 2A10A 4B9TA 4OMFG 3I9V9 1NK7A 2CA9A 2KTQA 1DZ5A 2RNEA 5IXUA 1N5TA 3POTA 4LF8J 1P9QC 3DLLQ 4UW2A 2AD9A 2CG8A 1BHNA 2CWKA 1EZZB 1S72S 5CAAA 2R7TA 4LBPA 2WOMA 3T1YJ 2R8GA 2BJ3A 1RXOB 1AFJA 3NXZA 5KG4A 4RNFA 1GK8A 3EVOA 1BQXA 3ZZ0A 4ILMA 3QJLA 4OZ1A 4ICLB 5BXIA 4A47A 2XMMA 2WSCC 4ED0A 2YXLA 1XNRJ 3K17A 2IRUA 2HNDA 2O67A 3Q24A 2ADCA 2OSQA 1LNQA 3RAMA 1S6PA 1S49A 2NYIA 3D3CJ 2IDLA 1V3RA 3SSSA 3J7Z5 1FKPB 2GCFA 1VI7A 1LXJA 8RUCA 4NCGA 2DRDA 3C2PA 2ZJQQ 4ZA1A 5KG1A 4WK1A 4HH1A 3K7RA 3M32B 4E2FB 2H9ZA 1VQMS 4I2PB 1WJ9A 1HMVB 2G1DA 3MR7A 1FNXH 3MAAB 5DDQC 4H4MA 2AT1B 3RBXA 5HROA 2QA2A 4QWBA 1X5SA 1EJ7L 1X9MA 2B9WA 2XYHB 4OZJA 4QWCA 4R8UB 1LWEB 5I3UB 3EE3A 4IG0A 2HURA 3HFKA 4I67A 2RT3A 5J1PA 1RAEB 4YB5A 4ED2A 3A12A 2BDPA 5IQQA 2MQMA 3RB6A 1YRXA 5K20B 3CJ5A 5A2QY 2MQNA 1QSSA 4RZRA 4K5SA 3MR5A 2MY7A 1UFLA 1WOOA 3OTBA 2P6SA 3VZHA 3LO3A 1CJUA 2FJBB 2FJEB 2EC2A 3GB0A 3SQOP 2CQ3A 2JWNA 3CO9A 4CH0S 1YIJS 5ETOA 3H90A 5KOXA 2P6TA 4DOZA 1MSWD 3TNVA 3GPAA 4NLWA 4USWA 4ECUA 2AWZA 3LP1A 2J7KA 3JSRA 1T3OA 1K73T 2ZZTA 5FLXU 2HNDB 4HDHA 3AB2B 4QQBA 4PQUB 3MUMP 5I3QA 2UXCJ 3IAS9 1HQ2A 1F5BA 3PTWA 4IR1A 1CS4A 1S6PB 4USJC 3ZNJ1 1UEVA 3PCOB 4E8UA 1KLNA 2PI4A 3M6WA 4NE9C 2IRXA 4KGKA 4NCGB 3US5A 2CQ1A 3BO3A 2MEWA 2QFIA 4I4BA 4ZOSA 3W9JA 2ZH6A 3NS6A 1VBKA 5J2MA 4ZITA 3O3LA 4YY3F 2K7KA 2VKRA 1OO0B 4HTJA 4MJKA 1S1VA 2O66A 4ES2A 4C0HA 3CXCR 3AJDA 3T5JA 1BXNA 3UD3P 1TP7A 3TX8A 3CULA 2OFHX 1RAIB 1T9XA 3PYEA 4ZLPA 4I69A 1PC4A 2ACYA 2QYCA 3M2VA 1Y11A 3GYNA 6FD1A 4DR6J 3N6MA 3AFGA 3GR1A 2JNJA 2YX1A 1VK3A 2CZ9A 3RW6A 3HHDA 5L1JA 2VF3A 1G1XA 3I96A 2UU9F 4X84A 1T95A 4MK9A 3D0GE 1REVA 5F0WA 3N6NA 2WBMA 2QZ8A 3GJSB 2VJUA 3QGIA 1YJRA 2CZ4A 1NSPA 2G0CA 4B3MF 3EUNA 4NXMJ 1DJ0A 3PW0A 3HF5A 4R25A 1CJUB 2P2CB 3J7YI 4OYAA 1NUEA 2EKYA 2GQQA 4ANCA 1AUSL 4U96A 1X5PA 2X1AA 3J80Y 3TAPA 3D6MB 2HSEB 4HI1A 3C6TB 2GGPA 2X3GA 3D6TB 3MM5B 3EZ5A 2VKZG 4F4KA 4H4OA 3IP0A 5JJBA 3LTOA 1V6HA 4IH6A 4C3LA 1ZM2A 2WRMA 2DITA 1FDBA 2KO1A 3AXKA 5HQMA 2MYFA 1DQ9A 1WSVA 3JQJA 3THVA 2AGQA 5GAGU 3Q8YA 4BHQA 1WNEA 3D1QA 1RK8A 4PRFA 4NCBA 1F5AA 2DCLA 3CTRA 3B4MA 3FEZA 1W7WA 3GLJA 3M8PB 4NLGA 1S99A 2EFPA 3H2LA 3TYTA 1Y5IB 2RQCA 2DRBA 2XCPA 5B0AA 3QFWA 5J2MB 2CQ2A 3EVMA 5FDLA 4OHXA 2OEJA 1PSDA 4DCJB 1FWKA 5DGAA 3IG1A 1WF0A 1Q8BA 3P4UB 3OFGA 2KHDA 2M5YA 3OD2A 3IBCB 3FNNA 2JLFA 2DGSA 3Q8RB 3BGLA 3I82A 4UY85 1BWEA 2O1PA 1QTMA 2PA8D 3HHKA 2HBYB 1X5TA 3MFHA 3UW1A 2B6AA 1GMWA 1RT4A 2H51B 1REVB 3KLEA 3NGSA 1RWOB 3KUGA 2BOPA 2F4VF 4PQAA 2VFUA 2KXNB 3HJFA 1ZZNA 5BYRA 1GTHA 2MZQA 1JXLA 2C3PA 5HL7Q 4R0JA 3M8RA 4QWDA 2CJYB 4K0KF 3OXFA 2DY1A 4K4YA 2UUTA 1F1BB 2NXUA 2ZC3A 1NJXA 3QNWB 2R2UA 4M94A 1XJWB 5JXSA 4KGVB 1WI6A 1VQNS 4IFYB 4ECVA 1PJ7A 4QR2A 4F67A 4O4GA 3MURP 2ZBCA 4DV4F 2GGPB 4DR2J 1PIEA 1MROB 2ZNYA 4PEOA 1SIZA 3W8GA 2J0WA 2QJ3A 1ACMB 4OX9F 4BC9A 2OMOA 4OX8A 4MH8A 2J6UA 3KLFB 4ETXA 4K4SA 1N54B 4M5DA 1UVKA 4ZKAA 1WWHA 1AW0A 2Y0SD 1NKEA 2ASJA 2DNGA 3K2YA 1JB0C 3FEXB 2Q3PA 3QT8A 3JTOA 2ZH8A 1QAYA 4NYPA 1H98A 2GVDB 1N56A 5FDLB 2XBPA 2U2FA 5HK4A 3FSIA 1SL2A 3IG1B 1W2BR 4NLUA 3LP0B 3PRVA 1WHWA 3K5LA 1TMMA 4WYWA 2E5LF 4ED7A 4ED4A 3BBCA 3FMWA 4TYAA 4ZLLA 2XI3A 3CD6S 2YX4A 3K89A 4NZ7A 1T9UA 2J9DE 4EU0A 1ZPVA 2YKMB 3AY0A 1DURA 1NAQA 1BUXA 1T7PA 3BREA 1REGX 3H8YA 3BYRA 2RRAA 1S5ZA 3CIZA 4KHPF 2XY6A 1QSLA 2MQOA 1MMDA 4JI3J 2G2OA 3FJ2A 1RT4B 1D9FA 1YJNS 5H1SV 2CXEA 1TKZA 5M2PA 2V4JA 5D77A 