2BB0A

Structure of imidazolonepropionase from bacillus subtilis
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
413
structure length
413
Chain Sequence
b'KQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazolonepropionase
publication title A catalytic mechanism revealed by the crystal structures of the imidazolonepropionase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 158
structure length 413
sequence length 413
chains with identical sequence B
ec nomenclature ec 3.5.2.7: Imidazolonepropionase.
pdb deposition date 2005-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2bb0A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2bb0A02
1GKQA 4GY0A 4HK6A 4PCPA 4F0RA 3QY7A 3AUOA 4KF1A 4CNUA 2Z00A 4KEVA 4G2DA 3GTXA 3T1GA 4BJHA 4GY1A 4H9VA 2GWGA 3MDWA 4KETA 1FWBC 3E0LA 4DYKA 1KRCC 1PTAA 4GC3A 2VC7A 4JOMA 3E3HA 4CNTA 4CNSA 1QXLA 3S2LA 4B3ZA 1EJRC 1WXYA 4DNMA 4R88A 4EPDC 2ICSA 1FKXA 3AU2A 3ISIX 4QROA 2HBXA 3QY6A 4EPBC 1RAKA 3CS2A 4MUPA 4QRNA 4CQBA 4D8LA 2Q01A 4CQDA 1NDZA 3OU8A 4QSFA 3S2MA 3E38A 3TN6A 3PAOA 1K6WA 1KRMA 3MVTA 4KEUA 4IGMA 1RA5A 2Z27A 3QY8A 3IARA 3BE7A 4LAOA 2AQVA 3GRIA 1NDVA 1POKA 2VUNA 1XRFA 1FKWA 3GIPA 4R7WA 1E9ZB 4R85A 4WHBA 3OJGA 1DPMA 3F2BA 2AQOA 3TNBA 4PBEA 2DVTA 3LNPA 2PUZA 4I6KA 2G3FA 2PGFA 4C6KA 1YIXA 3K5XA 4LFYA 2FTYA 1VFLA 4ERAA 3MVIA 3IV8A 1A4LA 2Z29A 3CAKA 4L9XA 3O7UA 1R9ZA 1QW7A 4C6CA 4DI8A 2GOKA 3IACA 2KAUC 4RDVA 1EJXC 4WVXA 2I5GA 2IMRA 1I0BA 3IJ6A 4KERA 4CEUC 3R0DA 2Z24A 4ERIA 3WYZA 4LAMA 2Z2AA 4RDZA 1UBPC 4KQNA 3EWCA 4KIRA 4IFKB 4EP8C 1NFGA 3HM7A 2R1PA 1YBQA 4G7EA 3PNUA 2UZ9A 1FWEC 4NI8A 4GXWA 4C6DA 2YZ5A 5HMDA 2R1MA 2XIOA 3GTFA 4E3TA 2EG6A 1V7AA 2ZC1A 2Z4GA 2PLMA 3A4JA 5HMFA 1RJPA 2P50A 1EJWC 4P5UA 2VHLA 3C86A 3MSRA 4DO7A 1P1MA 3SO7A 4AC7C 3PNZA 2PAJA 4IG2B 4LEFA 1M68A 4J35A 2P53A 4GZ7A 1EJTC 3S4TA 1NDWA 4CQCA 5G4HC 3GGMA 4C6QA 2HPMA 3F4CA 4ERGA 3F4DA 4PBFA 2CZVA 4XAGA 3PBMA 1YRRA 3MPGA 4LH8A 4C60A 4LCQA 4BY3A 4XD3A 3ICJA 1ADDA 1FWJC 1GKPA 1JGMA 3LGDA 4PE8A 4CEXC 2Z28A 1FWAC 1YNYA 2Z7GA 4XAYA 3IPWA 2ADAA 1K70A 3RCMA 1EJSC 4KEZA 2FVKA 1R9XA 1J6OA 4DIAA 2FTWA 3A3XA 1GKRA 1A5KC 1ONXA 1FWFC 1YMYA 1E9YB 3TN5A 1EF2A 4RDYA 1RJQA 3WZ0E 1V51A 4IFOA 4OFCA 4GYFA 4DLFA 3GU1A 3LY0A 4XAFA 4C6IA 3TN3A 3QGAC 1ITUA 1KRBC 2OB3A 4H9YA 3HPAA 3CJPA 3E2VA 2YB1A 3JZEA 2HQAA 3K4WA 3WMLA 4H9TA 4RE0A 3NQBA 4IFRA 3DC8A 4UB9A 4XD5A 4H01A 1V77A 4M51A 3MKVA 3MDUA 3TN4A 2EG8A 3MJMA 3KM8A 5CH9A 3URBA 3SFWA 1PB0A 3K2GA 2QT3A 1RK5A 4H9MA 1P6BA 3QGKC 1IE7C 4C65A 3S2NA 1XGEA 2DVXA 4F0LA 1BF6A 2HPIA 4EPKA 1V79A 4HK7A 2QVNA 3G77A 1J6PA 2D2JA 1UIPA 1ZZMA 4LANA 5A6TC 3HTWA 4C6MA 2GSEA 4C6FA 4C6OA 4EPEC 3A3WA 2FVMA 3GU9A 3UR5A 4BKNA 1UIOA 4XAZA 2I9UA 3DUGA 1UMLA 4J5NA 2QS8A 3NURA 1P6CA 4TQTA 1R9YA 1W1IE 4NP7A 4HK5A 3T8LA 3S2JA 4I6VA 2Y1HA 3FDKA 2HNHA 1FWGC 2E1WA 2O4MA 4ICMA 3B0XA 2A3LA 2RAGA 2OOFA 4XD4A 3GTIA 4GBDA 4C6NA 2OQLA 4INFA 3EGJA 3LA4A 2QPXA 2VR2A 4V1YA 2WJFA 1PSCA 2Z26A 3GUWA 5LXXA 2YB4A 2DVUA 4YIWA 4H9ZA 4LCRA 2VC5A 4QS6A 4H00A 3RN6A 4GX8A 3OODA 1PO9A 1RA0A 3GTHA 1A5NC 4NG3A 3DCPA 4DZIA 1FWIC 4C6BA 1I0DA 4Z42C 3ITCA 3LU2A 3E74A 2Z25A 3RHGA 1S3TC 2PGRA 2YXOA 4IFKA 4C5YA 2FFIA 1J79A 3D6NA 4C5ZA 4IF2A 1J5SA 3UPMA 3UBPC 1A5MC 4ZSTA 2OGJA 3F2DA 1O5RA 1XWYA 1FWDC 4LCSA 2VM8A 3IRSA 4PCNA 3URNA 2OODA 1EZ2A 4IH3A 3F2CA 4C6PA 3O0FA 2Z2BA 4IGNA 3AU6A 4LALA 1FWCC 1HZYA 3RYSA 4L6DA 3OOQA 3N2CA 1A4MA 4J2MA 4RDWA 4IG2A 4ZSUA 3OQEA 3PANA 3B40A 3FDGA 2AMXA 1YBQB 4G7EB 1XRTA 4KESA 3GIQA 1RK6A 2WJEA 4F0SA 4GOAA 4GY7A 4GX9A 1K1DA 3LS9A 5AKQA 4RZBA 4IQJA 1O12A 4WGXA 4C6EA 2UBPC 1EJVC 2O4QA 2E25A 4DLMA 1KRAC 3EWDA 5FSDC 1V4YA 2GWNA 1M7JA 1NDYA 5FSEC 1ITQA 2R1LA 4UBPC 2W9MA 4V1XA 2EG7A 1FWHC 1A5LC 2WJDA 3UF9A 3LGGA 3UR2A 2GZXA 2R1NA 3GG7A 4B92A 4DZHA 1EJUC 1ONWA 2BB0A 4HA0A 4AQLA 4H9UA 4DI9A 3V7PA 2Q09A 3URAA 3ID7A 4B91A 3FEQA 1RJRA 1EYWA 2D2GA 3GU2A 4B90A 3LSCA 3E0FA 5HMEA 3URQA 4GK8A 4QS5A 2P9BA 3IGHX 4QTGA 2R1KA 3LSBA 2HBVA 4C6LA 3OVGA 1M65A 4HJWA 3B0YA 3NEHA 1POJA 2WM1A 2ANUA 4XD6A 4C6JA 3ORWA 1WXZA 3T81A 2F6KA 1A5OC 1KCXA 5E5CA 2D2HA 4LAKA 4H9XA 2BGNE 3MTWA
chains in the Genus database with same CATH superfamily
3PW5A 1TIWA 1JZ5A 5L1IA 1QO5A 1E5JA 1VFMA 5MKGA 3LCXA 3CL7A 5D37A 4RW3A 4Z17A 4R8UB 3WQ6A 2VD8A 3KFTA 4H9VA 3S5SA 3NEVA 4ICCX 3GV5B 5KT6A 1P0EA 1FHVA 1JUKA 4XAPA 3T0BA 7A3HA 3BLPX 4DYKA 3SSJA 3TW6A 1XX1A 4E38A 3EBVA 4UFHA 3WJWA 1EJRC 1FH8A 3W24A 5DG8A 3DH7A 2DDXA 3CZ8A 3QY6A 3I3DA 4D8LA 5E1QA 3TONA 3RLHA 4X60A 3DYPA 1K6WA 4LWWA 3H2AA 1FCQA 2Z1SA 4IIFA 3R8RA 3RLGA 4X63A 1V6XA 4CKQA 1ECQA 2XPKA 3VOJA 1YDOA 1YTDA 3IJ8A 4D6HA 4LUSB 1XPGA 5EL1A 1SJCA 2ODOA 4DBSA 1UD3A 2V2HA 3OHIA 4R7JA 3OPSA 4ACYA 1ZENA 3SSZA 4PFHA 5EFFA 2G3FA 2JFEX 3WEMA 1VFLA 2DFAA 4Q8TA 4QCEA 3TQVA 1GYMA 3GSMA 3CAKA 5REQB 1OFAA 1A47A 5AFDA 1FH7A 4DJDA 3VU2A 2BVYA 4EXQA 5C5YA 1T0OA 2ZA1A 4JQ1A 4CD8A 3R0DA 2CBUA 3DENA 4LAMA 2C2EA 3S1VA 3TJLA 4Z2HA 4Q8MA 2JKAA 1O7AA 1PZ2A 1XDLA 4JQ4A 3KRUA 2CC0A 1UZHA 2JIWA 3TQKA 5D9PA 5BOOA 1VLWA 2EG6A 2R8GA 1KCZA 2P10A 5E0KA 5AYXA 3ARTA 