2BB0A

Structure of imidazolonepropionase from bacillus subtilis
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
413
structure length
413
Chain Sequence
KQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A catalytic mechanism revealed by the crystal structures of the imidazolonepropionase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Imidazolonepropionase
total genus 158
structure length 413
sequence length 413
chains with identical sequence B
ec nomenclature ec 3.5.2.7: Imidazolonepropionase.
pdb deposition date 2005-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2bb0A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2bb0A02
2FTWA 4P5UA 2IMRA 4OFCA 1POKA 2UZ9A 4ZSUA 3T1GA 3OJGA 2OOFA 4J2MA 4UB9A 3K4WA 4C5YA 4CNTA 3A3WA 2WJFA 1FWGC 2Z7GA 3E3HA 4J5NA 1YBQB 1VFLA 1FWCC 4AC7C 3PNUA 4GY1A 2PLMA 1EJVC 1BF6A 2R1LA 1RJRA 2Z26A 3OODA 4QS6A 4EPDC 1P1MA 1J79A 3S4TA 1KCXA 3AU2A 1I0BA 4C6FA 4LCSA 3V7PA 2Z00A 3F2BA 3EGJA 4V1XA 3NEHA 3GIQA 3T81A 1RJQA 2PGRA 3R0DA 3GGMA 4F0SA 3URAA 3RN6A 2Z2BA 1HZYA 4CQDA 3QY6A 3QGAC 3OVGA 1J6PA 1FWJC 4DO7A 4XAYA 4ERGA 1FWIC 5LXXA 3E74A 4TQTA 2F6KA 3URNA 3LY0A 1GKPA 4XD4A 1EZ2A 1FWFC 3WZ0E 4HA0A 2G3FA 1YRRA 1EF2A 2E25A 3IV8A 1XRTA 3ICJA 4XAZA 3IACA 4IFOA 3DCPA 4KEVA 4H9UA 1ITUA 2FVKA 4CNSA 4BKNA 4RDYA 3GG7A 3GU2A 4WGXA 4DNMA 4GXWA 3MKVA 3KM8A 3ORWA 4IGMA 2FVMA 3GU9A 3LU2A 4E3TA 2I5GA 4NI8A 4G7EA 2HBXA 4NP7A 1DPMA 2YZ5A 4XD3A 4HJWA 4IFRA 2YB1A 4C5ZA 2PUZA 1O5RA 2EG8A 1K70A 4LAMA 1ADDA 4QROA 3MVTA 3HM7A 4BY3A 4V1YA 4PE8A 3MJMA 1EJWC 4CEUC 3LSCA 1XGEA 3FDGA 3WYZA 4MUPA 3TN5A 4XAFA 2GZXA 1A4LA 4KETA 3LA4A 2HPMA 4IGNA 2GSEA 3MTWA 4QTGA 2VR2A 4GY7A 2DVTA 2OB3A 1GKQA 4GX8A 3G77A 2ANUA 3GTHA 3QGKC 4EP8C 1FWBC 4EPEC 3C86A 3TN3A 1FKWA 4DI8A 3GTXA 5E5CA 1RA5A 3DUGA 4IQJA 4DLFA 2GWGA 5A6TC 3NURA 1FWDC 4ERAA 1NDYA 3E0FA 5FSDC 3A4JA 1EJXC 3MDWA 4RDWA 1A4MA 1FWAC 1W1IE 2P50A 3F4CA 4KERA 4C6LA 1A5NC 1YMYA 4RDZA 4CQBA 2WJDA 4PBFA 4C6JA 3F2DA 4H9VA 3SO7A 3E2VA 1RA0A 2VC5A 4IFKB 3S2NA 4C60A 4C6OA 3O7UA 2R1KA 3QY8A 4Z42C 2P53A 3K5XA 2E1WA 2Z29A 4GX9A 2YB4A 4LEFA 1FWEC 2D2GA 1RAKA 3D6NA 3F2CA 4KESA 3UF9A 4XAGA 4KF1A 1A5OC 3S2MA 2D2JA 2Z28A 4CEXC 1NDZA 1UIOA 1PSCA 3MSRA 4B3ZA 4RZBA 4C6NA 1V4YA 3GRIA 3ISIX 1NFGA 1E9ZB 4GY0A 3PBMA 3GIPA 4ERIA 4M51A 1XRFA 1NDWA 2A3LA 3PNZA 4C65A 4C6IA 3RYSA 3NQBA 3OQEA 4LAKA 2Z25A 4LANA 3AUOA 2P9BA 2D2HA 4WVXA 1S3TC 3IPWA 1YIXA 2AQOA 1EJTC 5FSEC 3RCMA 4KIRA 3GTFA 4PCNA 4DI9A 3CJPA 4C6EA 3LGGA 4ICMA 3IRSA 2HBVA 2OQLA 4UBPC 1QW7A 1I0DA 2O4QA 2QPXA 3EWDA 3CAKA 4H9XA 3UR2A 3ID7A 4IFKA 1POJA 4XD6A 4KEUA 3SFWA 1ONWA 3GUWA 4H01A 3TN6A 4EPKA 3T8LA 3N2CA 3URBA 1P6CA 4GC3A 2BGNE 4YIWA 2FFIA 2R1NA 4LCRA 4QSFA 1R9XA 4WHBA 3E38A 4BJHA 3BE7A 4GZ7A 3GTIA 4XD5A 1UBPC 4IH3A 2R1MA 4I6VA 1R9YA 1A5MC 1PO9A 1UIPA 2PGFA 2Q01A 3MDUA 3OU8A 1E9YB 2QS8A 1ZZMA 3DC8A 2R1PA 4JOMA 2OGJA 4G2DA 4IG2B 2AQVA 2Z2AA 3LNPA 4QRNA 4I6KA 3LSBA 2FTYA 3IARA 2HNHA 1KRCC 3F4DA 1A5LC 5CH9A 1A5KC 4GYFA 1EJSC 1NDVA 2WM1A 3LS9A 2KAUC 4B90A 2CZVA 4R85A 4RDVA 4QS5A 5HMEA 4AQLA 4F0RA 4GOAA 1JGMA 4H9TA 2VHLA 5HMDA 3UPMA 2HPIA 4HK5A 4C6KA 4PBEA 1PTAA 4CNUA 2ADAA 1KRAC 4LALA 1EJRC 3IJ6A 4C6QA 1XWYA 5HMFA 2EG7A 4LAOA 3K2GA 2Z27A 2DVUA 4LFYA 4LH8A 2Z4GA 4L9XA 3RHGA 2AMXA 2UBPC 1R9ZA 4INFA 2VM8A 1M7JA 4PCPA 4D8LA 3EWCA 2WJEA 1FWHC 1WXZA 4C6MA 4H9MA 3B0XA 1ONXA 1V77A 3MPGA 4DZHA 4C6BA 5G4HC 3IGHX 1GKRA 3QY7A 2Z24A 4IG2A 3CS2A 2DVXA 2XIOA 4F0LA 3LGDA 2GOKA 3WMLA 1KRBC 4H9ZA 1IE7C 4DIAA 1ITQA 4R7WA 3JZEA 1J6OA 1EYWA 1RK5A 1PB0A 2YXOA 2VUNA 4HK7A 1FKXA 3UR5A 3FDKA 3HTWA 3O0FA 3B40A 3GU1A 1EJUC 2ZC1A 1O12A 3AU6A 2RAGA 4B92A 3OOQA 1J5SA 4GK8A 4J35A 4LCQA 3PANA 2Q09A 2ICSA 1YBQA 4HK6A 4ZSTA 3TNBA 4KQNA 2QVNA 3B0YA 4C6DA 4NG3A 1V51A 1WXYA 2EG6A 4C6CA 4DLMA 1M68A 3UBPC 1V7AA 3PAOA 3FEQA 4B91A 4EPBC 2OODA 3URQA 2GWNA 1RJPA 1V79A 4DZIA 4KEZA 3S2LA 2W9MA 3HPAA 1K6WA 2PAJA 3S2JA 1K1DA 3A3XA 2O4MA 2BB0A 4DYKA 3E0LA 1UMLA 1YNYA 1RK6A 3MVIA 2I9UA 2QT3A 4GBDA 1QXLA 4H00A 4RE0A 2HQAA 4R88A 2Y1HA 4G7EB 4IF2A 1P6BA 4H9YA 2VC7A 4L6DA 4CQCA 1KRMA 5AKQA 1M65A 3ITCA 3TN4A 4C6PA
