2BB0A

Structure of imidazolonepropionase from bacillus subtilis
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
413
structure length
413
Chain Sequence
b'KQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazolonepropionase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title A catalytic mechanism revealed by the crystal structures of the imidazolonepropionase from Bacillus subtilis
pubmed doi rcsb
total genus 158
structure length 413
sequence length 413
chains with identical sequence B
ec nomenclature ec 3.5.2.7: Imidazolonepropionase.
pdb deposition date 2005-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2bb0A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2bb0A02
3RHGA 3GU1A 2D2GA 1PB0A 3QY7A 4C6LA 4I6VA 3O0FA 2HPMA 1R9ZA 2DVXA 4QSFA 4LH8A 4RDYA 3IGHX 5FSEC 4C6MA 3N2CA 1EJWC 4C6EA 2WJDA 4XAFA 2GWNA 4CNSA 1EJRC 3RN6A 2Z27A 1FWEC 4XD4A 1R9XA 3SFWA 3A3XA 1EJTC 3OOQA 3UPMA 4CQCA 2E1WA 4G7EB 2Y1HA 4F0RA 4QROA 2Q09A 1ITQA 3URBA 4DLMA 4B91A 1NDZA 1A5LC 4DZIA 1YIXA 4I6KA 1PO9A 4V1XA 1FWCC 1O5RA 1DPMA 4CNUA 4GYFA 3MTWA 2ANUA 1A4LA 4ICMA 1ONWA 2ZC1A 1POJA 3LGGA 4QS6A 4GY0A 3F2DA 1V77A 3T8LA 4GK8A 4DI9A 3T1GA 5FSDC 3GIPA 3QY6A 3B0XA 3G77A 3B40A 4KESA 1O12A 2CZVA 3ISIX 3PAOA 2P9BA 2A3LA 3ICJA 3QGKC 3MVIA 2UBPC 4AQLA 2Z2BA 3AUOA 4ZSTA 2R1NA 2HBXA 2QS8A 2PGRA 4IGMA 3FEQA 4IFRA 1KRAC 1EJUC 1ADDA 1J79A 2I5GA 4J35A 4XAYA 1YMYA 3B0YA 3QY8A 4GXWA 2ADAA 1PTAA 3MPGA 3GG7A 3TNBA 3NURA 2AQOA 1RJRA 3PANA 4HK6A 1RJQA 1BF6A 4IH3A 1FWFC 3OODA 2R1PA 2OGJA 4EP8C 1V79A 3EWCA 5A6TC 4UB9A 2F6KA 2RAGA 2VHLA 4WVXA 4EPBC 5E5CA 4GBDA 1FWIC 4HK5A 3GU2A 4J2MA 1EJVC 4J5NA 5HMDA 2P50A 2HQAA 4PCNA 3R0DA 2YB4A 4XD3A 3RYSA 1K70A 2QPXA 4EPDC 1FKWA 4DI8A 4C5ZA 2PLMA 2FVMA 3NEHA 4G7EA 4KERA 1GKRA 4H9MA 2AMXA 4DIAA 2E25A 4L9XA 2YXOA 2OB3A 1KRBC 1W1IE 1FWAC 4C6KA 2I9UA 2Q01A 1FWJC 1IE7C 4H9ZA 4KEUA 4L6DA 4F0SA 4E3TA 2GZXA 3HTWA 2BB0A 1XGEA 2G3FA 4XD5A 1RK5A 1M65A 1FWDC 3WYZA 4M51A 1UMLA 3T81A 1FKXA 1FWBC 2EG7A 1EJXC 5CH9A 4BKNA 4GY1A 1V4YA 4LCQA 4WHBA 4PBFA 2Z2AA 3E0LA 4QTGA 3ITCA 4C5YA 1XWYA 3MJMA 1EJSC 1RA0A 4KEZA 1RJPA 4LAMA 4KQNA 2VM8A 3EGJA 4UBPC 4AC7C 1A5MC 4Z42C 2QT3A 1P6CA 4LAOA 1EYWA 2R1LA 4PE8A 1A5KC 1KRMA 4C6QA 2PGFA 4KF1A 3LY0A 4F0LA 4B3ZA 3F2BA 3LSCA 4MUPA 4LCSA 3GTHA 1VFLA 2OOFA 1V7AA 4LANA 1YRRA 4IQJA 4XAGA 3FDKA 3RCMA 4BY3A 4QS5A 4CEUC 3OJGA 2Z25A 2D2JA 4HA0A 2YZ5A 4KEVA 3URAA 4H9XA 1I0BA 3TN5A 3SO7A 2VR2A 4DYKA 4ERAA 4H9TA 3AU6A 2Z00A 1ZZMA 4JOMA 1J6PA 3OVGA 2VUNA 1UIOA 2O4QA 4V1YA 4C6OA 2OODA 3EWDA 3IACA 4PCPA 1M68A 4RZBA 1RK6A 1J5SA 3S2MA 3IRSA 3IARA 1ONXA 4KETA 4PBEA 4KIRA 4ZSUA 1WXYA 4IFOA 1J6OA 1RAKA 4C6DA 3K5XA 3E0FA 3IJ6A 2XIOA 1I0DA 4IG2B 4C6IA 1EF2A 3TN6A 4DO7A 1XRFA 2UZ9A 3DUGA 4H9VA 2Z4GA 3CS2A 3LS9A 1KRCC 3GTXA 2HBVA 3HM7A 3D6NA 3S4TA 1V51A 4R7WA 3IPWA 3UR5A 3S2LA 5AKQA 3TN3A 1P6BA 4LCRA 3LA4A 3PBMA 3UF9A 1NDYA 3GU9A 4H9UA 1K6WA 3S2JA 4B92A 1PSCA 4CQBA 4EPEC 2O4MA 3K2GA 3GTFA 3CJPA 1R9YA 4RDVA 4RE0A 1QXLA 1FWHC 3IV8A 4C6BA 4CQDA 2D2HA 3O7UA 4C60A 3MDWA 3C86A 3K4WA 1KCXA 3ID7A 1M7JA 4RDWA 2R1KA 4IF2A 2OQLA 4OFCA 3UR2A 2Z7GA 2DVTA 4B90A 3LSBA 3KM8A 1FWGC 4C6FA 2FTYA 3ORWA 1HZYA 2PUZA 3FDGA 2Z26A 4R85A 1A4MA 4EPKA 3MDUA 3F4DA 4QRNA 2AQVA 1NDVA 4H00A 1QW7A 3V7PA 3PNZA 3A3WA 2HNHA 3E2VA 1WXZA 3GUWA 4LALA 2DVUA 3LGDA 3DCPA 2VC5A 3E38A 4C6PA 1YNYA 4LEFA 1RA5A 4CEXC 3LU2A 2Z29A 1JGMA 3MSRA 5LXXA 4ERIA 4ERGA 3S2NA 1A5NC 1ITUA 4IFKB 4INFA 4C65A 5HMFA 1GKQA 4NI8A 4DLFA 4C6CA 4XAZA 4WGXA 2WJEA 2Z24A 4DNMA 4IG2A 4GX8A 4TQTA 2ICSA 4GX9A 4GY7A 2QVNA 1E9YB 2IMRA 2HPIA 1UBPC 3MVTA 2PAJA 3MKVA 3E74A 3URQA 1GKPA 3GIQA 2YB1A 3UBPC 3OU8A 4GOAA 2GOKA 1UIPA 4NP7A 3GTIA 4IFKA 4YIWA 3DC8A 3TN4A 3JZEA 4GZ7A 3AU2A 4LFYA 3GGMA 3WZ0E 4R88A 4C6JA 5HMEA 3F2CA 3F4CA 2GWGA 1YBQB 3HPAA 1S3TC 2Z28A 3LNPA 2P53A 4P5UA 1YBQA 4RDZA 2WJFA 4H01A 2BGNE 3OQEA 4H9YA 2FTWA 1K1DA 2R1MA 4XD6A 2FFIA 2KAUC 3WMLA 2W9MA 4DZHA 3PNUA 2EG6A 1A5OC 1P1MA 5G4HC 3GRIA 4D8LA 4CNTA 4HK7A 2FVKA 3URNA 2GSEA 2VC7A 3A4JA 1XRTA 4NG3A 4HJWA 4BJHA 1NDWA 2WM1A 4IGNA 4LAKA 3CAKA 3BE7A 2EG8A 3E3HA 1POKA 3NQBA 1EZ2A 3QGAC 1NFGA 1E9ZB 4G2DA 4GC3A 4C6NA
chains in the Genus database with same CATH superfamily
1TX0A 4FNQA 5G4EA 4J3TA 4E8DA 3ZXWA 1KNWA 4TUFA 3S83A 6XIAA 4JQ4A 3NL6A 4NZJA 1XF0A 3H2OA 3WL1A 3MV11 1NP2A 4M80A 4B2DA 1W2VA 1RXOB 3A4WA 1TJPA 3OBAA 2YBVA 4JYFA 1CENA 2QIWA 1CXKA 3H2FA 5EMKA 2CU0A 3HPXA 1SJAA 3LZ3A 1W2PA 1O5XA 2P5NA 4H4IA 4RX0A 1KTBA 3KXQA 1OFDA 4L9ZA 3VILA 3PPCA 4KRTA 3S5ZA 3W1PA 1CI1A 3IS4A 2VTFA 2EXOA 2HK1A 3MT1A 2W92A 4LS1A 3N2MA 3H2CA 1UWTA 3GIPA 5KFOA 1UKSA 3W7DA 3ISIX 2E5CA 1KXHA 3MVIA 4A8LA 3DH7A 3CV2A 9XIAA 2H9AA 5F2GA 4XZLX 4N6EA 4DXVA 3B8WA 4JR5A 2O56A 1XG3A 1W9VA 3RB0A 1H7RA 3ZS4A 2ADAA 3GG7A 4G3IA 4HK6A 3O6AA 4IH3A 3V1PA 1O1HA 4UUIA 3WUBA 1CW2A 1TQXA 2XC9A 3S46A 5A6TC 3IJ9A 1C9WA 3W82A 4NASA 1UKPA 3GU2A 1B54A 4NZFA 3WF1A 1LM1A 3LMYA 4Q8PA 3S1UA 3R0DA 2YB4A 4R8UA 3RX4A 3ZFHA 4A8IA 1KB3A 1JFXA 2BVWA 4ZOCA 5F4WA 5I06A 1GVYA 2PLMA 3WLJA 3GVVA 4UMCA 5A2CA 3AYTA 1E9IA 4G7EA 