5CABA 3QRRA 1GTEA 1KBRA 2GVZA 1JXEA 3QBCA 3G82B 3EPGA 1T9YA 2XMUA 3L9ZA 1EQMA 1YJWS 2BKNA 3PX6A 4X64F 2CJQA 3ZTRA 1GX5A 3P5BP 1RA7A 2HHQA 2XY7A 3KHGA 5F9LA 3C14A 3DYAA 2R7WA 1VCTA 1BE4A 2JEGA 2B56A 5J2QA 4YR3A 5ETTA 1HNVB 4M5KA 2Z56B 4ZVGA 1UW4A 4QIVA 3VCDA 2VHGA 4QIGA 2GO9A 2PI5A 1VIOA 4M5DB 1KS2A 2V94A 1NB7A 3VF0B 1U1RA 2NPIA 2C28A 1QE1B 1NRKA 3FBEA 1T05A 4W98A 4ZVOB 2XHCA 4KO0A 3OLAA 1KD1T 2OUGA 2LU2A 1SCJB 1RISA 1SL1A 2EVZA 4WJBA 3A3PB 4JI5J 4OHWA 4EGLA 2QIFA 5KFHA 3DRSB 4DCOB 3A8JA 5AE1A 1Z4UA 4Z37A 2CYYA 5ETVA 1N33J 1M90T 5B0DA 1KHWA 1CJVA 4LSZB 3Q8QB 2RDDA 1NJIT 2RU9A 1FJEB 5C42B 4H4KA 1PILA 4LVNP 3CF5Q 2NXCA 1XWLA 1NZ8A 3E01B 4WE1A 2OPSA 1LFWA 4F0KA 4AYBD 4OI0A 4ZMMA 1YHQS 4JOUA 4KKOA 3ZZZA 2ZH7A 4W90B 4NWBA 5CYQA 3UDEA 1R0AA 3RYLA 2V2QA 3J7A1 1S0NA 1TKXA 3DI6B 3CSKA 1N0VC 2D69A 4YS2A 4EUVA 4DV0J 4J7CA 3ELHA 1YQHA 1NH8A 2GVZB 1VBZA 2LLZA 2GJ2A 3R8YA 4ETZA 2CNNB 1VQKS 3FBCA 2CNLB 2NXEA 4DV7J 2Q66A 4HACB 1T9WA 1VDHA 4JV0A 1BMQB 4CCHA 3TUZC 2XMTA 1U2FA 1R89A 1LWCA 1XR7A 5EWFA 2E1MC 1RT6A 5J2QB 4C8NA 1QLNA 2OD4A 2ZD1A 2KT5A 2ZKUA 3C19A 2KU7A 5KFEA 2B4UA 3NP5A 3NCQA 1R8BA 3LW5C 2CQDA 2LXFA 4CH7A 1T05B 2CPZA 4CLLA 2I5JA 4L73A 4OHZA 1GX6A 2FD2A 2BANB 2GA7A 2QFJA 5HVHA 1WDTA 4EYIB 5HP1B 2DNNA 1JLEB 4B3SF 3HKZD 1NK6A 2VC1A 1MW7A 4N5SA 1CJVB 4DR7J 3EYZA 3MOJB 4M5NA 1HNXJ 1I5OB 1UVJA 1F3FA 2HZCA 1X4GA 4HT7A 3UR0A 2KZMA 1RBLA 4L75A 4GC7A 3BGRB 4O3RA 1Q5VA 2L9DA 2UP1A 4ZLJA 4KKOB 2HZAA 2RILA 3IXQA 4OJ1A 5D6GA 3JTPA 1HA1A 1RYSA 2XI2A 3TZYA 3O8WA 3TQEA 2FYXA 2OSRA 5JVGQ 2PFFB 3WIUA 5C2CA 2IJNA 2ASDA 4NCAA 4DR5J 4M5GA 1HQUA 3BV8A 4DI6A 1FRHA 2KB2A 2KXFA 1JKHB 4L74A 5KFYA 3PHTA 5K8MA 3OPKA 3H5XA 4WFYA 3BBBA 2HVIA 4MT1A 1YBTA 3MZIA 1UAWA 2FJXA 2JLEA 2LXIA 2N82B 1CLFA 1QDUB 1M5VC 2J8AA 4JI2J 3HSGA 4N56A 4CTAA 1RT6B 3NS5A 3CW2C 2HZVA 2KL8A 1IM4A 2B4OA 4WP8A 2DO0A 5KT6A 4XPCA 1KQKA 2ZD1B 5FIIA 1IR2A 2PMWA 1RAGB 3KK1A 3IN5A 1UEUA 5GAGI 4ZVFA 3BGUA 3WHIA 1EETB 3W3SA 4HR2A 1R8HA 2EBGA 2MB0B 3KNGA 1CULB 3ISZA 4Q0BA 1Q7YT 1UTAA 1XR6A 1X4HA 3MOZA 2PC6A 1UL3A 1Y3JA 1BQNB 1YWXA 2KG1A 4OLPA 1HPZB 3K5NA 1OY9A 1X9SA 2X1BA 3LPEA 3MPDA 2Z58B 2ALYB 3DOMA 4R5PA 2R8IA 3M4XA 1M5SA 4DPWA 1FDAA 3KFWX 4LF5F 5GAHU 2CJXB 3T5LA 1M1HA 2ACMA 2RUSA 1FNMA 2XYGB 2IFXA 2CQBA 2MZTA 1FDDA 2M88A 3VAFA 2A2CA 4CO1A 5IM0B 4A8YA 2UXDJ 2BVZA 2IPOB 2AX0A 3V4IA 3M2UA 1S12A 2CQPA 3DNCA 2ZH1A 4UUXA 4DX7A 3KOAA 3BQ1A 3HVTA 4I56A 4QIWD 4C4WA 3TEHB 2KRBA 2IJRA 1ZH5A 1QAIA 1GEHA 5EWGA 4UQTA 4DFMA 3VAJA 3CC7S 4CYUA 3PIOQ 4NYOA 3D0IE 4KB7A 3LAKA 2VG7A 3E3XA 4NLVA 2IA0A 4MFBB 2BW2A 3F0NA 1I3OB 2NCKL 3HHNB 2WSEC 4ZCMA 2RUGA 1T03A 4ZVRB 4F4WA 1J5EJ 4JP8A 2AYMA 1HBOB 5A8WA 1XMQJ 4DU7A 3JXOA 2ZKTA 3TUIC 1HHQA 1P27B 2J7WA 2YNHB 2JSXA 5AXMA 1WF1A 3TA0A 4DPYA 4Q0BB 3BSCA 2B7BB 3JYTA 1Y5LB 2R2SA 3SYZA 2VQEJ 1TK0A 1I94J 4CQ1A 1WTBA 4ECRA 4J5OA 1DY3A 3O5TB 2WHOA 2FY1A 4J9SA 2AEMA 2K3KA 3KJFB 1Q79A 2AJ2A 1ZAWA 5HMWA 1SUQA 1VHIA 3WC2A 2CPEA 3MFIA 2XLKA 2CJKA 1FX2A 3QZ7A 1JNZB 2VFTA 3VAKA 3GIKA 5BJRA 1KOOA 3U7JA 4DL4A 3I5BA 4KHRA 1TVRA 4AXJA 2WSFC 2VA3A 3V4IB 1NH7A 2C2MB 7FDRA 2UV8A 3ENAA 3M2UB 4NASA 3MEEA 5IT4A 2O01C 3SCIE 2Z2YB 4QU7A 1FVSA 1LW2B 5EUHA 2QSWA 3SDEB 1HNIA 2V2VA 4PG5A 2HFOA 2ZHOA 4RO0A 3I6PA 1S4EA 1RTJA 3OVBA 2HK3A 3OJSA 3KNAA 2FLOA 4C3MA 3QQCD 3AB4B 4UOCA 1HNZJ 4CRJA 3KTQA 4E98A 4PPZA 4X4VA 2J0XA 3MUVP 5DETA 2WW8A 4IG3A 2VG5B 4FYYB 3FSXA 3GG0A 