chains in the Genus database with same CATH superfamily
4HN4A 5AFDA 5FESA 1N8WA 2WQPA 4DJEC 5IXEA 2YCLA 1Q6GA 2GGGA 1BAGA 4P7RA 3M4HA 1M01A 1MEHA 3A3WA 5D2XA 2WJFA 4NJIA 1E3XA 2Z7GA 2WYSA 4GJ1A 4PGLA 3PNUA 2JGYA 3ABQA 1X6NA 5C9WA 3GHUA 3WQ4A 4AH7A 4AZ7A 3WD1A 3QMTA 1JDDA 1UKSA 2EBNA 1PX3A 2QR6A 3BW3A 3MUY1 4PB4A 4CCDA 3NEHA 2PWUA 4J9OA 4B5UA 1Q7ZA 3W24A 3PR5B 4UR8A 3H70A 5DQIA 5KFCA 2R8KA 1O5XA 4ECXA 2HEJA 1ODUA 4LW7A 2X1RA 1OX6A 4FBUA 3M0MA 4L65A 1TV4A 1XDJA 2FGBA 4LVAA 2F6XA 5IM51 1JDFA 4RPQA 5KFGA 1XL9A 1LWIA 4UCGA 1OCNA 1UD4A 5HQMA 3ICJA 3TROA 1GVRA 2EO7A 4JDYA 4O0QA 3DFYA 2GGJA 2V5KA 3GG7A 4WGXA 1BKSA 1FUYA 4DNMA 2GUYA 3MKVA 1FHUA 2FZBA 1YDYA 4DBEA 4ADSA 4DWSB 4OE7A 3FKRA 4GQQA 9RUBA 4CGTA 1DPMA 1DJXA 4UTWA 1EC9A 4FNQA 4JGDA 4IMAA 3ANYA 2EG8A 4CN4A 4MHBA 3TJIA 4F9DA 4JKMA 2PEVA 2H8XA 4BY3A 2BXYA 1EJWC 1EX1A 4H83A 1LF1A 1Y5XA 1XS2A 1QOPA 1EWDA 4Q4RA 1X98A 3WQPA 1DIEA 4XZLX 2WZMA 3VCCA 2ZWZA 2WBGA 1JQVA 3O0KA 3QQ1A 4F0MA 1VIZA 4WEVX 2VXNA 4GX8A 3EOEA 3TYAA 2Y88A 4OIFA 4FNSA 1T41A 3VKJA 5C6MA 3KRSA 4GJJA 2CHRA 1D3CA 3RK8A 4ORIA 3AZSA 4KERA 1EP2A 1DJZA 1S10A 1S5NA 2PF0A 4O8RA 1KTNA 1QCWA 3JVAA 1TJ2A 3ITLA 5T8GA 4HOZA 4B9ZA 3T07A 3MYPA 4ATLA 4B4FA 2OVLA 4BCEA 4YHEA 4KF1A 4ML4A 3WD0A 3IIZA 3GB6A 4V2XA 3HU7A 3ZLFA 3PBGA 4OHQA 3QOMA 1IR2A 4DF0A 1E9ZB 1MEIA 4E2BA 4E2VA 5E1QA 5KT3A 3PW2A 4RV8A 4OBTA 1IIHA 3T7VA 5JIWA 1W3IA 3R7MA 3OQEA 1S0NA 1T0OA 5MKGB 3SSJA 3AMLA 2GFTA 2ASHA 3RG6A 2AQOA 2H6RA 3GTFA 4MYXA 3T78A 2ZRUA 4Z1YA 1CGWA 3PUGA 4B5TA 2B7OA 4BK9A 1UWAA 3PPCA 2HBVA 2O4QA 4O15A 1J0HA 2X41A 3AS3A 2OO0A 4GNJA 5C7VA 4WOQA 7PTDA 3S83A 4DBUA 4Z0SA 1XXXA 4QAIA 2NLYA 4H01A 2F6UA 3URBA 2R1NA 4NUWA 3IGXA 5B7YA 3WL1A 1BG9A 3KBNA 4XB3A 2E4TA 3TP4A 3LLXA 5KFPA 1OINA 1E43A 1Y0EA 2VX5A 2WAGA 3CIWA 3E38A 1S39A 2H90A 4LBRA 5EBUA 3GTIA 3USZA 2QF7A 1AMKA 4KEMA 2EHHA 3FYPA 4AZHA 3TLLA 2W9CB 4J40A 3TTYA 1HKWA 3H40A 4D6FA 2GSJA 3S1VA 2DSKA 4O57A 1ZZMA 2ZX6A 2R1PA 3TKFA 4JOMA 3FYYA 3LNPA 2O9PA 4Y6GA 4IPNB 1E5JA 1G6CA 2YCEA 4F48A 2NWSA 3HPFA 2BHZA 4YTSA 3KW3A 3Q45A 4QISA 1K9EA 2DY3A 3RRXA 4LC6A 6A3HA 1X1OA 5I03A 1E51A 4H41A 3KDOA 2WB5A 1O5QA 2WSRA 1RPKA 3FA3A 5EBAA 2PGWA 1XDMA 3M0IA 1SO3A 1EJRC 2OLAA 1GHSA 4UTWC 1H41A 3KRUA 1LQAA 2V82A 2I9EA 4UTLA 3RHGA 2UBPC 1EHAA 3L4WA 1ISYA 3BJFA 1GQKA 1VZWA 4GVGA 5FEPA 5KT5A 5C9RA 5I0DA 2XGBA 3E2SA 4IIBA 1OFDA 1QU4A 1SMAA 2C7FA 1BGGA 1OF6A 1XRVA 1NFBA 1BF2A 4B5XA 1HG3A 4X0NA 1ISVA 1Z32X 3SW6A 4FS9A 4FNPA 1U83A 1F3TA 2G50A 3P6LA 2G37A 3QLLA 3RU6A 3AU6A 1PBGA 2MUCA 3LMZA 2IKJA 3H4XA 4HYVA 1QW9A 3A3HA 1XPYA 3UZYA 5E6YA 1UKQA 4HHPA 1I1WA 5DELA 1UC4A 3N12A 1IEIA 2NSXA 1EZWA 4IMDA 4LYKA 1WUFA 1V7AA 1VFSA 4JL1A 5A6JA 1KGUA 2QHAA 1OADA 3H26A 3VM7A 1ZJIA 4RNJA 2GK1B 3WBAA 3R89A 2VQUA 2WCGA 3ATZA 1Q2RA 3A5FA 2ZOXA 3ENLA 4LBUA 1WUEA 1LZOA 5FACA 4O12A 3W1XA 4IMGA 1OFEA 2A1YA 5A6KA 1CNVA 1M65A 3VNKA 3W2LA 2YW4A 4CU7A 3YPIA 2BQ3A 4ZSUA 3GO2A 2XWDA 3MKKA 2NX1A 3CASA 2VP8A 1JQXA 2BV9A 3DG3A 2V3GA 5BYWA 4K1GA 3DHPA 4H7ZA 3VMPA 3VNIA 4E3VA 4LPCA 4WJEA 3R94A 2Q6ZA 3CIXA 5I78A 1P1MA 3U3HA 4AHQA 4B9YA 5DEZA 2CNCA 3KCJA 3GGMA 4S38A 4O1BA 4CD8A 3GIKA 3GC4A 3OVGA 3A9BA 2HMCA 2Y8UA 1E6QM 3OA5A 2Y8KA 1VB9A 3RJXA 5TBOA 