5KINA 4O13A 1J96A 1O94A 4R7OA 4M82A 4W7UA 4QDMA 3RRAA 3NO5A 1M68A 1XCWA 5DQHA 5KMYA 2YW3A 4LUJA 1EJTC 3N18A 5FF7A 2ZUUA 3MU7A 3PHAA 4CQCA 4N0RA 4QBXA 3VM7A 5ABFB 3UCCA 3RB4A 1RQHA 2NXHA 3GB6A 1B3YA 1QWKA 1R3TA 4QJ3B 2QCEA 1H50A 4WY0F 4DWSD 4Z1YA 3LGDA 3SADA 4XAYA 1GZGA 2OEKA 1SW3A 1L6GA 3PBUA 1DXEA 3VIHA 2VZTA 2OZ0A 3L5MA 2J4GA 5C2GA 1A5KC 3P5ZA 3M07A 2EEXA 3G0SA 3NPWA 3GC5A 4LBRA 3HFYA 2W61A 3RB6A 4XKYB 4AZ6A 2PFHA 3MR3A 2J75A 3B0PA 4JYDA 3E2VA 3EOSA 3G0XA 4ZFCA 2V38A 4H9TA 3LCFA 3MWAA 3GYCA 1K4HA 3VX1A 5C71A 1CW2A 4ZQCA 3MDUA 4UTTA 1JCLA 2PTWA 3UNDA 1UKSA 1QNRA 1X38A 1NAL1 4ED2A 4JIPA 3CZEA 3MFIA 1OC7A 4RUCA 4OUIA 5I3IA 1EBHA 3PZOA 4B3KA 4EPKA 2VENA 1B90A 1J6PA 1LWHA 4RZ5A 3W85A 2PGWA 3CGTA 7TIMA 5HBFA 1O66A 4ZR8A 2FVMA 5DXYA 6TIMA 3MR2A 3L2LA 4YCOA 3M64A 2VDIA 3NURA 4TQTA 1R9YA 1MRAA 1XSKA 3WLMA 1DJYA 3QQWA 4JAWA 3F4NA 2MUCA 2OOFA 2OOGA 1F8MA 1Z6KA 4O1FA 4IICA 1G1YA 2OEMA 1IGWA 3EGJA 1M1BA 3APTA 2R91A 2CHRA 3N2OA 4TQRA 1TWSA 3KOYA 2VC5A 1W5PA 3WLJA 4H00A 3RN6A 3LTPA 1XQKA 1KM1A 4GX8A 2GJPA 4NUWA 1QI3A 4DM1A 3LU2A 4FBUA 4LBSA 2X2GA 4IR9A 4O3QA 2PGRA 1PYFA 4O10A 4F40A 1ODUA 2XVLA 3HB9A 4S1FA 3ARUA 3EWWA 2ZVRA 1TPVA 3UWVA 2W8KA 4JNMA 3NFUA 3N34A 4OIFA 1TSIA 1PIFA 1Q6RA 2PC8A 4W84A 1KKOA 2GQ8A 2YFNA 4ZGYA 5GNYA 1FWCC 3EB2A 3S5NA 3SY1A 4L6DA 3CHCA 3OOQA 4LB4A 1IWAA 4RDWA 4XX6A 3RB0A 3T08A 2OX4A 3M41A 1Z89A 3TNOA 2EJ1A 1XH2A 1ZLPA 1QW9A 4XVDA 1GVSA 4CN1A 4GC4A 2G8ZA 3QMSA 1QWGA 5CJMA 3VNYA 3APGA 4HD5A 2R24A 1TMQA 3T0TA 2Y5JA 4IZGA 4AF0B 3NNTA 1B4EA 2UVWA 1UA7A 3LHUA 1EJUC 4A6GA 4Q22A 4AZCB 4HSHA 5AHLA 1QATA 2OQHA 1F61A 3RPMA 1W9UA 1TA3A 1XIDA 5FKYA 3NVTA 1BYBA 1SZNA 1WDRA 3BLKA 4IPLA 5EWEA 1BQCA 1VPQA 2NQ9A 3S6OA 5F2LA 3N2XA 4PC8A 8CGTA 4IWWA 4KRZA 4JL1A 3MS8A 1G94A 2ZADA 3NDOA 5KITA 3BG3A 4O15A 3BAJA 2DZPA 1XLIA 1V0NA 2CLLA 3VGEA 5CC7A 1AMYA 5FD0A 4F0RA 4N9BA 3PWGA 3T55A 1UZ1A 2PCEA 3KHHA 4Q8NA 3G3DA 3EWXA 4PUKA 2NSXA 2J8FA 3B8DA 3GTXA 1HKWA 2PWEA 2W9CA 4J40A 1PJ9A 5TQLA 3CMFA 1UUQA 2V5KA 2O9OA 4E6MA 4ZQMA 4A3RA 4MG4A 3ZT7A 5DMYA 4HZMA 2Y8VA 4HZ6A 2YIHA 4AWEA 2WAGA 3LLDA 3BSGA 5L1KA 1CXFA 2HVMA 1PS9A 4GYPA 4D6IA 3HPSA 3OU8A 4GI6A 4UTLA 1KRMA 1QNQA 1Q6CA 1ISWA 2OYLA 4MY8A 4QP0A 1GVQA 1Q45A 1WAWA 4JS3A 1E9ZB 4P7RA 3V16A 3H2CA 5D8ZA 3IGSA 3TNBA 3LCGA 3U6WA 4O1DA 5G1MA 3G6VA 4GCAA 5HULA 1R86A 3SY5A 2ZX5A 3VKCA 2VFEA 3ZT6A 4PEKA 4C6CA 3NQMA 3ZT5A 4Q33A 3FLUA 1XYAA 1G7VA 2I5GA 3LTYA 1B5TA 2G3IA 2NUYA 4NYUA 3C6CA 3AIWA 3FKKA 3QV8A 3VGFA 1L2UA 1K7EA 4GVFA 3NM1A 2JEIA 3GNRA 4UIOA 4H4IA 1A50A 3AISA 2YDSA 5FJIA 2YZ5A 3FXGA 5HMDA 1GOXA 1W91A 3EOLA 3GIMA 1MQRA 1QASA 4M24A 2BY2A 3A64A 1OJXA 1LP6A 4FS9A 3THCA 4QNWA 1UKTA 4EAMA 2NXGA 3TJIA 5HNUA 2CLEA 4J3ZA 3DDMA 3BAWA 4FR6A 4D6FA 3RLVA 2OWWA 1C8XA 3AYTA 3HG3A 4WSKA 4RNOA 3A47A 1MWOA 2P53A 2VX4A 5JMUA 3M6YA 5IBXA 3SUVA 1EPVA 4DUWA 1O60A 5G4HC 3W2UA 2XH0A 3F4DA 1YRRA 2DPIA 2G97A 3EA2A 1BRLA 4RZ6A 2Y5EA 2ZZ7A 3W01A 1HG3A 7ODCA 1QU4A 1MFUA 4KWVA 3RBDA 4MWAD 2OLHA 2V3GA 3RCMA 3D3FA 3L5AA 6REQA 4NLGA 3RCYA 2WYSA 4GFIA 1B31A 2A3HA 4BF7A 2DGAA 3E2SA 4ROPA 5DQIA 2HCVA 1JPHA 2PWHA 3W02A 5J5DA 4K8GA 3QPEA 1TQJA 1FWSA 4DLFA 4OQVA 2Q3OA 1DXFA 2QXWA 4Q8QA 1R3WA 4Q8OA 1GONA 3WLKX 2QLYA 3C56A 3M4HA 5KFDA 4X0NA 3HPAA 3NQGA 4YTUA 3MA8A 1UJQA 1OT2A 2YZRA 3EDKA 4XD5A 4F66A 2HXUA 4YYFA 5I78A 3SECA 2FZ9A 3ONCA 4C1LA 2DPJA 3UXIA 2BXZA 2CW6A 1PHQA 4JTJA 2JF6A 3M9YA 1S97A 3FY1A 2GGGA 1ZNNA 1EFZA 2O9TA 4UFKA 3LPFA 3Q4DA 3T4CA 1R3YA 3AWOA 4JR5A 2QV5A 2NUXA 3T5HA 3EWBX 1EF3A 4UTTC 4YTSA 1FDYA 2V5JA 3LPPA 1XL9A 2XINA 5M3WA 2FIQA 2PSNA 3M9MB 4IL0A 4TIMA 4MWAE 2XVNA 3EWZA 3MR5A 1UR2A 4FOKA 3OVRA 2R8WA 2CEQA 3KOXA 2B7NA 4GBDA 3AO0A 1I8JA 3W7GA 2BZNA 5LA1A 3HU7A 4NZJA 4C7FA 1O68A 4A8RA 4K8EA 2XSXA 4MZYA 2UY4A 4UR7A 1RYSA 1WZKA 1OCQA 1OG0A 3FOKA 4C7DA 5KFOA 2BOFX 5JU6A 3MHFA 3PF3A 1XSJA 3OO2A 3GC4A 1V3KA 3VIGA 4C6BA 3UZXA 4TXEA 4CCDA 5I5RA 4P7OA 4XZLX 5DMMA 3PW7A 3Q45A 3CO4A 3EWUA 3O07A 4GA8A 2GDVA 3LOTA 3M0XA 3IN5A 4N42A 1AH4A 1S10A 5FJTA 1TR9A 4US6A 4WF7A 3PW4A 1VH7A 3W1AA 3FYOA 5CBJA 5KZMA 3KL0A 1NOWA 4UTWA 4NJGA 3V0TA 2VM8A 4LVGA 3W83A 1OYCA 3NR0A 5AHMA 4DJDD 2OODA 3FVDA 1EZ2A 1PV8A 4HU0A 3C0QA 3Q8PB 1V08A 4IUOA 4IGNA 4LALA 1W3JA 2DT0A 3KHRA 2VFFA 3FA4A 1E73M 4NIRA 3R2GA 2QUTA 5H2ZA 4E0CA 4J2MA 2QQ6A 3R10A 4HPXA 4ZXLA 4XB3A 1YBQB 3TOYA 1ZFJA 3CIWA 5EBAA 1VAHA 1RPXA 4PMDA 2FHCA 2D0GA 4L9YA 2E25A 5FSDC 5E70A 1ITQA 2ZDSA 2KZHA 1W17A 1XLCA 3O05A 2GZXA 2R1NA 1SO3A 2QUMA 5BRBA 5GPRA 4ZO8A 3P0WA 3URAA 1OX5A 4JTLA 3GNNA 1JRBA 1OX4A 2HVNA 1UMYA 3PBVA 4QJ5B 1O1ZA 3EDDA 1KM0A 1TZZA 1HKIA 1OF6A 4DO6A 3QQ1A 2G50A 3PZTA 2W9AA 3WK2A 1R2TA 3DHUA 4IRKA 2ANUA 4D1JA 5T91A 1N8WA 2H9AA 3WO8A 2FPVA 1Y5VA 4ATWA 1H5VA 2BHYA 1AVAA 1P5BA 4ECVA 3PTQA 4O0ZA 5A5WA 3WCZA 3ERPA 4ECTA 4HSNA 3BPWA 3QR1A 4ZQRA 1ECEA 5F7UA 3GXPA 2GFTA 5CJNA 3M16A 4F0MA 1EB3A 2CCRA 1JYVA 3O6DA 2E40A 3CHDA 5DRCA 3OB8A 2GWGA 1GOOA 4FNSA 4S3CA 5LHEA 2YCLB 4RXGA 3IVSA 1OEPA 5LA2A 1K1SA 2ZCGA 4NU7A 4R33A 1TV4A 1WZAA 4HMDA 2YL8A 4GC7A 3PPCA 4S3AA 5DCEA 3B8TA 4QROA 3N04A 5DRIA 1HJSA 4QRNA 