3EKLA 3HV8A 4F3HA 1JZ4A 3M7SA 3TYBA 3A3HA 5TAOA 1Q6CA 2ZYFA 1IR1A 1AQ0A 3WLNA 4XD5A 5LXEA 3WQ5A 4ONVA 3M5VA 3PWAA 2OTDA 2CLFA 4KH2A 2DIJA 3UWWA 3WUGA 4DZ5A 3RBDA 3OYZA 1B3VA 3Q4DA 1VYRA 1V3LA 1XIHA 4E6MA 2ACUA 2FQIA 3VE7A 1O5QA 3D5HA 1XW8A 4KEZA 4KQNA 1IIGA 6ALDA 4UBPC 1SZNA 3A64A 4CU6A 3N14A 4HYVA 2QAFA 2X40A 5LA2A 2VYOA 3UXKA 2OLSA 1KV5A 4KF1A 3LY0A 2YDQA 4D8ZA 2C14A 3GXMA 3F2BA 2DV0A 2JFEX 1V0KA 3GS6A 2G41A 3W38A 1TVLA 2OOFA 3VZYA 3P67A 5DY3A 3M5ZA 2GGHA 4EYHB 3B9EA 3W29A 2G3JA 1FWTA 4QS5A 2W0UA 1H11A 3T7VA 5CJ5A 1SGJA 4KCUA 1F9CA 1PEZA 3AS0A 4F9JA 1WPCA 1ICSA 2X2YA 2G4JA 3ALGA 3OG2A 2REQA 3ZSSA 4UTTC 4MKNA 3QQWA 4V28A 3QKZA 3W88A 1E3ZA 3I7SA 4GZJA 1UP3A 1WOAA 1J9YA 1KO0A 3TFXA 4ECZA 3VYLA 4C6IA 2UZ9A 3SUUA 1KM2A 1NQKA 3WDHA 3SCRA 2QZRA 4JV1A 2VJXA 4GWEA 1F4HA 2PMQA 3HU7A 4DBEA 2BLEA 1D9EA 1E6NA 5AKQA 3FGCB 4NZ1A 5DELA 3ZT6A 1BQGA 2HXUA 1XM3A 1W31A 1V02E 4F4ZA 1J2BA 3TSBA 1K6WA 2D22A 3OBKA 4CQBA 4EPEC 2CLIA 2DSUA 3K2GA 3MSGA 2PTXA 2ZRVA 3FNDA 1H5VA 1S5NA 4PL2A 3LCLA 5HANA 3ARVA 3CYJA 4D1JA 1V6UA 3P60A 4ED3A 5DLFA 1Q8AA 3GC4A 1HJUA 4DPQA 5HBFA 3BAXA 6A3HA 2OQLA 1WZKA 1R86A 3W1AA 5DQIA 1JAEA 3KVLA 4HU3A 4HZ6A 4HJFA 1H7PA 4F8XA 2CBIA 4Y6GA 2WZEA 1HO1A 4A22A 2YCIX 2V63A 1XISA 3NM1A 2VGFA 4JIEA 4K8GA 2GJLA 2ALRA 1MDLA 2ZUVA 4QCFA 3LX9A 5EU9A 3PTDA 2J6TA 3ATYA 2P88A 1OG6A 1EDGA 1Q6GA 1AQMA 4XZNX 4LX4A 3W2KA 3ECQA 3KHHA 2W61A 1O94A 3DZ1A 3M0VA 3MHGA 1EJ7L 3FDSA 3W9ZA 2V6AA 5ABGA 1JGMA 5GQBA 4P7LA 5LXXA 5KG1A 3WBXA 3C3NA 4LAUA 3H40A 4DBSA 4NI3A 4D6HA 3DKJA 5HMFA 4GXPA 1GKQA 4NI8A 4EVZA 1TV3A 3IGUA 2W9CA 2H90A 5EL1A 3K13A 2FPYA 3JS3A 2FPVA 5DN1A 3VZZA 1RALA 3UY7A 1HX0A 1JRBA 4FK9A 2WZHA 3GTIA 4IFKA 4MKVA 1SZGA 1ISZA 4XZBA 1A47A 4XO6A 1DVJA 5ABHA 4R88A 4RPPA 3TMQA 1GQLA 4MIMA 3UERA 4BWLC 3VNKA 1PVNA 3PW2A 4S3DA 4AZCB 3GR8A 2XU2A 4QR6A 3NCOA 5EY5A 5JBEA 4O16A 1ZU8A 1HJWA 4DL6A 4UTUA 1L6YA 1XGZA 4WR3A 4O54A 7TAAA 1JYNA 1S10A 3LLDA 4FBUA 3W22A 1KTNA 4HJWA 1NARA 4IJRA 3H23A 4Q3MA 4U28A 3BE7A 3BPWA 4D2JA 1JI1A 1JCNA 4LY8A 5C9XA 1C8XA 1UKOA 3NSXA 2AOSA 3QC3A 1NAL1 4XV0A 1UA3A 4TR9A 2V8ZA 3B04A 2GJPA 2B81A 1VHCA 3W1RA 4PMQA 3O0FA 5FSEC 3OLIA 1MNZA 4DXKA 3LZ5A 5C5JA 1EEXA 4HNUA 1CDGA 1EJTC 3WD1A 2F38A 3CTTA 4GIEA 1Q4NX 3NTYA 3EPIA 3WLIA 4CQAA 2JIWA 4RNNA 3FVMA 1FBAA 4B9ZA 3PVFA 3L9CA 4GNJA 1XL9A 1ITQA 3AO0A 4L4PA 3FS2A 4DLMA 4MZYA 1GYLA 3QFEA 1UR9A 2OWXA 2QR6A 1N2VA 2DT1A 5DCDA 1AFSA 2WZIA 2IQTA 1RUSA 5E0CA 3PUEA 1VRDA 2AQWA 2CKRA 5FEWA 3WK2A 5T26A 4O3QA 2GGEA 4QS6A 2WVVB 3C4UA 4K7YA 1L0PA 3GG1A 2E6FA 3H21A 4KESA 2OZ3A 2PDLA 4I7VA 4KPLA 2PDPA 1BWLA 4CU7A 2A6LA 5ECVA 3E0IA 2WANA 4E38A 3G8EA 4QE5A 1KFBA 5CG7A 1OFPA 5AC8A 2QJNA 4WEVX 3OBEA 1RJRA 3PANA 4K39A 4Z2GA 1JVNA 1B9BA 1KWKA 5TF0A 4DYJA 4JTKA 1V79A 1LTDA 3POHA 3AMCA 2R94A 3TYAA 4UXDA 4GBDA 2PP0A 2BVYA 4JTLA 3L4YA 4DUOA 1W5MA 5KFFA 1H41A 2A3AA 4XTIA 4B5VA 5CSYA 2AU0A 1OABA 2HQAA 3C61A 4K8HA 4DZAA 4NZ5A 3GNXA 4DI8A 1L8PA 3LGEA 1HP5A 4ZXLA 4YS1A 2ZUWA 3KHLA 1NM9A 4JFVA 4PUDA 1Z44A 2Q71A 1U30A 5LNRA 3PUDA 1CEOA 1VPYA 1BTCA 3VIMA 3EXSA 1UR2A 1AQFA 1DIDA 1UZ4A 4YTSA 1FWAC 2V69A 1FWJC 3W70A 4JKMA 2W6RA 1Y8BA 4AD3A 1RK5A 1BYCA 2NUYA 1I6NA 4F2BA 2Z1BA 4DJED 4F2UA 3LERA 1QHOA 3FHQA 4ECXA 4LCQA 4WIWA 3GTNA 3ZO9A 3WBWA 4PUJA 4JNMA 2AGOA 1X1OA 3SIMA 3WD2A 4QNWA 3MCMA 2HDJA 3BJFA 3E9AA 1GCYA 1R47A 1EZWA 2GJNA 3WQWA 4TQSA 4HHMA 4M6PA 4GCAA 1Z9AA 3USZA 5A94A 4QP0A 1QK2A 3TQVA 2PDFA 2ZBTA 2J8FA 1V7AA 2QGHA 4JTJA 5H2ZA 4Q8NA 4HA0A 1GOIA 4P8WA 1TE6A 3CAQA 3C52A 1XICA 4KWWA 1DJNA 1DJIA 1P7TA 3BUVA 2DZXA 2Z00A 4GYPA 3EB2A 4Z2LA 1Q2SA 2GVGA 3VDHA 2OODA 5D2TA 3UWQA 1YXCA 1QT1A 3BDKA 3PZNA 3IARA 3BZGA 2CYGA 3AXHA 3KVJA 3ZSTA 4JDYA 4LBSA 2ZC8A 1DEDA 1RAKA 4JTSA 3M6DA 4MJMA 3K5XA 5LZLA 1ZAJA 3T5HA 3EDJA 2Z4GA 3KZPA 1MVYA 4MTVA 1XIMA 4AMCA 5L9XA 5E6ZA 1IYXA 1PYFA 2OO6A 4NJHA 2X1SA 3OQ8A 2VNCA 1T96A 3S2LA 4GFSA 1OEPA 3WMBA 3PBWA 4OWGA 5AOUA 3EEGA 2XCPA 3MQTA 4AHOA 4JUZA 1Q4WA 5LGZA 3CHDA 3B9NA 3GTFA 4O0ZA 3FEMA 2CPUA 2BOFX 3P61A 1CT5A 1ZCOA 2RDIA 1FWHC 3W7QA 3NXFA 2QUVA 2V4RA 4O1AA 4HT3A 1F8IA 3GH5A 3KRBA 4IP4A 4HKPA 4C1KA 3T05A 4TQRA 3N3MA 4JV2A 3WJSA 1XS2A 1OCNA 3HO8A 3PFMA 5CPLA 3H4BA 1TJRA 1XLAA 2X05A 2XIJA 5LIKX 5BROA 1WP6A 1V7YA 4HD5A 4WDTA 1SZRA 3LHUA 2FZ8A 5XINA 4M81A 1B3WA 3H6OA 3YPIA 2FPTA 3KBSA 2SFPA 3VIOA 3STCA 5HJYA 4X60A 4GVGA 2RKXA 5CBBA 2INEA 6PTDA 1TJ2A 3SSZA 3BLIA 2PRHA 3CL7A 1SUXA 1YNYA 4LUSA 3L2LA 3QZ7A 2V5DA 4LT9A 5DANA 2OSWA 3W87A 1IGSA 3FW6A 3SGGA 2QCFA 1ZNNA 2JF7A 3GDLA 1DXEA 1E51A 4INFA 3M9OB 4CU8A 1OK6A 3O05A 1CB7B 1GJUA 2XZ7A 3GXNA 1ZL1A 4AIUA 5HAOA 1EBHA 3GD6A 2E28A 1V3IA 1RPKA 1J96A 1YQ2A 3GVRA 1R3TA 2C6QA 2CLKA 3U2OA 4YIWA 4GMEA 1SMAA 2WPBA 3WQ4A 1VJSA 3AIEA 1B3OA 1RH9A 2XIBA 1S3TC 2BV9A 3LG3A 2V3FA 4ECQA 1G9HA 3HFTA 4L6OA 3NNTA 3OQEA 2CXGA 3ENLA 3IAQA 3BLDA 4JNZA 1KBKA 2VCAA 1M7PA 1QOPA 2Z0IA 1KQZA 3UT0A 4OQVA 3VNYA 4A4AA 1O1ZA 3PFRA 4M6UA 1Y0EA 1PHWA 4Q4RA 2ACSA 4GUJA 1F2JA 4N02A 4QG6A 1ML1A 4P7NA 4C6NA 4I90A 1QI5A 2OCZA 3EWZA 3RRAA 1WUEA 4IXXA 2HS8A 4AZIA 3PW7A 3MS8A 4Y7EA 4QNEA 1QASA 1C8YA 3IIXA 