1HJWA 4J9RA 3SCTA 2E25A 4ZTXA 1SZNA 2BOFX 4H9UA 3TW9A 1G4SA 3E0IA 4M24A 4AWEA 4UTFA 1AG1O 4TIMA 3GXNA 2HK1A 4M6VA 3LU2A 3GU9A 3VDGA 1WZLA 1R6WA 4ZTYA 2I5GA 4O4WA 1MZRA 5HBFA 1VPXA 1LJYA 4MJ2A 1IXPA 1TREA 3VNJA 4GYPC 1ZAIA 3C3NA 4AFYA 1CLVA 4V1YA 5A6MA 2ZUUA 2F38A 3BW4A 5HNTA 2BASA 3OP2A 3LSCA 2WVVB 2GJXA 2QVHA 1PUDA 5TD4A 4J9QA 4MWAE 5KFWA 5D9NA 1I45A 4IZGA 4PCTA 3B9OA 4MDPA 2Z7KA 4NAEB 3WLRA 4WDUA 1CECA 4LGXA 2DZUA 2C1HA 4U5IA 4DNHA 4C1NB 2AOSA 1RA5A 3DUGA 1THFD 3EXTA 2GWGA 5BW6A 3GDRA 1FWDC 1Z8AA 4GKTA 2ZZ7A 4N6FA 4X2PA 3ZR5A 2V2CA 5FSDC 2D3NA 1OFBA 1ITCA 3H4BA 4NI3A 4JIIX 2OLSA 5C9ZA 3RCNA 1M53A 4IUOA 3GILA 2ACQA 4WLCA 4M81A 3PS7A 2J9XA 3C52A 4G1NA 2YL9A 1U1JA 4N9BA 1AH3A 2GQ3A 4OQVA 2J4GA 1E1FA 1TV7A 3AMDA 1CLXA 4JY8A 4TUFA 3MUCA 1UJPA 3WH8A 1Z9AA 5KFRA 4U28A 4Z08A 3AZTA 2JKEA 4H3DA 3WKZA 4FAMA 3RLVA 4RE4A 3S2MA 1UIOA 5KFKA 1S0OA 2OJPA 2CERA 4NAEA 2ATLA 3EX1A 3ZT6A 1CX9A 4AF0B 3ATYA 4PMDA 4C6IA 2P10A 4AISA 5CZJA 3PB0A 2NWRA 4U3AA 1VD6A 2WZTA 5C5YA 1BFNA 4ZZ9A 1XKYA 2IKHA 3ZFHA 1S3TC 3OYZA 5REQB 1BVNP 5FSEC 4Z1BA 5K9DA 4ZO8A 1BG4A 2E8ZA 2W62A 2AAAA 1NIUA 4JNYA 3KOYA 3PP7A 1JDCA 2J7DA 3TQ1A 4MADA 2JEGA 2BVYA 3SFWA 1FRBA 2F9RA 4NNCA 3H53A 3T8LA 4PCSA 2XM2A 3TYUA 4FB7A 3HPZA 3MHUA 5CGMA 3CM4A 2QAPA 2OH2A 3AISA 3UCCA 1E0VA 4R7OA 4US5D 4ZXLA 1XD1A 1TO3A 5KT7A 2YDQA 3MC5A 2FGLA 2DSVA 2QLYA 1ONRA 5CG7A 5B7ZA 4ZFCA 3OTRA 1LBFA 4XZHA 1B30A 5EB8A 2QF8A 2HXUA 4D6GA 3T5HA 1JXKA 1BKHA 4HZ6A 3RO8A 2JKAA 4DZAA 4PSRA 2Z6IA 1AZ1A 1EO5A 4WDTA 3TC3A 1TPDA 3W72A 2VI0A 4XV0A 3S1GA 1HL9A 3GKAA 2BY1A 4GOAA 4RUAA 4GH1A 4IMCA 1S2VA 3WLNA 3VMNA 4C7FA 1KRAC 2P8BA 3MR3A 1JCMP 1TA3B 1X6UA 4QJ1A 4WD0A 3TWBA 2Z27A 4ZQPA 2YJQA 3EA3A 1H0IA 3B05A 3EXRA 4L9XA 3T8QA 3BAJA 4EWJA 1TYGA 1ME9A 1OT1A 6REQA 1R2TA 2VM8A 2BGQA 4J7RA 3AHYA 4UQEA 4C6MA 3PPFA 1I60A 4AIOA 1ONXA 3CLWA 1WKYA 3BURA 4MTVA 3S5NA 3CYJA 2RDTA 5G4HC 2OSWA 3L2IA 3Q8RB 4Q8QA 3CB8A 5KG1A 1ECEA 4PYSA 1CGXA 1EYWA 4GYPA 3R8RA 2ZXQA 3QZ7A 4JUZA 2V2DA 1GG1A 3DZ1A 2KZHA 4C1KA 3ZIZA 3DHDA 3O05A 5D33A 1WZAA 3JRKA 3G6MA 1TX2A 4ZSTA 1RBOB 1RHCA 2H9AB 2R8IA 3TTEA 4DPPA 1HJXA 1ISZA 4ZB0A 4HB7A 1XI3A 1M03A 3SN0A 1W3JA 1W31A 3FS2A 3PFMA 3AAMA 1HKKA 5ABFA 1UZ4A 4LS1A 1K1QA 1XD0A 4REQA 4HMEA 1TV5A 4YN5A 3NG3A 1WKEA 3KTSA 3G6LA 3W7HA 3MVIA 5EWGA 2I9UA 2QT3A 4XVDA 3RUBL 4JYDA 4MOZA 5D9OA 3T0BA 3TYCA 2ZUWA 1KGXA 4P5UA 3I6RA 2V4RA 2PU0A 3LHWA 4E6MA 1V6TA 5F9NA 5SWUA 1G1YA 4LB4A 3L2MA 1XF0A 1J8VA 4DZ5A 3WD3A 1GZJA 4N7QA 4DO5A 3E5BA 1H63A 2Q3OA 1TPB1 1W8SA 3GXMA 5E09A 4BQ4A 2B7PA 3UWUA 4DWSC 2CLHA 1KCXA 2INEA 3KL0A 2FLNA 1UH2A 5KG0A 1R5YA 3F2BA 3EGJA 1TWZA 3F5JA 4Q44A 3V0UA 1OX5A 4E2DA 2RDJA 1TIWA 3E0VA 3RN6A 1TE6A 4MFDA 4HA1A 1XH1A 1YXDA 2QQ6A 1IT7A 3VOJA 4L4MA 1UWUA 4TQTA 4YVPA 2PLJA 2DT2A 3EOOA 4GMEA 3RO6A 4L9YA 1QASA 3DCPA 3AMCA 3KP0A 1ITUA 2GPTA 2WHJA 5HJLA 3L7RA 1WDSA 3AYRA 3UWQA 4BKNA 2PZ0A 2XINA 3BG3A 2FPVA 5F1VA 1E72M 4NZFA 4URIA 2ZTKA 4NI8A 1KFLA 4XD3A 1QPKA 3SUVA 3WFLA 3TC7A 5RUBA 4R9XA 2BMBA 1YPIA 4X9YA 4DJFC 4H8VA 5L1IA 4YCOA 3RIKA 4LUTA 1FHVA 4ALDA 2GK1A 3NZRA 4XZIA 1T94A 2B0MA 2WM0A 2IPGA 2BXVA 4DM2A 3VNDA 2VD8A 5G1YA 1P48A 1Z89A 4B4HA 3N4FA 3AQUA 3SQLA 3WF4A 1VEMA 2DUAA 4C91A 4JN8A 4QTGA 2F84A 2DVTA 3N6HA 1B3ZA 3CGTA 4LYRA 3LN3A 2VFFA 3M46A 5ABHA 1C8XA 2VGBA 3EX6A 5KT6A 3OGVA 2C8NA 3O3RA 3EX2A 5JVLA 1W8GA 5BROA 5U4NA 1AZ2A 1OGGA 3E0FA 3GR4A 6PTDA 1KLZA 1WO2A 4Q33A 3IWPA 4L4LA 2VX4A 4QW9A 2P50A 1W54A 3G18A 4MF4A 4LC8A 4WRHA 3WY1A 3NPVA 5AOUA 4L64A 4W5UA 1R2SA 2RDUA 4D6HA 4FOKA 4I7VA 4AD3A 1IYXA 5DMNA 3UCQA 1XH0A 2G41A 1G4EA 2V0TA 4WOZA 1UW9A 2X2YA 1C8VA 1PKNA 1DJWA 2PURA 2ABAA 2BVTA 2EXOA 3M41A 1KTCA 1S97A 