2BB0A

Structure of imidazolonepropionase from bacillus subtilis
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
413
structure length
413
Chain Sequence
KQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazolonepropionase
publication title A catalytic mechanism revealed by the crystal structures of the imidazolonepropionase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 158
structure length 413
sequence length 413
chains with identical sequence B
ec nomenclature ec 3.5.2.7: Imidazolonepropionase.
pdb deposition date 2005-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2bb0A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2bb0A02
2Z29A 4AC7C 4BJHA 4HJWA 3UF9A 4IF2A 1EJVC 5AKQA 2PGFA 4RDWA 3KM8A 1GKRA 4DLMA 3AU2A 4Z42C 4IFOA 4EPKA 3MJMA 2GSEA 3C86A 3PANA 1A4MA 2FFIA 4KIRA 3T81A 2WJDA 3PNUA 2PGRA 3RN6A 3LSBA 3K4WA 1M65A 3B40A 1FWBC 4PCPA 3NQBA 4H9UA 4F0LA 4YIWA 3T8LA 4GX8A 4NI8A 1EJWC 3QGAC 1PSCA 1I0BA 3EWDA 1J6OA 4UB9A 4QSFA 4CNSA 4ERGA 1NDYA 1RK6A 1QXLA 4G2DA 4GX9A 3E0FA 3IRSA 1ONWA 4C6EA 3LS9A 4EPBC 2VHLA 4GYFA 1FWJC 4I6VA 4KESA 4C6FA 3HM7A 4CNTA 1XRFA 1ITQA 2OOFA 2DVUA 2FTWA 2Z25A 4H9TA 3FDKA 4LCQA 1A5KC 4L6DA 3GG7A 2HPMA 3D6NA 4RDZA 1FWIC 4LAOA 1K6WA 4CNUA 4EPDC 4DIAA 1FWGC 3HTWA 3R0DA 2Q01A 3K2GA 1E9YB 3S2NA 4F0RA 3PNZA 4ZSTA 3UPMA 2YZ5A 1UIOA 2R1PA 3LA4A 4DYKA 2PUZA 3MTWA 4PBFA 4C6LA 1YMYA 3S2MA 4KEUA 4DZHA 4ERIA 3URBA 4C6BA 4LH8A 1NDVA 4GY1A 4DI8A 1WXYA 3AUOA 3URAA 2RAGA 3UBPC 4ZSUA 3O0FA 1RJPA 3QGKC 2OB3A 4BY3A 2QS8A 4B3ZA 2D2HA 4H00A 2P50A 4R85A 4XD4A 1FKWA 1O12A 2UBPC 2Z2AA 4QS5A 2E25A 2WJEA 4GY7A 2R1KA 4IFRA 4CQDA 2OODA 2CZVA 2Z4GA 3OODA 5FSDC 4LCRA 4IGMA 2PLMA 2Z24A 3S2JA 3N2CA 1R9XA 3CS2A 1QW7A 3ITCA 4V1XA 3LSCA 3GIPA 1E9ZB 1YIXA 2Z26A 3DC8A 1V7AA 2GOKA 4IQJA 5HMFA 2D2JA 1KCXA 3GGMA 1FWCC 4GC3A 4LAKA 3JZEA 3T1GA 4PCNA 5CH9A 4XD5A 1ITUA 3EGJA 4DI9A 4IFKA 4C6QA 3F2CA 4P5UA 3RYSA 3RCMA 2HPIA 4XD6A 4C60A 3TNBA 3TN5A 4H9ZA 4XAGA 4KETA 3EWCA 1HZYA 4J35A 3FDGA 4PBEA 1R9YA 4HK5A 1W1IE 3E74A 1FKXA 4GXWA 3DCPA 1R9ZA 1YRRA 4LANA 1RA5A 3GRIA 2Z28A 4C6MA 3ICJA 1JGMA 2KAUC 1P6CA 1RJRA 1IE7C 3UR2A 2R1MA 4TQTA 4IG2A 2BB0A 3URQA 4DNMA 4CEUC 1RAKA 4G7EB 3F2BA 4GY0A 4IGNA 4QRNA 1RA0A 3F4CA 3GTIA 1A5MC 5HMEA 3K5XA 4D8LA 4AQLA 4LALA 2Q09A 3MKVA 4NG3A 4RE0A 2Z27A 3IPWA 2P53A 1J5SA 3HPAA 3DUGA 3RHGA 5E5CA 4E3TA 3A3XA 4KEZA 1KRAC 1M68A 4L9XA 1UBPC 4C6IA 2G3FA 5HMDA 1J79A 4B90A 3WYZA 3WMLA 4LFYA 1ZZMA 4QROA 1BF6A 1KRCC 2VM8A 4LAMA 3GIQA 4H9YA 2AMXA 2QPXA 1EF2A 1EYWA 3F4DA 3LNPA 1K1DA 3OJGA 4XD3A 3S4TA 2I9UA 3CJPA 3QY8A 2D2GA 3UR5A 3GU9A 4RZBA 1I0DA 2AQOA 3B0YA 3E3HA 4C6JA 2I5GA 2QT3A 4I6KA 2GZXA 4KEVA 1GKPA 4QS6A 1VFLA 2F6KA 3B0XA 5LXXA 4C6DA 3GTFA 3GTXA 2QVNA 1YBQB 1PTAA 4ERAA 4C6KA 2R1LA 3MDWA 2ADAA 1P1MA 2YXOA 2IMRA 2PAJA 1EJTC 4R7WA 2FVKA 4H9XA 4B91A 3URNA 2YB1A 3TN3A 4G7EA 1V4YA 3IGHX 1FWHC 3IV8A 4C5YA 3TN4A 1UMLA 3V7PA 3IACA 2AQVA 4CEXC 2GWNA 4HK6A 4DZIA 1FWAC 1KRMA 4GOAA 4EPEC 2XIOA 3CAKA 1RJQA 1DPMA 4KF1A 3G77A 4V1YA 4CQCA 1NFGA 1NDZA 4EP8C 1GKQA 1XWYA 1V79A 3MDUA 4H9VA 3A4JA 2R1NA 3ORWA 1ADDA 1EJXC 2HBXA 4KERA 3PBMA 1V51A 1POKA 1PB0A 2DVTA 3TN6A 2WM1A 5A6TC 4F0SA 1EJRC 5FSEC 3MSRA 4MUPA 1A5OC 4H01A 4RDYA 4LCSA 1XGEA 4DLFA 4HK7A 4C65A 3S2LA 3LU2A 2WJFA 1NDWA 1FWEC 4OFCA 2FTYA 4H9MA 2EG6A 3IJ6A 4GK8A 2Z7GA 1FWFC 1YBQA 3MPGA 4XAZA 2VC7A 2O4MA 3OQEA 3QY7A 2ZC1A 2HQAA 4BKNA 1POJA 1PO9A 2HNHA 1O5RA 3AU6A 4NP7A 3ID7A 2VR2A 2A3LA 1P6BA 2VC5A 1RK5A 4QTGA 4CQBA 2Y1HA 2GWGA 1S3TC 1WXZA 1ONXA 4C6OA 2YB4A 3WZ0E 2EG7A 3IARA 4B92A 3BE7A 1A5NC 2ICSA 4IFKB 4PE8A 4DO7A 1EZ2A 1A5LC 4LEFA 3FEQA 1FWDC 4GBDA 3GTHA 4WHBA 2OQLA 3NURA 4HA0A 2VUNA 4J2MA 3PAOA 2UZ9A 2O4QA 4WGXA 3SO7A 4J5NA 1M7JA 3OOQA 4ICMA 4M51A 1EJSC 2Z00A 1UIPA 4KQNA 3OU8A 1K70A 2OGJA 3O7UA 2P9BA 1J6PA 3F2DA 2Z2BA 4UBPC 4XAFA 4C6PA 2DVXA 3GU1A 4RDVA 3GU2A 5G4HC 1V77A 3LGDA 4IG2B 4JOMA 3QY6A 2ANUA 3GUWA 2EG8A 3MVTA 4IH3A 3E2VA 2E1WA 3NEHA 1YNYA 3SFWA 3E38A 4C6NA 3LGGA 4C6CA 4INFA 3A3WA 2HBVA 4WVXA 3MVIA 3OVGA 1XRTA 1EJUC 4XAYA 3E0LA 4R88A 3ISIX 1KRBC 2BGNE 1A4LA 2FVMA 3LY0A 4GZ7A 4C5ZA 2W9MA
chains in the Genus database with same CATH superfamily
3MI2A 4HJFA 3SECA 1V02A 4HHPA 5DQHA 3UCCA 1U1UA 2OR2A 2W67A 4WX2A 2ZE0A 3W7QA 4GG9A 4QQUA 5C54A 2GSEA 3UG5A 3CGTA 2WMFA 4RNFA 3CV2A 2HS8A 1VRDA 1TELA 1SZEA 3PULA 3T8LA 1VFOA 4NI8A 1CIUA 1YPIA 3WCZA 4J9OA 3TFXA 2P8BA 1TRIA 2C2RA 4ED2A 2DVUA 2GJLA 1OX4B 1OG0A 3WD4A 4FOKA 3PZOA 4MLJA 1G9HA 2NV9A 4XTDA 1MRQA 2OEMA 1M5WA 1JRCA 5A2AA 1ZAJA 5A6LA 3KAOA 3VNLA 3K2GA 3S46A 5B7YA 5J04A 3PN8A 4DHGA 4B15A 3N73A 4IIBA 2ZUTA 3SCSA 5ABGA 2BP1A 1KFBA 4EXAA 5JBDA 3OGRA 6REQB 1SZFA 5BXTA 3PB0A 3BGJA 1BQCA 3CWHA 3CQ0A 2RDIA 1M7XA 1RVKA 5C8BB 1UQZA 5BOEA 2GUYA 4ZL1A 3UG8A 4S3CA 1AFSA 2FLLA 4UTIA 1XBVA 1QFEA 9RUBA 2X1TA 3QTGA 4WDXA 2J6TA 2J9ZA 2ATSA 3EKGA 4Q8OA 2OYLA 5AZ0A 3N12A 4QAIA 1TV2A 2OODA 1VBGA 3L4WA 2WKGA 1ISWA 4EK7A 1AW5A 1YQ2A 2FKPA 2CFFA 1M41A 4WJEA 4RX0A 3A21A 4AX7A 1OFBA 3G6VA 3RBDA 3IIPA 4IJBA 5JH2A 2J7DA 1FX6A 2J7GA 5CC3A 2CZDA 1R2RA 1KCXA 