2BOEX 2QCGA 4JHZA 1XC6A 5DMNA 1AH0A 3RB6A 2FHCA 1EXBA 5I02A 1XIJA 1UD3A 3NL2A 5DGAA 3R58A 4WXZA 2GGIA 3T5KA 1AH3A 2E77A 4CQCA 2ZX5A 2W8KA 3D3AA 4IMDA 1EP1A 2BVTA 3P82A 3NVDA 4WDXA 3I6EA 6ENLA 2B0MA 1REQA 4OGZA 4FNUA 3MTWA 4ZB2A 3P7YA 4JIPA 4GI8A 1POJA 1TPWA 2CLLA 4JICA 2WCGA 2D20A 4GK8A 1SMDA 1BSLA 1O66A 3W83A 4ED8A 1JEZA 3RCNA 3CAWA 3CGTA 3WY1A 1X7FA 4Q7BA 2WO5A 3AUOA 2W91A 4ZSTA 4J3VA 1S38A 2F6UA 2W67A 3TA6A 3W1MA 2YDSA 3DGRA 2VCBA 2ZA3A 1RYSA 2WK2A 2WW5A 1W5QA 4QX4A 1YTEA 3FA5A 4XB3A 5AC7A 3P74A 2H3BA 3UW6A 2AQOA 3H55A 1Z89A 4FO4A 1R46A 1FWFC 3RJYA 2CHRA 2QDEA 3DFSA 3WQVA 4GCXA 5D04C 4XISA 2ABAA 4ZB0A 3V18A 5K4XA 1WKEA 1TQJA 4H2HA 3N1AA 4W8BA 5BCAA 3WQPA 4LBRA 2E25A 4L9XA 4K68A 1CPUA 4KMQA 1CIUA 4A3HA 1IM4A 4TX8A 4C6KA 2CLEA 4Z1BA 3ELFA 2YXXA 3GSMA 1FWDC 3WYZA 1F3TA 5JH2A 2I17A 3TAKA 5AYYA 1CNVA 5HPOA 3B06A 4FR1A 4BKNA 1D8WA 4NAEA 4G1KA 1AZ2A 4H8NA 4WX2A 5AHLA 1RA0A 3BAYA 4NJGA 5C54A 1M5WA 3EMZA 3EGJA 4BA0A 4ENLA 4CD6A 1BFNA 3WX7A 1H7NA 2NQHA 3HJEA 4H19A 4B5SA 3XISA 4NZ3A 3IGSA 2CLPA 4JZ5A 4F0LA 2AGPA 2GDQA 3TTEA 4HQVA 3G0UA 1XIGA 2ABBA 4O4VA 4H7ZA 5EMYA 3T6CA 5IBXA 2NT0A 4MZ8A 2PF0A 4H9XA 1BGGA 1C90A 4DJDA 1I0BA 4L4MA 3Q2DA 4ERAA 1S1RA 2ZDSA 3OA5A 4KKXA 3N2XA 1UUMA 3PULA 4MJ2A 2Z1XA 3KL0A 4NXSA 3LQGA 4RZBA 1HUVA 4R53A 3GLCA 5D2XA 1F6YA 4H04A 2XFRA 4PR4A 5KZDA 1P43A 2D0HA 1XLCA 2YL8A 1PKLA 4QAWA 5LGXA 5ABFB 1LG1A 4WY0F 2YYUA 2HWGA 5I3HA 1KRCC 4P7QA 3A5VA 1DE6A 1Q63A 3CPUA 1OB0A 3VKBA 3D6NA 4R7WA 4PCTA 5JIPA 2VA3A 3N2OA 2WHKA 3LA4A 3MJYA 1TUXA 5H8UA 3UF9A 3H2NA 5D9OA 5A8OA 4M24A 2O4MA 4JTCA 3AMLA 7XIMA 1R9YA 3BW2A 1K4HA 1NFPA 1VP5A 3IV8A 8XIMA 1IEIA 1GZ1A 1EBGA 4R3UA 4CUCA 1CBGA 5DCEA 4KT2A 1CGUA 3QOKA 3GIYA 3B8IA 4RDWA 4W7WA 1XUZA 2VGBA 1OYAA 1NF7A 3U7BA 4ZGYA 2C1IA 1LT8A 4LB3A 4DX3A 3TWAA 3F5JA 1UWAA 3SB0A 2G50A 3L4XA 1FCBA 2QDHA 3O6CA 2A6NA 1NDVA 4GISA 1VEOA 3H7VA 4XBSA 5MHBA 4K38A 1HKWA 4O1EA 3LUTA 1S2AA 2EJ1A 3ARRA 1I1XA 1OT1A 1R2RA 1GPFA 3SURA 1ADOA 5BXSA 4JIQA 1OIMA 5EKYA 3WQDA 1B9ZA 3NYDA 1A0EA 4E5TA 4D9PA 4HZ8A 4MNJA 1ITUA 1HT6A 3TTSA 3GIKA 4H1ZA 2DZPA 4CQ8A 1V5XA 3I68A 2Z24A 4ZR8A 2GUYA 1JG9A 4J3ZA 1KXVA 4RZ5A 2BDQA 4X61A 3PTMA 1QI3A 1W1YA 3DC8A 2D3NA 1BKHA 3RFAA 4PH6A 3GNPA 3VKDA 3DAQA 3MYOA 4NX5A 4A3RA 3KVKA 1HJQA 3VO0A 3QQ0A 1XSIA 4HIBA 3W24A 2Z7KA 1I4NA 4LW7A 4RKAA 2VDGA 3AIUA 4X2RA 1RD6A 2KAUC 2W9MA 2TMDA 4RCXA 1QU4A 1TWIA 3QSRA 3UP8A 4W4QA 1W3NA 1EP3A 3CZEA 3NVTA 2G8ZA 5BW6A 3BAKA 4NG3A 3BQ2A 4MB1A 4HMEA 1KFEA 1POKA 3NQBA 3NR0A 4F66A 5DBTA 4PCSA 3PBVA 1E9ZB 4QJ1A 1BGAA 1TPB1 3KRSA 2E67A 4F4YA 4ZQMA 4IRDA 2HE5A 2D2GA 1UOKA 4NZ4A 1JPKA 3GQCA 5DX7A 3CNYA 4EAYA 3OPSA 2YPIA 4LOCA 3NQCA 4WKAA 2PDQA 1ME8A 1ME9A 5D37A 1V02A 1W8GA 3W7EA 4W88A 4XD4A 1YX1A 2B7PA 2OYLA 2RH9A 4DJFC 2WVSA 3TQ1A 1RBAA 3TCSA 1K1QA 3R94A 4ZQRA 2ESCA 1D7FA 2D3LA 4CNPA 5G2WA 1KCLA 3ZJKA 3W71A 5I3FA 4DQWA 1KBJA 3KX6A 4AXNA 3GKAA 4B15A 2TYSA 4U4MA 4AUBA 1PO9A 4LVBA 1QUMA 1KV8A 4DWDA 1IXPA 3NQVA 1EP2A 4B5TA 3PWGA 5AHEA 1XLBA 4CNNA 4AU0A 3TUUA 4JQ2A 5REQA 5JUMA 3S1XA 2VVNA 1T6MA 3BLKA 3PJWA 2WCAA 4JHOA 1PV8A 1TREA 2FKPA 1X1NA 3P14A 3MA8A 2W66A 1SO4A 4J4KA 1GEQA 3FEQA 1O7AA 3RLVA 1QR7A 3VGEA 4IIGA 2WKJA 3M9YA 3OGRA 3TJLA 3B0YA 1B3YA 1PCKA 3HQOA 3WKZA 3CAVA 3GX9A 5EPDA 2V3GA 1RJQA 1FQ0A 3RB4A 5CPQA 3EPOA 3GDTA 3UQNA 2GVEA 3SI9A 4K1GA 4Q8TA 1R87A 3OEXA 4F0MA 3PR4A 4L4LA 2WMIB 3VKAA 3CQKA 4D6DA 2C7FA 1DQWA 2J62A 3ARQA 3BCJA 3EX4A 4ICCX 4EPDC 2XJ7A 3RILA 4MPQA 5JMUA 2CCRA 1VS1A 4GIRA 1GJWA 1TA3B 3WN6A 3HPZA 4GG9A 4DL5A 2Z2UA 3E5BA 5CGTA 5DXXA 3TJXA 3B8SA 4A8NA 2CWNA 2J77A 3UYCA 1J0KA 2G3FA 1XGEA 3W2MA 3Q8PB 4PRTA 3ITVA 2BP1A 5E6YA 2JIEA 5LNUA 5CH9A 4UTLA 1UH2A 4MNKA 3GXTA 4QTGA 5AC4A 5CKSA 5AYXA 3C0JA 3PUGA 3NPVA 1UW9A 3SZ8A 2WNZA 2VI0A 3P6LA 1JX4A 4BQ4A 3SFKA 5M03A 3GIMA 5A3HA 3Q67A 1IWPA 4UZSA 1TKKA 3G18A 4DBUA 4XAGA 1PAMA 2DZBA 2GK1B 2CBUA 4ZODA 4R5EA 2J78A 2OKTA 1WO2A 2YJQA 2FZDA 1SM9A 3DYMA 4UQAA 2VC6A 5K9DA 3L23A 5IXEA 2XH0A 2AL2A 1UD2A 5KETA 5CLTA 1TWSA 5EBAA 3W7RA 3RBEA 2AKZA 4V1YA 4H6QA 4D6IA 1DWFM 1CYGA 1P0KA 3ARPA 1H1NA 1S46A 3CWOX 4MF4A 2YSWA 1ZTVA 1M53A 2QMKA 2G3IA 4JY8A 3TC7A 3PZPA 1LROA 5C9UA 2WTFA 3S6DA 3DUGA 1NOFA 4JX4A 3EPNA 1OFRA 1VFMA 3LS9A 4I9AA 2A1YA 4U31A 2HMCA 2Z6IA 4I7UA 4PMOA 4A29A 3A13A 4M1BA 4EBDA 4IICA 3UR5A 3ARXA 3UR8A 3UWZA 3K30A 2VFIA 1EGMA 1XIBA 1J0HA 2X7WA 1PSCA 4O3PA 2WKGA 3F5LA 3E5PA 5E70A 4MPKA 5KFNA 2AL1A 3U2CA 1WKYA 3VOCA 3THDA 2FIQA 3GKFA 2UVWA 4IMEA 4TO8A 1NTHA 5KTLA 1HGWA 2FZMA 3L66A 1V3HA 5C8BB 3VKCA 1H1ZA 3UR2A 4MG4A 4JV0A 1GJPA 2KX9A 3NEVA 2J9YA 4MWAC 5KFMA 2QJGA 4E0CA 5C70A 2ZZ3A 2PUZA 3QV6A 2D2OA 3BLOA 4GC4A 3OZPA 2ZZ1A 3GQYA 1XDLA 1RD5A 5D4YA 2FLNA 1FTXA 5LIXX 1VQTA 1E15A 4ZQCA 3KWXA 1QPNA 4YCOA 1R5YA 2YCLB 2YL9A 4OTKA 3VKJA 2NX3A 1X6LA 5LA0A 2R9RA 4NUWA 2Z29A 2CBVA 2EEXA 1TRDA 5HR7A 2IMWP 4ECVA 5BRBA 3QFWA 3THCA 1FHLA 2PWHA 1IXNA 1GYNA 1RVKA 3AI0A 4NJIA 1U2YA 3H8AA 2NUWA 3H24A 1JQXA 1UBPC 2EBNA 4FXJA 5HDRA 3DIPA 4P8UA 3KHGA 4BF5A 4QISA 5KFKA 1SO6A 5CPSA 2QJHA 4WSKA 3I4EA 2BY3A 3QPEA 1VYSX 1WDRA 3F1QA 3H2EA 3M0HA 2NLYA 2XFYA 