3MQTA 3TJ4A 5LIWX 2GVEA 3W75A 1REQB 3VKDA 1JXJA 3QV8A 4NXKA 3OHBA 4E4FA 4HU4A 3N3MA 1XRFA 3PNZA 5DFAA 2Z1SA 4C65A 5G1MA 3MZNA 1I2PA 4DJFA 2VEPA 5K9CA 3W84A 1DQWA 5IOBA 2WNNA 2ISFA 3BGGA 4WDWA 2VTFA 2BOGX 4V27A 5DMYA 2GJPA 9CGTA 4ECSA 2IQDA 1KV5A 1M6JA 2B81A 4B15A 3G2GA 5IFPA 4FALA 2OKOA 2J24A 1K8CA 3EPGA 4M5PA 2DU2A 4UBPC 2R94A 2OLHA 3UR2A 4EX4A 2J6SA 3CAKA 2XFWA 5D2YA 5ECUA 3PW0A 3IIPA 1SJCA 3RITA 1ONWA 2E3ZA 4JKLA 2BGNE 2IBKA 1J2WA 4B3KA 2WMJA 1W9PA 2OG9A 3VKBA 2ZA3A 3LK6A 3COTA 4A3QA 1LCOA 4DF2A 1BQCA 3NYZA 3GX9A 3NPWA 4XK2A 1Q8JA 4R53A 2RH9A 1XLFA 4PSPA 1E9YB 4I9TA 1CXLA 2AQVA 1XYFA 3O9NA 1LUCB 3FSUA 1WOAA 2OPJA 1S2CA 5CAKA 3LTYA 5HUPA 4LJ3A 4CVWA 1RP9A 1BYCA 1I2RA 2WW5A 4B90A 3VKAA 5A3HA 3NQAA 4AWTA 1S3HA 5HMEA 1P0KA 2YOCA 1BSLA 3WNNA 1B3VA 2DQXA 3NFUA 4ZO9A 4TMBA 3WK1A 3THDA 4N02A 1CGVA 1ODZA 2BG5A 1TPVA 3VABA 3PTQA 2PRLA 4GZEA 3NJ3A 3P0XA 1OYAA 3ZS4A 5GPRA 3KOZA 2V3DA 1TV2A 3DDMA 3UJRA 3EWUA 3KOFA 3UFYA 1G01A 2CETA 4F9JA 1VLWA 3S9ZA 1PTGA 1L8NA 3LD5A 4WXZA 4S3KA 4RE3A 4BHYA 4PCPA 2VR5A 1GQJA 1MW3A 2WJEA 3B8TA 1KTBA 4XKYB 1JZ3A 3WLOA 3B0XA 4PMYA 3W6YA 3GAYA 1P0NA 4EF8A 3EKGA 1KM4A 3AHXA 3MKCA 2DVXA 3FV9A 4ED2A 1VR6A 5T9CE 3W22A 3DFHA 1LL6A 2R8JA 1CB7B 2X1TA 2F8QA 2VUNA 4PUWA 3S42A 4ZA0A 5CQ1A 2W4XA 1Y65A 1DP0A 1SJBA 1WNOA 3WJXA 4HZMA 3KAOA 2IA6A 2CU0A 2XZ9A 3M0LA 1JYXA 2XN0A 4WKAA 1TA3A 1PXGA 4FOJA 3B0YA 3C8FA 1UR0A 3UWWA 3TFCA 1WXYA 3N3TA 1OK6A 3N29A 4DLMA 3AUJA 2WV8A 4EPBC 3UYCA 5DRIA 1XX1A 1TWIA 4OV9A 4CD7A 1M7OA 1B90A 1WCGA 3FSTA 3WFZA 3B0UX 1EHNA 5I23A 4GABA 2XWEA 3UNTA 1JUEA 1HVXA 3CQHA 4FP1A 3LM7A 1VQTA 3S5OA 5DMMA 4RZ4A 3W7LA 2PDHA 1DIKA 4IPLA 4IF2A 1BRLB 3OVRA 4ACYA 1YNPA 4EBDA 2NXGA 4ROQA 1KM1A 1AQMA 2YCKX 2XTKA 4N9DA 1HJUA 1ZL1A 3UWVA 4LUIA 1VCGA 3CO4A 4UB9A 3K4WA 4PN2A 2WHLA 4GE8A 4EXBA 4ATWA 3HGOA 1Q4WA 1VFLA 1FWCC 1XIFA 5D38A 3PVXA 4S3JA 3R0KA 4ZL1A 1YTDA 3CH9A 3MB9A 4NAFB 1WDWA 2XDFA 4JD4A 3P7YA 1BXBA 3QW4B 3GXPA 3MUZ1 3NZ1A 4QBXA 4XO6A 3V7PA 3C2YA 2PGRA 1GEHA 4Q8UA 4CD4A 5LHEA 1TR1A 3EDFA 1LDCA 3MSYA 3RXZA 3MS8A 5AHNA 4AZIA 1LLZA 4HNVA 3QGAC 4O3SA 1QWKA 4XAYA 1YPXA 1MXDA 1GVQA 2DW7A 4O0ZA 2PI6A 5BOEA 4X0VA 4QLLA 1E4MM 1YPFA 1UC5A 2ALZA 2G3FA 4QGCA 3AI0A 4MNKA 4PMNA 3GNPA 4GG9A 5L1LA 1TQXA 2ZZ2A 2XIBA 4TU1A 5DLCA 2VFDA 4IGMA 3SRFA 3M0XA 2Q3RA 4B16A 1PZ0A 4RK8A 3MCMA 1DIOA 3GZAA 3ARRA 3HG5A 4QM1A 2X05A 1S9FA 4F50A 2XVNA 2D1ZA 4KMQA 2POTA 2ZUVA 1AQ0A 2AQWA 3EPNA 3W70A 3QQ0A 5KSWA 4GIYA 4UQ9A 2FPYA 3I6EA 1PS9A 4PE8A 2A3EA 2RJHA 4UFKA 1W5MA 2DDXA 1WDDA 3WH6A 1EBHA 4QNWA 3TN5A 3PFRA 5CZ0A 4FR6A 4HNOA 3BARA 1W5PA 3UY7A 4HPHA 4IHCA 4IGNA 3SDOA 1DEDA 2CYGA 3H4GA 1O95A 2I57A 4EP8C 1KR1A 2C1IA 2I7GA 2OU4A 3OSNA 4AEOA 2NQJA 3R5EA 1JUKA 1E4IA 2JBMA 3ME3A 3U2CA 2ZE3A 3W0KA 4TQRA 4RUCA 1B9BA 4JTSA 4QITA 4LRTA 4UQAA 2V5BA 5E0KA 3WH7A 3QKEA 4F4YA 2NUYA 1NOUA 1QAPA 1DJNA 2UVWA 3OGRA 1JR1A 4KGJA 1UMYA 1IZJA 1R3TA 1M3UA 2P53A 4ATDA 4UQBA 3UETA 2WMIA 1F6YA 4KCUA 4OZOA 3MMUA 3RX4A 2Y6ZA 1W1YA 1IWBA 2QGYA 4HYWA 3WQ8A 2PCEA 3N25A 1V4YA 3TE9A 1QR7A 3A22A 3M9OB 4AY1A 3IRDA 3RYSA 3ZWTA 1C8YA 3OPSA 1UR9A 2E9LA 2ZICA 3H2AA 3AUOA 3CL7A 3UNDA 3DGBA 4YNGA 2Z1KA 3BOXA 4W8LA 3MO4A 3R11A 4N42A 3TH6A 5T91A 1T7LA 2VZTA 4NQ1A 5JBFA 4JICA 3V0SA 1PCKA 1OC5A 4C6EA 2FJUB 1F07A 1DKWA 3KHGA 3RAXA 4QSHA 1O5KA 4M29A 3EMZA 1KCLA 4PRWA 3ERPA 4FK9A 5AHEA 3PW5A 2XN1A 3VIJA 4GVIA 4MJ4A 4AEEA 1OZQA 3GUWA 5XIAA 4FPSA 4H8HA 4PMXA 5KITA 2EPHA 4F4ZA 4Q4OA 1S1RA 4FS2A 1XC4A 1HKJA 3BE7A 3ZO9A 4C1NA 4H4IA 2R1MA 3FFSA 4D6JA 3LCGA 1N56A 5DCBA 2Y63A 3BOLA 2X0YA 2W7PA 5IFTA 3MW7A 1OCBA 3NM3A 3VD7A 3OSPA 4HGXA 4U10A 1E1CA 1HKIA 1CGUA 2KX9A 4NRRA 5I06A 4QRNA 5F2GA 1UR2A 