4DXVA 1QK2A 3PWAA 4GXPA 4AX6A 3SSJA 4IFKA 2WB5A 2ZYFA 3CEUA 3W88A 3NGDA 3DHUA 3TNBA 2CWNA 1XKJA 1NQ6A 3NQAA 2HK0A 2F38A 2G37A 1A5BA 1GHSA 2VFIA 5H8UA 4PBGA 1FCQA 5ABEA 1NOFA 3H2CA 3UXDA 4LOCA 2D24A 5CPOA 1B1YA 3M0KA 2E09A 3COTA 2PLCA 4N4PA 4L7ZA 4ECZA 3TTYA 3CBWA 4OJYA 3UR2A 4A35A 1V0NA 1EL3A 2QJMA 4DJDC 4GI4A 2WVVA 1QHPA 2UV8G 4LWWA 2ONEA 2J7FA 5IXEA 3WNLA 3BVJA 5LGZA 4R33A 2D69A 3SUWA 3QV8A 3WL0A 3G0SA 3EXRA 3AS1A 1W8GA 1GEQA 1M68A 3NPUA 2DU2A 1W9BM 1GVOA 4RE2A 4YCOA 3Q45A 3CTLA 3G1RA 1XF0A 1X98A 2CLLA 1BWLA 4L56A 3N11A 3VMNA 2VM8A 3MKCA 4LAMA 5CLTA 3DI1A 4O18A 5K9DA 2G3IA 2XIBA 2QCEA 1JULA 1G01A 2WV8A 5D02A 1KQZA 2WMIB 3GYEA 2XH0A 1Z8AA 2C13A 2J25A 3NQCA 4GH3A 5M2FX 1G0CA 3ARUA 4KW2A 2NQ5A 4NHVA 2TAAA 1E73M 2VCBA 3NO3A 3PR5B 3W7LA 4JR5A 1R46A 1B3OA 2ZCGA 1UWTA 2PAJA 2ZICA 3PJTA 1CGUA 5IBXC 1K8CA 5KG0A 3FAWA 3DOPA 4Q4PA 1TVPA 4XBKA 3W27A 4RZ4A 1FWAC 1AQMA 2GQ3A 3EB2A 4DJED 5BRQA 3GBDA 2QYGA 3LRKA 2CWXA 2QJIA 3KTCA 1QI4A 4PSPA 1QNQA 1S39A 3OQ8A 5HNTA 1JIBA 1DWGM 2XUCA 4EAMA 3P5ZA 4KERA 2JEPA 2DVTA 4ZENA 1QOPA 1PEZA 1EC8A 3DEQA 2AL1A 3GXTA 1W5OA 3VABA 8XIAA 4NASA 4Z1CA 2O56A 4PL1A 5KMYA 4JTGA 2A7NA 1BVNP 3UWWA 3B8TA 4Q4QA 4XUGA 1DWHM 3RX4A 3B9AA 1OFRA 4JTKA 2OEJA 3H6OA 4GHRA 3WBWA 1KM4A 2JFEX 2WXDM 2GPTA 2V4RA 3WMBA 4BS0A 4DUOA 4CQBA 2A7PA 1WXZA 8XIMA 1AG1O 3QFEA 1TJRA 3ITVA 5BWFA 4LUSA 4ACZA 5D32A 3VOFA 1VHNA 2PTDA 1H1ZA 3AJXA 4N2YA 3FV9A 3A24A 2R14A 4I8DA 5BRPA 1DP0A 3MR5A 2RDXA 4GBDA 3C0SA 1PZ3A 2ACUA 1E0WA 3R0KA 4JCLA 3N18A 3D46A 1KQYA 4NAFA 5CGMA 5KFUA 1CECA 1LQ2A 1GOWA 3U7BA 4C1KA 3KOYA 4TMBA 2V3EA 1DE5A 2Y61A 5C7VA 4C6PA 1XS2A 5DMYA 2ATLA 1BAGA 1UH2A 4IH3A 1O4UA 1CYGA 3ITGA 5AOUA 1TWSA 1UUQA 5C9WA 3W3OA 2VDIA 4XAYA 5D33A 1QPOA 4J9PA 1NU5A 3PZQA 3GAKA 4JN6A 5DF0A 4EEYA 3SIMA 1V8EA 4Q7NA 4NYYA 4EXQA 3NSNA 3WLPA 3R5EA 4ZB5A 2EJAA 1X1ZA 3VGFA 3AU2A 3NM3A 2PWUA 3II1A 1XLJA 3T07A 2QIIA 2Z2UA 3DKLA 4AW7A 4KIRA 1FOBA 3GYCA 2VL4A 2WBKA 1ZQ5A 3HQOA 1UD5A 4HU3A 3RPMA 4E6MA 3U4AA 3EDDA 3DG6A 3L4YA 1E5NA 3O9NA 2F2KA 4F9JA 4TTUA 4AEFA 2HVMA 1IXOA 1I1XA 3W1NA 1MQQA 3R58A 3ARYA 1WV2A 1X97A 4K1WA 5ABTA 4YMZA 4RKAA 4GX9A 3IIVA 3UG3A 4YVVA 1GCYA 3HGRA 1K6AA 3T0BA 1DTNA 4DL4A 2EGZA 4L6DA 4OE7A 1JZ8A 3D6NA 1DJYA 4MWAA 2DUXA 3CASA 2TSYA 2JF7A 2Q01A 4EWJA 7REQA 3FW6A 1VH7A 4UIOA 1B54A 5CSUA 3BAWA 1Q6LA 3PNZA 4WSKA 3UPMA 2V30A 5HWNA 5IRPA 1QASA 3PUDA 2XVNA 4B3KA 3GVGA 4F0KA 4XVEA 4IPIA 4XTIA 4HNNA 3PVXA 2C3ZA 4DWSD 1LP6A 1RJPA 2VTFA 2QS8A 1XDMA 3OA5A 4OUIA 4H00A 5HK4A 3CUHA 1W1A1 4XZ9A 3HG2A 2W66A 1O5XA 1CXLA 2WNQA 3VUSA 4U7CA 1JXJA 2FZ9A 3IGSA 3KS6A 3EWXA 4ZO7A 5HULA 3P7YA 2Z4GA 4AZ5A 3MKKA 1UZ4A 2ESCA 1P0EA 3N2CA 2CLFA 3TYBA 4DUVA 3NQDA 2VRQA 3OVPA 4K68A 3C0JA 3GWQA 1PCWA 1QW7A 3ITCA 1TMHA 4MZ8A 5HNRA 5EY5A 2Z1WA 1TX2A 3A4WA 2OGYA 4MNMA 1YIXA 4YHGA 1UWQA 4J1OA 2QCDA 4OBRA 2GVEA 1XH2A 1JZ7A 1S2WA 4ES4A 2E28A 1EWEA 3VIIA 4HPGA 1UJQA 3QV6A 3BQ5A 2XH2A 4A8IA 1EH9A 1FBAA 4AC1X 3SZ8A 4FXSA 1S1RA 5HINA 3NXFA 1NIUA 5FJTA 3WDQA 4E38A 2BY3A 3GXMA 1YDVA 3IJIA 4K39A 4CCDA 1TV5A 3PP7A 2I14A 3W07A 2FGLA 1V6WA 3ARSA 1VHCA 1TPC1 1HQTA 1XINA 3NOYA 4QRNA 5EMJA 1HF6A 3KFTA 5KFTA 1IEIA 2YJQA 3OVQA 5HMEA 2WMGA 3VDGA 5J8LA 4GH1A 1AJZA 4E0CA 4P7OA 3VM5A 1MW0A 1Q45A 3IPWA 4Q45A 2P53A 4W8LA 2OMAA 3W72A 1SR0A 2POZA 3OW1A 4O0QA 5BOFA 4B9ZA 3N2MA 1L6YA 2CLKA 1BF6A 4U4MA 1VB9A 4Q8MA 5MKGA 1S2AA 5LKYA 4K38A 4B16A 4YVPA 3SSZA 4HHMA 1S2VA 4HTYA 3KVKA 2QUNA 3M6YA 3NQ2A 3GU9A 3WLMA 6TAAA 2XM1A 3JU2A 2F6KA 1A5SA 1QW8A 2QVNA 3VK5A 3E0IA 2YXOA 3W24A 1XDJA 3B0UX 2Z1SA 1PKMA 4J7RA 8RUCA 1FCUA 4AFYA 3BGGA 3GO2A 4M5PA 3KWXA 2BMBA 5BRBA 1ADOA 2IW0A 3IACA 3K1DA 5CZ0A 2GWNA 1XW8A 5LIXX 3P60A 5CSRA 2RH9A 5HQLA 4Y8EA 1YYAA 4H6RA 3CPUA 3QBUA 4XIMA 2XGQA 2ZX8A 3MS8A 3TMQA 1MFVA 2NSXA 2EPMX 2WSRA 1Z89A 4GO8A 2AGTA 1XPYA 2P88A 1CGVA 3BL3A 2RDTA 3HQNA 1F74A 3LTPA 4CKQA 1GQLA 3ALGA 1BYBA 3CYVA 4CNPA 3T05A 1EOKA 1PHWA 3MBDA 1T8XA 4Z2IA 5LZLA 3RMJA 3EDEA 1BXBA 4JTEA 1QNRA 1V6TA 3S2LA 3BAXA 2A6LA 3GS6A 3S6OA 4RNIA 5KETA 1VJIA 2FTYA 5L1LA 6ALDA 3TA9A 1E4IA 2P0OA 2O4MA 3W85A 2EKGA 2CPUA 4S3EA 2W7OA 5CC7A 1HTIA 2VA3A 1B5TA 3H55A 4MB5A 2EJ1A 5KFSA 3R12A 2NWSA 4ZO9A 3OSNA 2HXUA 4JX5A 3UWVA 2PTYA 1XCXA 5KFRA 2O9TA 3M7WA 1A53A 3BJSA 3PTMA 2QQ6A 1X8FA 1LWIA 3CHEA 1ZLPA 1E70M 3V1HA 3AICA 3ANYA 3GTHA 1AK5A 2J7CA 2BLEA 4NRSA 3MHUA 4JN8A 1B3VA 3RPDA 3N6HA 4TUFA 3PG8A 3WFAA 4DM2A 4FR1A 3K4AA 1LT8A 3XINA 5C5YA 3GUWA 3W23A 1Z32X 3M0ZA 1UKTA 1T6MA 3KBNA 3UWEA 2DZTA 4C6NA 2DP3A 1R3TA 2C91A 2Z6JA 3DECA 1TZ7A 1D3CA 4INFA 3CZGA 4HA4A 2HBVA 4HNTA 4AYGA 1EJUC 3AOFA 3LRMA 1KRBC 2BGNE 2FVMA 1DORA 2V63A 4H3DA 2WSYA 3G22A 2Z29A 3VIHA 5F2LA 1ZBCA 3H4GA 3WBAA 1C90A 1TE6A 3HZ3A 3ZSSA 3CAWA 4FOJA 1F3WA 4QAWA 1KFJA 3TW6A 1O7AA 1OY0A 3NQGA 3WEOA 4YTRA 3PANA 4WLCA 2R9RA 3WEZA 3KCOA 4LB4A 3MHFA 3KL3A 3QZ7A 1AD1A 2IPFA 5IDZA 4X3ZA 3ZR6A 5GNYA 3T44A 3W38A 4WOZA 1VIZA 1SR9A 1KLYA 2B81A 3ZJ7A 3OP2A 4G1NA 1ME8A 1OC5A 1W3IA 2VOTA 1TV8A 4C6FA 1Q4NX 3WF2A 4FI4A 4I3GA 1UKPA 3KVMA 4JTFA 1B57A 3GG7A 3QMSA 1PKYA 4DX3A 2R8WA 5LHEA 3VIMA 5EBUA 1Z41A 5A6MA 