1JXJA 2BODX 3UG4A 4KH2A 5G2IA 1VS1A 1OWQA 2G3NA 2EPMX 2PRMA 3NGFA 4Q4PA 4AD1A 1Q4NX 4KWUA 4FS2A 3IVUA 4J9RA 5EA9A 3T05A 1JZ8A 1CX9A 3IARA 2AQVA 1JI1A 1JYNA 2F8QA 3TTEA 3Q8QB 3SQLA 4HHHA 1JDCA 3CM4A 4GYPC 1GQNA 1CGUA 4QG8A 4MOZA 4RLIA 4PFMA 4FX8A 2BOEX 1E72M 2CXEA 1YIXA 5C5JA 4U2ZA 2WBKA 3IIXA 4JIEA 2WVSA 3TTQA 3O3RA 3R43A 4O1CA 1F8IA 3HMJG 2PDNA 4YVXA 2BNJA 4JIHA 3IJ6A 4ERIA 2ZXDA 1L9WA 1E9IA 1KB3A 3B03A 2WW5A 4O4VA 1NFGA 1UWIA 3KBMA 2WKGA 3A21A 3BMXA 4PTMA 2DZSA 2HWGA 1C9DA 3NPVA 3KTSA 3M0JA 2AL1A 4EE9A 2VTFA 1VPXA 2QCDB 1JDAA 2VT0A 1L0PA 3BG5A 4XZWA 2C2RA 2QJIA 2ZC1A 1HFBA 3EPMA 3W82A 4HHLA 4Y90A 5CCZA 1E1FA 1ZAJA 1FA2A 4FB7A 5I23A 3MYOA 3QW4B 3RU8X 5CZJA 3GC2A 3NCOA 4REQA 1LOSA 4RX0A 3ZMRA 5RUBA 4JFWA 2A5HA 2J7GA 3UXLA 2G4FA 3NZRA 4S3FA 5E0FA 3CBWA 4U3CA 4C6QA 2X1UA 4OBRA 1OYAA 4ED3A 3H53A 4CD6A 3NDZA 3RO8A 2AGPA 1M9HA 3ZLFA 1F4HA 1V0LA 4WOZA 4B15A 4QAWA 1QVBA 2Q8LA 4AIOA 4GMEA 2OJPA 1VBUA 4XWUA 4P61A 4AYSA 3ARSA 2BVTA 2VC9A 3SR7A 4WXYA 3L65A 1CWYA 1K9EA 3QSTA 3TN5A 5FF3A 3VGGA 4QDPA 2YYTA 3ES8A 4Q3MA 4S39A 1EHAA 1VYSX 1ITUA 2W67A 5KFSA 3PZVA 4L7ZA 1IYXA 3GE7A 3PPGA 4HU4A 1WUEA 1PZ3A 1RPKA 3DEQA 2C91A 3FHQA 1RCXB 2J7HA 3BGAA 3UCDA 5ENLA 2QGYA 1U83A 4E4FA 2BSLA 4P8VA 2X40A 5F1UA 3SY8A 1IE7C 2CBIA 3S2NA 4J9KA 2B7PA 1D9EA 4JXCA 1JZ2A 4FNPA 4DF1A 4JKMA 3TAOA 2BTMA 3N12A 3VINA 3SCTA 1TVNA 4Q44A 3SCSA 1VFFA 3P8IA 1FP9A 2QDEA 3MBDA 4L1GA 3C4UA 2R8JA 4XTIA 1UMLA 3UXAA 4M0XA 4LUTB 3W88A 3GFYA 1VLIA 2XH4A 3H26A 3GTIA 2C18A 1VHCA 2WVUA 1EC8A 5JH2A 3NL2A 1S1PA 2PDJA 3LA4A 2Z26A 4AG0A 3ZSSA 4IMDA 1QMLA 1XIJA 3KHLA 4H9ZA 4IXHA 2ZZ2A 4GKLA 4B5VA 4XIAA 1TPEA 3QLLA 4DZIA 2OT0A 1GUVA 3TP4A 3BSHA 1GVEA 3A9BA 5EWGA 4EBDA 4QJ4B 4IF2A 3UPMA 4QLLA 1W1ZA 4GACA 4K1WA 3O06A 2PZNA 5I02A 4Z1DA 1X8CA 2J13A 4UTJA 2CWNA 5XIAA 1OIMA 4FX7A 4IH3A 1DJXA 5H6HA 3PBYA 4MB4A 1HGWA 4HNNA 2PRHA 2XIBA 4HQVA 3RYSA 3MBFA 3QR3A 4O12A 3FCPA 3W27A 4GUIA 4IG2A 1AQ0A 1BKHA 2WQDA 2ZOXA 1AG1O 3W76A 4C6EA 4QIUA 4IQLA 3DESA 3W81A 3Q65A 1Q63A 4Q8PA 2YLAA 1GOQA 4UFIA 1J2BA 3W9ZA 1QOQA 3UR2A 1ONWA 3QV9A 4AQLA 1CDGA 6CGTA 1SR0A 2IKIA 3HPXA 3CWHA 4HMCA 3AIVA 3EKLA 2EKGA 4IGSA 2VGGA 4ZQPA 4B91A 1TTJA 3LCIA 4Q4QA 2I56A 3A5VA 4DXXA 3NQEA 4LS0A 2YA0A 2C79A 3E0FA 1CGXA 1U1HA 2QR6A 2W7OA 2VQTA 3G3MA 4QTGA 4HOXA 2JGYA 5H1WA 5CPNA 3BO9A 4XTDA 4FNRA 1FQ0A 1W9VA 4J4KA 2PODA 3DG3A 1VRXA 2Y7EA 3LB0A 2Q6ZA 4R3UA 2HK0A 3WLTA 3CAQA 5KFBA 1TMHA 3FXYA 2RDWA 1M41A 5HOSA 2AL2B 1QHPA 2DORA 3ITYA 2GUYA 2BXYA 3WDHA 2YBUA 4LV9A 1H61A 4GISA 4F0HA 5I7GA 3W2LA 3GIJA 3BQ0A 4E2OA 1R3QA 5C9XA 3HG2A 2Z6JA 5HNNA 3UPWA 1TV7A 3NQ8A 2GQ9A 3S5OA 1FKXA 3KVKA 3EOUA 2HBXA 4EPBC 1JAEA 1O5KA 4NNAA 4IT1A 3JW7A 3CB3A 3CAVA 1TYGA 1MZRA 1QPQA 3MQTA 1KWGA 2XISA 1QHZA 1R6WA 1YEYA 3H7UA 3F7JA 1R3VA 3A13A 3GH7A 1NDVA 3AS2A 3DKJA 4GUHA 4ZXOA 1AFSA 4JIRA 1E9LA 3AIBA 3NGDA 1CB7B 3B04A 4FALA 3W37A 5ABGA 3WEOA 4ZQOA 3WF4A 1LT8A 4RW5A 4CN4A 3H55A 1OX6A 3UGVA 3W1LA 2PTYA 1IV8A 3TTSA 1HN1A 3TLQA 1XINA 2H90A 2JALA 4ERAA 1YYAA 3H40A 1A4LA 2CLPA 2Z29A 4FLRA 4GIYA 1G01A 2DY3A 3ZJKA 1GWJA 1GJUA 2GOKA 4OOZA 2PP1A 4M7TA 4QDWA 4IX0A 4WRHA 4L6HA 3CIVA 4XZIA 3ZJ8A 4FOUA 1SO5A 4A4AA 2PD5A 3HM7A 2ZX8A 2V9DA 4BI5A 4G7EA 2UZ9A 1XYCA 1MUWA 4Q8EA 4N9DA 3QV7A 3CEUA 5KT3A 4MJ4A 4M80A 5DLCA 3W1PA 3UY7A 1RJPA 1EJWC 1P1XA 3B8UA 4JKLA 3UJSA 3TROA 3CZKA 1CI1A 1D7KA 1ZUAX 3SZ8A 2UVRA 1PZ0A 1Z9AA 4OBSA 1P1MA 3ABSA 4J35A 1E4MM 2YCEA 3L4UA 2QNEA 4EF8A 2PEVA 1V93A 4PODA 1B3WA 5BW6A 3BJYA 1J0HA 2DZXA 1WBHA 5AHIA 3F4CA 1LLWA 1SW0A 3WK1A 3WN6A 4PBFA 3RX4A 4O50A 3PBMA 4UTHA 4IGHA 3GXTA 1KBBA 5BRQA 1FWNA 1TTQA 4P7NA 5C55A 3FVMA 1D2KA 3SRHA 4DN1A 3DFPA 1EJSC 1OCBA 4CD5A 4MLJA 1FWTA 1R9XA 2DIJA 2ALRA 3N3MA 4MGGA 2Y6ZA 1AJ2A 3HIJA 3TEVA 1KW1A 3EX6A 1BWKA 5IRPA 3ZR6A 3OVPA 1KR1A 3TN3A 2FB2A 4MSSA 2X1IA 4B5UA 3E0WA 1NEYA 2ZZ6A 4HMNA 2NZLA 3JZUA 2RDTA 3C52A 4KT2A 1KXTA 3WMLA 1XSIA 1N2VA 2IKGA 1F3XA 3NSXA 3M1ZA 1JIBA 3UWWA 3DG6A 2I5IA 1PB0A 3V4BA 3RPDA 3EOEA 2JEGA 2ATLA 1XJBA 2QT3A 2HROA 1HJUA 3QKZA 3KHGA 3CEPA 1ADSA 2IUZA 5CJ5A 4AEOA 5EMYA 4H7ZA 2EAWA 5CPQA 5TBOA 3MR6A 1UIPA 2RGLA 1J93A 2PDUA 3WLIA 4XAZA 5DG7A 4J5NA 2WBGA 1E6XM 1RZMA 5H8UA 2Y1HA 4ICMA 3AHVA 2A3LA 1UD4A 2RAGA 3MC5A 1R3RA 5IM51 4N6EA 4HTBA 3I68A 1NJJA 3UY8A 2VZVA 1RH9A 1FP8A 2C3ZA 2OGYA 4FXSA 2ZFAA 3PB0A 1MFVA 3RCNA 4G8TA 4QS6A 4IQEA 4FF5A 1J2WA 4IPNB 1EQCA 2VEFA 3BAIA 1TZ9A 1QCWA 4EBEA 4DELA 3REQB 4J3VA 2J9YA 1OGGA 3ZS4A 3I7QA 4TX8A 3RX2A 2PBGA 4TVUA 1XBXA 1J5SA 1US3A 4O1EA 3ARVA 4OV9A 4AZGA 3W2KA 1Z48A 1CXIA 4U28A 1JD7A 3H4GA 3OTRA 2E3ZA 4CCCA 1U1UA 4GJ1A 3DFSA 4P2VA 4LCSA 4U7CA 5LGXA 3CB8A 3S3GA 4AVFA 1P0BA 3G1HA 3FGCA 4NILA 3AAMA 3B97A 1NU5A 5E9AA 4LU0A 2J62A 1TWDA 3AUJA 3Q37A 7TAAA 4RE4A 2FLLA 4KESA 4PTXA 3P3BA 3V3WA 5AC4A 4F4ZA 5D04C 2HMCA 1YPIA 2HDJA 2V2DA 4W4QA 4GYKA 2VQUA 2XH7A 4WGXA 4WR3A 1M7JA 1QNVA 3TSBA 1JUBA 1G9HA 3O0KA 5BNKA 3SFKA 3R58A 1A5AA 2EHHA 1A0DA 3S6DA 2PWVA 2BB0A 5D2WA 1WBJA 3WLLA 3BCDA 3FS2A 4GHRA 5D8WA 4H9UA 1YE4A 4W5UA 5AHNA 4LB3A 5A6MA 4B4FA 4IMFA 3SW6A 3CZJA 5K9DA 4A21A 1P7TA 3KZPA 4GZJA 1UWUA 