3B82A 4IOBA 4JUZA 3QAEA 2QLJB 1PBAA 2FVRA 1T03B 5CHCB 3MCNA 4ILLA 2F7VA 1QAJA 4A8XA 4DWIA 4OQJA 2XM3A 5LSRA 3RB4A 2LQ5A 1RGVA 4DX8H 4RUCA 1FI4A 1C1CA 4MKYA 2C2ZB 2W2QP 2AJQA 3CCJS 3ONQA 1XMBA 3M2RB 4LR7A 2HHHJ 3OSNA 1RT7A 4DHVA 3PKYA 4M8LA 3PX4A 3D68A 5HN0A 2DY9A 3PKMA 2JX2A 2KDOA 4LREA 1P9YA 5CCLA 1LWXA 4CLSA 4DV2F 3KLGA 1RACB 1S1UA 4RW7A 3LH2S 4GVBB 2P9GA 2IM1A 2AJFE 4J90A 4AQYF 1TFWA 1SH3A 2JC1A 4K4XA 4K2XA 1Y9OA 1O6XA 3GONA 3QGPA 4TU7A 1SUQB 1YJVA 5F3TA 4USHA 3HP6A 3TP2A 2HQ3A 2IDEA 1U2RA 3HT3A 4MIAA 4DL6A 3DM2B 1UJ4A 2MKKA 2MDAA 2C2DA 2E5HA 2N7YA 4CLTA 3H42A 2ABYA 2FJVA 3UPFA 3C15A 3I55S 2R7UA 2A6OA 1O0PA 2MZSA 1ICEB 5EHHA 2IC3A 1XBWA 2V8DA 2GHWA 3GTYX 4D3HA 3WDOA 1HHTP 4I1TA 1AA1B 1JJ4A 2DR8A 4AUKA 2YKNB 3G2XA 2MQLA 3HD1A 3MCSA 2V69A 4B9MA 1TVRB 3KHHA 1VK8A 1HNWF 4NZ6A 3THTA 4X62F 2OPQB 3LA0A 1RTJB 3AD8C 3MMBB 1TMJA 3TWZA 1OJ4A 4USUA 5CYMB 2H48B 4LF8F 2CQGA 2Z30B 2DGUA 2LEAA 1LWFA 2MQPA 4ELVA 1S6QA 2HFVA 3Q86A 4ED1A 3T1YF 3PR5B 1IKYA 3AT1B 4ZP8A 3P3DA 1G7CB 1OIAA 4N47A 4KY3A 3PO5A 4ZVEA 1T94A 3RBDA 3PW4A 1XNRF 2PEBA 1DQAA 1HWLA 5GADU 2JH3A 4BC7A 1KNZA 4DQPA 3NBPA 4P2XA 2UUBJ 5D3GA 2E1RA 1N6QA 2BJ7A 4EZ9A 3C8YA 2QN6B 2QYGA 4UOGA 2C3OA 2UXBJ 1RUSA 5KFAA 3RJMB 3W60A 1SKSA 4EFAC 4CP5A 3KLGB 2IVYA 4C98A 2OMLA 3H98A 1X0PA 5E33A 2XS5A 5E3PA 2E5GA 4YDDB 2MZJA 4DZ6A 2I0XA 5F41A 4OX6A 3M6UA 1RWVB 4M5LA 1N32J 2VASA 4ZJLA 3C15B 5AXNA 1SC4B 2IC3B 2QA1A 4O3SA 5KFCA 3J81Y 4U7CA 4KGMA 3CJ4A 4PYDA 2EFQA 1WOSA 4KT0C 3ISNC 1P1TA 2N4DA 4ES1A 2NREA 2CIMA 3OFHA 4DSFA 3KK2B 4IRDA 1IBLJ 3H5UA 2YPYA 4LRDA 2B9EA 1TKTA 4OJGA 3KMSA 1Z1ZA 3VGSA 4ECWA 3OBIA 1NHUA 5LSOA 2AJ4A 3KG0A 4A4JA 1S9EB 4EBCA 2E9ZA 3H59A 1S7IA 4NMXA 1FA0A 1YZ7A 2W24A 3VHQA 4F7VA 2J5AA 3OW2R 3QJJA 1IKYB 1FKOA 5E2QA 2ZBPA 1NK8A 3E2EA 2WVBA 1SL0A 2YKPA 4PG8A 4M5JA 3PR4A 3MM6A 4WKYA 3I31A 3RRHA 2M70A 7AT1B 4P52A 4LSNA 2UXCF 5HBMA 2ZFHA 3CJKB 4LSLA 1N6QB 3QSYB 3MMJA 1B7YB 4IFVA 5E0OA 3AA9A 1HBNA 1XMOF 2CRLA 2HVDA 1ZS6A 4G3IA 2HS3A 5A6WA 2R7QA 5DM7Q 1WG5A 1IJFB 1RTDA 1FNOA 2HHVA 4ZPDA 3A8IA 2DCUB 2PA3A 3GILA 4RBUA 1QAXA 2ZVSA 5GAHI 4YOEA 4F25A 5GMDA 4GVLA 2V4QA 1RTHB 4NLQA 3CB4A 3UDVA 1NMEB 3EVWA 5A0YB 1RJJA 2KKHA 2PDAA 4O3QA 3V6DA 3HSZA 4QWAA 3S7RA 1RDRA 2V50A 1AYEA 4DR6F 4KTQA 2HKEA 3TW0A 3TA1A 1YRTA 1AZSB 2ZITA 5KFDA 3I0SB 5JVHQ 5C24A 1YVFA 2PGCA 3CCQS 1T8EA 4P75A 3HFZB 2BE9B 2HBRB 3CUNA 2LFVA 5HANA 4QWEA 1TKTB 4ZHRA 5ITHA 1L3UA 4FYDA 5K5MA 4DFJA 2RH3A 3AXMA 4CDIA 4NXMF 3EJMA 3PYGA 5IT0A 2ZH9A 1UZHA 5LMNJ 1U2CA 3BM7A 2P5VA 4B9SA 3CEDA 4BDPA 4PYAA 4FBUA 3VAHA 2BW7A 1JLCA 3ETOA 4DX6A 4I6AA 1LQ9A 2FHKA 3RR8A 1VBXA 2YQ0A 2HRUA 1N52B 2ZE2B 4C8KA 2D9PA 4CM0A 2Y1LB 1UFKA 2V8PA 4ANEA 2B5JB 2LQBA 3EWGA 3VVUA 3T3FA 4IRCA 4P7VA 4JV5J 3R1LA 3U1MA 1Q82T 2C2RA 3G6XA 3PJ9A 3OSPA 1VQ9S 3NGUA 2C1EB 2B8PA 3IA0A 2HWHA 2OLWA 1EX8A 4IFVB 4LF6J 1RT2A 1HBNB 3HHEA 1VISA 4DZDA 3HKWA 4RNOA 3IRWP 3FDSA 1VC5A 3PFEA 5E7OB 4DDFA 2XZTB 2W2MP 4ZPVR 4Q8FA 3PRDA 3GIRA 2D9OA 2EKNA 3AD7C 5D15A 2HNZB 1CJTA 2ZH4A 3NG8A 3NRBA 2BX6A 5L1IA 1R0BG 3BH6B 2VPWB 3C66A 5K8OA 4PUOA 4DF8A 2DTJA 4IQMA 2GV1A 3DLGB 3ZFVA 2ZOMA 2CQ4A 2YWFA 4Q5VA 4ECZA 5KT2A 4X4TA 3Q0AA 2XZDB 2C22A 5C24B 4UOHA 1H74A 1WF2A 4K7QA 4AXIA 2KG0A 5HMYA 3OL9A 4DR3F 1RABB 1ZM4A 1RTIA 1KONA 4ZHRB 5IS2A 1I1GA 1U26A 4XK8C 3PFOA 2DGTA 3HLUA 4LRFA 2E29A 2ZZMA 4LBIA 2POKA 1WI8A 4O3PA 4FN5A 5D0GA 4V19J 4ALZA 1Q81T 1ZAVA 1RWPB 