1J10A 5L1IA 4RE4A 4N02A 4PCFA 4O8RA 4ZFMA 1ADSA 1OHLA 3K30A 5I78A 2FMNA 3TJLA 1D3GA 3A6OA 3OHIA 4F4YA 1GOIA 4LVFA 1TPB1 1NDVA 3W1PA 1KGUA 1W2VA 3ATZA 3KP0A 2TODA 4H7CA 1E1CA 1SFTA 3AIWA 3L21A 2BX7A 4J2PA 3OBEA 1KM3A 3R8RA 3WFZA 2QAPA 4IGMA 3T4CA 2HV5A 2YGYA 4RUCA 4HHLA 3CS2A 3W1QA 4RUAA 4B2DA 1PIGA 3MSGA 4YN5A 4EBEA 3UETA 3DC8A 3W26A 3VX0A 1OCNA 1W3KA 4NL1A 2GQAA 1US2A 4IOTA 4GZEA 3GGMA 3VYLA 1P43A 3N9SA 3T1GA 2I7GA 3PBWA 5CLWA 2ZXQA 3G1XA 2GSJA 2G3JA 1MEHA 3TN5A 4W8AA 2V8ZA 4KETA 1KWGA 1WAUA 1Y8BA 3MUIA 2JKPA 5I79A 1GVQA 3NIYA 3LCXA 2GK1A 4NNAA 4FNQA 1WUEA 2DJXA 4B5UA 1ZFJA 4TQSA 1E0UA 2Q3OA 1EO5A 3UCQA 4FLQA 2E6YA 2BODX 4DNMA 1WDWA 4GQQA 3GB6A 2PDWA 3AWOA 1JPIA 3U4FA 3PTKA 4O3SA 2BSLA 4JTQA 4Q32A 3WH8A 2XJ7A 1SJAA 3PW7A 1GVIA 7XIMA 3MI6A 1WQ5A 5KTLA 4FBUA 4Q8EA 1XIFA 5LA0A 3MR3A 3OLGA 3IAPA 5T9CE 1XYLA 2W9BA 1WX0A 4NAEB 2OT1A 4RNOA 4QDPA 4LYKA 5MF5A 2I9UA 4KCVA 4GUGA 2HDJA 4KRUA 5FESA 1QK0A 3C4UA 5HPCA 4IISA 3N4EA 2FPTA 3GVQA 4O10A 2QT3A 3RX2A 3CAVA 4AWSA 3QLLA 4US6A 3GTXA 3TCSA 2VCAA 1V7YA 3VGHA 3TIMA 1IQ8A 4UZUA 3MW7A 2VDGA 3URNA 1B30A 1QATA 1I9CB 4ECQA 1DXIA 2I9EA 2EPHA 5HDRA 3GDTA 1YKWA 3WNPA 3BW3A 3O6DA 2XFRA 3SEPA 3U2OA 3BGAA 3TEVA 2H8XA 5EWEA 2QW5A 4AEOA 2WLYA 3F4NA 3KOXA 2Q8XA 1QWGA 3GC2A 3M0MA 2OO0A 1NVMA 3V18A 2DZXA 3G6XA 1RY8A 4JTRA 1WOBA 5CG7A 3W76A 3I6RA 3PPFA 1PB0A 1VLWA 1AQ0A 1MXDA 2QJGA 3TP4A 1N82A 3MMDA 3TC7A 1JYVA 3OZYA 2DT3A 3B3DA 2EF9A 4HK7A 1R3QA 4ECYA 3I6TA 1IT0A 2G95A 2ZVIA 3WBXA 1ZNNA 3IJ6A 1TTJA 3W1XA 4MM1A 3ZSTA 2XM2A 4PSRA 4ECTA 2HJPA 4WXZA 5L1KA 3FOKA 4HZMA 2ZC1A 3AMCA 2CBJA 5ENLA 4W93A 1FHUA 2GGEA 4ZE4A 3QQ1A 3PZNA 2D1ZA 3NFUA 1W9UA 3IK4A 1TMLA 3N4AA 2C6QA 2V81A 1RK5A 1QNOA 1EC9A 1IGSA 4UNLA 4IPPA 5TQLA 2D0HA 1C91A 3L12A 2GDVA 4IXXA 5C2GA 3KL0A 1QPNA 3VKCA 1PWMA 1EIBA 5DMLA 4O53A 2OYMA 3L5MA 3NQEA 3EZ4A 3C0LA 1YE4A 4LC6A 5LXEA 4EANA 3OBAA 4HNVA 1EBGA 2ZZ5A 1QW9A 5DXXA 3SCWA 1B4EA 2ISVA 3V6HA 4PUNA 4YNGA 2W5FA 5FEPA 3HMCA 2FB3A 3WF1A 2OTDA 5D05A 1H3GA 5D37A 4YQWA 4S3DA 5AHFA 4RPPA 3NQ8A 3H7UA 4HZ6A 4DWSB 1BXNA 3NZGA 4PA8A 3SCNA 3EDKA 3D3AA 4NZ4A 5IDIA 4XSLA 5HMSA 4CD7A 4O3PA 1LBLA 1UOKA 4PYSA 5D4YA 2CHRA 3AZRA 3GDMA 1MYRA 1ISVA 3PY2A 4WEVX 4QE4A 2POTA 2GJRA 3DHPA 4HOZA 4MWAC 4LT9A 2QMKA 2Y8KA 5HJXA 1HJVA 4AIEA 4Z0JA 1R86A 5D2VA 2PWVA 5AC4A 4AMAA 1H7OA 1N55A 1TTPA 3BURA 4MGGA 3UVAA 4PCTA 4RNMA 4Q4SA 4JFUA 4GCXA 3WD3A 1M3UA 2UVUA 3KLLA 3IVTA 2J27A 1NP2A 1C8XA 4QSFA 4FO4A 3TZNA 1EQPA 1UWUA 2OOFA 5TAOA 1A5AA 3OLEA 4E5TA 3KWSA 4NYUA 1P7TB 4S1FA 1AH0A 2DPEA 1C8QA 4CU7A 2ZC8A 2QUVA 3DFSA 2GDUA 5GJPA 2WHMA 4IX0A 3FVMA 3MYOA 3G6YA 2YZ5A 3THCA 3ONBA 3UZYA 5ABFA 1BKSA 3VIPA 4Z1YA 3PZPA 3EMCA 3HBLA 5GQBA 3GFXA 3NDZA 3F4VA 4JEQA 3W2LA 4KWOA 4ZSUA 3WIJA 4HCHA 2DZPA 2OJPA 2JGYA 4GKLA 5I23A 1JF6A 1Q6QA 5LNRA 1FKWA 1BQGA 2WPBA 4Z2GA 3N15A 1XISA 3H2OA 2R1KA 1R38A 3W74A 2VURA 3N34A 5DT7A 1YDOA 3H54A 3N2OA 3UWQA 3EAUA 1NWUA 4V1XA 1UR0A 3E0VA 2GYIA 4K2SA 2VENA 1KW1A 3SUUA 2Y0FA 3RJYA 2GOKA 3VCNA 4KWWA 1OX6A 2WSQA 4IGHA 3FK4A 3LHVA 5K9CA 5I3IA 4GC3A 5HJYA 4DRSA 2E3ZA 5KG4A 2CW6A 4NXSA 2AQ4A 4CNNA 2OWCA 3OLIA 4YXGA 3J7HA 2BVYA 4JQAA 4F9DA 4QX4A 4OIFA 3O6YX 2IUZA 3WX7A 1MNSA 1DV7A 1TJ0A 2C18A 4JIRA 3Q4DA 3OYZA 2XSXA 1DWIM 3ZVHB 1EP2A 1H7WA 4ZR8A 3APTA 1W32A 1B3WA 1Q63A 1TB3A 2FGBA 2BB0A 4AG0A 1KFEA 3ARZA 4L80A 3WDIA 4M80A 3C2FA 4J3XA 2HRWA 3BCJA 1LBMA 1UG6A 1FTXA 1IWBA 4W85A 3H40A 5JQ9A 4LU0A 3HPXA 2TMDA 5DGAA 1F8MA 2EXOA 3TXZA 3B4UA 3R1ZA 3UZWA 1YX1A 3BSMA 5K7JA 3HPAA 1LT7A 5HA7A 4QNWA 3K8KA 4C6IA 1J79A 1SJDA 1Z3NA 1LTDA 3KRUA 4GFIA 3NQFA 3RB0A 4XB3A 4LUJA 5BCAA 4QDMA 2GVLA 3GG1A 1GK8A 1BF2A 4HT3A 3RAOA 2DSZA 3EWZA 4H9YA 1BRLB 1RLCL 1XV8A 3SUVA 3TJ4A 3WBEA 2Q6ZA 2ZRYA 4WJXA 2D2GA 4N42A 5G2WA 5AYIA 3W87A 3M0XA 2GZXA 1DJNA 3M5VA 1NAL1 1W1VA 1BPLB 3C3UA 3MHGA 1K9TA 5F1VA 3LERA 1P1MA 1A3XA 1QVBA 2H8ZA 3AXXA 3VXGA 2DV0A 4ZXOA 3GSMA 1UD2A 1HJXA 3S1WA 3SJ3A 4TX6A 5A69A 3NDOA 3G1VA 1KKOA 3MA8A 3WNNA 5FF4A 2UY3A 2YDRA 3FKKA 4DZIA 4G8TA 3QEZA 4E2OA 4O1DA 5AC8A 3WNOA 4ECRA 1UBSA 2XIOA 4XKYB 3HQPA 1OK4A 2W3ZA 3G77A 3WO8A 3N25A 1EZWA 4TVUA 3AMDA 5FF7A 3W25A 2E68A 3B06A 5EA9A 1EJXC 1IEWA 1YXDA 2PP3A 3PBMA 5EL1A 1IXQA 2E5CA 2ISSA 1K7FA 3BTNA 2JEIA 4UOQA 4B4HA 3VE7A 2NXHA 4G6CA 4FR6A 1Q2RA 2CXGA 1UC4A 3UXIA 3C61A 3AYRA 4LX4A 3GXFA 3QJAA 1R3YA 1CGTA 4H9MA 1CBGA 2QNEA 4B5XA 1XIMA 3VC5A 3R8GA 4CD8A 2PS2A 2VEGA 3BZJA 3QY7A 3WQ6A 4BKNA 3W7DA 2C15A 4J3VA 4K8HA 3CUFA 3MY9A 4QW9A 1ENUA 3ZM8A 3TH6A 4JV2A 2PDMA 1Q13A 3LM7A 4A2RA 1XGDA 3L66A 1S1PA 3LZ5A 2WQDA 4PUWA 4GC4A 3RM4A 5CBBA 4LPCA 3BJYA 4G5DA 1CGXA 2EG7A 2XG9A 3LBMA 2QDEA 3M5YA 1VPQA 4FF5A 4GI9A 4PE8A 2VR5A 4NNCA 2AL2B 3GNXA 5I3KA 4WRHA 5J5DA 3N6QA 4JIIX 3FLUA 4R8UA 2NXGA 1UUMA 4ICMA 3UYIA 4OV9A 1HKVA 3GR7A 4DVOA 2BHUA 3ABQA 1XD1A 1HVQA 3SGUA 2Z2BA 2WC3A 3DGRA 5DANA 3WUGA 3TTSA 1S3HA 3M44A 4IL2A 1UPMB 2ZRVA 5L6UA 3G6LA 1IWAA 1Y0EA 4UQCA 2EPNA 1J0YA 4ZQPA 2RDJA 1R30A 5FJIA 4Q4KA 4X0NA 2ZZ1A 4FIQA 4UR9A 3NL5A 4WKAA 2RHGA 4EF8A 1FDYA 4MB4A 3S9ZA 1B9BA 2FZNA 2YX0A 3BLOA 5T91A 4P7QA 4IF2A 1RR2A 3B03A 