1DE5A 5CLWA 1KGWA 4ZO7A 4HTYA 4GXMA 5KFLA 3NEHA 4LVFA 2ZXAA 1E6QM 2E5BA 5DCDA 1H49A 1KGXA 2D2HA 3QTPA 4Q4KA 4MHBA 1JCYA 2GSJA 3MTWA 1FHUA 3NM3A 4D6CA 2WMIB 1REQA 2EQDA 4N9CA 1QR7A 3EB3A 3NQDA 1KXVA 1UG6A 2ZWZA 1UD6A 1UWTA 3E49A 5DX7A 3W53A 2ZE0A 2QF8A 1KBIA 3RM8A 2E28A 5KT5A 5XINA 2AQ4A 4PMQA 3E0LA 6XIAA 5FJRA 2RFGA 5MHBA 4C7GA 4NZCA 2P76A 5KG5A 4W89A 3E3HA 3VOFA 3R0KA 5AYYA 1Q6GA 3NQAA 3LCLA 4LX4A 1BXCA 4CQBA 1IR1A 2YX0A 1F6YA 1ZAIA 1J0IA 1UWRA 3KCJA 3WBAA 3MVTA 5DCBA 2QJJA 4F9DA 4LAOA 3CMJA 2HEJA 2VRJA 4DZ5A 5E6YA 4BS0A 5BYWA 1FKWA 1E4NA 2J6VA 1DEDA 4GI8A 4FNUA 5IXEA 3BICA 1FBAA 3AZTA 3KVJA 2V5CA 3GBEA 3MKCA 1QNOA 5J5RA 4XBSA 1T8QA 3O6AA 2ALZA 1P0KA 3TR9A 4B9ZA 1JF5A 1L8PA 1QPKA 3BV7A 2WLZA 1WKYA 2GGJA 2YW4A 1W9XA 1QW7A 1AMKA 4S3KA 1S5VA 1FCVA 5LYRA 1YQ2A 1KBKA 3ARYA 1JDFA 4X9YA 3M44A 1RBOB 1JZ6A 1C91A 5CQ1A 3BLOA 1AH0A 1XLFA 3SJNA 5AC8A 2ABBA 3WDJA 2WJZA 3TLLA 4PTVA 4L4MA 3P67A 4ZFMA 3VDBA 3O16A 3AJ7A 4H19A 3WY1A 4Q8VA 1VJZA 1ZY9A 3VGBA 4B2DA 1EO7A 1ZU8A 1UD8A 3ARQA 4PL2A 3UYCA 4PMRA 5FL1A 5C9RA 1RCQA 3HQPA 5HA7A 2XFRA 5AHEA 2IKJA 3VABA 3KVLA 4DO7A 3BMVA 3WLSA 5HWJA 3WL0A 3IUHA 1Q8AA 3RM4A 3OSPA 1KLYA 3TC6A 4MVAA 4O3RA 2G4JA 2XGZA 3TTYA 1X97A 3SCOA 1UUMA 4M1RA 2CZVA 2E0PA 2CBJA 2OWXA 4Q4MA 4NXKA 5E09A 5AB3A 3BC9A 4BA0A 1NQ6A 2PDHA 2MANA 3PFRA 4GQQA 2Z28A 1OADA 1I2PA 1ZBKA 3S47A 3G1SA 4O8RA 4L56A 3QN3A 4Y7EA 5D2TA 4MWAB 2ADAA 1AD1A 1K70A 2H3DA 2HS8A 3F4WA 1ZAHA 2AAAA 3L4YA 5BMWA 1VBHA 2QCDA 1WOBA 3GY1A 1WDQA 3GDKA 3PWIA 1R30A 4RDYA 4Q8WA 1OG6A 4GYFA 3QPZA 1B2YA 4ONVA 1KQYA 1MW2A 4RE3A 1XQLA 1OFDA 1SFTA 5KG4A 4PMZA 1KFBA 1V02E 5CBBA 2ZRYA 3RU6A 3DIPA 4YHEA 1I2QA 3K4WA 3WFAA 3KBWA 3KRBA 2P1FA 4RE0A 4WLCA 4Z2GA 3DC8A 4Y9OA 3BZGA 5F4SA 2ON3A 2PLJA 5G2WA 3TN4A 2NLYA 1VC4A 5CH9A 1UPPA 5MKGB 1AJ0A 2IQTA 2QVHA 3MCOA 4QXIA 4OHQA 3QGKC 5DEZA 1Y5WA 2GJXA 4FXRA 1XGEA 5CGTA 3B9DA 3K4DA 2JEPA 1W1B1 1WB0A 3HTWA 1F3TA 3HO8A 3GG8A 4EPEC 2X2YA 3WBYA 1ITXA 2YJQA 3AOFA 2PDBA 5TNVA 4BKNA 2C14A 3LI1A 5JH1A 2GK1A 1TJRA 1QI4A 2V3FA 4PUUA 3R0UA 2XZ7A 1FWGC 3AMLA 4XD4A 2C22A 2RGMA 3B4UA 2IQ0A 3B0UX 2G95A 1XLDA 5CC5A 5HR7A 2E68A 2VI0A 3O8AA 4LCRA 2W5FA 4B16A 1T5AA 4WGHA 5B80A 1RA0A 2V5DA 1A5NC 2BWGA 2VGIA 1DQWA 2CETA 3HGOA 1S3TC 3T6CA 2BX7A 3T40A 4QX4A 1QBAA 2ZXBA 1UB3A 2VMFA 1IT8A 1VIZA 4GVIA 1CNVA 1EP2A 3I6EA 2OGJA 2HE5A 1T99A 1XICA 2AGQA 1V3IA 2NUWA 1LL6A 4YP3A 3R89A 4I5RA 4B4HA 3R13A 3URNA 1IIHA 3VE9A 1VEPA 4ED1A 4LNYA 1XUUA 4A3YA 3BAKA 3CTLA 4I7UA 4NL1A 3MHUA 5XIMA 3W00A 4CU7A 4ZSUA 4GI4A 2ISVA 2Y85A 4RJEA 1LZOA 2D69A 1VJIA 3GIQA 1KO0A 2ZUSA 1G4PA 1K1DA 3PBGA 4RZBA 1JUEA 1H11A 1KRAC 2DEPA 1V4YA 3PG9A 3TE9A 4KCVA 3P0XA 4UBPC 2NQ5A 4V1XA 4NNBA 4EIVA 5H8MA 4P8UA 3VMOA 1RBAA 4OGZA 4PMXA 3BLIA 3CWOX 2QPSA 1QOXA 4HCLA 1ISZA 1XLKA 2VEIA 3H2MA 4H8VA 1ZL1A 1XXXA 5HPOA 4BWLC 1EWDA 3WMCA 1SPQA 3ZWSA 4MNKA 1EO5A 3T5KA 1XFCA 2WM1A 1E40A 1QW8A 3ORWA 4C6JA 3U2EA 1BSIA 4ML9A 1A0CA 1XLLA 1RBLA 1F73A 3C2EA 3A24A 4PZVA 2FHBA 1NH6A 4H8UA 3J7HA 5KG1A 4O57A 2GQAA 1JCXA 3QY7A 1S0NA 1MEHA 4GZIA 4ZE5A 4H6RA 4ECQA 1G5AA 2Y24A 1PCKA 2Z00A 1EX1A 2PBOA 4Z0JA 5D09A 3BXWA 5HMSA 4JDBA 4KS0A 4QEEA 1FDZA 3I7SA 1F7BA 4NHVA 1YPXA 3TU9A 1NWSA 4WKAA 3SGZA 1RLDA 1TVPA 3O2LA 2A21A 2PWUA 4E3VA 2PDPA 2BMBA 1TPDA 1OCNA 2YOCA 4DNMA 4IMGA 1RQEA 4DAIA 3ONBA 3VC6A 1A3HA 4YL2A 1LWJA 3VCCA 2Y70A 1W31A 4Q32A 4B3LA 5KFNA 3DFHA 3OZMA 5BZAA 2OO6A 1WV2A 3CT2A 4GC6A 1NOUA 2DH3A 3V75A 1G4SA 1NP2A 1XM3A 2WKJA 3STPA 3EXTA 3QY8A 4AXKA 1TWIA 4L1XA 1S2WA 2CLOA 1EUNA 2WVVA 5D32A 4GIRA 2PGEA 4LC6A 3GIPA 1NFBA 2BASA 1MO0A 1H0IA 4ZB5A 4E5TA 3OEXA 5FEZA 1LQAA 5C9WA 3F2BA 1W2VA 5HPCA 1WKFA 3UR7A 1TPFA 4XKMA 3OIXA 4TR9A 4IMEA 3PP7A 3ZR4A 5FOOA 3L0NA 4K2SA 1K77A 4W88A 2SFPA 3O7UA 1FX6A 3T2OA 2W6RA 4I90A 1W3HA 4EXBA 3P5YA 4WCJA 1MNSA 2DIEA 1IEQA 2VDHA 1AQMA 1E0WA 2EXOA 3QQ0A 2WSYA 1MI3A 3DG7A 1K8CA 3TR2A 3NYDA 1V0KA 3ELFA 1R7AA 4JTGA 4GXWA 2XUCA 1SGJA 3GDTA 3GFXA 5HR6A 4HCHA 3S5YA 4NJHA 4LNCA 3VK5A 3IVTA 4PMUA 3MSDA 5KFKA 2DIKA 3E6EA 5FEXA 2DT3A 3WH8A 3MY9A 2VP8A 4AC7C 3G8RA 3P7YA 1NWUA 3L4TA 4XVEA 3FAWA 1QNSA 4YR2A 3N29A 5KG7A 4NRRA 1NDWA 1E15A 4PRRA 5M17A 2FVLA 3GGMA 3BURA 4TTGA 1MZHA 1MXGA 3H8AA 5KFTA 4A8NA 3NPUA 2PLCA 4LH8A 4M8UA 3OW1A 3W86A 5K4XA 1JDEA 1UKOA 4A3QA 3MO4A 4N02A 3HFTA 5A8MA 3AJXA 3DI0A 2JF7A 1YNYA 1HUVA 1G7UA 3PPHA 2HNEA 5FL0A 3RM9A 3PTKA 1TA3B 2GDQA 1I6NA 4KEZA 2WMKA 1U30A 3K46A 3LQGA 3OGVA 3SBFA 4KPLA 3OHMB 1VKFA 5AECA 3N25A 4I9MA 4DUOA 1JDDA 5JXQA 3LHTA 1S0OA 4EF9A 4XAFA 1MEWA 1OM0A 4UR8A 3CUFA 1S1RA 2B31A 4J9MA 3IJLA 2DW7A 3GX9A 2WZEA 3NL6A 2XSBA 4IFRA 1NELA 3MMDA 9XIMA 4M51A 4DL6A 3MKVA 2A3AA 2BG5A 3BANA 4FX6M 3MHGA 3U48A 3ITXA 1DJWA 4FEZA 3QW3A 1J10A 1RK5A 4H9MA 5L9FA 4J9JA 5FF4A 3ANUA 3MSGA 4CD7A 3KVMA 2W9CB 4LAUA 3FK4A 2XN1A 1UJPA 1W54A 4GKTA 4UQ9A 1ICSA 4KCTA 3MMTA 4AUBA 3GU9A 3UR5A 3TSMA 3BCFA 1W1IE 1BYCA 3GXNA 3B0VC 3S1GA 1AL7A 3W7EA 4HYVA 1QRQA 2QMJA 5FCZA 3M47A 4HP5A 2FJKA 4RV8A 1UKPA 3RAQA 2PLKA 2GPTA 4JUZA 2CITA 7CGTA 3DCPA 3WQCA 2GJNA 4RZ4A 2JEJA 3GW0A 3NL3A 3UD6A 2YXOA 1YTKA 3G1XA 4R27A 