1E0WA 1WX0A 4YTQA 1Q6DA 1TO3A 1WZMA 4GQGA 1NU5A 1UH3A 3LB0A 3QW3A 4YHEA 2OWCA 4MFDA 4P5UA 1V6WA 1HL8A 1IEQA 3SW6A 2WJFA 4W86A 4JY9A 2BGNE 3AIVA 1SFLA 2Y85A 2PI6A 5HQEA 2OKOA 3CL6A 2VL4A 3II1A 5D09A 5H91A 3W07A 3AXXA 4HNLA 4D8LA 3RCYA 2DT0A 3URNA 3UETA 4L56A 2W9BA 2CNCA 4P7RA 4PMDA 4A8RA 5FAGA 1SZEA 4CCEA 4ZENA 1W17A 3AHTA 1SW7A 3LDVA 1ZB5A 2C22A 1Q7ZA 1HL9A 4QWCA 5HWJA 3CQIA 4AZ5A 3DENA 3O2LA 2ZXAA 3RHGA 3GU1A 1ODZA 1S0NA 5FJPA 1U5HA 2Z1WA 4GKTA 2HPMA 4B16A 4N2YA 1VLWA 3NFUA 3PB0A 5CG0A 5GNYA 5CC3A 3KS5A 4UTKA 1Q5MA 3V6HA 1KC7A 3PZVA 3G0SA 1SR0A 4XKMA 3OOQA 4LU0A 4YMZA 1I2QA 4AEEA 4LWWA 5I6SA 3F7JA 1G69A 1NDZA 5AHNA 1A5LC 4GVHA 4JTDA 5A8MA 3T0TA 2C2RA 1OYBA 1B90A 3GVGA 4V1XA 1QPQA 3MWCA 2POZA 3BH4A 4TV6A 4ICMA 2UY4A 4PTDA 4DI9A 3T8LA 3BSHA 3L21A 2BGSA 3STFA 2YBUA 4WK9A 2CZVA 3IUDA 3ICJA 3VA8A 2BQ3A 3L5LA 1PBGA 4LVDA 2OOGA 1K3UA 1T99A 4IMFA 4IFRA 1M1BA 4JTGA 1AG1O 4ORIA 5FJJA 4AD0A 2C3ZA 1GG0A 5A6AA 3PTQA 4F4WA 3GK0A 3MYPA 4F79A 2YA0A 3TNBA 2DUXA 3LHYA 4TVUA 3WLPA 1LRTA 2R1PA 2IQDA 2GQ9A 1GW1A 1TVNA 1KFCA 3SDOA 1RPXA 5GJMA 2HNEA 4CLMA 1XI3A 3TCEA 2A3HA 4GUIA 4MY8A 4QE4A 2BXZA 3CUIA 4O13A 4ADUA 1CGVA 3GHSA 5DG9A 4GQBA 3L68A 1R3RA 1GVEA 2ZRWA 3EA2A 1H63A 4PZVA 1KRBC 1UD4A 4HNCA 1W1IE 3BLEA 2FH6A 4O0KA 4N4PA 2W5FA 3LRKA 5F7UA 1IXQA 3PBUA 3VUPA 4O12A 3C8FA 5PTDA 1U33A 4DWSB 3IIZA 5I3IA 2PLCA 1FKXA 3NQFA 3IIOA 3C2RA 1EJXC 1L6SA 3NDYA 4OOZA 4GIYA 4V15A 4EXAA 3N6HA 5FL1A 1ZBKA 3UVAA 3FAWA 1AD4A 4W87A 1U1JA 2RGMA 2WXDM 3B0UX 3ZJ6A 1KRMA 5D2VA 4C6QA 2PDKA 1EO7A 1BSIA 2ISDA 2QNEA 3N18A 3KEHA 1JQVA 5AY7A 2PC4A 4PMVA 2EKCA 5DGBA 4AWEA 4LANA 5L6UA 5KFXA 2FB3A 5J8LA 4FI4A 4GACA 4BY3A 3RCMA 1WBJA 1EUAA 3E12A 1S5WA 4HPHA 3THUA 2HCVA 3SO7A 3OGVA 2BQUA 2ISSA 3QEZA 4DYKA 3SN0A 3AU6A 4ZE4A 1X39A 3LI1A 1UIOA 2ZRXA 3EWDA 5I77A 4G6CA 3DFHA 4EF9A 4Q8VA 4KIRA 2VEIA 3UG8A 2QYGA 4S39A 4C1LA 4MNMA 1R3QA 2XIOA 3UNDA 4DO7A 4A05A 3T0BA 3MO7A 3Q65A 4FNPA 4IX0A 2ZWYA 4TV5A 2J8TA 3SEPA 1E6QM 3TIMA 4RJEA 3I3EA 1PTGA 3SCUA 1EIXA 3RLUA 4LY4A 4J7RA 2P3EA 4LF1A 2OFJA 3W76A 2J7EA 3WFLA 3MI2A 3PBMA 1NDYA 3ANYA 4DJDD 3GM8A 5CEWA 1RCXB 5DLGA 1Q6FA 1BG4A 4I9TA 1JZ5A 3CO4A 3LPFA 3H4XA 5I23A 5EBUA 4B2DD 1MXGA 3IJ8A 3UZWA 4C60A 1IWBA 1LJYA 3R8GA 8XIAA 4IF2A 3U2ZA 4L6HA 1RQHA 3KRZA 3TQPA 4ZO9A 4I7WA 4LBUA 4JQAA 4ICNA 5HULA 3KOYA 2DH3A 4IIFA 4TX9A 2QJJA 4O28A 1VIWA 3CPRA 1MQPA 1AUSL 1KGXA 4AD1A 4ATLA 2DEPA 4AZCA 2D0GA 1BRLA 2VC5A 4US5A 2BS9A 5GVJA 4C6PA 1U5JA 4O57A 5HA7A 4JN6A 3ABXA 4IZGA 1ONEA 3CMFA 1W32A 5KEZA 2PU0A 3VIHA 1F74A 1CCWB 2ZTKA 1W1PA 2JF6A 3EPMA 4N6FA 4WSHA 3LM7A 3U9IA 2D73A 1EGVA 3URQA 3BG9A 3GBDA 3WF0A 1EHAA 1B30A 1VCGA 5FJIA 1Q7QA 3CUXA 2XSAA 3FIGA 1TMQA 4NRRA 3CUGA 5BXPA 2C2EA 4YXGA 4IMAA 5KG2A 3JRKA 3B3DA 1F05A 4JCLA 3M5YA 4MJZA 1OBAA 5ABFA 3R8HA 2PGWA 1BPLB 3RAOA 1K7XA 3NM3A 1UOZA 2DSWA 4LV9A 1C7SA 4Z2KA 3WBYA 5BOOA 3T2OA 2NV9A 3PSVA 2RHGA 3NYZA 1JRCA 3FYOA 1XRTA 1WDWA 2PSNA 3KAOA 1LLOA 1Z42A 5FF3A 1UA7A 1GOKA 3AQUA 4BS0A 9CGTA 4GI9A 2YXGA 3CYVA 6CGTA 2ZRYA 4I5UA 3LYEA 4EBCA 5CCZA 1DOSA 3BV4A 3T2QA 3G1XA 3G3MA 2UY2A 1WDQA 4FB7A 3PW5A 1D3CA 2O92A 1QWGA 3VE9A 2ATSA 4IMCA 4LC8A 5C2XA 2UVUA 4IR1A 4LRTA 2WPGA 2BXYA 4C90A 3MZ2A 5J04A 4BQ3A 3EOEA 4HTYA 3EDKA 4OZOA 2PZ0A 2Q09A 4X0NA 3VD7A 1E6SM 1KCKA 2X1RA 3LRMA 3SCPA 2VEMA 2BHUA 3EWXA 2NQ9A 3DG7A 3S8HA 3AXKA 3NIYA 4G8TA 4W7UA 2A79A 1FUYA 4YQWA 3NUKA 2XIIA 2XVPA 2FVLA 3IVTA 4UTIA 3UG3A 3GHRA 3GYCA 3BLPX 3F2DA 4V33A 2YA1A 1JUBA 3LPGA 3OZMA 3B4YA 4V2XA 1VR6A 1XDMA 3QYQA 5KFHA 3M7WA 4JEJA 3TFCA 3TQKA 2EQDA 4XBJA 5TQLA 3SM0A 5C9ZA 3DFPA 3H4DA 5K9CA 2XISA 3EMCA 5CZTA 3ABZA 2IPGA 1OHLA 4W85A 2GJXA 2WJZA 4ZQNA 2JEJA 2FDSA 2XN1A 1DKWA 1PTAA 4GYKA 5MKGA 4C1NA 1YDVA 4A2RA 3S1WA 5KSWA 1ITXA 5K7JA 3EA3A 4EP8C 1JZ6A 4M0XA 5FESA 2RAGA 3FYPA 4HU8A 1QTWA 2BY2A 1S2VA 3GVQA 5CPNA 1DJXA 2GUBA 3N29A 4NYUA 4YR0A 4X9YA 5CZKA 5DG8A 1B5TA 2PS2A 2GLKA 4Z1DA 4F50A 3HG4A 3KDOA 1W1A1 3HGOA 4Y8EA 1YXDA 2MANA 1LLWA 4Q8WA 3O1NA 4FLOA 3HN3A 1GW9A 5I03A 1R3YA 4H6KA 1WCGA 2PWEA 4QSHA 2R8WA 2YXOA 1XGDA 1SFJA 3FK4A 2INZA 1L2QA 3ARYA 4ZE5A 2IXUA 4XSMA 3GR4A 3HTWA 5HQLA 3UGRA 3CB3A 2VFDA 3OSPA 4H41A 3UG5A 4DBWA 4URIA 2E0PA 3DC0A 3M43A 4GUGA 3O07A 2D1ZA 5JBFA 3SSJA 3GO2A 2W9CB 3U4FA 3VNIA 1W3JA 1VFTA 3CB8A 2TODA 1OFBA 1W91A 1KBBA 5B80A 3BCDA 3SRDA 2A3BA 4W93A 1T41A 3S9ZA 4O18A 4I5RA 4DL4A 4ML9A 2WHLA 5LA1A 2YFNA 2ZWZA 1K02A 4CEUC 5A6MA 3BMWA 1GOWA 2PD9A 2YZ5A 4KCTA 3GZAA 4OUEA 3I7QA 3CK5A 2QCEA 3MCNA 2F2HA 1OADA 4I8DA 2OZ0A 2C2DA 2VWTA 2ZRUA 1GTHA 2WM0A 3B8TA 1DWAM 1WUFA 1VPQA 4U33A 1TPEA 1J5SA 2V67A 1ONXA 4PBEA 3KBVA 3ES7A 5HJXA 3SJNA 1WZAA 1D7KA 2NSOA 3LM3A 5A6BA 1UBSA 2A85A 1W37A 3WO8A 1T8QA 3E2RA 3AIBA 3V5CA 1NH6A 4GVFA 4J2PA 2XSBA 1WOBA 1RQEA 2PTDA 3RK8A 3TW6A 1ZBVA 2QUUA 5EMLA 1H62A 4UCFA 2HBVA 3SUVA 3VNJA 4NAFB 1CGWA 5A6SA 1QDSA 1R2SA 2DIEA 4LCRA 2J9XA 3QYSA 4Q6XA 4ED6A 1PX8A 5BOEA 4QE1A 4B92A 1UHVA 4A2SA 3BSMA 2CETA 4MY1A 3KDNA 1S5VA 1MFUA 1HTIA 2X42A 2WSQA 1PCWA 4WSJA 3KHRA 1UWQA 3FXGA 2QJMA 2PDJA 3VK5A 4QWEA 3MR6A 3CUJA 3W2NA 2ZX9A 2DVTA 4DEFA 3KM8A 3SCVA 