2E68A 3L4ZA 2O9OA 1A5LC 4X2RA 1PYMA 2ATMA 4FMVA 4R85A 4UOJA 2BLEA 4Y96A 3O06A 4Z2GA 5K7JA 4AQLA 3L0NA 4GH3A 4DO4A 3ZZ1A 2VOMA 5CJ5A 4ZENA 2QJHA 1ISWA 3CB3A 1KO0A 5I09A 1TJPA 3W7RA 5TQLA 1OX4B 5G1TA 2VZSA 3K2GA 4CNOA 3KOWA 1REQA 1UR1A 3RM8A 4Q8WA 2YYTA 5JBDA 3MBDA 1UCWA 3QZ8A 4Z2KA 4HZ7A 5C2CA 4WR3A 1RQBA 2DEPA 1V77A 2I56A 2VUYA 7XIMA 4FX7A 1VYPX 3VD4A 1YDOA 3WUEA 4GIRA 4LRSA 1XG4A 3QEZA 4X60A 4HSNA 1WDPA 2GQAA 3OBAA 2TMDA 2AL2B 2E77A 4OUIA 4KRZA 2QPUA 4NZ5A 4O1CA 4KRTA 1TMHA 2CBJA 3ONCA 1HGWA 4AD0A 1F3WA 1BHGA 2G3NA 4Q32A 1UQYA 2V5CA 3NDYA 4GISA 1F73A 2VR4A 1N8FA 1JDEA 1F8IA 5BNKA 3I3BA 5EDWA 2VVNA 4TMCA 4E4PA 2NQHA 3TQKA 1Q6CA 1V79A 3G1AA 1XSJA 3BTNA 3STFA 2F2HA 1R86A 4PMRA 3GFYA 1NWSA 5CJNA 4UNIA 2BB0A 3T2OA 3W7QA 4ACZB 4QJ5B 2QCLA 4M8UA 1J0JA 2ON3A 4DBDA 4RE0A 3K30A 5HINA 1GNXA 4R88A 3AJXA 2VC7A 2SFPA 2G4FA 4J3ZA 1TE1A 4JQ4A 5DXYA 3POHA 3CHDA 3RM4A 1K8XA 3KBMA 4FEZA 2XGPA 4HCLA 1EEXA 4ZQNA 2V3FA 1KBBA 3T4CA 5G2IA 3LCIA 1OYBA 2PTZA 5IHSA 4GY1A 1JD9A 2VENA 1MUCA 2E0PA 4GUFA 4Y7EA 1VYSX 1UHVA 1RJRA 2R8HA 4TO8A 3OODA 4CQ8A 3BZGA 2JEPA 3LEPA 1J79A 1Q8AA 4RXFA 4GA8A 2YL8A 2A21A 3WF2A 1B5TA 1E9IA 3WEMA 4V1XA 3GIQA 3T81A 1KW1A 3MMTA 3VGEA 4E38A 5A8OA 3AS2A 1KM0A 4KCWA 3CPRA 4CQDA 1PZ3A 1BRLA 3WLQA 1FH8A 1MVYA 4NT0A 3EWYA 3WFAA 3CL6A 2QDDA 3H6OA 4PMVA 1EZ2A 4DBWA 5HXMA 4HZ8A 1V08A 4U31A 2XVLA 3NQ2A 2X09A 4AWUA 1SO4A 4AG0A 7CGTA 3WNLA 3H22A 1J9YA 3QKZA 1GVFA 4H6EA 3S5YA 5I79A 5BMWA 2MANA 2WKGA 1Q2SA 2OQYA 1DWIM 3NZPA 3QPYA 4XKMA 4IFRA 2YB1A 3L5AA 3R6IA 3DBPA 2ABBA 3HGJA 2G97A 3LOTA 1MXGA 1QI4A 1JYNA 3WYZA 4Y9OA 3WJYA 4CN6A 2XH7A 4KFNA 1S5WA 1EXPA 4KETA 2VX6A 3GV5B 2DSUA 5FJOA 3T0AA 1JG9A 2UV8G 5AHMA 3BVJA 3EKLA 3TN3A 1H5YA 1NU5A 3GVQA 2O56A 4WSKA 3O1NA 3NURA 3QHMA 3PJWA 3BK0A 1UKTA 1DQXA 3SIMA 2OELA 2FIQA 1Y8BA 2J8TA 1N8IA 2Q02A 1H51A 4AZCB 4S23A 2L5HA 2NT0A 1H7XA 3MR2A 1C9WA 4A4AA 3E2VA 1BYBA 2VD9A 4IP7A 1A80A 3WJWA 2IUZA 5KFQA 3W38A 3O7UA 1KFEA 5GNXA 3K5XA 2IXVA 3AALA 5A8MA 3LB0A 1EO7A 2OMAA 3XISA 2PDBA 1YKWA 4JX5A 3UEQA 3BSHA 3NL6A 4P8VA 3W25A 1FWRA 2QUUA 2QUNA 1E6RA 3PB2A 3R2GA 5C2GA 3PZTA 1XW8A 3CHCA 2XIQA 5CLWA 3CHVA 4GQ0A 4PFHA 2CHNA 1T8QA 4DXXA 2V63A 3CO8A 1TTIA 4LAKA 1EC7A 2OGYA 5BRQA 4M3PA 2QMJA 2W66A 1YIXA 3W82A 1DWJM 5LIXX 3P93A 4PCNA 2W63A 4J9KA 4NJGA 5LA2A 3MSDA 1RH9A 3HMJG 2R8GA 1YLVA 1ZBWA 4IQDA 3DN5A 4MFEA 1Q13A 2XZ7A 3WLIA 3AWNA 3N9RA 5G5IA 3OLIA 2DZVA 3SI9A 5HNNA 2VDHA 3EOLA 3L2LA 1EUNA 3SCQA 5KFVA 2WPGA 3N2CA 4H7VA 4M0XA 2YW3A 4R34A 1ICPA 3BV4A 4TVCA 3BJTA 1KC7A 1W2PA 3KZSA 4A3UA 3N4AA 2HVNA 4LV9A 1R9YA 1XG3A 2XG9A 2WZEA 2FQIA 3OU8A 1J2BA 4ZOCA 4O1DA 2OZ0A 1K1SA 1KFKA 3FVMA 3N2XA 3F4DA 2CWXA 3AIVA 1JNEA 5H2ZA 1QNRA 2X40A 2HVMA 2CZVA 3NA8A 3EDKA 3LBMA 1GPFA 4MKVA 1DE5A 1V3IA 3QH2A 3S1WA 2OYLA 4ED1A 1LLWA 3PHAA 3T44A 3IGUA 4TX6A 2ZXAA 1TR9A 1SFSA 5JU6A 4HNNA 3BAIA 3VKKA 4C6KA 4JV2A 2CHOA 1MW1A 4ZR8A 5KZMA 4YTUA 3E02A 4DJED 1OVDA 3ARZA 1WE5A 5KFDA 3GNXA 4UTKA 3KL3A 1O1HA 3UWYA 2Z4GA 1BGAA 1JPMA 3NQ8A 1XIMA 3VA8A 2FH6A 3RMJA 4IIDA 1JRCA 3VIMA 3OB8A 2AKMA 1A5CA 3VIPA 1GKRA 1W3LA 3H23A 2YIHA 4ENLA 4DL5A 3U0HA 2XIMA 4U3CA 3RX2A 3FXYA 3JZEA 3V5OA 3ARSA 1IEQA 1FKXA 3HTWA 4EF9A 1E70M 2W3ZA 1ZP3A 1H4PA 3TQPA 3WD4A 4HQVA 5XIMA 1WAUA 1CPUA 2DQWA 2ZVIA 2CLEA 2E8YA 4J4KA 4P8XA 3UG8A 5JH2A 4ED0A 1JCNA 1S2WA 4TX8A 2YDRA 4YTQA 2Y5JA 2W0UA 4B91A 4QWAA 3VNZA 2GWNA 2I5IA 2DH3A 3CIVA 1IT0A 1VPQA 3PPHA 3PW4A 2G95A 4S39A 3MZ2A 4R9OA 1AJZA 3SJ3A 5CSYA 1IGSA 3NGJA 2O4MA 2X2GA 1RYSA 1S2AA 1N48A 4O52A 2QEZA 1GG0A 4N0RA 4IXHA 2VRKA 3DYMA 2PGEA 3W7DA 3L21A 4F79A 3TN4A 2W6RA 5M17A 4EK7A 1HTIA 2NV1A 2IMRA 3CMGA 1V0MA 3WG6A 2NT1A 4JIPA 3TDFA 1XYLA 