3WUEA 4CQ9A 3KBSA 1KR0A 4OBTA 4UOQA 3KTCA 4RXFA 2ZVIA 3VNZA 5HATA 4TV6A 2ZUVA 4PULA 2WWDA 3RMEA 1KKRA 4IRCA 3OGSA 2B0MA 4EOUA 2W3ZA 1FCUA 1MDRA 3UQNA 2PU0A 5BOEA 2DQWA 2NQLA 5PTDA 1Q2SA 4ECRA 3BCJA 3SN1A 4E2DA 4WZHA 1W9BM 1XBZA 4B5TA 4EEYA 1JZ7A 4B2DD 4CU6A 1W9PA 4HU8A 3EWDA 2G5WA 5A6JA 3REQA 4NRSA 2ZZ4A 2PD9A 4DRSA 5AC5A 2R1LA 3K8KA 1XBYA 5D4YA 3E5BA 4QG9A 2VO5A 2ZUWA 3TDFA 4NKCA 2EPKX 4HVXA 5C8BB 4PB5A 2F9RA 4QAIA 1JD9A 1M6JA 2GVLA 4ZVJA 4JTQA 5DG9A 2ASHA 1VGAA 1EA9C 5T9BG 3W28A 4QG6A 2XFFA 1KV5A 3W84A 3MUXA 2REQA 4AC1X 4H8HA 1EWEA 1OB0A 3W2MA 4PSRA 3TC7A 4L4LA 4Q4RA 5I3GA 4G7FA 2AQWA 1AUSL 1K6AA 4YWSA 3I10A 2NW0A 1KM5A 1BRLB 2OZTA 1VR6A 3GXFA 2VCAA 4HJWA 3T0DA 4MB5A 5I09A 1TREA 3IK4A 1X1NA 1JFHA 5EMUA 4MADA 3TYUA 1W6TA 4GABA 4HYRA 1TCDA 3CLMA 1TE1A 6REQB 1FUYA 1W8SA 1ZQ5A 3LDVA 4GY0A 4HK6A 3HG5A 5M2FX 3AFBA 3NTYA 3G6XA 4PB4A 3NQ7A 3E02A 1KM3A 5FI8A 2E4TA 3H24A 5CEWA 3T1GA 1UWSA 3W6LA 1XLEA 3WD4A 5HAOA 3P14A 2OSWA 1HX0A 2CZFA 3CV1A 1R85A 1SYTA 1QFEA 3DAQA 1K9TA 1G67A 1T40A 1H4PA 3IJQA 5A2BA 1QO2A 3L0KA 4E4PA 4EPDC 1UR0A 3R79A 3GUGA 2E8ZA 3MANA 4O53A 3QTGA 1S2AA 3CS2A 4PTDA 4LV4A 2NX9A 4HJFA 2PDFA 1L6FA 4RKAA 1JZ4A 1L6SA 4YYCA 4JN8A 1UH4A 3BE7A 1POKA 3W3OA 1PKLA 4ECSA 2G37A 5HXMA 3CXOA 1F5ZA 3FSUA 4U31A 2ZA3A 7REQA 1K7XA 4A3UA 3RG6A 4QITA 4I5XA 2NLIA 1K9DA 3LCHA 5A69A 4F3HA 2J9XA 3MVIA 3KCLA 1QOPA 1OFPA 1V03A 1UD2A 4WVXA 2FMOA 2QCCA 4WSJA 3T5JA 1SJAA 2Z24A 4GUFA 4XG1A 2GVYA 4Q7BA 2BDQA 2ISWA 5M03A 2X16A 4B9YA 4UNKA 1B1YA 3WLRA 1FWRA 4NAEA 4M6QA 3G1YA 2IW0A 1T6MA 2V5BA 4E3TA 3G1VA 1RY0A 2Z4GA 3V36A 2P50A 2WCAA 2ZRZA 5LSMA 2YL5A 2W8LA 3OZOA 4GNKB 1DORA 4ZZ9A 3CNYA 1W1A1 1OY0A 4DBEA 1F2JA 4DNHA 2DQXA 3MV11 4QWDA 8XIAA 1W8GA 3VNJA 1B3OA 1ISXA 2F6UA 4AEFA 2X41A 2FTPA 1DJHA 1UROA 3NXFA 3QZ8A 4XAGA 2OFJA 1KBLA 1SQ7A 4UQCA 2RDIA 2DSWA 4PH6A 4ADUA 4J7RA 1XCFA 1PYMA 2C7FA 1IZJA 3CT7A 1U2YA 2Z7GA 3FNDA 2CBVA 4EBCA 1CGVA 1OX4B 2GYIA 3G6LA 4NXSA 3DGBA 4OE7A 2QYGA 1IGSA 2FZMA 2VWSA 2CZ5A 3T4WA 2JKPA 5DN1A 1X8FA 1SSDA 3H23A 5CBIA 3WZ0E 1H1ZA 3GLCA 4KWWA 2IA6A 4O11A 1XG4A 4FOJA 3BGJA 5CAHA 2EKCA 2WLYA 3KAOA 2H9AB 4AWUA 2YCJA 1WO2A 4AYGA 3VOIA 4ZENA 3WQFA 4JEJA 4F2BA 4DJFA 4XZHA 3F5JA 4H6QA 3Q94A 3OLIA 1I45A 3K2GA 2A79A 3DX5A 4FNQA 4KFNA 1QPRA 1XDJA 2DVXA 1E0UA 3T0CA 1YW1A 4JV2A 1BAGA 2YXXA 1XYFA 1KFKA 2FDMA 1FY6A 5CXPA 4YPJA 5DMLA 3HOJA 1XRSA 3P84A 3D3AA 4NP7A 4OTKA 1PXGA 3W29A 3T8LA 1E51A 1CXHA 1A49A 4PA8A 3B0XA 4GCXA 4ZE4A 2RDXA 2OQLA 4JKKA 1VBJA 3WJXA 1UQZA 2VGBA 5LXXA 1ZJAA 5HJXA 3V5FA 3W7CA 4MJ2A 3QMTA 2PDXA 3SGGA 4UCGA 2CNCA 3ARZA 3GTHA 4J3SA 3LHZA 3N15A 3E74A 3PUGA 1KD0A 5LNRA 2QCNA 4HHPA 3VD3A 4IFKA 2C1GA 5KT2A 1J79A 3N6QA 5LNVA 1ONRA 1W1TA 1IXQA 3NYZA 1VFOA 4GBUA 3MUCA 3BH4A 3VAVA 4IP5A 2DZWA 3IRSA 2YDAA 2WCGA 1QT1A 3TKFA 4CCZA 4YU1A 2Y8UA 1HZYA 1N8IA 1OT1A 4JTAA 1IXPA 3W7HA 1BG4A 4JX4A 2XN0A 3H6OA 1RK6A 4Y96A 2QJGA 1P48A 3TYBA 3CPGA 5DFAA 1EUAA 3OA5A 1F76A 4JGDA 2XWDA 3PSVA 1AJZA 3DKLA 5F2MA 4GWEA 4HN8A 3OIHA 4REQB 4HA0A 4KIEA 2RJGA 1IZKA 2QDGA 4J9SA 3A9IA 7ENLA 1KWKA 1ZTVA 3MJYA 1KFLA 3ID7A 2H6RA 4UOZA 2OT1A 2VR4A 4W8LA 4ECWA 3V6KA 1B3ZA 2CWXA 4XZ9A 2QPUA 3U3HA 3JR2A 2ZUNA 3LSCA 2J74A 2PWGA 3A5FA 1U1JA 1GHSA 2OXNA 4LJ3A 6XIMA 3TIMA 1QJWA 3ITOA 2HBVA 2VX6A 4C6LA 3VNDA 4G5DA 4J27A 1TJPA 1S5WA 1G4EA 1XGDA 1BTMA 2F6KA 3GHRA 2BR0A 4D6DA 4IPIA 5CLTA 4MTVA 1I1WA 1DJZA 2OWCA 3NPXA 4HYKA 3CL8A 1IWPA 3N2MA 3KOFA 1AD4A 1Q6DA 4F0KA 1ZBVA 3ARWA 2A3CA 5LIKX 3P2VA 3USZA 1K02A 1KBJA 4MM1A 4J1OA 4BJHA 1EXPA 5CZTA 3QZAA 5G1YA 5FF2A 3NSNA 3VGDA 3S2LA 2V4RA 3VPLA 4DL2A 1VCFA 1YADA 3D46A 2ICSA 3IAQA 3MP4A 2CZDA 3LRKA 3K30A 1XBVA 1N8FA 3UESA 4ZB0A 1RSCA 3E38A 2DZUA 4MKNA 5KFFA 4UUIA 1ZCCA 4GE8A 5EKYA 1PKNA 2ASJA 2ZZ5A 5FAGA 1TB3A 2A7NA 5I3KA 1L2QA 1XRFA 3WKZA 2V69A 2X7VA 3THUA 2RUSA 1DJIA 4GH1A 2AQOA 3GTNA 2B81A 2NT0A 4I6KA 1V8EA 4PEEA 4YWIA 3LNMA 4GQBA 3UU0A 2C8NA 4OV4A 3RDKA 5EMKA 2QV4A 3N4FA 3PUOA 3W7MA 4HNTA 4RDVA 1FTXA 4L65A 1PE1A 3VOHA 4F9JA 3CUGA 4KERA 4UZUA 2VURA 4CVUA 4AIBA 2WHLA 2YFOA 5KETA 4KIRA 5D33A 3V1PA 4AD5A 5KEZA 2X0SA 4O1AA 1E0TA 2PDIA 3HQNA 5GVJA 3LLFA 3I6TA 1UHVA 4XSMA 1M01A 3PZNA 4WSHA 1RP8A 2DSKA 2A7PA 4QWCA 1LDCA 2Y89A 2BVWA 1RD6A 2J7EA 1BFNA 3VD9A 3LYEA 3EX1A 1O95A 1OIFA 1THFD 3RR1A 3GDRA 3SUUA 4Q7IA 2OLSA 3L4WA 4DBUA 1JF6A 3MSRA 3UJFA 4LEFA 3VD5A 4IG2B 1A3WA 1MW1A 5KFIA 4NZ5A 4OT7A 4POCA 4JFVA 5AY7A 5T8GA 3C5QA 3M5VA 3UW6A 3FSTA 4GLEA 3U4AA 4PBGA 2QUUA 1X6NA 4CNNA 2BHUA 2DJXA 1JGMA 1CIUA 4E4UA 1K8ZA 5BU9A 3GBDA 1I2RA 3IIPA 1DIOA 4ED6A 3G18A 1XIFA 2WPGA 3Q58A 3K4AA 3LXBA 5BXSA 2FVKA 5J8LA 1J6OA 2EF9A 1E6RA 4JYEA 4BI7A 4WDTA 4OECA 1HJWA 3DERA 3PZ9A 2DZBA 4GGHA 2C1IA 4UQEA 5D05A 4J9PA 4W9TA 1XH0A 4C6IA 4UR9A 2E7FA 2OB3A 2ZRWA 3E96A 2IBKA 3CLWA 4MUZA 2YA1A 3CJPA 4YR3A 3PTDA 3LERA 2ZTKA 4JQ2A 3VFLA 4QLKA 3E5PA 1PCWA 3CL6A 1TV8A 1D7FA 4O4WA 3VNMA 3W7PA 3P82A 4L80A 4IMAA 5D2YA 1LQ0A 1LCOA 3TC3A 4CD4A 1W5NA 2X30A 3TFXA 4DHGA 3O9NA 3PBWA 4Z1AA 1V3JA 1RVKA 1FH9A 2XM2A 2GUBA 3EMQA 1PAMA 4ZTXA 3TZNA 4XISA 4ASTA 3SRDA 1JL8A 3TA9A 4ED7A 4DJFC 3O6CA 4QWEA 