3J7AN 1JLCB 2UUWA 4KV8B 2DYAA 2F9JA 4DV5J 1QTNB 2HS0A 4KC5A 3MTJA 1Q5YA 4DPXA 1B99A 2O3DA 2YKAA 4DR2F 1AT1B 4GKJJ 1ZAXA 2HGMA 3QRPA 1RHKB 2W9CA 4FXDA 1NK5A 4ZS6A 2E7XA 1DQ8A 2AJ0A 2J8SA 4QPXA 2V2ZA 2RS2A 3UWTA 3TARA 2Z0GA 2FLLA 2MZRA 4RNMA 2WVDA 3DFEA 3NEKA 3ULHA 4OV6A 3QGHA 1T02A 1RT2B 4ILRA 4WWSA 1X5OA 2OTJS 4LT6A 3BJYA 3AJ1A 1GFWB 1X0FA 4QPTA 2FJAB 2LP4A 3IWNC 1K47A 2NSBA 4RW4B 3CC2S 3MEGA 1RWXB 4Y2CA 4TYBA 3KKFA 5KFZA 2LYVA 3KWMA 3EZUA 2B9YA 2KJVA 3PY8A 4WP9A 2YX7A 2LMIA 1TK5A 4RW6B 2CQCA 3PEHA 4DX5A 2XHWA 3I4PA 4NZ0A 2AZ1A 2L48A 2HFNA 3UDLA 2GMLA 4QYRA 4ECXA 2JVRA 2YNGB 1IQZA 1XIQA 1SI9A 2ZBRA 3SMZA 3HHLA 4F02A 1NBEB 3U02A 5F9NA 4JI3F 5F8IA 1EB0A 2E44A 4WXOA 2FTRA 4KH1B 3ZC4A 3PDNA 2ZH5A 2CPHA 3UVJB 1F9HA 5CH7B 4IKAA 2HLUA 4K2JA 4KSEB 4CLZA 3LGHA 1WOPA 5THWA 4AL5A 4Y34A 3RB3A 2VA2A 1U6BA 3EDRB 2CQ0A 3SIPB 3K59A 2LDYA 3L7PA 3H4DA 1FRMA 4KQZA 4OYZA 3I9ZA 1VC0A 3IO1A 2QL7B 1JK9B 5EDWA 1KEKA 2OPRA 3NL0A 3KDNA 4DUYJ 3MI7X 4LF5J 2CVEA 4RJVA 5GADI 2UZAA 3CCTA 4X4NA 4WZMA 4J9LA 4J9VA 3SSRA 3KJVA 1S1XB 3D2WA 5I42A 2Z57B 1HI1A 2Y1RI 4C8MA 2RKIA 3BGFA 2DR9A 1S9GB 1U45A 2VPYB 3D3BJ 4JI5F 1SJ1A 3G8QA 2R7XA 4Q7AA 3VAIA 2EK6A 1NJZA 2PFDA 2F8EX 1N33F 4UT4A 3TJ9A 4RUHA 1HKAA 4OYIA 1TUVA 2QLFB 5T7LB 4OZ3A 1S7HA 5KT4A 1RYRA 1ROFA 3NAIA 4DFPA 1NKCA 3SXLA 1K8AT 3EXYA 1S79A 3MM8B 2MKYA 4NLRA 1H2VZ 4J37A 2J9DA 1QSYA 1WG1A 2FUG9 4U9RA 3BH7B 1O5JA 4BLGA 4DSLA 3D54A 4Q2MA 2AF6A 5JUMA 1HIYA 1RWWB 1VLYA 3DOKA 5KG5A 3M8SA 1WHYA 4DV0F 1B0TA 2FHJD 1T9VA 4RW8A 1KTQA 5ETLA 5A8RA 2VQFJ 2EK1A 4M95A 3ETMA 1U7LA 5DZ6A 2WVEA 4NRTA 2XCAA 2FVCA 1ZA2B 3A13A 1WC1A 1TL4A 3L09A 4DV7F 2VBXA 1C2PA 1WHVA 1VQ6S 4RNNA 3IC1A 4TLRA 4OZ0A 3JAMU 4DSIA 2ILZA 5T41A 1FRIA 4KFBB 1RT3A 3NY0A 3RAXA 3C16A 3W2WA 3JB9k 2BRLA 1VOMA 2UV8G 3HVRA 3SCKE 4OHVA 3P96A 3D6FB 4YHHJ 2G0IA 2UVVA 4NLDA 4X4UA 1IBKJ 3H7HB 2E5IA 2KH9A 2ZDOA 3ZTPA 3KJVB 3JSMA 2BQUA 2C3YA 5F8LA 1A9NB 3H2VE 5KFOA 1DAXA 4ED8A 1HHSA 1NM2A 2JOQA 4RR5A 3EICA 3RGIA 4HHUA 4EMDA 2F4FA 3W9IA 1LOUA 4Y3CA 1RE1B 2PEHA 5L1KA 3W5ZA 1KVKA 4DR7F 3R27A 1HNXF 5KG3A 4ID5B 3CCZA 2Y1IA 3ZZOA 4F4XA 4MIWA 4FF3A 1GQEA 3FKBA 1OQ6A 4I6WA 5E3CA 1XNQJ 1PCAA 2QG9B 5KAKA 1XQIA 1NDPA 5HLFB 4TNOA 2DISA 3N6LA 3UCZP 3QAUA 1G3OA 2N7CA 2LEPA 1SKRA 4WPAA 2Y0BB 1SKUB 3X3UA 4P73A 1U24A 2ZOFA 4CNYA 3BDEA 2HHXA 4ICLA 5D0EA 3U1LA 1KLMA 4YUDA 3DOKB 2E7VA 3D4JA 2YNFB 2GZOA 2VPXB 1TAQA 3A3NB 4LRCA 4DR5F 1SPBP 4RW8B 3R1HA 5A8RB 2Y9HA 3LP2A 2N4CA 4I64A 1YITS 3BKTA 3CD7A 5AJ3J 4U7UK 1FKPA 2BJDA 3LPYA 1EIYB 4QCLA 1KFDA 4PWDB 3D1HA 3B78A 5ADZA 3GG1A 4JI2F 1RT3B 3GIIA 2HPUA 1PKUA 5A8KB 3KJQB 3OVSA 1RTZA 3CD0A 3GFZA 3C16B 1FFSB 3M32A 3E51A 3CT9A 5EX0A 1OS5A 3UE2A 1W26A 4I2PA 2CQIA 1VYAA 1HMVA 3A1YG 5DO2A 3JSMB 3NMRA 4GMKA 3DCAA 3Q2SC 2VDHA 1SJFA 1CQMA 5KFRA 3DLEA 3H4BA 2XC9A 2VJVA 1YDLA 2XMKA 4R8UA 5I3UA 1JLGB 1HNWJ 2HHPA 3FUYA 3R5CA 4WFBQ 2R4FA 5HQLA 3SQGB 4LF2A 2JJ4D 4H4KC 3EGZA 3NNAA 1RAFB 4DV3J 5M2UA 4RNHA 1ZETA 3CDEA 3OHAA 5KG7A 5LJ5Y 4ED5A 2W1BA 1ZZFA 1TUWA 1IBMJ 4M63A 1HBMB 2OIHA 4DLGA 1L3VA 3DC2A 5DLFA 2YBVA 1N5VA 2W9BB 2MKSA 3KK3B 4ZVHA 1U1OA 5G4DA 2CPJA 4WCEQ 3FCHA 2XSJA 3LF0A 2CNOB 4FKXA 3SZ2A 2V34A 1Y3KA 3C6UB 4PWUA 5LOQA 2ASYA 2CUYA 2UXDF 4EBDA 4C3KA 4JI4J 1WKKA 1KLMB 5IWAJ 5ETQA 4V1Ak 2JFKA 1N36J 4PQUA 3IBFB 1B70B 3RTVA 3LP2B 3ET6B 1RKIA 1Q95G 3D66A 2W9AA 2U1AA 1ZPWX 3DGPB 3TAQA 3BO2A 4A8FA 2QX0A 3ZZTA 3T41A 4PABA 