1K8XA 3AIQA 1JDCA 3D47A 3O06A 1PX4A 3KTCA 3QMRA 4WLCA 3G1HA 1UC4A 3S6OA 4MB5A 3AISA 1EA0A 2R6OA 5CC6A 3SAZA 4FS9A 4QRNA 2OT1A 1JDFA 3Q58A 1KLZA 4H00A 4PFMA 2D0FA 3V7PA 2Q02A 1B3XA 3MO4A 5AFDA 2AGTA 3A9IA 4XVEA 1XLFA 3TMLA 1G4SA 3BJSA 3H22A 1A0CA 3W6LA 3WK1A 1YTKA 2E68A 3WLRA 4ERIA 4XAPA 3AS2A 3WBEA 4WKHA 4CNOA 2VX7A 5EWEA 1NF0A 2PDCA 3QHMA 4C6CA 4IG2A 5BYWA 1J0YA 3E0WA 3NQAA 1XLMA 2WVTA 1RZMA 2HPIA 5G5IA 4AHPA 3HG3A 3WK3A 2J27A 3RAXA 5C71A 5IHRA 2PLKA 1XYFA 4DHGA 1TPFA 5HNTA 4FLRA 1A3WA 2X1TA 1EOKA 1HKJA 1YLVA 3AU2A 4B5NA 4RUCA 1Z8AA 2Z28A 3GW0A 3TQ0A 2R1MA 4ZVJA 3Q94A 3LXBA 2GYIA 1ZY9A 1G6CA 1OT2A 1LL4A 4QJ5B 2IXVA 1FOBA 3CIXA 2FVKA 5C2GA 1DXFA 1OGSA 4Z2IA 1TPUA 3PB2A 2PCEA 3QMTA 1UKQA 3QR3A 1JIBA 1O68A 2PU1A 1XX1A 1UD5A 1VZWA 4PRWA 4J9MA 2YCJA 4LH8A 2DVXA 4XQ6A 3UJRA 2O7QA 3L0GA 3N2CA 4OE7A 5A8GA 4B5WA 3GIJA 3ARUA 1WA3A 2XCAA 2EPOA 3W1QA 2XIMA 2YDRA 3SADA 4A3YA 3IAPA 1Z32X 3TLQA 4QEEA 3KHDA 4KWUA 3N17A 4OJYA 3E0VA 4QLLA 3RM8A 3R5EA 4JQ1A 3REQB 4ATWA 2XYLA 2LLEA 4CNUA 1XLEA 2ONEA 1TG7A 5A1AA 3DYPA 3W53A 3BQ6A 1DORA 3CUHA 4DAFA 1FP9A 1GORA 1QNOA 3B0XA 4BF9A 2PA6A 5BMWA 3LXCA 4JFUA 4L65A 3VD4A 1FWSA 1N56A 2A3LA 4PEKA 2V38A 3NQGA 1DYSA 1E1CA 2HBXA 1TELA 4JTTA 2A7RA 3JVAA 4R34A 1XLIA 1X8CA 3QY8A 4MWAA 3BARA 2NQJA 1A0DA 2FGZA 3VXGA 1OZQA 4KFOA 5KG3A 3OODA 5KFBA 1BTMA 1I9CB 3NJ3A 3VD5A 2RFGA 4AB4A 3G1AA 3TU9A 1A53A 1WAUA 2PD5A 3AICA 5MF5A 3OYXA 4Q4KA 3LV5A 3L2IA 3ES8A 3NXLA 3G1YA 2BZNA 3PW4A 2QIIA 4XD3A 3T4CA 1QVBA 2OSXA 4PMUA 3BJYA 5H6HA 2BTMA 5IOBA 1VLIA 1EGZA 3W7PA 2FVMA 3AIRA 2AMXA 4MJ4A 4CD7A 3U5YA 2J6VA 3EYPA 5L1LA 3ZLHA 2VR5A 2GGJA 3GXIA 3UESA 2E5BA 3BG5A 4KS0A 1ZBWA 3VGDA 3M4HA 4WRHA 5KT6A 3MKKA 4AHQA 2R91A 1YYAA 4UNIA 1IHIA 5TD4A 2NUXA 3DHFA 1V6VA 1AL7A 1QHPA 1W9UA 4DPPA 2VM8A 4BFAA 1GOXA 1QOQA 4YJ5A 5BU6A 1JIHA 4PE8A 1JXLA 4X3ZA 2R8HA 3BW4A 3T08A 3VCRA 1TFVA 3W7CA 2VZTA 5C5YA 2XHYA 1SQ7A 3ZVHA 3T40A 3NZRA 4ZOAA 4KGJA 1NFBA 3VZXA 3W01A 1S0MA 2Z25A 1SR9A 2WMHA 2ZZ5A 2G0WA 5LNWA 4A35A 1UR0A 2WMFA 1N8WA 4JOMA 3SUSA 1MUMA 3EAUA 4UOJA 4W9TA 4EK7A 4JTRA 4AIEA 5SWUA 3BSGA 3UG4A 4X0VA 3TKFA 1H7WA 4N4QA 1W6TA 3C2VA 2ZUTA 1ZCCA 2VUYA 1EOMA 1IWAA 3ZT5A 3DOPA 3T5JA 1VYPX 1X38A 2QUTA 3ONCA 3TTQA 3RB3A 2ZZ4A 3EDEA 1M41A 4YLWA 4GYJA 3HM7A 4I3GA 4JTFA 4D6EA 4ECYA 1XKYA 3MWAA 1EWDA 4LAZA 3TN3A 2D23A 2ZCGA 3EB3A 3DFOA 5DQGA 3L5AA 4FF5A 4RZ4A 3GU9A 3S2JA 3WF4A 3VGHA 1I1WA 1RCOB 3NPUA 4HA4A 3C56A 4NL1A 4I9MA 4L80A 1NP0A 3LNMA 4LUTB 3M46A 2X0HA 3G24A 3TOPA 4S3CA 4ZO8A 3C86A 5JU6A 1M7JA 4O53A 3W1UA 4K37A 1M7XA 5HINA 4RPQA 1ISYA 4TIMA 5F9NA 3VOFA 3LHVA 4A6GA 1DWIM 2RJHA 4DJFA 1B4KA 2WMIA 3GDRA 2HISA 1ZPTA 4N9EA 1GVFA 1Q6LA 4QDWA 2GSJA 1UB3A 3L4VA 1WB0A 4O1BA 3U5UA 3W00A 1J0JA 1GZJA 3LPPA 4NX0A 3N04A 3M47A 1Q85A 4JD4A 3CC1A 1TWDA 4U5IA 4UFHA 1WV2A 4HMNA 2RDUA 4M6QA 3EKZA 2QJIA 1KWGA 4DF2A 3H26A 4LEFA 3AXIA 1RA5A 1S2CA 1EQCA 2HVOA 1LOLA 1R38A 4W89A 4DM1A 3CZ8A 1A5NC 1UQYA 1PZ3A 1XIIA 3DHDA 3PZGA 4EANA 3GDMA 3WH8A 4S3AA 2BFGA 2BQRA 3SIZA 4O17A 4U3CA 5JBDA 4DNMA 3MP5A 2WSYA 4GY7A 1E5JA 2ACRA 1E9YB 3GR7A 2IMRA 5B7YA 2YB1A 1NWUA 1XPGA 3IK2A 2GOKA 3DBPA 2JEQA 1WAWA 1AMKA 1W3KA 4GZ7A 1QATA 4JTEA 2Y7EA 3C2EA 3HPAA 1CXIA 5G1MA 2JALA 2V3EA 4LUSB 2WC4A 3VIIA 5KFWA 3DN5A 3VDCA 4HOXA 5HXMA 2G96A 5KFPA 1AVAA 2NZLA 2C71A 1XYLA 1K1DA 4JPGA 3K46A 4JS3A 3TJ4A 1H4PA 3AOFA 1SW0A 2ZE0A 4WOQA 2DIKA 5F1VA 1U1HA 4HZMA 5IFPA 1QCWA 1PTDA 1OCQA 4GXMA 1XFCA 3M9NB 3J7HA 1ZJBA 2G5WA 2QXWA 4IOTA 3NZGA 4A21A 1GQIA 1UZ1A 1W1TA 4PC8A 3AAMA 3B9AA 3FCPA 4UCGA 3E2QA 2WHJA 1OM0A 2VURA 3QH2A 1SSGA 3A22A 2IKIA 4IJBA 3LD5A 1EJRC 1C8QA 3VU2A 4QFUA 2O9RA 3QSTA 4ADSA 4HYRA 4DL7A 4LYRA 4TXEA 2FZNA 3BQ1A 3SQSA 1G0CA 3BMVA 2J8GA 4AZ6A 1FA2A 3W0KA 2YLAA 3FA3A 2OGYA 3GFYA 1A3XA 2HTMA 1HVXA 2BY1A 3UVIA 3WMCA 4ATDA 3WLMA 1FWCC 2VKZG 5FJUA 1ONRA 4GYFA 4B5XA 3N15A 1ZALA 4JTUA 3WQOA 4QLJA 5IBXC 4JTAA 3M44A 2VX6A 2EF9A 2EPNA 4JIHA 1FH8A 2QV5A 1IGWA 1XLDA 4JX6A 2UBPC 4OV4A 2VVSA 1VEPA 2BMBA 1XUUA 4FAMA 3HIJA 1U1UA 4XVDA 3DHPA 1M3UA 3QPZA 4OV9A 5BMXA 2EKGA 1AW5A 4W7VA 4ECUA 4UIOA 1MW1A 3DBNA 3GDKA 3L2MA 3LI0A 3I6RA 3RR1A 4XX6A 4DJEC 1H1YA 1VGAA 3TZNA 2F6KA 5BXRA 4Q4SA 2ZVRA 3KCOA 1K9DA 4KBXA 4JYDA 4S3KA 2O55A 2VDIA 3DDMA 1X8FA 4GBUA 4EE9A 4D6JA 3W3OA 4PCNA 2NVDA 3W2LA 4JX5A 3E96A 4QJ3B 1K70A 4MAVA 2MUCA 2A5HA 1MRAA 1PS9A 2R24A 4ZL1A 1E6XM 3WLTA 2Q8LA 3H70A 4LQ1A 5LHFA 2C0AA 1VH7A 3HJZA 1S9FA 2WSKA 1SO3A 3MY9A 3NG3A 2I9EA 2X0SA 3L65A 4H9ZA 2AL2B 4KEUA 4L6DA 1PE1A 1VD6A 3QC0A 4GQQA 4NZCA 4O15A 4WQ6A 1QAPA 2DZWA 3ZYZA 4OIFA 3LMZA 3T81A 3GIIA 1UUOA 2EG7A 4UQDA 2PEVA 4S3FA 4JN7A 3VC6A 1PIIA 3DI0A 1XP3A 2DPEA 3B8UA 4AY7A 3QTPA 1VBRA 4RNIA 2B7QA 5GNXA 3W7OA 3JUGA 5DY2A 3W1XA 1Q3NA 2QCMA 2VEGA 2QHAA 4EF8A 3ABOA 5EDWA 3R79A 3PZTA 2NWRA 1CXFA 3UJFA 4PB4A 2Y61A 3VGBA 4PTWA 4P8XA 3PAJA 4KEVA 3TNOA 1XC4A 4J28A 4U7CA 1N55A 1FFQA 1GK8A 3BLLA 1H0GA 4YWIA 3N3TA 3OLDA 1SYTA 1IT8A 3V6KA 3L4UA 5GNZA 1M01A 1XXXA 5IM51 3IACA 5I2UA 3ARWA 1TA3A 4ZA0A 2UY5A 5KG5A 5A8PA 3WQ6A 4C7FA 2Y88A 3TN6A 1XYCA 1BF2A 5HWNA 2OR2A 1VRXA 4IGSA 1TUFA 4Q4PA 1LG2A 