3OGRA 2X05A 1UIOA 2XVKA 5EBUA 2Y5SA 3VOGA 1HGYA 2A85A 4TU1A 4PUMA 4D9PA 2HNHA 2HXTA 4MWAC 4JTEA 3ARXA 2DV0A 5KFXA 3OG3A 3VFCA 5C9ZA 4ROQA 2D22A 4GVHA 4RNHA 1OC6A 1GQKA 3MFHA 4EYIB 3AXXA 1C9WA 3W6YA 4DJEA 2X0YA 1WA3A 3RHGA 3INPA 3KE0A 3VVGA 2WZTA 3QVQA 4MPKA 2V3EA 2A3BA 1R2RA 3QSRA 1R5YA 3GDBA 2E5DA 1P0DA 2GGHA 2ACQA 1UWQA 2FH8A 3EX2A 4LRTA 3QFEA 4FI4A 1O5QA 1KCLA 4DO4A 3O0FA 4Y8FA 2QZRA 2YL6A 3W2NA 4FAMA 5F2GA 2OSYA 2P0IA 5G4WA 3GKFA 1CLKA 5AOUA 4G7EB 3AS1A 4ZA0A 3G8EA 2PB1A 4QE5A 4ZODA 3ZLGA 1JCNA 1V6UA 3ITTA 2J25A 1NDYA 5H91A 4Q45A 1LRTA 3W7QA 1TFVA 4H7VA 4KMQA 3S1WA 2FDSA 3MP3A 1FWHC 3AYVA 2FMNA 3CK5A 2V4QA 2X09A 2FKPA 3DI1A 4DZHA 2W92A 3K8LA 4I9JA 4EAYA 3L7RA 3BQ6A 3VIOA 5EU9A 1RJRA 5BOFA 1GG1A 4O3OA 4LTSA 4V15A 5KFYA 5DBUA 3MCNA 1MNZA 3OP2A 1BGAA 3SUWA 2IXUA 1QUMA 4OZOA 1PDYA 4QS5A 1Q6OA 1XYMA 4KFPA 2DJLA 3POCA 1W37A 4XD6A 4YJ5A 3RBEA 2NT1A 5DY3A 1QK0A 2GJLA 2I57A 3BTNA 2P8BA 3LV6A 1WQ5A 4DJDC 3S9IA 2WHMA 5HK4A 1SO4A 2CERA 2BGNE 1NF0A 3AIRA 1XW8A 3A3HA 3EPNA 3SCPA 2HTMA 3H22A 1BHGA 4PMYA 2QGHA 4AISA 1JQXA 1IIGA 1GPFA 1JRCA 3EA3A 2MNRA 2CLHA 3M7WA 4UTMA 4CUCA 4GY1A 5EMJA 1X1ZA 4XZBA 2OEJA 2PZ0A 3OA3A 4IX2A 3A4AA 3ECQA 1CLVA 1F74A 1MMFA 4PCSA 5BU6A 3VM5A 4GINA 4G3IA 3RGTA 2PWDA 4NSBA 1PTAA 3EMCA 3AZRA 4L1WA 1RR2A 1FWWA 2TPSA 1QXLA 1YNQA 3FN9A 3UWYA 2I9EA 3C2OA 4G1NA 3VE7A 3ISIX 4DJFD 5GNZA 1KXHA 4ZCWA 3UVIA 4FLSA 1P0NA 2W79A 3VCRA 1R2SA 2PDKA 3AHYA 5AYZA 2OMAA 5EY5A 2ZDRA 2FPTA 4QSFA 3SEPA 3U5YA 1SMAA 1U33A 3LZ3A 1DJGA 3GRIA 4NJJA 3P62A 5KFQA 3WX7A 1XLJA 2WHKA 1NVMA 2PA6A 1HJVA 3FJNA 1JNEA 3D0CA 4HZ7A 5A3HA 2DUZA 4PBEA 3TZFA 5LIYX 3IEBA 4DWSA 1R47A 1WZLA 2PMQA 5EMMA 3S42A 2A7RA 2HJPA 3SURA 3IJ9A 1K4GA 4YTTA 1UOKA 4DI8A 2BP1A 4D1IA 1KM2A 2XZ9A 1DYSA 3RAXA 2DPEA 1WDDA 4F4YA 3GHTA 3FFSA 3OLEA 1EEXA 4O52A 1FHLA 5C7VA 3WNMA 1T94A 3A6OA 2Z2AA 2J6SA 4RDZA 4O28A 1GOWA 5DLFA 2Y8KA 4QQ3A 4G6CA 2R1PA 4HB7A 3PNUA 5LXEA 1QI0A 3T42A 4AD2A 5AZ1A 4AY8A 5EB8A 3EDEA 3WQDA 2XIOA 3PSWA 2OX1A 5FACA 2C6QA 5JUMA 5H8PA 2VA2A 1RVGA 3FGCB 2V81A 1HT6A 3A4JA 4RR4A 3N1AA 3OVQA 3PZMA 1UCWA 1ZCOA 4JV1A 4FO4A 3QRHA 3HGJA 3V1HA 1R87A 2XWEA 1XS2A 5CPLA 3RJXA 1TV3A 1GYLA 3LX9A 2ZC8A 4O8AA 1JYWA 4BHYA 1BVNP 4DYEA 3OG2A 3L4XA 3S4TA 3PJWA 4WY0A 4S3EA 5F4WA 1J4EA 3PR5B 4U6PA 4WD0A 2HPMA 3M9OB 2YPIA 1MYRA 3RX3A 3QYQA 4C60A 1H41A 1H63A 4XD3A 2JEFA 1Q4WA 4XQ6A 1PUDA 4K39A 2QAFA 4Q4SA 5J04A 1PIGA 2YYUA 1TIMA 3WL1A 4M56A 4S3DA 3ZZ1A 2BVDA 2VDGA 3TFCA 3EX4A 3H70A 4HIBA 3KDOA 4LY4A 1N56A 4YN5A 1P7TB 1MXSA 1GKRA 2J79A 1KV8A 2C0HA 4IJRA 1EF2A 3BW3A 3LQLA 1C8VA 4OFCA 2WZMA 4KWSA 3W71A 1HW6A 5FF0A 3QGAC 2R6OA 3JRKA 1KRBC 3DYMA 3C2YA 1Z8AA 4JTRA 2GL5A 3UG5A 3SRKA 2QCHA 4MPQA 3NVDA 5AYBA 3N4EA 1S5MA 5LGZA 3H2FA 1REQB 4B5WA 5I3HA 2F2KA 1Z69A 3IAPA 4F2UA 3QEZA 1A5CA 2I14A 5KSWA 1P6BA 1GOIA 5DO8A 1VEMA 5CSSA 4W7VA 4IP4A 2IXVA 3U7BA 1DL3A 4GNJA 4JBRA 1ICQA 2QVNA 4HK7A 1Q6EA 1E71M 2WC4A 4MAVA 1EDQA 3DHDA 4K38A 3CQIA 3GV7B 2NV2A 3C0JA 1XRVA 1CXKA 4K8HA 1TCMA 4HK5A 3S2JA 4AHPA 3D5HA 2E1WA 4W87A 1XISA 4OWGA 2YLLA 3STFA 3KWXA 3WSUA 2PDGA 5I03A 4HNVA 4O0QA 3CH9A 1ZJIA 4YIWA 3RXZA 3TMLA 1P43A 1XLGA 3NZQA 3OODA 3P93A 1G4TA 3CPUA 5A8PA 4JTCA 2V30A 3QXBA 4Z42C 1Q2RA 4YVVA 1LRQA 1WYIA 1I75A 2PF8A 4I9AA 4C1NA 4DXKA 2ZUMA 1K03A 3DU0A 1ISYA 1HL9A 4MNLA 5AYIA 3ARRA 3BW2A 2W63A 4EWJA 3MUIA 2VZUA 2J66A 3HG4A 1EIBA 1U5VA 4QW8A 4LXFA 5U4NA 3VXGA 3BV4A 3LHWA 4GVGA 1DE6A 3GVWA 1B0IA 2JE8A 5FJOA 2X0HA 2ZUTA 4CVWA 4O3PA 2OTDA 4L6OA 3W7NA 4GI9A 4RE2A 4GOAA 4DL4A 4DLMA 2JEQA 3PJXA 2BQ3A 4GIAA 1ME8A 2GJRA 4W93A 3WH9A 4J3XA 5CZKA 3LRLA 3GG7A 1LBLA 1RUSA 3FA5A 4JTFA 4OUEA 3C0SA 1F07A 3AHZA 2WXDM 3CUJA 2ZIDA 3UFYA 4GPNA 4QNEA 3ANVA 3PJUA 3VMPA 4A29A 3VOCA 3PB2A 4JQ3A 4KRUA 3S9ZA 1S5NA 3N4AA 5CGQA 5KG3A 5CPMA 4AIUA 1CCWB 2P9BA 1HKJA 3MUZ1 3NSMA 4FNTA 3ZIZA 4JD4A 3ZR5A 4K6AA 3GO2A 3T81A 1JULA 1DHKA 3NAVA 3DHFA 4AVOA 2FGLA 3AHXA 1AW5A 1E6SM 3CU2A 1VPYA 3WFLA 4NVTA 3SDOA 1ZB5A 3D47A 3VNKA 3OHBA 3SJ3A 2CHNA 4ECZA 4D6EA 1XP3A 2WKLA 4PL1A 3OHAA 1BWVA 4RV3A 3G1RA 1Q7QA 4ACZA 5IHRA 4HZ8A 1S2CA 3L2IA 4YTRA 5E6ZA 2C16A 1E1CA 2PCQA 1OZMA 1I9CB 3RAOA 4AY7A 3RLUA 3AIQA 4AY1A 1U22A 2VC7A 3R8HA 3ZQ9A 3HZ3A 4B3ZA 1UC4A 4MB1A 1QAPA 3LRMA 3WH7A 4JEQA 1N7KA 3PPFA 2BOGX 4HOZA 1RAKA 2A6LA 2QDHA 2C28A 4PTWA 4WX2A 4MUPA 4LSBA 3WUFA 3UG3A 3ARPA 2GJXB 4BR1A 3RJYA 3ZWTA 1WX0A 1XF0A 5IBXC 4UFLA 3SCNA 3PAOA 4JFTA 4PCTA 4F79A 1OFBA 1C8QA 1TJ1A 3BWWA 3W7LA 2E9LA 2Q71A 1EIXA 1I2NA 1SU5A 3T07A 3W26A 3VZZA 5GJPA 3W25A 2GK1B 2OQYA 3EEGA 4FSAA 3U2ZA 4MFDA 1BVZA 1F9CA 1FRBA 3C3NA 1YXYA 3CO8A 2W91A 1FOBA 1E55A 4LUIA 8RUCA 3S0CA 5I24A 4F4XA 4CLMA 5BXRA 3GM8A 2IQDA 1E0XA 3R1ZA 3IV8A 4YVPA 4Z2IA 3U9IA 1W0MA 3CQ0A 3NOEA 2R82A 5A6SA 3TJ4A 1OK4A 3OSNA 3A4WA 1A5BA 1XIBA 4JN7A 4N7QA 4CEUC 3V6JA 5T26A 4QSHA 1D3HA 3WYZA 4G56A 1UBPC 1HIZA 4ZEPA 5ABTA 2QF7A 4KWOA 3MW7A 4EP8C 4GIEA 3AXKA 4P8XA 1XIMA 1QK2A 1J12A 3OZYA 2RKXA 1PX3A 4LYQA 4MZ1A 3UVAA 1AZ2A 3KP1A 4JIIX 1FFQA 4DQWA 1E3ZA 1KA9F 3UGRA 1HF6A 2XHYA 1GVIA 1R0MA 4AZHA 2D24A 4XO7A 5CGMA 1SZGA 4PMOA 1PKMA 2VHLA 3MYPA 