4TOQA 1L6GA 1GKRA 2JE8A 2JEFA 2NV2A 3TR9A 4EBCA 1YHTA 4P8WA 1MWOA 1LLWA 4O1CA 3IANA 2IS7A 2FFIA 1OFAA 1Q6GA 1UR8A 4HHHA 1W3TA 1CENA 2PGRA 3RN6A 1TA3A 4QR6A 1OZQA 4UQDA 1H0GA 7TIMA 1PZ0A 1OX5A 3T5LA 4XZBA 1XRSA 1R2SA 1ZBKA 3DN5A 3CWNA 1QPRA 1NTHA 1RK6A 3V4BA 2GJXA 1J8VA 1KGXA 3ECQA 4CNTA 4L5ZA 1ZCCA 3LMZA 2FTWA 4H9TA 2ZVRA 1XLHA 5XIAA 4BQ3A 4QGCA 1IF2A 3R0DA 3PW0A 4J9MA 1W37A 2BOEX 3MUAA 1HIZA 7A3HA 4ZSTA 1H50A 2W62A 1Q4WA 2DW6A 3R94A 3M07A 3IWPA 4DPQA 3H70A 4U2YA 3V75A 2VWSA 3PUOA 3URAA 1REQB 2JIWA 4Q43A 3MV01 2PDIA 5AYYA 5AVNA 4BY3A 1JRBA 3GFYA 1K1SA 3NTYA 4AH7A 3AYSA 4GIRA 3LCLA 3P2VA 2VQTA 2PU0A 1W9VA 4DBUA 2A3CA 4I9JA 1DOSA 2CZVA 4LCRA 5E0FA 1K8ZA 3UA4A 1W91A 4ECVA 1R9XA 5EMMA 1W5MA 4R27A 1EHAA 2R8GA 3VUPA 3GIPA 2CIPA 3IAQA 3CL8A 2PDJA 2F9RA 3C56A 3CUIA 4R34A 3B0VC 3H24A 3QR1A 1PUDA 4DJFD 3EYPA 3M0VA 1FDJA 3UJ2A 3WJZA 1FWCC 3JZEA 1MUWA 3EGJA 4XUYA 4FB7A 4TMCA 5AC5A 1H2JA 2PZ0A 4NJJA 3Q58A 2VNCA 4OQVA 3L0NA 4QDWA 4XZLX 1Q7MA 1EGZA 1XP3A 2HK1A 1JGMA 2X0HA 1LLZA 2KAUC 3A4AA 2FFCA 4GGHA 1JAEA 2RJGA 1UUOA 4IG2A 4LS0A 4QLJA 2B7OA 4YR3A 1WZLA 4GY0A 3M0LA 4L6HA 3CHCA 1ICQA 3RMEA 1RA0A 3QOKA 3M46A 3H12A 5L9XA 3WH7A 4GWEA 4LALA 4AY1A 5FJPA 2Z27A 1IIHA 3G2GA 3DUGA 2GQ9A 3SGZA 4H8VA 2VRJA 3KLKA 3MZNA 3DFOA 4L9XA 1J96A 1O5QA 4Z1BA 1H49A 4QXIA 5I07A 2G97A 4J9RA 1GOQA 2X1IA 3BV7A 3KVLA 3CMGA 4TTGA 3SI9A 1JEZA 3WF0A 3LLFA 2PWGA 4V28A 1ZJHA 3SI8A 2X41A 2Z6IA 5G1YA 2R8JA 1US3A 4GJ1A 4HBKA 2P8CA 4MTVA 4WZHA 2FLNA 1CXKA 1F76A 4DJEA 3GVRA 1HJSA 5KZMA 1YBQB 4PFHA 3SCRA 2X09A 3QXBA 3V0SA 3IN5A 1PJ9A 1EDGA 1PZ2A 4CN4A 5K2ZA 2VRKA 1Q3NA 1TO3A 1BSLA 3HGOA 1OT2A 5JVLA 5DG7A 1O66A 4W84A 1CW2A 4NU7A 5EFDA 4DN1A 4EPEC 3TQVA 3CYJA 5LNUA 1RJQA 1KM2A 1DPMA 1NFPA 4KF1A 4LNYA 4Z1DA 1IGWA 3UXAA 1US0A 3BK0A 4QG8A 3SN0A 3ZWTA 2XIIA 1XWYA 3UD6A 2E6AA 4MKNA 4PC8A 4LY4A 2FHCA 5U4NA 1XX1A 4N9EA 2WNNA 3CUXA 4G3IA 2IKGA 5T14A 3WH9A 3OZOA 4IMAA 1GW9A 4PMUA 4ICNA 1JCJA 4H01A 2O7QA 5I77A 1KM1A 3MFIA 3EOOA 3ARTA 4UTTA 1GUVA 3D3FA 3S47A 1J2BA 3M9NB 4Y7EA 4ED6A 2VC7A 2W4XA 3OQEA 4J9SA 3BDKA 3WF3A 5M5DA 3A23A 3S1UA 2F6UA 4CLMA 3EEZA 4IT1A 5AC6A 4TVDA 1O1ZA 2HNHA 3AU6A 1MRAA 4PUUA 5JU6A 2WJZA 5HWMA 2YKKA 4LUTA 1JCTA 5DEZA 4AHOA 2BWGA 3KE0A 5A6JA 5AY7A 1SO3A 1ONXA 4Q8WA 1K7XA 1QWKA 2G3MA 1KM0A 4UNIA 3B05A 3IARA 4E8CA 3WQ5A 4IFKB 1C9DA 4QFUA 5A6BD 1JPMA 4LEFA 4L4MA 5M03A 4WHBA 1GG1A 2BOFX 3GAYA 1U5HA 1TQXA 3P80A 4N6FA 1FP8A 4WGXA 5I3DA 4J5NA 3SN4A 3R8HA 1EJSC 5GNXA 5MHBA 1RUSA 4KQNA 1T5AA 2OGJA 5BW6A 4DO4A 3WK0A 3TMLA 2ZIDA 3ARXA 5EGRA 1XIEA 3G1AA 3WD0A 4CNOA 3GDRA 4GNKB 3OB8A 2A5HA 3SFWA 2WVVB 3KRZA 3AXIA 1FRBA 2HEJA 4AWEA 1T99A 4XISA 4ZVJA 2ZA1A 2E40A 3VKBA 5KITA 2WWCA 3KRBA 4W89A 4GJJA 3GR4A 4GUHA 3HGSA 2PCQA 3PZUA 3G18A 3CAKA 4XQ6A 2BDQA 1GJWA 3WELA 1RCXB 2PGFA 4TX8A 3KXQA 4IP5A 4IFOA 1ZL1A 1B3ZA 4O3NA 2ZZ2A 5KFOA 1H51A 3VOGA 1YW1A 4AXNA 2A85A 4AIUA 3RIKA 3WQWA 4H9UA 1GVEA 4BZYA 3A13A 3ZT6A 2V5KA 4KH2A 4CNSA 4QM1A 3W1UA 3JW7A 2H6RA 5A8GA 4WUIA 2EHHA 3LS9A 5CPQA 4IXHA 4KRZA 2QF7A 5A1AA 1XIIA 4Q8NA 3SAZA 2A6NA 3DKJA 4FAMA 2XZ7A 1S0MA 5D9MA 1BWVA 4WSJA 4DWSA 3BAYA 3WFLA 1EPVA 1I1WA 2Q02A 3ARRA 2P5NA 4PUDA 3WQCA 5GVJA 1C8YA 1QPQA 4PBFA 2QPUA 2XGPA 4DBDA 2D0FA 3S1GA 1VYSX 3CUJA 3QM3A 3K8MA 3PBVA 1I2NA 2RAGA 3BOFA 4LAUA 3QGKC 4LVGA 4FALA 4R85A 5F4XA 4D1JA 3WNKA 4KFOA 3DBNA 2WJEA 4Z2JA 3BLKA 4FEZA 5AYXA 3O16A 1TV3A 3FYOA 2YCEA 1PX3A 2DIEA 2PLMA 1KBJA 1KBKA 2WOQA 4Q8VA 1GZ1A 1V08A 3NQMA 4QE5A 2IA6A 3WD2A 5AZ1A 2OU4A 4FLOA 4UOJA 3G3DA 4KT2A 4U31A 1UZHA 1I6NA 5HMFA 3OA3A 3S1XA 3BC9A 1ICSA 5BNKA 3GX9A 3RRAA 1OADA 4ED3A 4DM1A 3PFMA 2OZ8A 4FNUA 4TVCA 4ACZB 4P5UA 3V5FA 2BQRA 2X1RA 3C2RA 1VCGA 1GTEA 1I75A 4LTSA 4US5D 4GI6A 4AVNA 4IGSA 2WTFA 5DLGA 3GH4A 1P4CA 3W71A 3DFNA 4W7UA 4C7GA 4WOQA 1IEVA 1EXBA 5AYBA 3O63A 3LPFA 2YBUA 1NF0A 4NAFB 2PP0A 3OYXA 3HN3A 3CK5A 2R1MA 3VD4A 2Y2WA 3TU9A 4X60A 3VU2A 4H8UA 1U5JA 2JF6A 1FHVA 2F7FA 3GVVA 4N7QA 1F5ZA 5KFIA 4G7FA 2IBKA 3STFA 1EP3A 3TSMA 4PEKA 3ZFHA 5DRCA 4JKLA 2Y88A 5DBUA 2OH2A 1H41A 3F5LA 3RFAA 3W6LA 3GKFA 1NOWA 1RALA 2Y6ZA 1TX0A 3W01A 2FJKA 1VR6A 1ZSXA 2QPXA 3ZYZA 3GNDA 1EYWA 5KFDA 1TUXA 3ZO9A 2Q71A 2YXXA 4FIRA 4O28A 1RH9A 2CITA 3DH7A 2YBVA 4PTVA 4MB3A 5HATA 2ZA3A 1MXGA 2FZBA 4HVXA 5LXXA 2ALZA 2INEA 3FS2A 5KFYA 1OC7A 2R1LA 3SM0A 3W1AA 4CQ9A 1PKLA 2QCCA 1LRNA 5JUVA 2PBGA 1JFXA 3TWBA 2CZFA 1H63A 4M81A 1TG7A 1E4MM 4FA3A 3PBYA 5FL0A 6PTDA 5HQMA 3LXCA 4FZIA 3W73A 4AF0A 2ZRZA 1HKWA 3M9OB 2OSXA 4XBSA 3W7EA 5C2XA 2YYUA 1VCVA 1VFFA 4PMNA 1N56A 1NDZA 1AW1A 4MWAB 2C71A 3W83A 3BO9A 3OVRA 1MW3A 1S5WA 5A6AA 4E8GA 7REQB 4AMCA 3AXHA 4JL1A 3ORWA 1LUCA 3S5YA 1BRLA 4XBJA 1V0KA 3RF9A 4EVZA 4J3ZA 5A2BA 2J9XA 1QAPA 2BS9A 4XIAA 3VZYA 3I7SA 3FAXA 3K4DA 4LVBA 3UR8A 1XGEA 2ZTJA 4F2TA 2DZAA 2J8TA 3LOTA 3H4WA 3WH6A 4JIPA 3LU2A 1NDWA 1J0IA 2YLAA 5JIPA 4GK8A 3MC5A 4QP0A 1K7EA 2XDFA 1WKYA 1CI1A 2OZ0A 1UQYA 2PDGA 2NQHA 4UMBA 2B7PA 2CCRA 3PWIA 1HP4A 4CN1A 3ME3A 4P61A 1E5JA 4YP3A 3VFLA 4JDYA 3P81A 3PW2A 4B3LA 3VA8A 1OB0A 3KUMA 2REQB 4MPKA 5EPDA 1JFHA 2Y4SA 2YL9A 2C1GA 2E9LA 4HKPA 2QCDB 3W1LA 