1PYSB 1H72C 5BR8J 3RBEA 4E0DA 3OT9A 3SCJE 2X1FA 3PIPQ 5HI7A 2XWYA 3G87A 4O23A 2XO6A 2AQ4A 2GMJA 2A1BA 4DQQA 2OEKA 2CJ9A 3W5YA 2VZ9A 3W8PA 1J5EF 2HNYB 2AU0A 1XMQF 3WZ0A 5D0RA 2BXJA 4Y2AA 1N5QA 3CD5A 4WBFA 4F04B 1NK0A 3BS9A 3DLEB 2H54B 1UZDA 4OFZA 1Y10A 4A8WA 2R42A 3MPVA 2VQEF 2XG8A 1I94F 4RW9A 2EPIA 1IBCB 2YY3A 4LF1A 4F4AA 4MMOA 4J9UE 5DQGA 2AV5A 4EZ6A 1YG0A 5AT1B 3BF4A 4IH5A 3MPYA 1BWVA 1JLBB 1SJ4P 4ZPCA 3M05A 3VAMA 4KBIA 4QYZK 4USVA 4P10A 5IT9U 4LF9F 2HMIB 4YEAA 2V2KA 2BJEA 2XSJB 2H4WB 3AJ2A 3PO4A 4A46A 4JYAJ 2GJFA 3C6TA 3DDNA 3MM5A 2J0SD 1ZA1B 2OPPB 3EGVA 2QLBB 2JVOA 4YB6A 1MN7A 1JJ2R 1K9MT 4ZN3A 2DNYA 1ZM3A 4NLPA 4G1QB 1HI8A 1RU2A 3QZ8A 3GYXB 1XC9A 5ETMA 2QRRA 3A8KA 4YMEA 1PJ5A 1XMOJ 3VAGA 1FKAF 1HNZF 4TN2A 3OR1A 4DPOA 3OTEA 3M8PA 4QBUA 1R31A 1J5OA 4Q43A 2GC8A 2E1AA 5FLXY 2Q43A 1SJ3P 2VD3A 3LWMA 2V67A 3SCLE 1FFWB 3EGNA 4LUBA 5J1EA 4Z7CA 1UEKA 1IM6A 1S0MA 1VQOS 1S0VA 5G0RB 2IHR1 4EBEA 4C0BA 2FDNA 3MCMA 3MXHP 2CDQA 5AE2A 1R0CB 2RRBA 5D4OA 1SVDA 2RHQB 4NI2B 2HVHA 2HHHF 3JQKA 3L95X 4A8SA 4B3RJ 3GCXP 4I2QB 3WX4A 4DUZJ 4CH1A 1Q1KA 1QUVA 4RW9B 2Y8WA 1KRPA 1RKJA 3TZXA 2VFVA 5IC4B 4C8OA 2DB1A 4LF7J 5FJ4A 1APSA 2VICA 3DU5A 4IYQA 3CCMS 2D3OR 4USTA 1OSDA 3T6BA 1N5SA 2ROEA 1JWWA 1S1TB 4PXDA 4YB1P 4USIA 3TVYA 4KGZB 5LSLA 4WFAQ 5B0BA 3WIVA 1C4CA 1BC6A 4EI2A 4HHJA 4ZN1A 1KDNA 4CM2A 1SQEA 1NJYA 4IFYA 1JX4A 3CO0P 2XO7A 4LF4J 4LFBF 1MROA 3NLCA 3DMJA 4P72A 2HHUA 3MMAA 4B3OA 2E1PA 4GKKJ 5EX3A 1D8ZA 2K1RB 2Y1JA 3OR2A 2RQKA 1C0UA 1PAEX 4NYZA 3KLFA 3H40A 1B0VA 2CPFA 1GMUA 2VOOA 2KRRA 4RBVA 1KOHA 1YGYA 1JMTA 4U95A 2DHHA 1JLQB 1ZBTA 3OR1B 2VBZA 2KFZA 2R2TA 3V5RA 1J5OB 2GVDA 3GV8B 1P1LA 2BR0A 4UZCA 3BZQA 3EX7B 1NNDA 3LP0A 4J9RA 3FCVA 4RBTA 1RBAA 3K8WA 5J1EB 2X51A 2VFSA 1NK9A 3M7VA 1RWUA 4G65A 1EKRA 1HR0J 1RWNB 4JI7J 3BO4A 3OV7A 3ZTQA 2IA6A 2YKMA 1S6UA 4WP3A 5LMUJ 2C2EA 1TK8A 2FZGB 1IR0A 1RCOB 2HGLA 3M6XA 1IWAA 3IM8A 3BSOA 2UUAJ 4D3GA 3IMQJ 2UUBF 3TEGA 3NGTA 1URRA 2XB2D 2H5IB 4UF4A 5KFSA 2YTCA 2GW8A 2UXBF 1X4FA 1U8SA 4W92B 3E8OA 1TFYA 2AEFA 4DR3J 1LW0B 5IOLA 3W66A 2LECA 3B8HA 2VH7A 1SB6A 3MM7A 3HVAA 2MLZA 5D8HB 1X9WA 1GMVA 3G82A 3HDSA 3M8YA 4WFXA 2HG4A 1FRXA 1HLWA 1N32F 4ID8A 3MECB 2YH1A 3DDIA 1K1SA 4X4QA 5KG2A 2FC8A 1GXTA 5H9EJ 1CPZA 3MAHA 4FF1A 3A3OB 3TVKA 2W4PA 1RLCL 2XLJA 3DMJB 2E9RX 2HIYA 1HNVA 2DGWA 3MMAB 4B3OB 2DNLA 3DLBA 1EKSA 5DRKA 3OR2B 1C0UB 2GS8A 4K4TA 3R5JB 5KFLA 2R3VA 1Q4RA 2DNMA 4CLUA 3NWGA 1IBLF 3GMGA 5CA5A 4QR0A 1SIWB 1QE1A 2YWGA 1F3VA 3R5BA 2AW0A 5LXRA 2FJDB 3DLJA 3ITHA 2DPJA 2BABA 3OJUA 1S1WA 3DRSA 1QUPA 3OL8A 1IKWA 3K57A 4OZ5A 3DXBA 2LKZA 2V4RA 3R7NB 4N7TA 5C42A 2M4MA 1HWKA 1D9DA 2C2NA 1QD1A 3E01A 1XK8A 4X65F 3U1NA 2Z4PA 1QY7A 2K8GA 2GNKA 1FVQA 3DI6A 2DBBA 1FTCA 4KGXB 2DXEA 3CC4S 3IR7B 4C48A 1MWQA 3AODA 3MR2A 2J9EA 2XWXA 3LOUA 4TXSA 2WTFA 2CDRB 3HZGA 3TI0A 3MM7B 4CI0B 1FTRA 1D1UA 1PJ6A 2ADBA 4O0IA 1S9FA 2V6AA 5KFIA 1EHWA 1AROP 1Z2ZA 4F4ZA 2H1YA 5K8NA 3GCWP 2FJWA 4HACA 3HM9A 2YVSA 4URGA 2KFYA 2CJBA 1JLFB 2G2YA 2R8HA 3TRGA 4C9DA 3EZOA 3KHRA 1HQEB 1WC5A 4KPCA 3QLHB 2VDIA 1ZTTA 4NA3A 4F26A 1FF2A 3DOLB 5CCMA 4DJBA 2G13A 2GX8A 3J7YU 2QSFA 2W25A 2BE2A 2QMWA 3TO8A 2VIHA 1N8RT 1RHMB 1Q7LB 3PACA 2BUNA 3KG4A 1X4CA 4F3QA 4MAKA 3ADAC 5KFMA 3GU0A 4PG6A 2EW9A 4A48A 2FHOB 4U8YA 3OXGA 2BANA 5LMNF 5KG0A 3ITHB 3N5FA 3BEGB 1S1WB 1S77D 3FQKA 2B43A 3SFUA 2QA4G 4ZP9A 2AKWB 2XGQA 3Q23A 1IKWB 5HP1A 1JLEA 1XR5A 4PCQA 