4Q4OA 1OK6A 4AXNA 3BARA 4AWSA 4Q6JA 2BBFA 3QZ7A 3W07A 5HDRA 1Z41A 3TMQA 1VIWA 3M43A 3NZPA 2QDDA 4JFSA 5G1TA 5LHFA 3KRZA 2NX3A 1SVDA 3SGUA 2P3EA 4AU0A 5L9XA 2FLPA 5E0CA 3WDQA 1AW1A 2ACRA 3PG8A 3EEZA 3N6HA 2BY3A 1I60A 4PE8A 4CEXC 1FWAC 4GUGA 1BXNA 1KQZA 4JX6A 3RRXA 4UZSA 2BGSA 3M0MA 4U10A 1YMYA 1SZRA 2QJMA 3EKGA 4FP1A 3L66A 4PMVA 2KX9A 2OKOA 4GRSA 4US5A 4A05A 4Z1BA 1J5TA 1XGZA 4UTWC 1E4LA 1XI3A 4GO9A 2ZX7A 1WKEA 3TYEA 2J6UA 4XUYA 2W7PA 3EWYA 1XLMA 3R11A 2HQAA 4LW7A 1IWBA 2V2CA 4H01A 1E43A 3PC0A 4W5ZA 4XV0A 2F2HA 4LYRA 3I4EA 2LLEA 2Q02A 1S46A 5CKSA 1Q6FA 4X22A 3HJZA 1W32A 4EVZA 4PUDA 4RNIA 5C6MA 3GIKA 1B4KA 2D2JA 3FAXA 5HJYA 3HJEA 4RNFA 4UNIA 2D3LA 2Z6IA 3A3WA 4TOQA 5KFZA 3M0IA 1ZP3A 1M5WA 1K3UA 1PTGA 3M46A 3PY2A 4LPCA 1EP3A 1UP2A 2C15A 2NX1A 1LBMA 1MXDA 5EWFA 4ILSA 1PWLA 3RO6A 3WQEA 4C6NA 1A53A 1M7PA 1UZDA 2VEMA 5A2AA 1ESWA 4H6KA 3GUWA 3GHUA 2YB4A 2DVUA 1F4AA 1FFRA 2AKZA 1FCBA 5HQEA 1MW3A 1EKOA 4TO8A 1AW2A 2PDYA 2J6XA 2WVVB 1GZJA 3PM6A 3GVVA 1FWIC 4Z2JA 2PP0A 2BQRA 4O54A 1EC9A 1US2A 2QCMA 1NP0A 2VRKA 5ECVA 2FLNA 1WP6A 3W1XA 3GS6A 5FJPA 3VCNA 1AK5A 4UTFA 3UWUA 2G41A 3M0YA 4NASA 5IDIA 3U2OA 4HSOA 4J9NA 1B54A 2Z2BA 3QHOA 4MNJA 4DZAA 3TCEA 4UFJA 2GVEA 2XH2A 4JNYA 3PANA 1UPMB 3FDGA 3OBKA 3TH6A 3A12A 2IPJA 3CASA 3G6MA 4WUIA 4QEHA 3KL3A 4F0SA 1WZMA 4GX9A 4RNNA 4G1KA 2G3JA 5AKQA 1GEHA 2YL9A 3MUY1 4NZ1A 3L4VA 5GJNA 4MY1A 2GWNA 4UCFA 4HOWA 3CIXA 2VEPA 4DF0A 3AALA 1MDLA 3E9AA 5I2UA 4ML4A 2XVGA 1O5XA 4GQGA 3LGGA 2BGQA 3WDPP 4W7WA 3TQ1A 3A22A 1EXBA 1C90A 1EBGA 1YLVA 3BGGA 1EDGA 1Q13A 3QGVA 1EYEA 3VNLA 3SCWA 1T3NA 5DT5A 1SZEA 3M0ZA 3K13A 3KHJA 3MWCA 4AZIA 2NV9A 3YPIA 1GQJA 3UT0A 5HMEA 1I4NA 1T7LA 2PTXA 4GK8A 1TPC1 2CLFA 3S6TA 3TA6A 3LSBA 3EDFA 4KEMA 1WAUA 1DWFM 2QKFA 5ECUA 1ME7A 1R8LA 1OHLA 2E9MA 4UTKA 1XHGA 3PUEA 4TTUA 5CC3A 2Q3RA 4ZOEA 2X1TA 3I6RA 4U5IA 4H6EA 2IPGA 4UFMA 2W4XA 1G6CA 3T7VA 1MQQA 3W7IA 1SSGA 1JVNA 4CNUA 3IJIA 3WQ8A 2J47A 1UR9A 4YMZA 2VOMA 3EYPA 1CGTA 3N6JA 4G2DA 5IFTA 1GG0A 4L64A 4CQAA 1OFOA 2XYLA 1JPKA 4ZO6A 2DSZA 3S5ZA 5KFMA 1M04A 3WJZA 3WBXA 1US0A 5A8GA 1UYQA 2O9PA 1GQLA 1HKMA 1ZP4A 3HA1A 4K3ZA 2Y0FA 2J7CA 3CHFA 2ZYFA 1NTHA 3WLNA 5A6LA 1NQKA 1DXIA 1CB2A 2W66A 2VZOA 3G1DA 4M6UA 1TV2A 1C29A 3TW7A 1XIEA 3A23A 4K1GA 4HCDA 1L6WA 2YDQA 4N4PA 5HUPA 4E2BA 1Z7AA 2FGBA 4FR1A 3OBAA 1U5HA 1JCJA 3E1F1 4TX9A 2DT2A 4XUGA 2BV9A 1RA5A 2Z27A 4QCFA 1CZ1A 2AGTA 4YXGA 2AKMA 2ONEA 3ZM8A 1CPUA 2VUNA 1WDSA 1M03A 4S38A 3W70A 2JBMA 1D3CA 3P61A 1GHRA 4HYWA 4R7WA 4WHBA 4HPJA 1DPMA 5A6BA 2W0UA 4S3BA 2A3EA 2ASLA 1JXLA 1NM9A 1D8CA 1DVJA 4LFYA 2E09A 1S39A 1ISVA 1LYXA 3W1UA 9CGTA 4KBXA 2PTZA 1HNYA 4FS1A 2INZA 2JGQA 1DJQA 1TPWA 1X1OA 4DPQA 1J8VA 2ZRXA 1PX4A 1GW1A 3NO3A 2C13A 3LI0A 1UD5A 4L61A 1W1PA 3RB3A 2HSAA 4L4PA 4M6VA 1H5YA 1W5MA 4LRSA 3GH5A 5EYWA 5JUVA 3H2OA 1EJ7L 3B8SA 3T2PA 1OD8A 3N11A 2YKKA 2R1MA 3TUUA 4WOQA 5LIUX 4JY9A 1VF8A 2VD9A 1SO6A 3VNIA 3N9RA 1V7AA 3UG8A 3KS5A 1JEZA 1R46A 5I3JA 4P5UA 1RYRA 3QC0A 5BCAA 3BLEA 3C86A 3N73A 3BJTA 4ZO9A 3SO7A 2PAJA 2DUAA 3AYSA 5LNUA 4RU9A 4WQ6A 2V3DA 4GZ7A 1EGZA 4H7CA 1LORA 1OFRA 3UWQA 3T8QA 1DIKA 1YHTA 3ICJA 5KT7A 2VA3A 3DZ1A 4IIHA 1U5JA 2XJ7A 3IWPA 4KFOA 4CNOA 1UR3M 3POHA 2ACSA 3QF0A 3P6LA 5KZDA 4I7VA 2XIJA 3KHDA 2REQB 2Z1WA 1UZ4A 4DIAA 3G6YA 2V68A 1FWFC 3A4XA 4TX6A 4HPNA 1BD0A 3GD6A 2BFGA 3N3TA 4EXAA 3MZNA 1DKWA 5IOBA 3ZVHB 1JZ3A 1WOAA 2YCIX 1XH1A 1VP5A 3WD3A 4TMCA 1WUFA 1JG9A 4Q43A 4DY1A 1YDVA 2CYGA 2RDJA 1GYNA 3M7SA 4IM4A 1PVNA 3THAA 1UA3A 2F84A 2WSRA 2R8HA 1HO4A 3MJMA 4UMBA 1M7XA 3KM8A 3SFWA 5KFCA 3BSMA 4IHCA 5K9XA 4Z2KA 2XU2A 1EGVA 5DANA 3SIMA 4AD3A 3N19B 4MF4A 2XG9A 1C7TA 1UBSA 4NY2A 4NAFA 3MI3A 4C6OA 4CGTA 4IXXA 4AEEA 4R53A 1X7IA 5LNSA 3L4ZA 4NZ4A 1TVLA 2QS8A 2PS2A 2EPLX 1KFCA 2Q8ZA 4D6GA 3CQJA 2CXGA 3BG9A 1GJWA 3QJAA 2CPUA 2VXNA 3FDSA 1TO3A 4INFA 1PL9A 1Q3NA 1QPOA 3IIVA 3W2JA 2QPXA 2VR2A 3ALFA 3MMWA 3E0VA 1X7FA 4IIEA 2A2IA 3GDMA 1VHNA 3V18A 1EP1A 4PR4A 5SWUA 2FB3A 1PO9A 2DZTA 1G0CA 1Z42A 1O1HA 2BQUA 2DSVA 7REQB 3STEA 2Z25A 3S83A 1CXLA 3GFZA 1Y7VA 3FX4A 4I7WA 5CC6A 3VDCA 1LF1A 2B4GA 4HHMA 3DFTA 5BWAA 3LM3A 3COTA 1VFSA 3LPOA 2JK2A 1F3EA 4PCFA 3FYYA 4E8CA 3H4BA 5K7JA 1BXBA 2E67A 1SMDA 3IIZA 4H83A 4E8GA 3OQEA 4V2XA 3SN0A 2VL4A 4NAEB 4IPPA 1GTEA 1EH9A 3KBVA 6ENLA 4GY7A 3T9PA 4L9ZA 3UNTA 3WQPA 4NYYA 1EJVC 3APYA 3ZFHA 4NT0A 3HMCA 4DAFA 2W9BA 4OJYA 7XIMA 1XV8A 4PN2A 1A5LC 2WJDA 3UF9A 1ICPA 3EDJA 1PBGA 3FV9A 3WQGA 3VIJA 1I2OA 3KWSA 2J77A 5KFJA 3SIZA 2VX7A 1OSEA 4EX4A 1OGBA 1Z44A 3AWNA 1UH2A 3V7PA 1J01A 3FYPA 5C2CA 2QIWA 2WC7A 3UJRA 2XCAA 5CSYA 3PJTA 5BXTA 1V6VA 1J0KA 4HNOA 1M7OA 3IGHX 2EPOA 1IT0A 3N9KA 1NARA 2JIEA 3SCUA 4MZ8A 3FKRA 1AQHA 3O1NA 1A5OC 1ZS2A 3LGEA 3PW0A 4FMVA 5E5CA 4IMCA 1LRNA 1H7XA 1Y65A 5GJMA 3HV9A 1LUCA 1H7WA 3BAXA 3DOPA 2FQIA 1GKQA 5T14A 1XFBA 3GR7A 2AU0A 4WDUA 2NVAA 3E2QA 3GAKA 2VGFA 2G0WA 4WIWA 4CU8A 3VUPA 5JIWA 3P60A 4US5D 3U57A 4PMNA 3ZVIA 2PPGA 5CG0A 3CPRA 3WF2A 3CUHA 3VKDA 3HGRA 3VTRA 1KCKA 3I65A 4DUVA 3KW3A 3TW9A 5I07A 1S9FA 3EAUA 1Q7ZA 4NNCA 1IEWA 3VMNA 4E8DA 3NZ1A 1WDWA 1E4IA 4ZBCA 3DFQA 2E6AA 