3WQ8A 5A6KA 3MP3A 3EOLA 5EWFA 1KNWA 1NARA 2HWGA 2PSNA 2OQLA 5D8WA 2XCPA 1DEDA 2J6UA 3R4IA 3S5ZA 1ZU8A 4GZIA 1EKOA 3W7CA 3WUBA 3H2FA 3U7VA 1HL8A 2Y5EA 1J6PA 2Y85A 3F2DA 1B4KA 2A4AA 1DJGA 1TWWA 2WHLA 1V0MA 3B8DA 4JFSA 5LNWA 4I9MA 3W7PA 3NEHA 3VGDA 3UEQA 4KWUA 1S2CA 3QKZA 4EX4A 1SUXA 3VNMA 2VJXA 4WJ8A 2PDBA 2HXTA 2PD9A 1XM3A 2AGKA 2XIMA 1BVWA 3MYPA 2WMKA 2YSWA 4U33A 4D9PA 2FH6A 1G7VA 2JALA 4AC7C 1OBAA 1SW7A 3GHUA 3UJRA 3NPVA 4HB7A 1D9EA 5MKGB 3WDPP 1UD6A 5F2GA 1UMYA 1RQEA 3DDMA 3LLXA 1L6FA 3A22A 3MU7A 2VKZG 1E1FA 3IVUA 4NJIA 1JQVA 3QW3A 3AMKA 2QJNA 2E9MA 3DIPA 1WDQA 4DYEA 1V0LA 3VDAA 1ZS2A 2VP8A 5U7SA 4ERGA 3B9NA 1F4HA 4MY1A 3V1PA 1AJ2A 3LUTA 4C6EA 4GUFA 2VHLA 2CBVA 2WC4A 4KESA 2A3EA 3LLDA 3VIGA 2Z25A 3I6EA 3GV5B 1OGSA 2YA0A 4ALDA 4MFEA 3VPLA 4ZB2A 1FWIC 5TD4A 4UC5A 1E9IA 2V3DA 3U0HA 1XYMA 1DBTA 1H09A 3H2NA 4LYPA 4ZO8A 4YVXA 3G8RA 3IEBA 1E55A 1OK6A 4DL6A 2WVUA 1LOSA 1PPIA 1XUUA 4H7ZA 2JEQA 2QF8A 1XR2A 1UIOA 4C6LA 2INFA 5I0DA 4H6EA 3EOEA 1IR2A 2EQDA 3H53A 4F4ZA 4O15A 3VAVA 4CUCA 1UPPA 3WLQA 2J66A 3O0KA 5AECA 3TQPA 1NOUA 5JH1A 3R6IA 1DJIA 3O0FA 1OVDA 4MY9A 3MMTA 3VD5A 1SZNA 3ABOA 3PBUA 4MAVA 4EAYA 1KR0A 2WHKA 4CQDA 4CVWA 2UVRA 1BYCA 2W27A 4PUKA 1TPWA 3EX1A 1AQHA 2VDHA 4WKHA 1B3XA 3V36A 1EWDA 2Y8UA 4E3VA 1KKRA 4UTLA 2A1YA 3BAIA 3AMGA 4ZBCA 4XK2A 2IKHA 2CBUA 1Y5VA 2P3ZA 1E6PA 1UR9A 3W7JA 3L4XA 4DUWA 3IIXA 4XWUA 3MBFA 3HA1A 1PX8A 2PDHA 1KFCA 4Z2HA 1WCGA 1M6JA 3RB4A 3KOFA 4UOZA 2GJPA 4W9TA 3DHFA 4ZTYA 3GK0A 3VKJA 1BVZA 3E1F1 3H22A 3BH4A 1P48A 3GW3A 3W9ZA 1REQA 2ISWA 3QLDA 4EBDA 4DZ5A 3TQKA 5IHSA 1P6CA 4HGXA 2ATMA 4PMJA 3NYDA 1G4PA 2ASHA 1O1HA 3VIJA 1T40A 4PTNA 3GVWA 2VR4A 2GUUA 3T0DA 4UTHA 3Q37A 5E9XA 2V3FA 4OECA 3PB2A 4FS1A 4DJEC 2Y7GA 2XINA 1V3HA 1ZENA 4L9ZA 1J5SA 1WBHA 1UP3A 2D3NA 4HCDA 5LHFA 1TR1A 1XSKA 1JZ5A 1R3VA 1OIMA 5IHRA 1C7TA 4KWVA 1HJQA 5EMLA 1F3TA 3K1GA 3AHYA 4PB5A 1EX1A 1X6LA 3GIQA 1RYSA 3T2PA 3N04A 3NOEA 5KZ6A 3VIKA 3S83A 2Y5JA 4LF2A 2H3DA 1A0DA 4B4FA 2I5GA 6A3HA 1UP2A 5HAOA 1E0XA 1V3KA 4P8VA 4QE1A 4C6KA 3MDWA 5EKYA 1BGAA 2X16A 2FVKA 2PA6A 4A2SA 3QR3A 4PMYA 2ZQ0A 4ATWA 3SCQA 5XIMA 2XH4A 3B8VA 4UTTC 3YPIA 4FHAA 2PDQA 1T0OA 3UY8A 3W7IA 4IZGA 3MT1A 4O1FA 3ZS4A 4GOAA 2HNEA 1M53A 2QJJA 4IIEA 3QVQA 1OGGA 1K77A 4KEMA 1XLAA 4NX0A 1X38A 4Z2LA 3UJFA 4EWND 3LBOA 2J77A 1TZ9A 4NRRA 3PR2A 3A12A 4AD5A 4IIFA 4NJHA 5A8NA 1TCMA 1HO1A 1DHKA 1V51A 2XSBA 4MDPA 4AZBA 3E6EA 2WSPA 3EWUA 1SFSA 4O0KA 4GVFA 1D3HA 2FMOA 1TIMA 4W87A 4RNJA 1VGAA 1E1CB 1H60A 2YDQA 1NM9A 1XLLA 2I17A 4XSMA 1G6CA 1YBQA 4MPQA 5C0QA 1IT8A 2VYOA 5CZSA 1ESWA 2WBGA 3DZ1A 4FSAA 1CTNA 1TCDA 3HO8A 2QAFA 3NWRA 2PF0A 3BJFA 2G5WA 1OCBA 4FLRA 1J4EA 2OQYA 1YDNA 3AIUA 2WKJA 3O6CA 1MFUA 4L64A 5CJNA 1WDPA 3SW6A 4K8EA 3CPRA 1W9DM 3ZLGA 1J12A 4IMGA 2PRMA 4XG1A 2BHZA 4G1KA 2J24A 2BZNA 5DQPA 2V4QA 2ICSA 4TV5A 3VD7A 1QI5A 4D6FA 4HU4A 4MY8A 1FFRA 3ZR4A 5D2WA 1FCBA 4NT0A 5LIUX 3IGUA 3WK1A 3LPOA 2F6XA 2UZ9A 2ZADA 5AB3A 2NQ9A 2F84A 3WQPA 2GK1B 3OU8A 3BLFA 4S2BA 2ZWZA 3WH5A 2C28A 3L4ZA 4C7DA 4HPXA 4FS2A 2YDSA 2DVXA 3IRDA 3GU2A 2FLIA 3EOSA 1EXPA 2NT1A 3GC4A 4ZQOA 3RG6A 3UT0A 2RUSA 2ZZ3A 4JKKA 3OBKA 3HJZA 5DCDA 4C6CA 4PN2A 3KOWA 2I57A 1WA3A 1P5BA 4X2RA 3DG7A 1GNXA 1R0MA 3IUIA 1E3XA 2QKFA 2O55A 1TV4A 4I7WA 7CGTA 1QOQA 3WY1A 2OXNA 2W9BB 3H26A 1KFWA 1ZAHA 2Y63A 4RDWA 1I8JA 2ZOXA 4E4FA 3MJYA 4LB3A 3WQVA 4AZ7A 2NVAA 3PPGA 4UMCA 4DWSC 5AHMA 2HTMA 5KG3A 2ZDRA 3SDOA 1RBAA 1C9WA 1VPXA 3LSBA 1W8SA 3W00A 1DIKA 3CB3A 4RXFA 2GDQA 3BW4A 4QJ5B 4DO6A 4S23A 3LENA 3QGAC 4GQRA 2NZLA 4GXMA 2C22A 2BTMA 1W17A 3N1AA 3KHJA 4E8DA 1WB0A 5ECUA 4G2DA 1TUFA 1VIWA 3NR0A 4JN7A 5HWJA 3VX1A 1J11A 4M82A 3LX9A 4M19A 5C9ZA 1W3NA 2G0WA 4PUJA 2WLZA 1LDCA 2C79A 1WDRA 2FIQA 3WLSA 3IVSA 3N9KA 1PS9A 2ZA2A 2PF8A 2JKEA 3KCLA 1VS1A 1SMAA 4F2UA 2PUZA 2DGAA 3VNDA 1OFOA 5A5WA 2OWXA 4JTLA 2W6RA 2OT0A 4DI8A 1TKKA 2YW4A 4BF7A 1XLBA 1J0ZA 3ABSA 4PTMA 4BA0A 4FXFA 3RJXA 4DYJA 1PTGA 1F05A 4TV6A 3MP5A 4LS2A 1MW1A 4GY7A 3LBCA 1XKYA 2WCAA 1JPHA 3BQ6A 2Z24A 3NSXA 1HGYA 1D7FA 2X40A 2YL6A 2DH2A 2WCSA 3H21A 2XWEA 5JBFA 3ZXWA 1UROA 4JCMA 1UD8A 2VD8A 1QNVA 2AGPA 1DWAM 2VD9A 2BY1A 4ZA0A 1W2PA 3NQVA 4L6OA 4PCNA 4X9SA 2W8LA 1Z48A 3HG4A 3MCMA 3ZMRA 5CSSA 2JBMA 2HPIA 3BXWA 3O06A 5IFPA 5FACA 3CHVA 3POHA 5E9AA 5DMNA 1W1IE 1QR7A 2C19A 1AL8A 2ASLA 1UWSA 1KM5A 4LS1A 5KT4A 4R3UA 3OSPA 1CCWB 4JHOA 4BWLA 3GNRA 3B0PA 3JS3A 1P1XA 3RK8A 3U6WA 1X1NA 2YLLA 1IE7C 4NZCA 3MB9A 3TKFA 4ZZ9A 2CNCA 1LQ0A 2DY3A 3AXKA 3MUZ1 4CEUC 3CLWA 1HL2A 4GUJA 3I3BA 3MUXA 3KTXA 2V67A 3QPEA 2W8KA 3NJ3A 2XN1A 4PMVA 3P14A 4UCGA 3K5XA 2Y70A 1HKJA 1WAWA 3KZSA 3MFHA 4NG3A 4F2BA 4UQEA 3MWAA 1SMDA 4Q4OA 2PTZA 2J79A 4M1BA 1QI0A 1TREA 3CM4A 1XQKA 4B90A 3VOCA 3WYZA 4LFYA 1Y5XA 1CGYA 1A50A 3R25A 4GBUA 4L1GA 2XC9A 4JFVA 2UY5A 1EF2A 2VX4A 3WLOA 5CAKA 4XZWA 5JXQA 1W3LA 1UP0A 1BXCA 2VT0A 3UY7A 4GI8A 2EEXA 1PAMA 4JNYA 3GHRA 1RV8A 2FJUB 1GORA 5E70A 1PE1A 2QGHA 1DJXA 1RCQA 4QS6A 5A2CA 5KZDA 3PR4A 4C6DA 1Q6FA 1W6TA 1E6XM 2WVTA 4I9AA 3N14A 1KB3A 1WO2A 4ZMGA 4IICA 2ADAA 1UZDA 1PL9A 3H8AA 3QFWA 4V15A 2OLHA 5A8QA 1OG6A 1DQUA 3TROA 3TN4A 