2XFRA 1VCFA 1JZ6A 3QSRA 4AC7C 2DV0A 5E6ZA 1V03A 3LXCA 4EBEA 1PIIA 4LBSA 3U48A 4UMAA 3RMEA 2BR0A 4YTRA 1D3GA 3H7UA 4GQGA 3D5HA 1W3KA 4LCSA 3G1VA 5A95A 4XKYA 1DWFM 1RJQA 1TWSA 3VGDA 4TOQA 5DY3A 4ACZA 3K8MA 2HV5A 3V1PA 4FLOA 5C8BB 4DEZA 5AECA 1HN1A 2GVYA 2V68A 3AXHA 2RFGA 1CXHA 2BHUA 4JN7A 3RX3A 3WDHA 5EGRA 1J96A 3WZ0E 4HMCA 5ABGA 3KRBA 1Q66A 2D24A 3WLJA 1LOSA 2A85A 3FHAA 4JV0A 2G3IA 1QFEA 3LM3A 1PIGA 4RDYA 4G3IA 3HF3A 2FVMA 1Q6FA 3ZWSA 3PUDA 2YZ5A 3LZ5A 3RAOA 4NZ4A 1IIGA 3LPOA 3TYDA 4PRTA 3Q2DA 5D2VA 1JI2A 4JTUA 1P1XA 1T8XA 1K70A 3G6YA 1AD1A 3MVTA 4WSJA 2VT0A 4UZSA 4PRRA 1V8EA 3Q67A 4XAFA 4QJ4B 1Y5VA 3CU2A 3CYVA 4I8YA 1E56A 1RR2A 1P0EA 3IUHA 1MYRA 3CZGA 3UG4A 1MMFA 2GYIA 4O0KA 1MXSA 1KFCA 5GNZA 4CQAA 4DF1A 4MKNA 1L6SA 2PDJA 3PY2A 5I7GA 3ZT5A 4ILSA 1UD6A 2GVGA 2BODX 4A2SA 3GG8A 3AIUA 3BOFA 2ACRA 3DFQA 3T42A 4K8EA 4ZFMA 3ITOA 2XVPA 4ERAA 3FK4A 2NUWA 4Q8FA 2AQ4A 3LCFA 4I5UA 1US0A 4D1JA 1Q6LA 3EYPA 3F4CA 1BSIA 3PR2A 2VEMA 4MSSA 3SY1A 1EPVA 1FOBA 1XKJA 3UESA 5C2XA 3S2NA 2PDGA 1W9XA 3G5EA 3ZVHA 5IRPA 5FAGA 3D6NA 1NAL1 1SVDA 2G4JA 2VGFA 2NXIA 3GNRA 2Y7EA 4XAPA 1JL8A 4FLRA 3WO8A 3VGHA 1VFOA 4GO8A 1TPEA 3G1HA 4YP3A 3GY1A 2X0HA 2O92A 3C0LA 1VFFA 5D2WA 4JTAA 2ALRA 4S2CA 3RNDA 4AHOA 4F0KA 1JPKA 3VCNA 1HKVA 1HVQA 1IXOA 3C6CA 3GFXA 3KCLA 5KFAA 1FP9A 5EWEA 1VAHA 2J75A 4GVHA 5FIPA 4AZCA 5KFTA 3BL3A 2Z1VA 1E9LA 3BLOA 1TRDA 2EPNA 3IRSA 2JALA 4AZGA 1PIFA 3WEZA 2W7OA 4GIEA 2XGIA 1I1XA 3W86A 1TJRA 3BLFA 1BYDA 5LIUX 4LY4A 2J6UA 3AYTA 5CC3A 4KEUA 4LVDA 3ZMRA 1E6XM 3B97A 2NV9A 4CLMA 4F2TA 2WANA 3N2OA 4YIWA 2FFIA 2W92A 3A23A 3PBUA 5FI8A 2PD5A 3QW3A 2VNCA 5CJMA 3EPMA 1EDTA 4BJHA 2VQTA 3SCUA 3H2OA 4DJDA 2UWFA 4E0CA 5I3FA 4Q6XA 3NQVA 2FDMA 3KHLA 1U33A 4U4MA 3W1TA 1LG2A 3M16A 3IGSA 4CCCA 1EJSC 3CMFA 2XHYA 4RV3A 3U7BA 4W8BA 1AH0A 3THQA 4R8UB 3WQDA 1R85A 4UNKA 4G6CA 2RJGA 3PZUA 3HA1A 3PZIA 2QNEA 3QR3A 3UPMA 3TLQA 1YTEA 2PC4A 2ADAA 1BXNA 1GJPA 1W1A1 4FOUA 1QK2A 2PLKA 2Q8XA 2DUXA 4GXMA 3BZJA 3B9EA 4XTDA 2DVUA 3SR7A 1RPXA 4E5TA 3L9CA 4QNEA 1PHQA 4D71A 3TSBA 4R5EA 1V93A 5D30A 4WX2A 1AW5A 3EWCA 3L5MA 2WVTA 2QCDA 1IXNA 4DZHA 2NW0A 1OG6A 3WF0A 4LS2A 3TNOA 2DSWA 4FS1A 3PZQA 4RU9A 3VO0A 2V9WA 1VFHA 3B8IA 5FJIA 3RPTA 3G1YA 3WMLA 2FLIA 2ZIDA 1DWAM 3ZJ7A 4ZE4A 4QR6A 3ARXA 5CPSA 4OKDA 4HP5A 4JFUA 1OK4A 3OOQA 1K02A 1DJHA 3UJEA 1R0MA 2GL5A 1IQ8A 1LP6A 4FF5A 4GC7A 3C2EA 4JTDA 2CWNA 1XINA 3OA3A 2C22A 3GW3A 4AHPA 4MY1A 1QUMA 9XIAA 3CZLA 4OWGA 5DCDA 3SCNA 1JJKA 3BC9A 4GUIA 1F4HA 2CXGA 1RJPA 3GAKA 3TV8A 5I3JA 1QT1A 2XISA 3CAWA 3DI0A 3A4AA 3WF1A 3GXIA 1BEUA 1E3ZA 5E70A 1QNQA 1MQRA 3KLLA 3A3XA 4B5VA 3N9SA 4O1AA 5CEWA 2A4AA 1W1B1 1GW9A 1RK6A 3QBUA 1IGWA 4MWAD 1QXLA 1OGBA 3O8AA 4H9YA 3M0VA 2AGPA 4Q7BA 1XPGA 5IDIA 5BU9A 1NTHA 4C6PA 5CC6A 3OEXA 3IS4A 4W88A 1FCUA 3EOSA 2VWSA 1RV8A 1EGMA 3LI0A 1CXIA 1POKA 5FF4A 4U7CA 3QYSA 4GFSA 2P88A 1D7FA 1PEZA 1LTDA 3N34A 4ASTA 5EWFA 3EB3A 2CESA 1DYSA 2P0IA 3ES8A 1RXOB 3EWBX 3WMSA 1PX4A 1VFTA 1VBUA 1SJAA 1H60A 3LPFA 1O60A 3CZKA 1HFBA 1EQPA 3URAA 2E9BA 2NX9A 4ZMGA 4KFOA 1J6PA 1JI1A 3SY5A 4A35A 4QCEA 4J9PA 4S3BA 3G0XA 1KFJA 3VMOA 2DH2A 3LRKA 4DL2A 3R12A 1EGVA 2J79A 1A5SA 3RLUA 1L6FA 2QKFA 5KFHA 1KM3A 1LT8A 4AVNA 1G7VA 4UC5A 4XG1A 4M56A 2FVKA 3NO3A 4ONVA 3PZNA 2J77A 4JIQA 5J5RA 2RDIA 4FO4A 5D09A 3L0KA 3TOYA 4JTHA 1HO1A 4E8CA 1B9ZA 1OBAA 1R2RA 2VGGA 4NP7A 1NF7A 1QWGA 3TTQA 1Q7MA 2PE4A 3F5KA 4RW3A 3AHVA 3M5YA 4YPJA 4LVFA 4N2YA 2X0SA 3GVVA 4WZHA 3ARTA 4E8GA 4J9JA 3ABXA 5K4XA 1JEZA 3UYIA 3F4VA 1IWPA 2EAWA 3TYBA 3L4XA 4MM1A 1OZMA 4RXGA 8TIMA 2JK2A 3EX3A 1Q6QA 2J8GA 1QI5A 3PUOA 2J6TA 3R13A 4QWBA 1K7FA 2C14A 4DI8A 2WTFA 3VDHA 1P7TB 3WF3A 4DLFA 4F40A 5A6TC 1LOLA 