4QWAA 4E2VA 3G1AA 3WNOA 4RPPA 1XC4A 1TPB1 2QHAA 3WMBA 3DFNA 3MP5A 2GQ3A 4NJKA 3QOMA 3I3BA 2ZZ3A 5FEWA 1EOKA 1UP0A 5D38A 3WUGA 4IP7A 4WJ8A 6PTDA 3L0GA 4Y2WA 4A8IA 1UKQA 4FXFA 3IGXA 3G2GA 2PUZA 5HANA 1JPMA 3KCOA 4S3JA 4C6KA 3K5XA 2FTYA 3O63A 4Y9AA 3P81A 4DX3A 5IDZA 2GVJA 2XGBA 4L9XA 2G96A 5EFDA 1VYPX 3IACA 6ALDA 3LXCA 1I0BA 1TUFA 1ELSA 3WNPA 2VCCA 2YCKX 1D3GA 4GJIA 5D02A 5DQPA 1XLHA 4IFKB 5AC7A 2A6NA 1IEIA 4PTNA 4AD0A 2ASDA 3WUBA 2CLKA 3WF3A 5DT7A 4U33A 1KTCA 4AH7A 3WLHA 2HZGA 2UVUA 2XFWA 1CTNA 3EPGA 2PLMA 3GNPA 4PRWA 2C1HA 5KZ6A 1KXQA 1TJ0A 3DECA 1J11A 2PI6A 5DGAA 4D72A 3ITLA 2NQZA 2Z1KA 5DY2A 1VB9A 4ZOAA 1HJQA 3W7KA 5CG7A 1H7NA 1T8XA 2F61A 4ORMA 3U8GA 3WD2A 2YXGA 3HBLA 3MPGA 5I77A 4LCQA 5K9CA 3LBCA 3GVQA 3Q8SB 2P0OA 1ADDA 1GKPA 4Z1CA 3LLXA 1JXKA 4AFYA 4AVNA 9XIAA 3Q2DA 1AODA 4F50A 2PF0A 3WD1A 1I1XA 3ATZA 3EX3A 2CKRA 4M7SA 3ZVHA 1H60A 4DEZA 2WSQA 4QR6A 3FW6A 3AMCA 1E9YB 5F9NA 4YCPA 1CGYA 2E6DA 3QPYA 1RJQA 2WANA 4XZMX 3T5LA 2VFHA 3GU1A 4R8UA 3VIPA 4DYJA 1WE5A 4MJMA 4BCEA 5D2VA 3UA4A 3AS3A 1XUZA 3TQ0A 3PTMA 2XN2A 1K1QA 4IIDA 2ZWYA 3NQBA 3PS7A 4LYPA 2IS7A 1Q65A 1W3IA 1ME9A 2BY1A 1VBGA 3B8WA 1UR1A 2VYOA 1UWAA 1ML1A 1ZRQA 2J24A 4EANA 5LIWX 1GPWA 1TR1A 1NF7A 1BTCA 3GXDA 4YTQA 4QFUA 1OD0A 3H21A 2HRWA 2WPBA 3CYJA 4I9TA 4LUSA 2J7DA 1H09A 3KL5A 1XYZA 3SAZA 4FLOA 1LOQA 3DFOA 4OOUA 5JBEA 3L68A 3MV01 2AGOA 3AC0A 4N9EA 2ACUA 3VD7A 2EO7A 3CH0A 4HU3A 3TYDA 2PDWA 4ICNA 2C0AA 2WZIA 1K9FA 3R25A 4XK2A 3HPFA 1J0YA 4GQRA 4PB3A 1VFUA 5REQA 4FZIA 3BLLA 1TUXA 2ALDA 5IFPA 4QLJA 2TYSA 2Q8XA 1JCMP 1CBGA 4O16A 5CSUA 5A6BD 1WDPA 1LWIA 2Y7DA 3GVRA 1BSLA 2WWCA 3AQUA 2NQJA 3W4RA 3ABRA 1JGIA 1IM4A 4Q6XA 5KFRA 1GNXA 1JPDX 3MKKA 4BQ2A 1GORA 3PZGA 1BYDA 1JIHA 2VJXA 4WK9A 1GJPA 1ZBCA 4S2CA 2OELA 3QHMA 2I5QA 4KGJA 4ES4A 1EX5A 3CZGA 4ECLA 3N2CA 3TSDA 5B7ZA 5EPDA 2AMXA 4BEQA 4HNCA 1B9ZA 3W1MA 1O12A 2XGPA 4DVOA 2POTA 5ABFA 4JNZA 4R9XA 3TWAA 5DGBA 5KFPA 1B30A 3RMJA 3BVJA 2W27A 2TRSA 3IJDA 1SR9A 2ISDA 5A95A 1AQFA 2BHZA 1RY8A 2ZICA 3UWEA 3B9EA 1BWLA 3NL5A 4DI9A 2RJHA 1B9BA 1R38A 5A6AA 3GU2A 3QV6A 2QIIA 3KUMA 3M0LA 3VDGA 3URQA 4MB3A 3LENA 1F6KA 4MKVA 3WK0A 3JS3A 4DO5A 2WNZA 4XKYA 1TX2A 1PPIA 3B0YA 2ZZ1A 5EMLA 5HNRA 3I7RA 1E0VA 1TRDA 4S3GA 4HT3A 3AMGA 4FBTA 1GTHA 1W1YA 4FA3A 4OVXA 3EXSA 3T2QA 4M1BA 3UPBA 3S2CA 5CPTA 5TAOA 3GNOA 3AUOA 5ABEA 1AA1B 4ZL1A 2GLKA 4GJJA 1B3VA 3P80A 4Z0SA 1W56A 1MSSA 3LMZA 3W72A 4J28A 1C7SA 1E5NA 2WV8A 1O4UA 1EHNA 4UWMA 1ENUA 4LQ1A 3ABZA 2A0NA 5TIMA 1LM1A 1VEOA 4X2PA 3VIFA 2IKHA 1LLZA 5KG2A 3GYEA 2XC9A 3W7JA 4TVDA 4GC3A 4CNTA 1NIUA 2EPNA 5FEPA 3VZYA 1DIEA 3ZXWA 4DL3A 3MI6A 2Y62A 3V6HA 1HJXA 2J8TA 1H3GA 1V02A 1XG3A 4IOTA 1K7FA 2AGKA 4IL2A 4KCUA 4C1KA 1J9YA 4KKXA 2VFGA 3II1A 4MJZA 1BPLB 3W7RA 2XSAA 4JTSA 1W5OA 3AXMA 3VYLA 2Z2UA 1E56A 3UZYA 3LN3A 3H2EA 5BMXA 4HA4A 1TV5A 1XYBA 4QQUA 1SJDA 2OKTA 1TTIA 2H3BA 2TAAA 4F8XA 3C2FA 2J88A 4ED0A 1PX8A 2WZHA 4O0KA 1Q6LA 2WMHA 5KFHA 2QW5A 2UV8G 3U5UA 1CT5A 1DV7A 1L8NA 5FJUA 3T09A 1EJXC 1D8WA 1XR2A 2IMRA 4LS2A 2GGEA 2FHFA 3TQPA 4ZQNA 2W62A 3AMDA 4KRTA 4MMWA 4GQ0A 2XIQA 5A8QA 1KM4A 1EPXA 2FGZA 3U7VA 1GEQA 2QUNA 5K4ZA 5I00A 3FHAA 1CXEA 4U4MA 1UC5A 4UC5A 2NWSA 3W75A 3EB4A 1S2TA 2HVOA 3W7DA 2HS6A 3SB0A 1PDZA 1T96A 1IHIA 4AF0A 4HGXA 2J9ZA 5BXPA 3EPIA 3W1NA 1V3LA 4AZCA 5KFAA 2F7FA 3TJXA 1MUMA 8XIMA 1W2PA 4O17A 4M6PA 4U3AA 1RCOB 3DHPA 4JCMA 4IIGA 2WB5A 3ZSTA 2WM0A 4ZOBA 2XFYA 2V63A 4EWND 1ZJBA 4YQWA 4DL7A 3EPOA 5U7SA 2GDUA 3IIOA 3LMYA 1OFEA 2E77A 4MIMA 1XIGA 1OABA 4HNLA 3SN4A 3ZJ7A 2VNCA 3G24A 3QC3A 3HQ1A 4XBKA 9RUBA 2YR1A 5KFEA 5A8NA 4FIRA 4L5ZA 3P8JA 4F2TA 1K8YA 3GNXA 3LHYA 2V67A 1JCTA 2YB1A 2NVDA 2QCLA 3JZEA 4UQBA 1XD1A 1Z3NA 2WMFA 2TMDA 3WBWA 3LTSA 1HL2A 3HV8A 2EG8A 3KBJA 2ZE3A 2V82A 2Y7FA 4JTIA 4RUAA 4DM2A 2WSKA 2BLEA 3UJ2A 4LYKA 4FPSA 4C65A 3RILA 2WVTA 3WFZA 3EMZA 3BK0A 4Y9MA 3G77A 3QZEA 2I7GA 3PFMA 3THDA 2EBNA 5BWFA 1G69A 4QJ1A 2ZRUA 2BS9A 1C92A 2OZ3A 3U0HA 1NY1A 1A3XA 3AMKA 1FHDA 5A1AA 1H0GA 1GOMA 1S5TA 3OQ8A 3BW4A 5BROA 4AZBA 3CV2A 1BF2A 3M5YA 4WKHA 4DUXA 4J9OA 3H2NA 2WJFA 3N14A 4R5EA 2V0TA 4HA1A 2FPYA 3QMRA 4LT9A 3AXIA 4TV5A 3LBMA 4J9LA 1BEUA 3NXLA 2QJNA 2PE4A 4O3NA 1VFTA 4IJBA 2WOQA 1DP0A 3VKKA 4B5NA 1PKYA 3NIYA 3GQYA 1QHOA 3B8IA 1KFJA 1KNWA 3PZIA 4C5YA 3T0AA 4QISA 2Z7KA 2FFIA 2WTFA 3D6NA 4DWSB 3UBPC 1LL4A 4M19A 4X2RA 4LF2A 3M0HA 3F2DA 4WKFA 4BF9A 3NJ3A 1XC6A 2Z0IA 2D73A 5G2HA 5CAKA 1XKJA 5AZ0A 1TJ2A 1VZWA 5CZSA 4HA3A 3GIIA 3QLDA 1TE6A 1WXJA 2PDMA 2BXVA 4ZOCA 1XIHA 3H7RA 1HQTA 3OZPA 5EGRA 3WDIA 4PGLA 1XRTA 1PZ1A 2X7WA 1H51A 3R7MA 3KLLA 3WQWA 2UBPC 4R9OA 2O4QA 3B9OA 4LGXA 3NWRA 2HV5A 4A22A 5M5DA 2EG7A 5L1JA 1CYGA 5KZEA 3TYCA 2PDQA 3CQKA 1DWAM 1R7OA 4LAZA 1UOZA 5JQ9A 1IEXA 4F4RA 1LG2A 4ATDA 4YNGA 3B9NA 3I4KA 4WY0B 4UXDA 3GILA 3CQHA 1L6YA 4GG9A 2V8ZA 2TSYA 2P5NA 1SM9A 4AMCA 1ZGDA 2R1KA 1JAKA 4MLRA 1XD0A 1S3HA 4M81A 5AHFA 1HP4A 3VIKA 3VI2A 1WXZA 1DTUA 3KTXA 3B3DA 1BKSA 2VFIA 4WDXA 2A1YA 3M0KA 2J27A 4HN4A 4H9XA 3RK8A 1DOSA 1F6PA 4AHQA 4C90A 3OYXA 3W6MA 4FF7A 1MRQA 4DF2A 2Z1VA 3DBPA 3ES7A 3R6IA 1MEIA 4QE1A 2FH6A 4AB4A 3NUKA 2HISA