5I0DA 4PEEA 4E3VA 1PL9A 1EB3A 2G95A 4O11A 4K7VA 3V6JA 3RG6A 1EXPA 3S47A 3OZYA 1J01A 4XZHA 4QIUA 3WLSA 3UJ2A 2YL5A 4JKKA 1EDQA 3ANUA 1CGYA 3CV7A 3K1DA 1JZ8A 2HVNA 3SRFA 2VGIA 2WWCA 4HP5A 1DHPA 3S2CA 1E1FA 3ZLFA 1W8SA 3NAVA 4E2DA 5BXTA 4IIDA 1LT7A 2E7FA 2DUAA 4DAIA 5KZMA 2GVYA 4C91A 4OFCA 3IVUA 4REQB 4AVNA 2OU4A 1K6AA 1TTIA 2E6YA 4Z08A 3I10A 2XGBA 2YCKX 2J4GA 2Y89A 1OC7A 2IKHA 3NZ1A 4EPKA 4M29A 4EYIB 3F4DA 4JGDA 3F03K 3LCGA 2JEFA 2GJXB 1RCQA 2PCQA 3C2OA 1Q6OA 2Y24A 3MZNA 4Q4MA 3A3WA 1W1ZA 3E2VA 3RUBL 3LGDA 4K6AA 1T3NA 3A4XA 4KWOA 3QV8A 4AAJA 3VOIA 2OSYA 2XIQA 2Z1VA 2XVKA 2VOTA 4ALDA 5KFTA 4YCPA 3S2NA 1VF8A 1U22A 2XZ9A 4HNVA 1CLXA 1J18A 3TXZA 4D6CA 4HU4A 3B03A 1EUNA 1G4EA 3UGVA 2H8XA 4UMBA 1XLGA 2R8JA 1D8CA 1DJHA 2QVNA 3TE9A 1OX6A 1FH9A 5A6LA 3GH4A 3QV9A 3TTYA 4YVPA 1ISVA 1GEHA 3ARZA 1YE6A 3TXVA 3VNLA 4LVFA 1OY0A 5DO8A 5T91A 3GGMA 3D3FA 2CBJA 3A24A 2F6XA 3G6LA 1ZSXA 3NQMA 2GWGA 2NXGA 3W4RA 1GVIA 1NY1A 1GONA 1NOUA 4GQRA 3TYUA 3WEZA 3GHTA 1MMFA 3H4WA 3W7JA 1XINA 4LYKA 4PGLA 1AW1A 4CN6A 1RLCL 2UWFA 2IBKA 1XJBA 1TWWA 1OGBA 2EG6A 4KWVA 2QUNA 1H2JA 3SY8A 3VDAA 1XYAA 3ZQ9A 4AYGA 3IGXA 3VX0A 3LRLA 1KFKA 3PY2A 4M82A 1V3JA 2WM1A 3IK4A 4Q6JA 2DGAA 1U5VA 2V5JA 3HFYA 4L4OA 1J4EA 1KTCA 3LHZA 3OLGA 4KRZA 5FF0A 4C7GA 4I6VA 2VZOA 4YTRA 5ABEA 3W73A 4O50A 2WKLA 1XIDA 4C6EA 2P0OA 3D46A 1LDCA 1QI0A 2Z27A 4ORMA 2NT1A 1PKMA 1P7TB 2HVMA 3BICA 4QXIA 2VZVA 5K2ZA 3SR7A 2Y1HA 2JEIA 4F0RA 2XVLA 4JTHA 3AHYA 3MU7A 3HURA 5AHFA 4K36A 5ENLA 3FFSA 4LUTA 3S5SA 3RPDA 3BAWA 4RLIA 3BTNA 2CZEA 4FPSA 4AEOA 2ZC1A 3XIMA 3NO5A 4YYFA 3WJWA 4XZ9A 3WQFA 1HW6A 1U83A 2BSLA 2YCEA 1I45A 3SCNA 3SUTA 1KM5A 3DI1A 1QO5A 4O1FA 3KP1A 3W84A 1IZKA 5CPTA 2EPMX 2QS8A 3MUXA 3AFBA 3BWWA 5LNVA 1XCWA 2V9DA 1J79A 1Y65A 1V8EA 2AAAA 4PN2A 2WMKA 1QBAA 2V9WA 8TIMA 1HF6A 1RBLA 3DXIA 1VFOA 3VI2A 1T7LA 4Y2WA 3TTOA 3PJXA 2X09A 4IM4A 4UB9A 4J9QA 1LBFA 4UTTA 2V2DA 1FWIC 1V0MA 2YW4A 1L6WA 5CAKA 2YIHA 2ZUUA 2ZZ6A 2OG9A 1J93A 1K4GA 4A3QA 1FKWA 1OF6A 2A7NA 3O63A 4BI6A 3CH0A 1S2WA 4F0KA 3ZZ1A 4HHLA 4RW3A 2C13A 3T78A 4Y96A 3NEHA 3KWSA 2J7FA 4AC1X 3N6QA 2Q01A 3QLDA 3UZJA 5D02A 4HSHA 3P5YA 3S9YA 4L61A 1YPXA 3WDRA 4ZCWA 3UZYA 2O9PA 4MADA 2CXEA 4FP1A 2J6UA 3A23A 1XRSA 4Q4QA 2GVLA 5EA9A 3MV01 1AK5A 1NIUA 1MEWA 2OO0A 4HNNA 3JW7A 2HRWA 3ZJ7A 2C16A 3WUFA 5GJPA 3E0LA 4EX4A 3G6XA 2OWWA 2PDUA 1ECEA 3UD6A 1A5UA 5DEZA 3KL3A 1QNSA 1A5MC 4LAOA 1BG9A 2NLIA 2PDBA 2YCLA 4Y9PA 5IDZA 1A5KC 5CBIA 3W81A 5T14A 4D8AA 2PE4A 2DW6A 1GNXA 1TPDA 1W5NA 4YYCA 2G97A 3ITLA 3AHVA 4LCSA 1VFLA 5AVHA 2HSAA 1BLIA 1KGWA 2V5CA 2NX1A 4FX6M 4IQJA 1EDTA 2CZFA 5E9AA 3EZ4A 3U4AA 1DIEA 1UYQA 3ZIZA 4YP3A 3B9DA 3ITXA 1H7XA 1B31A 5DMYA 1T5AA 5JIWA 1HNYA 1IXOA 4PCPA 3C2YA 3O3RA 4NF7A 3DX5A 4ZMGA 3BGJA 4OBRA 2QCDB 5CQ1A 1J6OA 1MNSA 3SRHA 3WCZA 3IJ6A 1US0A 4MGGA 1AA1B 3M0ZA 5TIMA 3CS2A 4GO8A 3R6IA 4Q45A 1XLLA 5I3DA 4C1NB 3B0PA 1ZP3A 3HPFA 4E2VA 1W9DM 5J5RA 2RDXA 1H09A 1RHCA 4E2BA 1TWZA 4ED7A 1OD8A 2J47A 4TTGA 4RUAA 4ED2A 2VX4A 4AD4A 3N9RA 1JUKA 1G4PA 2H8ZA 4ZFCA 4PYSA 3WENA 3KCJA 1CGTA 3RRXA 1PDZA 2F61A 1BXBA 2ALZA 4UQBA 4WKFA 3O7UA 5AYBA 3REQA 2J88A 2ODOA 4HYWA 2I57A 6REQB 4FNRA 1EPVA 1ZRQA 4UOQA 2ASDA 3UA4A 2XN0A 3CIVA 3HB9A 3PPGA 3WJXA 1O4UA 2XINA 1QFEA 5DRIA 1J12A 4B9YA 3I3BA 1REQB 1LF1A 5M17A 5F2MA 2BVDA 1WKDA 1QW7A 3UXDA 1T94A 1B0IA 2V81A 2C15A 2DSKA 2WVUA 2IKJA 3MANA 1NSJA 1CZ1A 2Y5SA 1EKOA 1EWEA 1TMLA 3VVGA 3QPYA 1LQ2A 4GLEA 2PGEA 4MNLA 3WDIA 2RDJA 2EJAA 1NQ6A 1NVMA 3CZKA 1FWWA 1CX9A 3R43A 4D1IA 4MB3A 3UXIA 3QW4B 2IW0A 3OB8A 4HNOA 5CGQA 4H8HA 3E6EA 3OU8A 1HKMA 3MCOA 5REQB 1FVPA 1PWLA 1GZGA 2QF8A 4JEQA 5C7HA 3CUZA 2NVCA 3OW1A 4LFYA 3MHUA 1VFSA 3OIHA 5A5WA 3WH7A 3S9IA 2GUUA 3THAA 1VFHA 4Y8FA 2EPKX 3O9NA 3U6WA 3W86A 3T42A 1UG6A 5D9PA 1XBXA 1CECA 1A5AA 1ZS2A 4H9YA 4NNAA 4Y90A 4XD6A 5KFIA 2JEGA 3FXYA 1GHSA 4PSRA 4DZHA 3SN1A 5FJTA 5E0FA 5KFJA 3FJ4A 4RNMA 1PPIA 4NAFA 3CHFA 6TAAA 4W5ZA 1YKWA 1EZ2A 1WDPA 4JFSA 3USBA 3R12A 1MW0A 2ZXDA 3EWYA 2IS7A 2QCLA 3W1LA 2DJXA 3IVSA 2BWGA 1QNQA 1MO0A 2VZSA 3H7UA 5CJNA 1AL8A 4M3PA 4QSFA 1MZHA 3AZSA 1DQXA 3H2MA 4J3SA 3S42A 1MI3A 4WDWA 2REQB 5CBJA 4CNSA 3SUWA 3FX4A 3SFWA 1V3KA 3UPMA 1EL3A 4QQUA 1UWSA 1JJKA 1C93A 1D2KA 3HOJA 1UQZA 4MB4A 1E0XA 1IR2A 4OU1A 5KFSA 2P8BA 1RP8A 5CPMA 1OFEA 2ZA2A 3GV8B 3T0CA 1X98A 2ZKMX 4RNHA 2VRJA 1A5BA 4S3GA 4PUMA 1UJQA 4Q32A 1UD8A 3A21A 3EWWA 2W7OA 3R2GA 4DO4A 3FJNA 3E1F1 5AYIA 2WSRA 2TAAA 4GFIA 1A4LA 4IP5A 3UCQA 3JZUA 2I16A 5D9MA 3AXMA 5F2LA 1IIHA 3HBLA 4JHMA 3BO9A 3I4KA 4RK8A 1DWHM 1S5MA 4KWSA 4Q4OA 3WNKA 4IQLA 1V77A 3WELA 3V5OA 3T1GA 2Z1KA 3W27A 2ACQA 1RVGA 3W85A 3LCIA 4GZIA 1O12A 3M6YA 3PAOA 2V5LA 4R9XA 4AFYA 1YHTA 2CZ5A 3LHWA 3SCOA 3APYA 2Z2BA 1X97A 1HJSA 1FH7A 5EMJA 3A4AA 2JKEA 2A3CA 4IGHA 2QV4A 5I3JA 4WY0B 1EIBA 5DMLA 3T0DA 5FEXA 2VOMA 1UJPA 3CQJA 3NURA 1GGOA 4BZYA 4J27A 2I5IA 3DFNA 5KT2A 1FCVA 1XH1A 3HGRA 3FAXA 4LJ3A 5T9BG 1ISXA 2GL5A 3UWUA 4J2MA 2DSZA 3M0MA 4PB5A 1LRQA 2OELA 1SU5A 3G6MA 4HPNA 5M1TA 1LWHA 4M56A 2YKKA 3VNDA 1G94A 2OEJA 4H7VA 4HSOA 1TPC1 4YHGA 1K1SA 3VM5A 3NL3A 3EPGA 2NVAA 5HWMA 4MUZA 3L4ZA 