2XQCA 3OLBA 4CNZA 4RUBA 4U7UD 3WX8A 3B6BA 1YSJA 2CPXA 3CIMA 2FLNA 3OVAA 4OZ2A 3RAQA 1U6FA 1E6VB 5ETNA 4Y0FA 2IAJB 4FXWA 1BD6A 3BGRA 1U48A 1B64A 2DH8A 4JV5F 2LA6A 3BKUA 3VVTA 1OYDA 3R6LB 4PXEA 2WW4A 2CADA 5SUHA 3M6VA 4LF6F 4RPFA 1FEHA 2ATLA 2B7CB 3I5AA 3BB5A 2AMCB 1HWIA 2AZ3A 4NPOA 4ZK7M 1JKHA 2B8QA 2D7SA 4CIOA 4NL5A 4P2FA 2RAQA 4V19X 2QMXA 2BE7D 2B4PA 3NNCA 3C46A 1IXKA 2KM8C 1GT8A 1AFIA 3B4DA 3ILLA 2EWHA 4X66J 4ERDA 1H38A 4BBYA 1O51A 1U1LA 5DS7A 4X4OA 4LFCJ 2PMHA 2MKIA 2BE2B 4L6V3 3G8SA 1EETA 3DHWC 1FT8A 4DPTA 2NR0A 3CPWR 3CJ2A 1WORA 5B0CA 1CULA 3QIDA 4ZLNA 2XTJP 2HVEA 1DLOA 1VQ7S 3C3LA 2DO4A 2K7JA 3OFEA 2MQQA 2YWEA 2OI2A 1BQNA 2J0QD 5BYSA 1CEZA 4Y2IA 4A8QA 1HPZA 4ECYA 1OWXA 1WSRA 3T1HJ 2BJ8A 6FDRA 2VV5A 4DV5F 1WEXA 4PXBA 3TZZA 1KHVA 2YQ1A 4GKJF 2KN4A 4C97A 2R7RA 3DLKA 1NPKA 4DR4J 3UQSA 2ZJPQ 4DSKA 1CQNA 4QIFA 4DL3A 2YWKA 2JHEA 5F8JA 1JXVA 5B0EA 2M3DA 5J2PB 1YJ7A 3BYPA 1A0OB 5IM0A 2XZWA 3W64A 2AX1A 1ELOA 5CXTA 1HBUB 2JZ5A 3V6KA 1FFGB 2AP6A 4JI1J 1Q8IA 1ZTWA 1MU2B 3FK4A 4U6PA 4DL2A 1HFEL 3UD4P 2V8VA 3L4BC 2OFGX 1N4LA 2F40A 3DRPA 3NKYA 1MLAA 2HVZA 1KN6A 1T3NA 5J2NA 2D3ZA 2RS8A 3N01A 2E7WA 5DZ7A 3ENWA 1QM9A 1NCLA 1OY6A 5C7PA 2XMAA 2J6TA 2MHEA 3MMCB 3V6HA 4WZQA 1FD8A 5IC6B 1HWUA 1K0TA 3JSYA 4MFBA 1VRQC 4HLBA 3NGKA 4IO9Q 4ENOA 2UUCJ 5L39A 4CO3A 1NDKA 3GIMA 4WXWA 4FDFA 3I0RA 1RI7A 2QC3A 1X4BA 1HBOA 2C3UA 4ZVUB 5L46A 1WC6A 5KFFA 2YNHA 4ZCKA 3NGDA 4WTYA 2JC0A 1RWKB 1DLOB 2OH2A 5KFQA 5LL6d 4UUWA 2M0GB 3RUBL 3NAHA 1NXIA 3OXLA 5GMEA 1QVFR 4KYZA 1U1KA 3CCES 2VFRA 3T9ZA 1KQGB 3RBZA 5GMKa 2VC0A 5F3ZA 4IRKA 3HXMA 2EEYA 2R8KA 1RBOB 1X8DA 3S1TA 1WUUA 2LQJA 3DLKB 4N76A 3MDFA 4DUYF 4PG4A 3BN7A 2GJIA 4TVAB 1R43A 4MIBA 3H25A 1N34J 4JI0J 3M30A 4C11B 3FRZA 2DNRA 3ENVA 2XLIA 3GQCA 3AQOA 3PX0A 2VOPA 4Q44A 4WIQA 2DEJA 4JBCA 3EMTA 1YJTA 4DEZA 3QIPB 1HI0P 3M8QB 4F36A 3Q8SB 5A2QU 2KFNA 3T5KA 2JL9A 3DHXA 3PZPA 3AOCA 3MWBA 1LW2A 1ZOTA 3SDEA 3DRPB 3FFIA 3QWPA 1SH0A 5E3RA 5J2NB 1UJ5A 2PN6A 3K5PA 2J76E 1SBRA 2FGOA 2EFNA 1VMBA 2HS4A 2OEMA 1Q78A 3OUYA 1RAOA 3FSYA 2VG5A 1FWPA 2K2PA 1LV5A 4LMZA 2I9SA 3P45B 5D0HA 2KVQE 3POTB 3I0RB 4HL9A 3QT7A 3HT0A 5E3AA 2QEXS 2WOMB 4ZPBA 2ASLA 3DU6A 4WFNQ 3ISND 1PBUA 3DRYA 4ZJOA 4ZPWR 2B3TB 3W65A 3M2RA 2VQFF 1MWYA 1P8GA 1Y7PA 4HDGA 1N48A 3PJXA 1LK7A 3IR5B 2EG1A 2Q1LA 2YWWA 2AYBA 4ZJQA 1WC0A 1VGYA 4YN3B 4NLSA 4OL8A 2D1CA 3DRXA 1DFDA 4GVBA 1UMJA 2XGPA 1IVZA 2HWTA 1UW9A 3HSJA 1FHTA 2GFFA 2KJWA 2ZM6J 4BWJA 1XTZA 5CQGA 3UNYA 3QMQA 4CT9A 3QT6A 4QW8A 1R8AA 3WQPA 1U0HA 3DM2A 4YHHF 1W25A 1IBKF 4LF9J 2FC9A 3M30B 1PYTA 2IMWP 2I2YA 3DRRA 5DG9A 3AH6A 2AEJA 4TY8A 2M7SA 2YKNA 1MG7A 1UJ6A 2NPFA 4ITSA 4H4MB 5HROB 3QRQA 4WF9Q 4OIXA 5L38A 3OL7A 1UKUA 4I68A 4RUAA 5B0GA 3FFIB 2OPQA 4IG0B 1SXLA 6AT1B 1RQ0A 8AT1B 3MMBA 1VHFA 2DNQA 5DDOC 1R6VA 4KAIA 2KT2A 3OUYB 3G6ES 8ATCB 5CYMA 3HHLC 3J80U 2FPHX 4XIUA 1XNQF 5D4NA 3DKDA 1V5IB 2WK4A 2X3DA 1H6KX 2PO4A 2UVRA 1X31C 1C1BA 2XS7A 2L9WA 3PEJA 3HFVA 3I87A 3OTDA 3WBZA 1L5UA 5KFWA 3B54A 4K4WA 1KQFB 1CC8A 3ZNUA 4DF4A 1NPRA 4I0WA 2M2BA 3LP1B 1TL1A 3W2VA 1MNEA 3TR5A 2RE1A 2F63A 5AJ3F 1VJWA 3S01A 2OKQA 3FRYA 2MZ1A 2HHWA 3GJQB 1CS4B 4RU2A 1UVIA 3UDCA 3O44A 3FBBA 5KFNA 4DLEA 3A4TA 2DGXA 2AJ1A 1U0HB 3MR3A 2Q6CA 3BSNA 2DHAA 3GE9A 2DXFA 1S1VB 1K1QA 4PG7A 3TANA 3DRRB 3D1OA 4K5RA 3GJTB 4KR0B 3VGVA 3BN4A 3GWCA 4TY8B 2ALZA 3UN3A 2OP5A 4LFBJ 2BM1A 1D0EA 3IAM9 2QA4S 2RU3A 4JV1A 2Z2MA 1YK9A 