4PCSA 4DEFA 2AGQA 3RLHA 3V7PA 2VMFA 1XFBA 5KT5A 2AQVA 4CEXC 1RBOB 4LJ3A 3SCOA 1Z6KA 2DSWA 4EOUA 5CZKA 1W3JA 3ITYA 4AZHA 4D6JA 3TJIA 1A0EA 3N2XA 3HIJA 1ZBWA 2I1OA 1YXYA 2XN0A 1H62A 1QU4A 2PWDA 5H8MA 3DXIA 4PMOA 4IR9A 3BLPX 1SJCA 5G4WA 1CDGA 1ZUAX 5B80A 3TZFA 5ABFB 1JJKA 2DIJA 4QIUA 1ELSA 1F3XA 3PJXA 4M24A 3MSRA 1A5OC 4UTJA 1E6SM 2QVHA 1CXHA 1ZRQA 4KFPA 1H1NA 4S3FA 1XSIA 1XQLA 1B0IA 3OO2A 3R79A 2YFOA 1P0DA 4H2HA 3EWBX 2XFWA 4EYHB 1KFLA 5KFVA 4FLSA 2BVWA 3RUBL 2E77A 2P10A 4GQBA 3PAJA 1O5RA 3C5QA 4PTWA 2DZVA 2DUAA 5C9XA 3ID7A 2A3LA 2QLYA 3TTQA 4POCA 3B04A 1SFLA 3MV11 1IM4A 3TAKA 1XGZA 3VILA 1LOLA 1FXQA 2YPIA 3PK7A 2Z1KA 4UFJA 4MMWA 1A5NC 4JEJA 2WNWA 1RPKA 1NP0A 2FDMA 3M1ZA 2PDCA 1XLCA 3EB3A 4JS3A 4JTIA 4CU8A 5JMUA 1CX9A 1VENA 2BY0A 1BKHA 2JGQA 3TTOA 1XJBA 4AD2A 1ZALA 3TUUA 2Z00A 5E1QA 1TVNA 1UIPA 4O13A 3W2NA 3W2UA 1M04A 5CPSA 4F40A 3WUFA 3CV1A 3HPZA 3PZVA 2XHYA 2BQUA 4FOUA 3CT7A 5C2CA 4Q4MA 3ZIZA 4S2CA 1UJPA 4O54A 3U3HA 4Q6XA 4Z0SA 5BYWA 5I09A 1OCJA 2AQWA 3QZ6A 3MVIA 4GINA 1Q8JA 1TWDA 1M7PA 5D04C 3TDFA 2IQTA 4BEUA 4Q8TA 2I16A 2REQA 4ECLA 2YCLA 1GYLA 4ML9A 3BICA 4BQ5A 1HKIA 3P61A 3TVAA 1CEOA 4HJWA 1YADA 3P0XA 5F7UA 4UR7A 2QDDA 1HXJA 4RLIA 4DLMA 2VEPA 3HV9A 2TRSA 3I3EA 4PTXA 1W1YA 3M64A 4O14A 3MJMA 3W28A 3DI0A 1KBIA 4C7FA 3CZEA 1HW6A 4R9XA 4A8LA 1HFBA 2A3HA 3D47A 3NVDA 4F0LA 3CT2A 4JL2A 4HA1A 1S9FA 4ZTXA 3WLHA 1BFNA 2UWFA 4PODA 3UZ5A 2ALDA 3G1YA 3PZTA 4AHPA 2PRLA 1JCXA 4HU8A 1V03A 5HPOA 5FJUA 3BWWA 1HKKA 2YXGA 2VA2A 5KINA 4PB4A 3NQ7A 1EJ7L 2YA2A 3OHAA 3C6CA 3LEPA 1K9DA 4I8YA 3FGCA 4RDZA 2UVVA 2Z0IA 5KG2A 2OKTA 4DQWA 3NO1A 3E2RA 5FA5A 4HSOA 1ZAIA 4LBRA 2QV5A 1WKEA 3VE9A 4ZODA 4GO9A 3TJXA 4BI6A 4LEQA 5BXPA 3CLMA 1GYNA 1GWJA 3NVTA 3W70A 2X0YA 5KFZA 4JTDA 1QO5A 4Q8QA 3G8EA 1MQRA 3NGFA 2QZRA 3ZLFA 4DJFA 3GIKA 3C0QA 1HKMA 3AMLA 1HT6A 4XD4A 1OJXA 3TWAA 3W6YA 1V6YA 1I45A 3PG9A 3FYYA 1V6UA 4JFTA 4WXYA 3CPGA 1X1OA 4KFNA 2W7PA 4NLGA 3UNTA 4RW5A 1TPEA 3CQKA 3PUEA 1E9ZB 1DIEA 5REQA 1G1YA 4IQJA 2PZNA 3FCPA 2WM0A 3TW9A 5LIWX 3CQIA 1S10A 5HR6A 3F7JA 5J5RA 4A3UA 3GZAA 3RCMA 3L0GA 1F73A 2QGYA 3LPPA 1SO4A 1UH4A 5K4XA 3A4XA 4GXWA 1ISZA 4R8UB 4RZ6A 3W86A 4BFAA 4ML4A 4S3GA 2ISDA 4YTTA 3MMUA 2OELA 2PWHA 1RJRA 4HOXA 5KFAA 2O9OA 2WHJA 3M43A 3WQEA 2YL8A 2P3EA 2Y7EA 2DT0A 4QJ3B 1VJSA 4NZJA 1GOMA 2BXVA 2VX7A 3WL1A 4OU1A 1B90A 3VNKA 3BLIA 3F03K 4RXGA 5DBTA 1JAKA 2FDSA 1B9ZA 2V5CA 3RGTA 1I2QA 4MJZA 3Q94A 3MQTA 1JNEA 1JNDA 2VZUA 4ZQNA 3BUVA 5AVHA 4LW7A 3VKDA 2C8NA 5TIMA 4MJMA 3LNPA 1K1DA 2ZKMX 3T0AA 3WJSA 4Z17A 5F1UA 2OO6A 5LSMA 5H8PA 3G6MA 4H8NA 3BQ1A 4OTKA 3UR5A 3DYMA 2AQOA 4XO6A 2PE4A 1XCFA 1ZJIA 3PM6A 3C8NA 4LV9A 2OZ3A 1GKPA 3IJ9A 2JEJA 1TA3B 2XU2A 1DQXA 2BNJA 5G5IA 1XPGA 4ERAA 1GT8A 4XVDA 4ZQCA 4NKCA 3A64A 1EJTC 4R7WA 2G3NA 4CD4A 2P1FA 1L2UA 4H04A 4MUZA 4UMAA 2GJXB 3C8FA 3VDBA 4CGTA 1AJ0A 3FY1A 4HK6A 2FGZA 1DJQA 3BOXA 3GY1A 3EA2A 3OEXA 3W84A 3EB4A 1AZ1A 5KG7A 3BLEA 1ME7A 3F1QA 1A47A 5GJNA 1XFCA 3QYQA 4QNEA 4JIEA 4A3QA 4GISA 2GGHA 4V33A 3RM9A 1QUMA 2C14A 2FPYA 4JBRA 4WKFA 3TK7A 4IJCA 3WMSA 5HUPA 3OZPA 4GABA 1POKA 2QCMA 4XKMA 1JDFA 5KFCA 3W7HA 1EJRC 3I7QA 1R2TA 4HMEA 3UWYA 3UQNA 4F0MA 1KO0A 1I2OA 1K02A 5M3WA 1U2YA 1JUKA 4LV4A 1FWSA 1X7IA 1JCLA 4Z08A 4JV0A 1LJYA 4IP7A 5FAJA 1AW2A 1WOAA 1POJA 1U83A 2V2CA 2GVGA 3GXIA 1PO9A 3Q8RB 5A6BA 4ILSA 4O3QA 3VCCA 2VX6A 3IV3A 1PWLA 5AHEA 2EPKX 4J3UA 4AWUA 3BAKA 4S3JA 2WW5A 1S3TC 1XYCA 2EPLX 3ANUA 3BJTA 2ZUVA 2ZRXA 3FFSA 1W9XA 4C6OA 1T41A 3WKZA 4N4QA 3L68A 4M6UA 3ERPA 4W5UA 1UD3A 4KPLA 1UCWA 4JICA 2DW7A 3AYVA 1FWDC 1QHZA 3ES7A 5TF0A 4HA0A 3NNTA 3Q2DA 1AMYA 1E3ZA 4ZOBA 1FHLA 1CGWA 3V3WA 3I7RA 1EUNA 1R3SA 4HD5A 5GNZA 1K8XA 1K70A 1OWQA 3PVFA 4WY0A 3TR2A 2XWDA 4U10A 5CCZA 1N2VA 1V77A 4IG2B 2ANUA 4MNKA 1MDLA 4ECXA 2PDUA 3E2VA 1F6PA 1QI3A 1HX0A 3VO0A 3VOHA 4ICCX 1GOXA 3SB0A 4Q7IA 1LQAA 1OSEA 1PZ1A 5IM51 3NA8A 1DJWA 1VEMA 4R88A 4FXRA 1KM6A 4HA3A 3LQLA 2R82A 3T4WA 3OGSA 1LG1A 4RNNA 4NZFA 5HNNA 4YCPA 4Q8FA 2WC7A 1S2TA 2FH8A 1LWJA 3KBWA 3T7VA 3FEMA 3VTRA 3PZIA 3BMVA 1MZRA 2PTWA 4MYAA 1UKOA 4HPJA 1TVLA 4XZNX 4FBTA 3K4WA 3USZA 3AZTA 4PRRA 1Q65A 1ITXA 2YYTA 2AKMA 4IM4A 4UTWA 4C90A 1R7OA 4GVHA 2XVKA 3HG5A 4U3CA 3EWDA 1J6OA 5BMXA 1ZP3A 3BPWA 2GVYA 2ZX6A 3M16A 4HN4A 5G2IA 3SADA 1ONWA 3LB0A 1FWJC 2EPOA 1H0IA 3VGEA 1J01A 2HVNA 2DZBA 2V5DA 3ENLA 3ZOAA 3FN9A 1FQ0A 4I5XA 5T9BG 1OIFA 4C1NA 1LRTA 4FXJA 5H2ZA 3ITOA 4A6GA 1THFD 1CLXA 4W5ZA 2NLIA 4D71A 2R1PA 2VEKA 4X61A 3CAQA 3T0TA 1NH6A 4MFDA 3EOUA 3UW6A 3P8JA 3WLRA 3RCYA 2FHFA 2Y8VA 2YR1A 5FI8A 1U33A 1K9FA 4NJGA 4JY9A 1JZ4A 3AHVA 3BAJA 2ZUNA 4ONVA 4DL3A 2VUYA 5T8GA 3L67A 2NQLA 1JI1A 3PSWA 3UBPC 4YTQA 3GIYA 1AMKA 4IPLA 2C7FA 3S8HA 1NJJA 3FXGA 3FXYA 4ROQA 1J2WA 1R8LA 5D38A 2OZTA 3LM3A 1XBYA 1OD0A 1GHRA 5K9XA 3S2JA 3PUGA 4US5A 1DJZA 2ZRUA 1XBZA 1DWFM 4GIEA 4BWLC 2A3BA 3HURA 1MQPA 4QITA 3W1TA 3FSUA 4K37A 3TQ1A 2XVPA 4HYVA 5CSYA 2BQ3A 4MLRA 3FHAA 4LUTB 3ARWA 1QMLA 2OX4A 4WF7A 2H9AA 2IPWA 3RLGA 3S5SA 3RXZA 4LAKA 4S3BA 4AY7A 2WZMA 2GSHA 2QR6A 4L4LA 4PZVA 5E09A 3BG3A 3L65A 3M5XA 3PPHA 2HS6A 2EKCA 1B2YA 1DTUA 1QOXA 