7ODCA 1EFZA 3U2EA 3N19B 1FCUA 2XUCA 3SGZA 3S3GA 2I9UA 5E0KA 1JXJA 4DO6A 4F0SA 3MMWA 2GZXA 2BB0A 4N7QA 1RR2A 1RY8A 2AMGA 4M5PA 1YDOA 5D8ZA 7REQB 1OK4A 3AHXA 3G1SA 1ZENA 1W1VA 4OVXA 1TPH1 4EBEA 1FDJA 3I6TA 2Z2AA 1R2TA 1PKNA 4NRSA 1E73M 1FX6A 4LAMA 1KGUA 4ECWA 3LV6A 3V1HA 3PSWA 1J8VA 4P8VA 1WZLA 3L7RA 2XVNA 5HMSA 4NIRA 2F9RA 4NY2A 4JCMA 1Y5VA 4GJJA 2GGGA 4XIMA 5D8WA 3T2PA 5AVNA 3P8JA 3P2VA 5G2HA 3VPLA 4JAWA 4AF0B 3C0LA 1J0ZA 1XIEA 2ASJA 1P0NA 4UR8A 2OH2A 3C6CA 1QNPA 2DU2A 3KBWA 3R0KA 4MZ1A 4DWSA 2BBFA 4PFHA 4NSBA 3MP4A 4H9TA 3EDDA 4D6GA 3KHJA 2BNJA 1Q6QA 2VRKA 2O4QA 3GVWA 3EMQA 4DELA 3MUZ1 2EPLX 5HUOA 4L1XA 2E6DA 5AZ0A 1UWUA 3GE7A 4GUFA 4HA1A 2DDXA 3IRSA 4IXHA 1C3FA 5F4SA 4KETA 4ZSUA 5EFDA 4E8CA 5LKYA 1OVDA 4DUXA 3PM6A 5LIYX 1VB9A 2ON3A 3W02A 3GWQA 5EGRA 5CLWA 4ECRA 3NGDA 1Q8JA 3WD3A 1F7BA 3H2AA 1OG0A 3PZIA 3CUFA 3SBFA 4IJCA 2E3ZA 1J10A 4CN4A 2MNRA 1S3HA 1BXNA 3N4EA 1I2NA 4Q43A 2QGYA 3TH6A 1OC5A 4HOZA 1P5BA 3CBWA 4M7SA 1IF2A 4XTDA 4YR3A 1QXLA 3VCCA 2QW5A 4F2TA 1UH4A 2Q8ZA 4ACZB 3MDWA 2V2HA 5KG6A 3Q8SB 3EWBX 1MW2A 1RQBA 4IUOA 1H61A 2C1GA 4UTFA 5AYZA 4UQEA 3SCQA 1YXYA 4B90A 4FBTA 2OXNA 2CESA 2D24A 4Z1YA 1FWGC 2UY3A 3ORWA 1HZYA 1FWNA 1PUDA 3OG3A 4JXCA 4ECTA 2GJRA 3G1VA 1JUEA 3AJ7A 3EOUA 4UC5A 2FZ9A 1QPRA 3GB6A 1WXZA 3GUWA 3LXAA 2OQHA 3ZR5A 3AYRA 4GE8A 1GVOA 2PWDA 1W3LA 2I56A 3U3HA 1R7AA 3OVQA 5IDIA 3U57A 1VFFA 1DHKA 4V27A 1FDZA 2VQUA 1TB3A 7A3HA 2Y70A 3R8RA 5ABTA 1TZ7A 4IIBA 3RAQA 1BRLB 1ME7A 2A7PA 6XIMA 3GAYA 3E2SA 2G37A 4GJ1A 3W26A 3MR2A 3PG9A 1JCXA 4O8RA 1KKRA 1GOOA 4QG8A 4K1WA 4H8VA 1P4CA 6TIMA 1YTDA 2JGQA 1HXJA 5D2WA 3EA1A 2E8ZA 5F2IA 3F4CA 1LUCB 4O0QA 4F0HA 3TJIA 1GOQA 1EX1A 1OIFA 3FN9A 1JZ2A 1CTNA 3WBAA 1CLKA 4KRUA 1TCDA 7CGTA 1YBQA 1Q13A 2TRSA 4H2CA 4LEQA 2BG5A 2ZQ0A 3ZVHB 2W3ZA 1VAHA 2C91A 2J7BA 1A5OC 3L5MA 3NGFA 3Q8QB 1JL8A 5HNUA 1QOXA 2AAMA 1B57A 1BD0A 3N2BA 4BJHA 2AGQA 3M0JA 4GA8A 3KZSA 5GJNA 3RJXA 4FIQA 3WQ8A 1GG1A 2NSXA 2PDNA 2RDWA 4UNLA 3NO1A 5HUPA 1DIKA 4BR1A 3U7VA 3CHEA 3QVQA 1IEVA 3PVXA 3AIWA 4AXKA 1M03A 1JDAA 3TX9A 3GC2A 1JPMA 4PUKA 4RDYA 1VBHA 3KBNA 2BASA 2OYKA 2WJDA 2CKSA 2Y62A 3LCXA 5CC5A 1JF5A 3PZUA 1R30A 5CPOA 1R9XA 1TRIA 3A3XA 1GQJA 5BWFA 1D3GA 2QCNA 3WSUA 3OA3A 2VX5A 4QROA 4AG0A 3GY1A 1OFOA 2IUZA 1UASA 5HR6A 5KFYA 1MEHA 3N73A 2CLMA 2VT0A 4AIOA 3LTPA 2VWSA 2WLZA 4PMYA 4IISA 1DPMA 4IIHA 5D9NA 2C79A 1ONWA 5BOFA 5LYRA 4MWAE 1Y5XA 2J7DA 1XIFA 3NZPA 2Q6ZA 3GV7B 4AD5A 5FSDC 3HGJA 1E9LA 4HPXA 3HF3A 4MSSA 3P8IA 3QXBA 1VEMA 3N9KA 2NX9A 3PZQA 2R8KA 4P7OA 1XCXA 4S23A 3F5KA 4GYPC 5G2IA 3Q37A 3TWBA 5KT7A 1UR8A 1YMYA 4Y9OA 4ZTXA 4GXWA 1OD0A 4NXKA 4W84A 2G3MA 1HGYA 3DYOA 1G5AA 2RGLA 3RGTA 1S0OA 1FHVA 4JIIX 2VHLA 3WH9A 5E5CA 3VDBA 3MMUA 3IIPA 4IP7A 1EJVC 3R25A 4RU9A 2IKGA 4HBKA 2Q3RA 1TMHA 3RYSA 3N12A 4Z0JA 3B9OA 3ZOAA 1A3HA 2DUZA 3UXAA 4C5ZA 1VKFA 5XIMA 1MZRA 1E0VA 3BG3A 1E43A 3KFTA 1BWVA 4QWDA 1BYAA 5AHIA 3C0QA 2QKFA 3MUAA 3E02A 4AVFA 1W9XA 1XD0A 2Z1SA 3G1DA 2DZAA 4AMAA 2UV8G 5DFAA 4G1NA 3DFYA 3ATZA 2CITA 3P80A 4YPJA 2UVRA 4E4UA 4M8UA 2ISVA 3B0VC 4M51A 1F6KA 1SJBA 1E6ZA 3S1GA 3JR2A 4GI4A 5JH1A 2B7NA 5TNVA 3K1GA 4WHBA 4XKYB 5T9CE 1JD9A 4YVVA 2ASLA 3IJDA 1DP0A 4PTMA 3MJMA 5C9WA 2BHZA 1EJSC 1RJPA 1SPQA 2QF7A 5C0QA 2QDGA 3K8MA 1TVPA 5EWFA 1EYWA 2R1LA 3B4UA 3GV5B 2PWFA 2PGFA 4FEZA 3LBOA 3QM3A 1TV5A 1JYVA 3LQLA 3H54A 2DZUA 4MKSA 3PPFA 4QDPA 2J7HA 1E6PA 2D69A 4O8AA 1P48A 4HB7A 4NJKA 5E09A 3M41A 1HQTA 5CC7A 4FOKA 1KXTA 3BXWA 4OHQA 3VTRA 4C6OA 1Y7VA 3MUCA 1E4MM 2J6XA 1ODUA 3UZXA 4AH7A 4MAZA 2FMOA 4L9YA 2UVVA 4L5ZA 1VHNA 3WQCA 2PBOA 1A49A 1A5SA 3N2TA 5DRCA 4C6DA 3W23A 4GABA 4RZRA 3EDFA 2X2GA 3IUHA 4ADTA 4DJFD 1UMYA 4ES4A 3KLLA 2X16A 4JFWA 3NDOA 3FA4A 3IPWA 4DY1A 1MYRA 1UPPA 3WLQA 2W9BB 2IPJA 2V3DA 4H3DA 3VCNA 4UFIA 4P61A 4YVXA 3IUIA 4YL2A 5CZJA 2BXVA 2GQAA 2HS6A 3KTXA 1IQ8A 4CQDA 3RXZA 3VAVA 3N4FA 1F4AA 2BODX 3WEMA 3DFQA 2ZFAA 3AS1A 4Y9NA 4F9DA 1KCXA 1I2OA 2R1KA 1LZOA 5RUBA 5FOOA 5BZAA 4QWBA 3T4WA 4R9OA 1N48A 4N9DA 3TYEA 4G9PA 2FGLA 2QCCA 1SFTA 4NLGA 5L1KA 3MDUA 3CH9A 5FI8A 4HCDA 3WNMA 2VENA 3N11A 1I2PA 4O3OA 1XPYA 4ZTYA 3N25A 1HVQA 3GG0A 4LS2A 4MYAA 2Y5JA 3TR2A 1CLVA 3L12A 4IQDA 1W54A 1EQPA 2FLLA 5DQHA 3QF0A 3T09A 3OLEA 1PZ2A 3WFAA 4NNCA 2YLLA 1TV7A 2CW6A 2INFA 4AWSA 3P62A 1O60A 2NWSA 3EOOA 4IPLA 4NQ1A 4MWAD 4TQTA 1QK0A 1VCFA 4MHBA 1GKPA 3UBPC 3PR2A 1TV2A 3W1TA 2E6AA 2PURA 1EC8A 4DVOA 3DG6A 3KOWA 1WNOA 1UPMB 1H60A 4MYXA 3BLFA 4NILA 3WNNA 4QW8A 1OYCA 4HHHA 1JNDA 3TYZA 4WY0A 4BI7A 4IIEA 5K9XA 1XSKA 7TIMA 2XH7A 1D3HA 3PBYA 3O16A 4N42A 4WF7A 5G4HC 3GRIA 1L2UA 5C9RA 2JBMA 4E4FA 2YYTA 3CHCA 4Z1CA 1AW2A 4IRKA 5HATA 1OX4A 1NDWA 2PODA 2WVVA 2CLHA 3STPA 3AHZA 3V5FA 4NVTA 3B8VA 1JULA 1K8ZA 1SJDA 4G2DA 1XSJA 3CZGA 3VX1A 1JZ3A 4H83A 3GXDA 3NQ2A 3ZLGA 1A80A 5I09A 4GNKB 3UYIA 3QRHA 4N0RA 8CGTA 3IGHX 4XAFA 3KOFA 4KIEA 1XYZA 3RN6A 1E55A 4H6EA 4HU0A 1CXEA 2OLHA 5KT4A 1H50A 4ZQOA 2NV1A 5DF0A 3AMGA 4AZBA 4UFLA 3GNOA 3R89A 4AWUA 2VGGA 4NU7A 4LUJA 4DJDC 1HKVA 2B7OA 5AC5A 3G1FA 4JTIA 2XM1A 1FHDA 2PBGA 3U8GA 2V30A 2OJPA 3IRDA 3W6YA 4GD0A 5I7GA 3IWPA 2A2IA 4EXBA 2Q3OA 