3W5XA 4K4VA 3M2VB 1C0TA 3F73A 4DQRA 3GFYA 4JI6J 3QT5A 3KK2A 1FESA 2R2RA 4ELTA 4DV3F 1RHRB 2MSTA 5KFKA 3QGGA 4C6AA 1XN9A 2XSFA 3HPOA 3AAWB 2DH9A 5EWEA 4ZVQB 2M8DB 2WBRA 1U1PA 3K5MA 3UCUP 3R2CJ 2X7IA 1IBMF 3W61A 1S9EA 3MEDA 1PC5A 5E41A 5L9NA 1ZYQA 2DGOA 3G8TA 5KT7A 1VQPS 2BBEA 3PW5A 2KT3A 2LDIA 2XYPB 1C1BB 4YR0A 4C2MA 3TUPA 4ATNA 5RUBA 1NB2A 4JI4F 5IWAF 5IFMA 3D6HB 3D7SB 3GIJA 2ZDPA 1N36F 2DRAA 7FD1A 1KTVA 4X4SA 1TL1B 4H4OB 3CJKA 3W2VB 4TQRA 2EXUA 2RF2A 4B9UA 3VALA 4URQU 4TU9A 1CVJA 2W8KA 2F1FA 3R9LA 1RA6A 3PM9A 5BR8F 1RCXB 2R7OA 4LIRA 4Q8EA 1DBDA 2QMUB 1VLOA 2ZNZA 1UCNA 3M1VA 1CBKA 1RTHA 5KFPA 3CE8A 4QYZJ 3ZTSA 1UA1A 5A0YA 4OYWA 1RU1A 3V2UC 3H20A 2FVQA 1U47A 1GXUA 2JEJA 1IQTA 4NLOA 2MKCA 2QTWA 4FPRA 2QL5B 5A6PA 1AZSA 3HMJG 3I0SA 2AYGA 3PHEA 1RWMB 3TJ8A 1C0TB 3AHPA 1NSQA 4Z7YA 2FZCB 2G9OA 1RZMA 2HHTA 4JI8J 5KOWA 4ZPTR 3SI8A 3TZWA 5KFGA 2B6AB 2ZJRQ 2ROGA 1NK4A 2IRYA 3UD5A 4CWBA 3KLEB 1YZ6A 2HYIB 4L3KA 4DSJA 4ZCIA 3MEDB 3MGJA 4YP3A 1VJQA 3KDOA 3W62A 4CO4A 4CT8A 1FX4A 9ATCB 1NEEA 2OGUA 3ILOA 4CO0A 4JYAF 2MY8A 4M5MA 2E66A 1SC3B 2FY8A 3FBFA 2ZE2A 4PAAA 3OTOJ 2B5JA 4LQ9A 4X2BA 4X65J 5EN1A 4RX6A 2PT0A 1Q8KA 4O4GB 2KYZA 3IR6B 2P9EA 3N28A 4NXNF 2XY5A 2IM2A 3UI3A 4C8ZA 2JFDA 5CD4H 2RF2B 4A8KA 4CLPA 3OFFA 5J1NA 1KR4A 3D0HE 2ZHBA 3IS9A 4OI2A 3P8BB 5E3QA 4B9LA 3CJ3A 5HJYA 3U27A 3NOCA 3X1LB 3ILJA 4B02A 2HNZA 3JTNA 2MLXA 1Q8LA 3M1VB 5L1LA 1WELA 3D5MA 1NLKL 4WYLA 3GZ7A 4OHYA 3R6GB 1T11A 4J9OA 2GMHA 4DV6J 3DLGA 1N88A 4DSEA 2ZBQA 1FO1A 1M1GA 1LFPA 5KFTA 1D09B 1JJCB 3L7OA 5LM7E 1UPMB 2NUHA 3QWUA 2GIFA 2LA4A 2VL1A 4DUZF 4B3RF 3CJQA 2DKOB 1OSCA 5AXKA 4Z2XA 2N3LA 2OO4A 2CPYA 4LF7F 4AFFA 3ZO7A 4ED3A 5HAOA 5F8GA 4ER8A 3LGMA 4XAKA 4IQXA 4J9QA 4LJMA 2CNKB 1TKZB 2V4JB 3MD3A 4YFUA 4IOAQ 3FZBA 4B08A 3KYLA 4OZLA 3HVWA 5B7WA 4KV8A 2K06A 1UVNA 4DCPB 4LF4F 1M1KT 2EFOA 4OLOA 2K3IA 1GMWD 3Q2TC 1WC4A 2DHXA 3C14B 2WZ1A 4GKKF 3DYAB 5C5JA 2EFVA 3GP9A 3AQPA 5DQIA 2IBKA 4UZBA 2B0GA 2GHVC 4LFAJ 4AE5A 3D9BA 1M0SA 4WK3A 1VFJA 3QSIA 4FVMA 2ZC4A 3NMAA 3IS9B 1MN9A 2DNKA 4XDCA 4WFZA 2WB1D 1F60B 4MYTA 3D67A 4RW4A 2D41A 3MHYA 4KO0B 2QLXA 1DARA 4EO8A 1V3ZA 2EI5A 4DR1J 2VBWA 4B3TJ 1FD2A 4FS2A 3PW2A 1HR0F 4RW6A 2BA9A 4JI7F 3R5GA 5B09A 1FERA 3T1AA 2FHJA 4TU8A 5F8HA 4F8RA 4ES3A 2CPDA 2HQFA 2YNGA 5LMUF 2UUAF 3R5AA 4B9VA 3T9NA 4WE1B 2OPSB 3N4WA 5HATA 4O0NA 3ZZUA 2M52A 1K44A 1NJWA 4M5HA 2MKJA 3TAMA 1KWMA 5CYQB 3KJNB 5SZTA 3UFCX 1R0AB 2MLYA 5ETSA 2HFSA 3THPA 2RHSB 4R0EA 1TKXB 1IJEB 1EQ0A 1SQFA 3UVJA 5H9FK 2PE8A 4Q2LA 4YR2A 4K4UA 4FZVA 3BR8A 1KC8T 4OJHA 3KLVA 1JJHA 2H3EB 2VG6A 1HW8A 2YNIA 1I51B 1WD6A 4LR9A 3Q22A 3TX0A 4DU8A 4OI3A 2A18A 1UA0A 2F5GA 2CPIA 4AL7A 3LGNA 4XTTA 3NS7B 4N8OA 4N8NA 3ILIA 4RU9A 2MPUA 1PYOB 2YKQA 3I56S 1LWCB 4LRBA 2RB7A 2AGOA 2YQ3A 3BR9A 2IJFA 2H65B 2DPIA 5IZHA 1TKDA 3UN2A 4DS4A 1VQSA 1S1XA 3MR6A 3PNIA 2C2OB 1B4SA 2HEKA 4ZVSB 4QZVB 2V68A 1S9GA 2KXHA 2IVMA 1VQ4S 4B9NA 1TR0A 1NHKL 3IFEA 2FIUA 2Z8QA 2DGVA 4FVCA 4DQIA 2I5JB 5ETKA 3O2IA 2WB4A 2PSZA 3G6YA 2QGFB 4QU6A 4XO0A 5T7LA 1F9EB 2ZOGA 2SXLA 1HD1A 2NXNA 3TOQA 4H54A 1S59A 1FJGJ 4AD6A 1GAOA 3BPDA 2GQ2A 3J7ZT 1V9OA 3MM8A 2EBEA 1W2IA 1RB0A 2VBYA 1S0OA 3MTKA 2OELA 3ZZPA 2LVWA 5GAEU 4J9NA 1WTFA 4CZCA 4OYMA 3HULA 4XDDA 2BJ9A 4KPYA 2AGPA 3TAMB 4ZCLA 4N41A 1SQGA 5F0UA 1FJ7A 2RRNA 3CMES 2JLGA 3TUJC 2AIRB 3MPWA 1YLXA 3HK2A 5LXYA 3HCXA 2ZBIA 2DJWA 1VRTA 2L08A 3CJ0A 2VG6B 4QW9A 2GQCA 1HQUB 