1V3MA 2G4FA 3H2MA 4H7VA 4KKXA 1LF1A 1FKXA 3GRIA 1LBFA 1ZB5A 3IJQA 3IJ7A 4JTHA 2VFGA 1KTBA 1OF8A 3HG3A 2QJHA 4UTKA 1CXFA 5C9UA 5L9FA 3OG3A 3SCTA 3C3NA 3RLVA 2WCGA 2Y62A 2ALRA 2ISFA 1QRQA 4D8LA 3WSUA 2VOMA 3SBFA 5FJJA 2Q09A 4Q8PA 5IOBA 1F9CA 4A8NA 4O1EA 1L8PA 1VD6A 1T7LA 2OLAA 3T0CA 1KRAC 4RV3A 3QHNA 5FJRA 4WDTA 2NV1A 3GNOA 5D2TA 1QI2A 4PGLA 1UWRA 4BQ2A 4B9YA 1C3FA 3WMLA 1E9LA 4JY8A 4DBSA 3PZ9A 3QW4B 4E2BA 3W2MA 1JVNA 1PYFA 5H91A 4XD3A 3AJ7A 1PIFA 2DZUA 2W63A 3ANVA 3ITXA 4JTSA 3M0JA 3L7RA 3KZPA 3UNDA 3E2QA 4XO7A 1PDYA 2J6SA 3FVDA 2VELA 2WSKA 4O0ZA 3VNIA 3EPIA 4QWEA 3L2MA 2V2DA 2V5LA 4XZMX 4C5YA 2OQHA 3EWWA 2ON3A 1VCFA 3NEVA 3RNDA 1XLGA 1PCKA 2IKJA 1UWIA 3WD1A 4WD0A 1UC5A 3KHLA 1E6ZA 3VVGA 3WQGA 4MIMA 1E6NA 2X7WA 5KG5A 4O57A 3CZ8A 3AAMA 4CQCA 2BY2A 1NFGA 2A21A 3HPFA 1GVSA 3GE7A 1ZPTA 1Z42A 1S5MA 2VZOA 4M7TA 2V82A 3LCHA 4RZRA 3NM1A 1WKDA 2QUUA 3QN3A 5F2IA 3GDKA 4RZ5A 4QCEA 3NL6A 2V5BA 3WJWA 4IQEA 3GM8A 1FA2A 4KRTA 3CUZA 3VKKA 2G96A 1OFDA 4CCZA 3E5BA 5H1WA 2ASDA 3OLDA 3T42A 4JTAA 4N0RA 3K8LA 3EMQA 5DQGA 3JRKA 1JCYA 2DSVA 5LA2A 3G5EA 3TW7A 1PHQA 2YW3A 1FWRA 2WNZA 3LTYA 1F4AA 4AEEA 2YZRA 3A5VA 4AZ6A 4JQ4A 5HOSA 4DPPA 4QTGA 3TYUA 3P6LA 4M3PA 2E7FA 1SYTA 1YNPA 3WZ0E 2OVLA 2A7RA 5EMUA 4K7VA 1F6KA 3S0CA 1EZ2A 3GQCA 4JQ1A 1PIIA 1XI3A 2KZHA 2J7BA 3APYA 3QSTA 3EPOA 1GQIA 1LG2A 1QO2A 1VP5A 1VYPX 2Y7DA 3G0UA 4N6EA 1SFJA 1LL7A 1JIHA 3V0TA 2QUTA 1EP1A 3SIZA 3ONCA 1KXTA 1JDAA 2PDYA 4LRTA 3IIZA 4D6IA 1YTEA 2PWEA 3KHRA 4P7LA 1GQJA 1ODUA 3WQDA 3SN1A 4JIQA 1JR1A 2DZWA 2RDUA 1Q6RA 3VFCA 3WF4A 3HGJA 1VQTA 3LY0A 1YDYA 4O4WA 3QMRA 5M1TA 4BJHA 1K4HA 3NGJA 5AKQA 3U2EA 5HANA 3RR1A 1FFQA 4IPJA 3H4XA 4Z42C 1U5VA 4DXKA 3KBJA 3Q8QB 4Y9PA 4O8AA 2XH7A 3VOJA 1TWIA 4KIEA 1FUYA 3DHDA 4I5RA 3T81A 1XLDA 4X9YA 3L2IA 4DEZA 4N9DA 3NG3A 1M65A 1D7KA 4FX8A 3THUA 1FWBC 5IFTA 5CPTA 3NQBA 1EYEA 4R53A 2ZZ4A 1O94A 1SQ7A 2X1UA 2PDPA 1XICA 4MAZA 4H4IA 3UCDA 4E4PA 3E0FA 1R7AA 4FNPA 3WDJA 5A8MA 1RQHA 3SCUA 1XRFA 1LORA 1KLZA 3GKAA 2VC9A 3FDKA 4DJFC 3B8IA 2WZHA 3EX2A 3EKZA 3UYCA 1HUVA 1MZHA 2LLEA 4AF0B 4EPDC 1G4SA 4NQ1A 1PX4A 4NY2A 3RU6A 2FQIA 3HTWA 1E40A 2RDWA 4HP5A 1DWJM 3H4BA 1LL4A 1GPFA 1W1TA 4JTJA 3AIQA 3JZUA 4Q4RA 1RYRA 3S2MA 1LUCB 5D9NA 1C29A 1N8IA 1OQFA 3O2LA 4ERIA 4C1LA 4LH8A 4UWMA 1EC7A 1MO0A 2QHAA 4XZIA 1GOKA 1TJ1A 2QULA 3BARA 1TJ2A 1DXFA 1S5VA 3W82A 4Y2WA 3VCRA 4Y9NA 2OB3A 3LG3A 2PB1A 2P50A 2D22A 3P8IA 2ZUMA 3QV7A 4LRSA 4NILA 2DT1A 1KXHA 1Z9AA 4PMZA 5BXSA 2FYMA 2VGFA 2WMJA 1VZWA 5FF3A 3SRKA 1W56A 4NF7A 4QWBA 5JUMA 4GMEA 4IUGA 1JI2A 2J8FA 1IR1A 3TYCA 1CPUA 3N4FA 4JFWA 5GJMA 1MSSA 4F50A 2ZBTA 1JF5A 1Q8AA 3LHWA 1C92A 2OG9A 4JXCA 3KHDA 4JUZA 4XD5A 1JGIA 2GGIA 4ROPA 3EBVA 4MNJA 3CZLA 3NCOA 3NUKA 4MZYA 3G1HA 4ACYA 4XAGA 5D9PA 1Y7VA 4ECWA 1BTMA 1O68A 3P67A 1XL9A 4LANA 1SO5A 1RA5A 4GYPA 4C6MA 2WVSA 1MVYA 4LXFA 1JUBA 2ZXDA 1RLDA 4Q7BA 1PVNA 1RHCA 3F5KA 1ZY9A 1XLEA 4G7EB 4D1IA 4IGNA 2QEZA 1L9WA 5I06A 2ZX7A 3CTTA 3R2GA 3FYPA 1QPKA 1A5MC 3GNPA 1WZMA 3BCDA 1W1PA 4PRWA 1SW3A 1H11A 2C2EA 1CLVA 2PBOA 3ITTA 2BFGA 1X39A 3NQ6A 1XIJA 2TPSA 3NO5A 3E96A 1W5NA 3AIRA 2C0HA 3LYEA 4CVUA 1L6SA 3CHFA 3CNYA 1V5XA 4D6GA 4R7OA 4ECSA 5G1TA 3S9IA 2NX1A 3LMYA 3KEHA 4FNRA 3B8WA 4UCFA 4ZFCA 4UTUA 1N7KA 3LCIA 3KX6A 3QY8A 1FHDA 4HYKA 3W7MA 3DGBA 5CXPA 1KCLA 1MI3A 2Z1XA 3PTDA 4BF5A 2BASA 2O0TA 2OWWA 4OZOA 4ZO6A 1PTAA 4TXEA 2PLJA 5KFWA 2VGBA 6CGTA 2MUCA 4RJEA 4F48A 3LCWA 2YB1A 3M5ZA 1RBLA 4ZEPA 1H7RA 1UMLA 2I5QA 3BANA 4DJDD 4P8UA 3AIEA 3E5PA 3W2KA 1KRMA 3BSHA 4UTMA 4A05A 4D2JA 1XSJA 3AWNA 2NW0A 2B0MA 5BWAA 4QISA 1X7FA 1IEXA 1LCOA 3KP1A 4Y8FA 2IPGA 5DT5A 3R11A 4PUEA 4D8ZA 3G3MA 3FJNA 3L23A 4WK9A 3UERA 2BOGX 3IS4A 3S5OA 3MDUA 3C52A 1CWYA 1E6RA 2AU0A 3JUGA 4OT7A 4H19A 3WN6A 3ABZA 2OEKA 4ATDA 1QTWA 4LBUA 4AVOA 1JD7A 3NZ1A 3TN6A 3VNYA 1M7OA 3ZZ1A 1EGMA 2VGGA 3N17A 4QWAA 2J4GA 4HOWA 2X1SA 1XUZA 4LCSA 2V68A 4IMCA 2VFHA 4J9KA 4C65A 4OV4A 1GPWA 4MF4A 5BMWA 1XBXA 4M29A 5DRIA 3MPGA 4MSSA 3T5KA 3W37A 3W7NA 1TV7A 2VZTA 4PR4A 3QZEA 2HVOA 3W6MA 5K4ZA 4JZ5A 4MKSA 2W92A 1M01A 1L0PA 1XHGA 3KL5A 1EIXA 3DERA 1H7NA 6ENLA 3I68A 1IV8A 2GWGA 2VXNA 3DC0A 1TWZA 3NL3A 4LVDA 4P7NA 3VDCA 1F2JA 2O9RA 3AUJA 4L1XA 4U2ZA 2B31A 5DG8A 1AVAA 1A3WA 3P93A 1FP9A 4F66A 4DAIA 3CIVA 1ZGDA 1IXNA 4H6KA 4LUIA 2J75A 3NURA 3BOLA 4AIOA 4A3RA 2CHOA 3SO7A 1KCKA 1SGJA 3DU0A 3PF3A 3WBYA 3GBEA 4IIGA 3TX9A 3U5UA 3CXOA 4UBPC 7TAAA 3B8UA 3LHTA 2V6AA 3GU1A 1HGWA 3AS0A 3QY6A 4R7JA 4AUBA 2EG8A 4CQAA 1R85A 1O6IA 2OCZA 2A2IA 1AL7A 4HNCA 2DFAA 3RO6A 4EE9A 1V02E 1ECQA 3DENA 3N6JA 5KFMA 1WE5A 3OVGA 3H4DA 4UTWC 1ECEA 3IJLA 3E0LA 4LYQA 3ZR5A 2QMJA 1XH0A 5I2UA 2V2HA 4O3OA 1VFTA 2XSAA 2PRHA 3GIJA 5KT2A 4UFLA 5G1MA 5FOOA 2ABBA 3V0UA 4O12A 1OYBA 4RK8A 3B4YA 3KHHA 2PURA 1OD8A 4JYFA 4QWDA 2QCHA 2WJDA 2J88A 3SRFA 3SY8A 4S3AA 1VBUA 3B40A 1YXCA 3U2ZA 3NDYA 4ED8A 1PSCA 2WWDA 3LHYA 1E71M 1WYIA 2Q8LA 1SJBA 4L61A 3T6CA 4A4AA 3TSBA 3B8SA 1NDYA 1OCQA 1N8FA 3T55A 1P0NA 2UY4A 3HM7A 2I56A 4JNMA 4W88A 3EDFA 4W7WA 2JQXA 5HBFA 1FWGC 2Y5SA 1OYAA 1BG4A 3V6JA 1C8VA 3A47A 3CMJA 1JDEA 3TSDA 1S2UA 3IUDA 3QGVA 4HPNA 