1H2JA 2PTWA 1TV3A 3MSGA 1AQFA 3CXOA 4L5ZA 2P8CA 1N2VA 1IEVA 1JPDX 4NYYA 4N4QA 4Z2IA 4UTUA 4ZVJA 4IRCA 1HUVA 1QBBA 2A0NA 3CAVA 2EQDA 1LLOA 4K8GA 3I68A 2FZDA 2D20A 5HR7A 3QR0A 1A5UA 2AL1A 3S6TA 4GQBA 2Y62A 3LI1A 4IFKB 1PX8A 3UVAA 1XGZA 3IJIA 4C6OA 2OWXA 2ZRVA 2QCHA 4WCJA 1RAKA 2PTYA 2YA0A 4YWIA 3FLUA 2YYUA 3W76A 4JPGA 1DHPA 1W32A 3DXIA 1NOWA 4LYPA 4ZOEA 3RFAA 2W27A 3NL2A 4GLEA 5C55A 1EX5A 3ARPA 2A3LA 2WNWA 2IPFA 5CLTA 2DT0A 4Z2HA 1XYMA 2PRHA 3VIHA 1TQJA 4PMZA 3PF3A 1TCDA 2VA2A 5CSRA 1E73M 4NAFA 3BCFA 3ARQA 3IUDA 3T9PA 2PCQA 6ALDA 3HOJA 3H55A 3S1XA 4NZ1A 4U2YA 3N14A 5LIYX 4HTYA 3JU2A 1I0DA 2FHBA 4IFKA 3TUUA 1RVKA 2WSKA 1UOZA 1OY0A 4IXXA 4YHGA 4ES4A 1X39A 2ZBTA 3CQ0A 3PSWA 1AMYA 3CUXA 3OQ8A 4LCRA 2VC6A 3BSGA 3XIMA 4RJEA 1QBAA 1D8WA 3T09A 2G3MA 4ECVA 3GIMA 4UTTC 4H6QA 4AZ5A 3VKCA 2EPLX 2JGQA 4UNLA 5PTDA 3P5YA 3WDIA 4NJJA 3BJSA 2UY2A 1K8YA 4JFSA 1F05A 3OHMB 4UTHA 5ECVA 1XHGA 2ZRYA 3ARYA 1FFRA 3QF0A 4LVBA 2HNHA 3S3GA 1TTQA 3CUGA 4F2UA 3P60A 4NXSA 3BO9A 3S1UA 4I7UA 3LS9A 2WM1A 3AC0A 3CLMA 3QLDA 2C19A 1CEOA 3P80A 2VCCA 2PB1A 2WOQA 3W53A 2WSQA 2VA3A 3P82A 4S3FA 1UKOA 2A3AA 5DCEA 3JS3A 2Y5EA 3P74A 4JTFA 4DYEA 5AVHA 5HMDA 2ZX5A 5KFLA 1XLKA 5E93A 2IXUA 2NSOA 3SCOA 4AW7A 3DECA 3VD9A 5HMFA 1XLHA 3NR0A 4JBRA 1AUSL 1GQIA 4HNTA 5HNUA 3R58A 3AIEA 5KEZA 4S3EA 3BQ5A 3GHRA 2GDQA 3OHIA 3W87A 3SCWA 1BQGA 3P81A 3UQNA 3EA2A 3VU2A 4H9MA 3M5XA 5TNVA 5AC8A 4Z1AA 3STGA 1CDGA 2G5WA 2PRMA 2PWFA 1YDNA 4JYEA 2DZAA 3IGHX 1O6IA 3TU9A 2XIOA 3Q8QB 3QRHA 3W85A 5M1TA 2HZGA 3CNYA 1MO0A 2BVWA 4LTSA 4UOZA 3N17A 3EPIA 1R3WA 4TV6A 5CBBA 4U33A 5CPNA 3WNKA 4Y9NA 3W1MA 1ZENA 3STCA 5C5JA 4B2DD 3ITYA 3QFWA 1KFBA 3MP4A 1UR8A 5KZEA 4O10A 3TA6A 5KFEA 2J47A 4H1ZA 5AC7A 2X8RA 3W1QA 4ED8A 3VVGA 3QV6A 3FEQA 2TRSA 3II1A 2X30A 2C18A 3EMQA 1H0GA 1CGTA 1PKYA 2VFIA 6TAAA 1V3LA 3QZ6A 5FJTA 2ZZ1A 3LHYA 1K6WA 2PAJA 3DFPA 3VUSA 3RR1A 5C7HA 4J9LA 4YR3A 3E0LA 1J5TA 1XC6A 4M1RA 4MLJA 1SUXA 4A3RA 2ASJA 1MW0A 3VOGA 2HROA 2XYLA 3KL5A 1GOMA 4G8TA 4IR9A 3FOKA 4S2BA 4MWAA 1U1UA 3W74A 1FWSA 4PMOA 3OJGA 2OOFA 2EGZA 1FDZA 1NF0A 4AEFA 2PDMA 4CN1A 4IL0A 5FJUA 4KWWA 4I90A 3TQVA 2PLMA 1IV8A 2OQHA 3W7CA 4D72A 1EXBA 1I0BA 3H7RA 3W6MA 3L5LA 1G7UA 5HATA 3VIFA 2ZXDA 3TWAA 1EA0A 2BDQA 3C0JA 1MDLA 1DQUA 2CC0A 4ZE5A 2GQ8A 2PWDA 2RUSA 3MI2A 4PB5A 4DO7A 4ZO7A 3GG1A 4XUGA 1ZPTA 3BLPX 2EPMX 4ZOBA 2XU2A 4XD4A 2DZWA 3GFZA 2FZNA 4PH6A 1EF2A 1QPOA 3B4YA 3GSMA 1C91A 2P0OA 5I77A 3VUPA 1CI1A 3WNOA 3WUGA 1SW7A 4P8WA 4GNKB 2GGEA 3AOFA 3NQ7A 4DM1A 2HS8A 3LUTA 4GUJA 1HF6A 1ENUA 2BSLA 1VGAA 2ODOA 2P1FA 5DBUA 2RGMA 3LGEA 1GOWA 3WQEA 1VS1A 1WZMA 4PL1A 1EUAA 7ODCA 2ZQ0A 1P6WA 1UR4A 4I5XA 1ADDA 4MMWA 5HPCA 1PWMA 5IBXA 4JKKA 3NCOA 3N18A 3UZJA 1GEQA 1MDRA 3P67A 6CGTA 3ZT7A 1TCMA 4Q8VA 1NJJA 2GSEA 1LYXA 2Z6JA 1RQEA 3S5SA 4IGSA 3G77A 3G0SA 5GQBA 3FKKA 1ESWA 4G1KA 5DQHA 4ZQRA 3QTPA 4BR1A 3LHTA 1OCJA 3GTXA 3QPEA 2QUMA 3VZYA 5HULA 2UY5A 1R87A 3KUMA 1EA9C 4Q7IA 1EJXC 2WHKA 3IN5A 3MP3A 3W37A 4MUZA 1XLDA 4EYHB 2PDCA 1Z42A 5DG7A 4ADTA 2PWHA 3L65A 2D0FA 4WY0F 1ZQ5A 4F4WA 4D9PA 1WP6A 3IK2A 2XFYA 2W8LA 4IWWA 3GR7A 3VINA 2Z29A 4GX9A 4LEFA 3TOPA 3M07A 3GXFA 8XIAA 3VFLA 1SZRA 5E9XA 4BWLC 3GKFA 4CEXC 3QJAA 1J0ZA 2TSYA 1NWUA 4JIRA 3D46A 3GRIA 4IISA 1R3YA 3W23A 4ERIA 3CUIA 2QV4A 1OHLA 3GC5A 3PAJA 3OIXA 3IUIA 4DL6A 2PF8A 1E55A 1TVLA 5G2HA 2PA6A 5A6BD 3AXMA 1KBLA 2Z25A 4LANA 3CTLA 4JTKA 4E8DA 4PR4A 4IPPA 3NPXA 4ECTA 4GACA 1RCXB 4HVXA 1ZUAX 3GV7B 1KLYA 4J9SA 3RU8X 4XWUA 3W88A 3K8KA 1GCYA 4O11A 3M9NB 5HWNA 1GQNA 2HE8A 5H6HA 4Q8PA 2CXEA 2VFEA 5I2UA 2QPXA 2WKLA 3VOFA 4UIOA 5FL0A 4IOTA 1XLCA 3INPA 5HANA 3A6OA 1C90A 2C16A 2YCJA 3ELFA 1Q6DA 4A22A 2Z1BA 3W9ZA 4QEHA 