4XZIA 2VD9A 3TDFA 1Z41A 3RLGA 4G56A 4DWSD 4IPNB 4CVUA 2DH2A 1OCBA 5C55A 3TR9A 1XLHA 1X6NA 2R1NA 4IGMA 3BCFA 3AWNA 3P0WA 5MKGB 1QWKA 5BRQA 2OZTA 2GPTA 3V75A 3FJLA 2DPJA 4HPJA 3TK7A 5CAHA 3MPGA 2I14A 2YFOA 3SY5A 1OINA 2WQDA 4OT7A 3KS6A 1KXQA 2PPGA 3ONBA 3LCHA 4G5DA 1QI4A 4C7DA 4HK5A 4Z1AA 5KINA 3PTKA 4DF1A 3WFZA 3V4BA 3UWVA 2CZDA 2IA6A 2DZVA 4XK2A 1JXKA 5AZ1A 2P10A 3PP7A 1GT8A 1RV8A 1AODA 4UR9A 4UFMA 5D32A 3PJUA 3R13A 2OYMA 3ZJ8A 4JIRA 3V16A 2OB3A 2AQ4A 1V03A 2FZBA 3MKCA 3APTA 1E6RA 1UROA 4CQ9A 3QV7A 2ALDA 3WG6A 3M9MB 1BVZA 4J40A 4EXQA 1TYGA 2Y2WA 1Y5WA 4OKDA 3T0AA 3PWIA 1E0UA 4Q8FA 1ICPA 1K8YA 2E09A 1BVNP 3NQEA 3I7RA 1OCJA 4Q8QA 3WD4A 2W9AA 3POCA 2VCCA 4KW2A 1W9BM 3UZ5A 3WK0A 1X1ZA 3ABRA 3VFCA 5BNKA 3CASA 5FCZA 4O3NA 4Z42C 2QT3A 1R3SA 2C1HA 1Q45A 2QPSA 3RX2A 4QJ4B 2PDXA 3M0KA 1V93A 3OZOA 3UWYA 4TX6A 3GTHA 4AY1A 1JZ7A 4M1RA 2HK0A 4AZ7A 1QJWA 4QW9A 3IEBA 4PSPA 3R10A 4TOQA 3MUIA 2VR2A 3GW3A 2CLOA 3ANVA 3KCLA 4QITA 3O0KA 2NV2A 2VUNA 1SO5A 1Z6KA 4UQCA 1DTUA 1FRBA 1M68A 1RK6A 2WWDA 3AALA 3VNMA 3M1ZA 4PCFA 3HMJG 3LEPA 3W7MA 2GDVA 1W9PA 4JN8A 1EF2A 1XRFA 1MXSA 3CPGA 1GVRA 3RDKA 4FHAA 4FALA 3GH7A 1V6XA 5A69A 1V51A 3G6YA 4PTVA 5A95A 1B4EA 4FIRA 1TV8A 1F76A 2H9AB 2OQYA 4ILSA 1JR1A 4X2PA 1T0OA 4PRRA 5CSRA 3G0XA 3OHMB 4BF7A 1W1B1 1R0MA 2PC8A 1EC7A 4RE2A 3V0TA 4EACA 1HJVA 2RDTA 5I78A 2E4TA 1P6WA 1AZ1A 4ECSA 4HN4A 4US5D 1XH0A 4BI5A 3LLFA 3ID7A 1DWGM 1YPIA 1UD6A 1VBUA 1I75A 2VA2A 5G4WA 2VDHA 3IN5A 4C6FA 2QLYA 5L9FA 2FTYA 1SZFA 3W7KA 4F40A 1AD1A 3V3WA 2WBKA 4MY9A 1A4MA 2WNNA 1R3VA 3O6YX 4Y9MA 3LPOA 1NWTA 1FXPA 3NOYA 4ZBCA 3GXPA 4B4HA 3P0XA 4CGTA 2G4FA 2YGYA 3DCPA 1FWRA 2Q8XA 2ISWA 1NELA 3QHOA 1PIFA 2YA2A 2POTA 3LU2A 3BAIA 3MSRA 2CC0A 4E8GA 2EAWA 3KBJA 3RU6A 4ERGA 1MDRA 2VD8A 3PZMA 1E40A 3GC5A 3KRUA 3BK0A 2J6SA 1NJJA 3A5FA 2W7PA 2QULA 3VABA 1JF6A 4Q8OA 1AH4A 3GAKA 3WNOA 2PDIA 5CSSA 4PMZA 2PAJA 3MKVA 2VEFA 4ZFMA 2ATMA 1E4LA 4HVXA 3NA8A 2BR0A 4J1OA 3GNNA 3SY1A 1GQKA 2WB5A 4C6JA 3F2CA 5D05A 1YBQB 3PR5B 1M9HA 3KOZA 1ECQA 3NGJA 2OEMA 1ZGDA 2X41A 4PMNA 3PC0A 3EOLA 5HQMA 3PW0A 3V36A 2PTWA 4RUBA 2QPUA 3BVJA 3WJYA 2VFHA 3O6DA 1KR0A 4OECA 1ISWA 5DCBA 3C0SA 1CB2A 5A6KA 5FF4A 1M04A 3W72A 3IJ7A 3RPMA 4HK7A 3A6OA 3BMXA 2YL6A 1PHQA 4XZWA 2GSEA 3A4JA 3ME3A 4UTWA 3ITOA 1JDEA 2EG8A 4PMXA 4CD4A 3PBGA 3VGGA 1MEIA 4FX7A 3W7LA 1NFGA 4PBGA 4GC3A 1MUCA 3ABQA 1ZBCA 4C6LA 5KFEA 4RV8A 1R9ZA 3N34A 4HTBA 1XHGA 3ZWSA 2A21A 1G4TA 5KFDA 1EO5A 1PWMA 2J7CA 2GWNA 2XM2A 2V0TA 3LTYA 3M0YA 4EEYA 3MMDA 4QCEA 3P84A 3G6VA 3LBCA 3G1RA 3STEA 5C7VA 1F3XA 4NJJA 4FOJA 1K7FA 3KUMA 1YIXA 4UOZA 4HNTA 1XD1A 3QZEA 4BEUA 1V0NA 4UMAA 1JFHA 3SI8A 1TE1A 3GZ3A 3VD3A 1XV8A 1TR1A 5EMMA 4GI6A 2FLIA 2PTZA 3RF9A 1J5TA 1QNVA 3LGGA 4GY0A 1THFD 2DSVA 4FLSA 4RE4A 5M2FX 3CM4A 4IQEA 3SN4A 1QHZA 3PPHA 1OJXA 5L1IA 3TEVA 4F48A 3G77A 2YW3A 3KW3A 5EMUA 3QGKC 1LBLA 4H6RA 4AQLA 3L4WA 5KFGA 4NAEB 1W3HA 4FNSA 4KCVA 4LUYA 1ITCA 2PGRA 3LCFA 1F6PA 3T8QA 4DWSC 1UR3M 1TPVA 3LK6A 1UKTA 4XAYA 2E9LA 3ALFA 4GJIA 3L0KA 4W8AA 1UP0A 3THQA 3V0SA 3OHBA 4RR4A 3EWCA 3KL5A 4B5UA 3W6MA 2WZMA 1QI2A 4HCHA 4GGHA 2FFCA 4AW7A 4EOUA 1W3TA 5HMDA 1XCFA 1ZHAA 4HN8A 4PTNA 1DV7A 3S0CA 3HG5A 4UQ9A 2VP8A 4Z17A 2R82A 4OOUA 3PUOA 2G3NA 3COTA 1DE5A 1E72M 1GKRA 4H9MA 1IT0A 1E1CB 5KMYA 4XBKA 1E56A 4CCCA 5LIWX 1BHGA 3AZRA 1B1YA 2FTPA 3FGCA 3W1NA 3LENA 4XSLA 3HZ3A 4D72A 2FYMA 1W0MA 4BK9A 3UU0A 4IT1A 3WMSA 2CHOA 4AWTA 4LGXA 2Y7DA 2OX1A 3TA9A 4GY1A 2NW0A 5FEPA 4W8LA 2QCDA 3U48A 1YNQA 3LTSA 3VINA 2WAGA 3EX6A 5FD0A 2ZOXA 3FKRA 2ZXBA 2V4QA 3AYSA 4ZOBA 5T8GA 1T40A 2W4XA 3P5ZA 2Y63A 5FJOA 1MUWA 1C9DA 1FDYA 1HN1A 7PTDA 3T55A 3FY1A 2CEQA 4HCLA 1K9FA 1KD0A 4LYPA 2ZX8A 5XIAA 5DT5A 1OQFA 3DFTA 4E2OA 1FY6A 2PB1A 1PKYA 3BZJA 1SW3A 1E70M 1ZZMA 2ZZ7A 3WQEA 4LB4A 3WH5A 1MXDA 4ZO7A 1I60A 2C8NA 1DJYA 3DG3A 3QZ8A 3IJIA 3S2MA 4M7TA 1VJZA 1XDJA 4MMWA 1E3XA 1W5OA 5A8NA 3VIKA 1HP4A 1SFSA 1UR1A 4K2SA 3TROA 1N8IA 5A2AA 2XVGA 3KLKA 4IPPA 5C6MA 1MRQA 3ABSA 2FMNA 1YE4A 2Y8VA 2WQPA 2ZX7A 3GFZA 3EEZA 4GH1A 2OMAA 2PZNA 3PZOA 3UFYA 1TZZA 2Z6JA 3M64A 2VO5A 4M19A 1ZAIA 1X6UA 2J9ZA 2C0HA 4IPJA 4HOWA 4XUYA 3QKEA 4PB3A 2FJUB 4TVDA 4C6BA 5M5DA 1ZFJA 1JPIA 3SGUA 3HGSA 2J79A 4U10A 4DB7A 2ASHA 4Q22A 4OUIA 3WF3A 2JGYA 3FDGA 1DTNA 4K8EA 3R4IA 4Q7IA 4U5KA 1H49A 3F4NA 1CGXA 4TVCA 2F8QA 4PL1A 3AZTA 5AN7A 2WC3A 4K3ZA 4XZMX 1HG3A 3WQGA 1IT7A 3CZJA 1YEYA 4KGLA 2DQWA 4L1WA 4YTTA 4PUEA 3E38A 1K77A 1OFQA 5KZEA 2XDFA 1LOQA 3C8NA 3PS7A 4PUUA 5D03A 4GNVA 5KZ6A 4B4FA 1E1EA 4WD0A 2YZRA 3O15A 3VDGA 4C65A 4EWND 2R8IA 1VC4A 3TLLA 1F5ZA 4DLFA 5U7SA 3RM4A 3UA3A 2WJEA 4EKJA 4MWAB 3TW9A 1OF8A 4LUIA 1F61A 1P0BA 2I5QA 1AJ0A 4QHRA 4MOZA 1V6YA 5E93A 4RNFA 1FCQA 4KFPA 3TN4A 3JZEA 2XGIA 1XQKA 3WZ0E 1S39A 3SCSA 4HYKA 3QQ1A 4BQ5A 1MSSA 3PK7A 2PDGA 3LNPA 1JCJA 2ZZ2A 4RDZA 1TTJA 2P3ZA 1PZ1A 3UR7A 2WLYA 4J9KA 1CXLA 1LL7A 4CCZA 3QLLA 8RUCA 1P0EA 5FAJA 1FXQA 3FSTA 1JAKA 2P1FA 2GFTA 3IIVA 3DECA 2O9TA 3F4VA 5IFTA 2Y5EA 4LAKA 3CAKA 1WDDA 4RW5A 2NQZA 3VIGA 4AEFA 1UP2A 4ZO6A 1FFRA 3VMOA 3NSNA 2XFWA 1PB0A 1C8VA 1HJXA 3FLUA 3CEPA 1LCOA 4JQ3A 3BURA 4RE3A 2PP1A