3P3BA 2W9AA 3S42A 5E0CA 1RPXA 5EB8A 1AH4A 1SPQA 2PFHA 2ZZ7A 3N13A 4U5IA 5FAGA 3LN3A 3REQA 4FP1A 1UD4A 4OKDA 4AZCA 2W61A 3OHMB 4IIHA 1TFVA 4B3ZA 1X96A 3EX4A 1NSJA 3PJWA 4PH6A 4QS5A 3V16A 3N2BA 1U22A 3WNMA 1TQJA 4F79A 5F4SA 5FSDC 1VKFA 1YTDA 4P8XA 3OPSA 2J62A 3PZMA 3C2YA 1GVRA 4YHEA 5D9OA 3NSMA 2NQJA 2ZXBA 3DBPA 1FCVA 1BWKA 1ZTVA 2VGIA 3CU2A 1HVXA 4NZ3A 1V7AA 4DY1A 4QHRA 3W1RA 4ASTA 1FH7A 2E0PA 3QZAA 4RCXA 4EYIB 2DPJA 2PDFA 3G1DA 5CH9A 4MB1A 2CC0A 4L4PA 3F2CA 5L1JA 4UQ9A 1EOMA 2XIJA 1A5CA 2ZDSA 4IQLA 4H9ZA 1QJWA 3WQOA 3AHXA 1RY0A 1LRQA 4HNUA 3KDNA 1HZYA 1XYZA 1J93A 1A80A 4PBEA 3IUHA 3DYPA 3CL7A 3NZPA 1R9ZA 3E12A 2VEFA 3CV6A 1M03A 2DDXA 2Z28A 3UXLA 4J9JA 4L4OA 1JYWA 2YCKX 4QJ4B 2ACSA 4OOZA 1KBBA 1O60A 3URQA 3F2BA 3GIIA 1PDZA 3K46A 2IMWP 3STGA 3F4CA 4Y90A 2Q8ZA 1DXEA 3MCOA 4F0HA 4PMDA 3TV8A 3L9CA 1RVGA 2BR0A 4O1BA 4DO5A 3BMXA 3ARVA 3UA3A 4KEZA 4MJ2A 2VI0A 2F61A 1BG9A 2E67A 3P62A 5KFFA 9XIAA 1JUEA 3LGEA 4DELA 4DBEA 3KS5A 4YS1A 4BEQA 3GHTA 4REQB 3RM8A 3OJGA 5CJ5A 2ABAA 3R13A 2PCEA 1DQWA 3R7MA 4RZBA 3DFYA 2YDAA 1ZJBA 3QF0A 4NX5A 1XIBA 3MCNA 1T94A 2QUMA 4CCEA 2C1IA 3B0XA 4NI3A 3I4KA 3SY5A 3BLDA 3NZQA 4J27A 1ISYA 1XC6A 4HMCA 1JD9A 1S5TA 2CLPA 5AYZA 3F4WA 1QT1A 4H41A 1R87A 3WK2A 5KEZA 4I7VA 3SUSA 4H9XA 4XV0A 1ZETA 4Q8UA 2IKIA 1Q7QA 4DF0A 1J0KA 5CG0A 3IGHX 1D2KA 1EFZA 1MNZA 2PGWA 1OX4A 5D09A 1Q6OA 4J9LA 2GGJA 5E6ZA 4HQVA 4FMVA 1GTHA 1K9EA 1EA9C 4WQ6A 2CU0A 3S6TA 4V1YA 1FY6A 4GJIA 4CD5A 4NIRA 1Q66A 4AU0A 4B5TA 1GKQA 3QC3A 1XC4A 4MADA 2D20A 2I5IA 1V79A 1R47A 4O4VA 2R1NA 1S46A 6REQA 2R8KA 4NNBA 3SCPA 5CZJA 4UFMA 1ALDA 3TAOA 1WXJA 3V6KA 3BCFA 3SJNA 3WLKX 3W7GA 4PTDA 4OUEA 3WDHA 1NWTA 1VEOA 3UJSA 2WZEA 1KV8A 3WJYA 1K03A 2CESA 4KCUA 3TC3A 2VFDA 3ZVIA 2EG6A 1V3LA 3Q8PB 3VD9A 4P2VA 1FWFC 3GW0A 1JXKA 4AD1A 4AVFA 2H3BA 3QH2A 2WQPA 4D8AA 2P0IA 4GD0A 1OF6A 3PTQA 4J3TA 1TSIA 1G7UA 3WQFA 5EU9A 2PP1A 4W4QA 5LGXA 2VR2A 3CUGA 2VC5A 3T09A 1JZ2A 3N2TA 3MZ2A 1I2RA 3V35A 5A6SA 2BGQA 1UH3A 1XXXA 2YB4A 4ZQRA 5LA1A 4K1GA 4J9NA 4LVAA 2PDKA 3IK2A 1WBJA 3DFHA 2R8HA 5BOOA 4GGBA 3QR0A 1F61A 4ADUA 2VFEA 2VCCA 4JYEA 4S3KA 1A5LC 3FA3A 1ZJAA 3VGGA 5JIWA 3AISA 4AWTA 1KR1A 4A29A 2B4GA 4GC7A 2NT0A 5C5JA 1BSIA 2W9CB 3UGVA 1W3HA 3NPWA 3SCVA 3E9AA 5D30A 1RCOB 4M6VA 3EDJA 2E6DA 3P82A 2WO5A 4I90A 1PKNA 3JVAA 3UFYA 3LI1A 3O15A 2Y7FA 1NWSA 2V5JA 4Z1AA 2R91A 2DEPA 5I3HA 2QCFA 4RW3A 1TTQA 2FHBA 3EXSA 4F8XA 3L4TA 3CC1A 3AC0A 1R3WA 3TE9A 3ISIX 4C5ZA 3T78A 3KOZA 5KSWA 1QBBA 1HJWA 4Q6JA 3HQ1A 4DL7A 3U2CA 1EJVC 1A3HA 4YR2A 3AFBA 3RO8A 1H4PA 2C1HA 1G4EA 3RAXA 2E8YA 3XISA 4F3HA 2WMIA 1R5YA 5FCZA 4IIDA 1PXGA 3KCJA 2JK2A 3N29A 2J47A 1P6WA 3M9YA 1ISXA 1EEPA 4GX8A 1NFBA 4YTSA 4ED0A 1NEYA 2NX9A 2HROA 3QC0A 4MWAE 4EPBC 1UOZA 3RBEA 4JD4A 1ITQA 1S0NA 1OFEA 3FJLA 1A5KC 4GFSA 3SQLA 5XINA 1ZCOA 4JYDA 4LAOA 3N3TA 4UFHA 1EB3A 1XYAA 4HZ7A 2PLKA 2UY2A 4BQ4A 3E2SA 1Q6EA 3TYZA 3WLNA 3UXKA 1OABA 1UWAA 4Q3MA 1VFSA 4KEUA 5LYRA 4A3YA 3DG3A 1E4LA 1TJPA 2NQZA 3DFTA 3URBA 1PV8A 2CZEA 3SQSA 3ES8A 1I60A 3VM7A 1IYXA 1EBHA 5AN7A 3WENA 4FK9A 4CQ8A 2O92A 2TYSA 1O12A 1SSGA 1N8WA 2Z2AA 3W75A 5C70A 3L0KA 4Y6GA 3WK3A 4Z2KA 1TTIA 1J0JA 1H5YA 3FJ4A 8CGTA 1VFHA 2W91A 1YPFA 3EMZA 4AZIA 2XYLA 4PRTA 4GYPC 2NWRA 4OVXA 3THAA 2CLHA 2Z26A 3EXTA 1FWWA 4WY0F 1SZRA 1ONRA 4AY8A 2INZA 3FJ6A 3LZ3A 4MJ4A 3N3MA 4C60A 3B9DA 3MSYA 3DAQA 3DYOA 4YYCA 3AHTA 2GL5A 4RR4A 4CCCA 3TLLA 2Q3RA 4QLKA 3PPCA 5KFLA 3QQ0A 4S38A 1X6NA 1EQCA 5A8PA 3MI3A 2RFGA 3LXBA 4HCLA 4R9OA 4YWIA 2IXVA 3B97A 3RAQA 4IJRA 2OX1A 3EA3A 3UVIA 1DL3A 3USBA 2KX9A 1P0BA 5E0KA 1EO7A 1OZMA 1V6XA 4LGXA 2DIKA 4BI5A 1GZGA 4AD3A 3CV7A 1BD0A 4V2XA 4JQ2A 1J9YA 2CLEA 3M6DA 5HXMA 1UBPC 2G3FA 4LQ1A 3KBSA 3B9EA 4JQ3A 1UKSA 2YCLB 5LIYX 1KRCC 4URIA 2GVJA 3P5YA 1GW1A 2AMXA 5KFHA 1C93A 4MNLA 3F4DA 4YL2A 1JL8A 2YCJA 3CO4A 3ITLA 2ZUWA 1KXVA 3E3HA 4C91A 1QCWA 2P76A 5I5RA 1OT1A 3EX3A 4UXDA 1MDRA 2XGIA 5C71A 3LNMA 2XFYA 3SUTA 1VFLA 4JTUA 2VQUA 1OYCA 1LWHA 1T8QA 4KWSA 4Y9OA 1FDZA 2QXWA 4NXKA 2IMRA 5KFPA 3W0KA 2FZ8A 3GNNA 1QBAA 2XGZA 4Q33A 1IIGA 3PWGA 3MWCA 4G7EA 4PUMA 2AOSA 2MNRA 5D2XA 1G94A 3UWZA 1JYXA 9CGTA 4IL0A 1AA1B 4M6PA 3THDA 1EDTA 4V27A 3UWUA 3LHUA 5FKYA 1K3UA 5JBEA 3FGCB 4BI7A 1EX5A 2QCGA 2GJNA 3OGVA 2G50A 3GXPA 4TU1A 2WK2A 4MVAA 3QKEA 5LNSA 1ADDA 5AC7A 2YIHA 2HBXA 4BHYA 2QIWA 5HR7A 2RGLA 2DQXA 3TYEA 5K3VA 1KCZA 4M6QA 3MUY1 3PSVA 1TE1A 1KWKA 1SM9A 1NWRA 3E49A 3W7OA 9XIMA 5KZEA 5BZAA 1WP6A 5HUOA 4QBXA 4XAZA 4DB7A 3VKAA 4O19A 2HISA 3EX6A 1KTNA 1V3JA 1TPH1 2FZMA 1ZP4A 4LNCA 4NP7A 1VYRA 4GQ0A 4TR9A 1EF3A 1JCNA 2E4TA 1W1B1 3U5YA 4CD6A 1RP9A 1BTCA 1JZ6A 4UNKA 2V9DA 4PL2A 3IJDA 5REQB 4J9QA 3G1FA 4G56A 2JKAA 1QDSA 5DMMA 3CL6A 1XG3A 4YLWA 2R24A 2QDHA 3BE7A 2W0UA 4NUWA 4PEEA 4IMDA 2OKOA 4TO8A 1LOQA 2JIEA 2VUNA 3AS2A 3PAOA 2O4QA 4GA8A 2CLOA 3LCFA 3CZJA 4QLLA 2BGSA 2XVLA 4M51A 5SWUA 4IMEA 3PFRA 2YL5A 2V3GA 2D3LA 1IT7A 2OSYA 3VI2A 3OIXA 4H8HA 3WEMA 2YOCA 2R6OA 2CLIA 3KDOA 4BCEA 7ENLA 1I2PA 2X42A 4MYXA 4RDVA 1KFKA 1W9PA 5A3HA 4GPNA 3EKLA 3ARQA 3V5CA 1GOOA 2CKRA 2ASJA 5DCBA 3BSGA 2WYSA 1XIGA 3CWOX 5CJMA 5KFEA 1XLKA 1Q8