2N3OA 2YNIB 4RWXA 2DVIA 1YRUA 3BKFA 1F6TA 2ZHAA 4C7QA 4OYPA 1Y4ZB 1RADB 2RSQA 3IGNA 2IM0A 4CLFA 3FCWA 3GSIA 4KFBA 2CZVC 2MTLA 4OYOA 5CZXA 3VR1A 4YQWA 5KT5A 2I6WA 2H5JB 9RUBA 3QO9A 2ZUGA 3HX9A 5DQHA 1KVIA 1E6YA 2C3MA 3QYYA 4DS5A 4CTAB 4UOFA 1TU0B 2PIIA 1FRJA 4X4RA 3R5DA 4WTOB 2NXJA 1HD0A 3T6JA 3KK1B 2CJAA 4L76A 2RDJA 4OI6A 5BYQA 1UP1A 1T9TA 3QJPA 4WKRA 1YKWA 3PV8A 1VQ5S 2W7PA 2DEIA 4ZDNA 4Q45A 1HWJA 5MLCV 2WVCA 3DXSX 1CJKA 1YTYA 3JS9A 4NRUA 3M8ZA 4ID5A 4OI1A 4DL7A 1T0TV 1NZAA 2BM0A 3QFHA 4OV1A 1Z2LA 1S97A 2QE5A 4AT1B 1RSCA 5DG8A 3DOMB 1NDLA 2VPZB 2V9WA 2F8HA 4R5PB 1CC7A 5HLFA 2Y8YA 4L3NA 1J27A 4MTPA 1KKHA 4FYWB 1YBAA 3CGIA 3I4HX 4HKQA 2FVPA 1UETA 1S4FA 2QL9B 4FBTA 3FGVA 1SJRA 4G6VB 5K9FA 3NWRA 1OMSA 2M9KA 1URNA 5ETPA 2JEFA 4ECSA 5KFUA 2IIHA 3PXGa 3T5HA 4FXVA 4PR6A 2YNFA 3MEKA 4WU2A 3KHLA 1VC6A 1MWZA 5DDRC 3G6VA 3UNGC 3FMBA 4XPEA 3TA2A 1RAJA 1VRTB 2V63A 3IM9A 3KUHA 4A8OA 3H5YA 3CCVS 3AA8A 3HVTB 2C2KB 1KSPA 1NDCA 2QT7A 5KTQA 4PWDA 4X66F 1YI2S 4CYUB 1Y0HA 1U02A 5KFXA 1KFSA 3Q89A 3R2DJ 3I5CA 5C2GA 2OAUA 1WACA 4P6QA 5A8KA 3M9OB 1FCAA 4YB7A 4J9KA 2MMYA 3QO9B 2VG7B 1FXLA 2G2ZA 4LFCF 1E6YB 4Y28C 4CLKA 1DRZA 4YY3J 3JAMY 2MKHA 4C8LA 4GC6A 2H5EA 5D4PA 2GO8A 4HTIA 4EWTA 5A8WB 4DV1F 4F2SA 2FGCA 3K0JA 1JLGA 1ZM9A 2DHGA 2NLWA 4K4ZA 3JYTB 1FXDA 1X7VA 2XEXA 1RP5A 3SQGA 1NU4A 3T1HF 3NNHA 3H0PA 1CJKB 2UU9J 1WHXA 4FYXB 1R27B 5F8NA 3CDBA 4DR4F 1H73A 1HBMA 3R7SB 2HK2A 4QIEA 2JDJA 1KP6A 3G96A 2W9BA 1FDNA 3KK3A 3GV7B 4B3MJ
chains in the Genus database with same CATH topology
1FXRA 1XERA 5GAGU 1VQ7S 3C3LA 1JNRB 4IQMA 2XNRA 1FE0A 2GV1A 2DO4A 2K7JA 3DLGB 2KYXA 2A3JA 1DTQA 3OFEA 2DD8S 4BHQA 2MQQA 1WNEA 2YWEA 3ZFVA 1FJCA 2ZOMA 3C6UA 2MGZA 1BQNA 1RK8A 2VB6A 3D1QA 4PRFA 4O44A 2J0QD 4NCBA 5BYSA 1F5AA 2DCLA 2RVJA 2CQ4A 2YWFA 4Q5VA 1CEZA 3CTRA 4ECZA 3B4MA 3FEZA 4Y2IA 1DTTA 1HPZA 4A8QA 1YJUA 3M8PB 5KT2A 4ECYA 1OWXA 4NLGA 4X4TA 3Q0AA 1S99A 2EFPA 3H2LA 2C22A 3TYTA 5C24B 2JEIA 6FDRA 1Y5IB 2VV5A 4OZNA 1WF2A 2RQCA 4DV5F 2DRBA 1WEXA 4PXBA 2XCPA 5B0AA 2HW3A 1KHVA 4JI1F 2HRYA 5J2MB 2CQ2A 4AXIA 3V81A 5FDLA 4OHXA 2HHSA 1PSDA 2KG0A 4GKJF 2KN4A 4C97A 5DGAA 5HMYA 2R7RA 3OL9A 3TVZA 3IG1A 3DLKA 1Q8BA 1WF0A 2EC0A 4DR3F 1ZM4A 3OFGA 3UQSA 1RTIA 1KONA 2ZJPQ 4DSKA 2RD5C 1CQNA 2KHDA 4ZHRB 5IS2A 2M5YA 3RR7A 1I1GA 4QIFA 4KHMA 3GV5B 1U26A 3MEEB 2WAQD 4XK8C 4URSA 4UY8T 3DGPA 4DL3A 3PFOA 2DGTA 2YWKA 1UVLA 3HLUA 2JHEA 5F8JA 3FNNA 1HNIB 2JLFA 5DJBA 2E29A 4F3OA 2ZZMA 2DGSA 2POKA 1U6ZA 4FP9A 3Q8RB 2OTLS 3GR0A 1WI8A 3BGLA 3JSBA 1RT1A 4O3PA 4FN5A 1L3TA 5B0EA 3LAMA 3I82A 2M3DA 1U4BA 5J2PB 4V19J 4ALZA 1Q81T 4UY85 1BWEA 2O1PA 1ZAVA 2L41A 1QTMA 5IM0A 3MF5A 2PA8D 2XZWA 3HHKA 1JLCB 2AX1A 1ELOA 5CXTA 1X5TA 1HBUB 3MFHA 2UUCF 2JZ5A 3V6KA 3UW1A 2B6AA 4KV8B 2UUWA 2AP6A 2F9JA 4OI4A 2HS0A 4A8MP 1Q8IA 1ZTWA 1MU2B 4KC5A 3MTJA 4IG3B 2O3DA 2YKAA 4DR2F 4U6PA 2HNYA 1RT4A 1ZAXA 1REVB 3KLEA 4DL2A 2BRKA 1HFEL 2HGMA 3UD4P 1ULRA 2V8VA 3H5SA 2OFGX 1N4LA 3IRXA 1AXQA 2W9CA 2BOPA 2F40A 3DRPA 2F4VF 3NKYA 2RMLA 2HVZA 4PQAA 4FXDA 1NK5A 4ZS6A 2E7XA 2VFUA 1LK5A 1KN6A 1DQ8A 3N0VA 1T3NA 5J2NA 2D3ZA 2KXNB 2AJ0A 4QPXA 2RS8A 3HJFA 3N01A 2E7WA 1ZZNA 2RS2A 3ENWA 1F0XA 1QM9A 1U25A 2YWHA 3QPIA 5BYRA 3UWTA 3TARA 2Z0GA 2FLLA 1GTHA 2MZRA 3PVXA 2MZQA 1JXLA 4RNMA 3DFEA 2C3PA 2J6TA 5B08A 5HL7Q 4R0JA 3ULHA 2MHEA 3MMCB 3M8RA 1C1CB 3V6HA 4QWDA 4K0KF 4WZQA 1FD8A 3KMQA 3OXFA 3QGHA 1T02A 1RT2B 4K4YA 2UUTA