3W1NA 3DOPA 2ZX7A 3MANA 3SZ8A 3GXDA 5EL1A 3LENA 2WWCA 4F66A 5HPOA 1WAWA 1J0YA 4NX0A 3ZXWA 3AMKA 1TMLA 4G56A 1BWVA 5EMJA 3JUGA 5HWMA 3GM8A 1JVNA 1GK8A 2Z2UA 4OTKA 2BVDA 2CKRA 1J10A 5KZDA 3DC8A 3FJ4A 5M03A 3AHZA 1XICA 4EAMA 1N7KA 1U2YA 3IARA 5E0FA 1IR1A 3IANA 1FQ0A 3KVJA 2XPKA 3IJ8A 5AYXA 1A5KC 3W1UA 7TIMA 5HNRA 3REQB 3M5ZA 3V3WA 2WK2A 2BQRA 2YR1A 5C71A 2OSYA 2BY0A 1Z7AA 4F8XA 7REQB 3ZVHB 4GIAA 1XJBA 3TXZA 4PTVA 5M3WA 2CLFA 1A0CA 3QMRA 3L4VA 1TB3A 5GVJA 4QDPA 4H2CA 3DESA 3PBVA 5F2LA 4QX4A 3P5ZA 3U8GA 1M7PA 3LV6A 2D0HA 3CUJA 3E5PA 3HV9A 3BAWA 3AYSA 3O6AA 4C6BA 3UCDA 1JYVA 3BLDA 2VURA 4F0LA 1UD8A 3RBEA 1VFUA 2HISA 1NY1A 2D3LA 5FEZA 1RK5A 3G1DA 3UP8A 4PMJA 4ZODA 3W7GA 1HJVA 3LYEA 1EL3A 3STPA 1OYCA 2E5CA 3PBYA 4L9ZA 4QJ3B 4LCQA 4O3PA 1XLAA 1V3HA 3N4EA 1J12A 2DFAA 3SIZA 2H8ZA 4C6DA 5DQPA 2C2RA 1AQHA 1T5AA 2A6LA 1KKOA 2OYKA 2CITA 3DEQA 4G5DA 1ZRQA 1SSDA 1XIIA 4PEKA 1LROA 4HYRA 2PWVA 3SEPA 4GCXA 4PTDA 1NVMA 4FX8A 2PDLA 5CXPA 1TMQA 4UR7A 3TTOA 3UZ5A 2Y1HA 3CC1A 1LRQA 3LCXA 3N13A 2ZC8A 5AKQA 1WBJA 4O1FA 2X1IA 1F6KA 1G4TA 3B4UA 2Y85A 4MPKA 4R8UA 3LX9A 3GTNA 5A5WA 3U2OA 3QM3A 4RX0A 2V38A 5DQGA 4JN6A 1ZAHA 2QPSA 4UR9A 1QMLA 5KFMA 3HGRA 2VC9A 3M9YA 3QTGA 1E0TA 3W2KA 1B31A 4MZYA 2WCSA 3EAUA 1GOKA 3S4TA 2HTMA 1VYRA 3SADA 1Q3NA 1F4AA 4FLQA 4FSAA 2WWDA 3SRKA 1KM6A 1DL3A 3STEA 4PB3A 4O3OA 2ZXBA 1RCQA 3TR9A 3NSMA 2J74A 1FWJC 3HN3A 3IJDA 4LEQA 5LA0A 2OOGA 4PUDA 4K38A 2A79A 5HQEA 4DBSA 3E74A 4RNIA 3LY0A 3GYCA 3VAVA 4Q8MA 2FZ9A 5KETA 1W3NA 2V69A 1E4NA 2JIEA 2O7SA 5I24A 3BQ2A 3MT1A 2OO6A 1W5NA 3QVQA 3QYQA 4KCTA 4AVFA 5HR6A 4V15A 2CZFA 3UY8A 5JBEA 5AVNA 1XLBA 2FZMA 4XIAA 1MSSA 1P4CA 4GBUA 4H8NA 3C5QA 5CGQA 1F3EA 3SGZA 1KD0A 4O17A 4G7EA 5KG2A 3C0QA 1UH3A 4J27A 2VYOA 3VD5A 3VFCA 3BAXA 2PUZA 1MW2A 4QROA 2XH2A 1MNSA 5BXRA 4YR2A 1UPPA 4BI6A 5AB3A 1XYBA 1KKRA 3S0CA 4AXKA 1WXJA 2I5QA 3R4IA 2XGQA 1JCTA 5D04C 1ZBVA 4JTTA 4O28A 4BQ5A 3H2FA 3SN4A 3EWZA 4WJ8A 3GK0A 3VC6A 1WA3A 3A13A 3M64A 3WLSA 1ZBKA 3GNDA 4LT9A 3MBFA 4RNNA 3TW7A 2OYMA 4AX7A 5E5CA 5LA1A 3NQCA 2GJRA 2OX1A 1ZBCA 4R27A 1W3TA 1LL7A 5BCAA 4XZNX 1PDYA 4R3UA 1WDQA 4LS0A 1F8MA 2INFA 2DSZA 4DUOA 1VIWA 3KVKA 3MV01 4CQBA 3H2CA 1QI0A 1Q6OA 3W7NA 1AL8A 1OSEA 3ALFA 5I3GA 3THCA 1BWKA 2CIPA 1I75A 2Q8ZA 3W2JA 4LV4A 2OSXA 1MFVA 3Q4DA 1E1CB 2YCIX 3DFNA 4HKPA 3W83A 1A5OC 2OZ8A 3DI1A 4YTTA 1PSCA 1US3A 5DN1A 3N04A 3E49A 4GY0A 3PBMA 4AZBA 3QPZA 4NL1A 1M04A 3Q8PB 4UTJA 1XR2A 2YBUA 2PDFA 1TKKA 3SCPA 3A4WA 1B3OA 4PTMA 4MPQA 5DRCA 2FH8A 3UA4A 1MRQA 4US5A 4NNAA 1W5QA 2OZ3A 4BI5A 3GUGA 4RNMA 3FEMA 1VH7A 1D9EA 3UJFA 3QV9A 3QFEA 1BXCA 5K3VA 3MWAA 3CQKA 3O6YX 1FWTA 2PSNA 4US6A 3W1AA 1CENA 2O9TA 2YZRA 1S5MA 4LY8A 3S5ZA 1T99A 3V5FA 4D6EA 4TV5A 1R46A 3SBFA 2EPKX 4YYFA 4HN8A 1SW0A 4C7GA 3MHGA 2VZOA 1YE4A 4ZEPA 2ZA2A 2Y2WA 3MCNA 3AZRA 2YFOA 3VX0A 5D02A 1ONEA 4JIEA 4LOCA 4AD1A 4ZB5A 3BSMA 3M6YA 3LXAA 1UIPA 2PGFA 1G0CA 1SM9A 3RB6A 3ZSSA 4HNLA 1UWRA 1HL2A 1P7TA 5T14A 4WGHA 4GUHA 4TTGA 4HU0A 1FXQA 5L9XA 2QJMA 1NOFA 3LSBA 2PDWA 2WC3A 1CB2A 1KNWA 4DQWA 4YLWA 3ES7A 3F7JA 1J01A 3K4DA 4GD0A 4GZIA 5H8PA 1XH2A 2DZTA 3AS1A 1LOQA 1YE6A 1JZ7A 1GTHA 1W37A 4IR1A 2X1SA 3VI2A 1TTPA 1ZETA 4IIEA 4X3ZA 2VHLA 2G3JA 5L1KA 2BXZA 3WBEA 4DUVA 4ED7A 1CT5A 1PTAA 2Y70A 3KHJA 4HBKA 1J18A 4GZJA 2PDUA 1OEPA 3FJLA 3W27A 2BFGA 2CBIA 3OBKA 3W2UA 5AYYA 1CXEA 2V5LA 4Z2LA 1JCYA 2FB2A 3BCDA 2XVKA 1FWHC 1JCLA 5ENLA 1E6PA 2WSYA 1E0XA 3W02A 3SCSA 1S46A 2WNZA 3VCRA 2V2HA 1KXQA 3BMWA 1KRBC 3WJZA 1SO5A 4PA8A 1FHLA 5HOSA 3ZJ6A 2TAAA 1UA7A 3SB0A 5KFBA 4MGGA 3V1HA 4J35A 2VCAA 3KP1A 3T0CA 5I07A 3PG8A 2YDAA 3QSTA 3OHAA 4MIMA 4A8IA 3V0TA 3U2ZA 3N2MA 4Y9PA 4DJDC 4IM4A 4KQNA 4W8AA 2A5HA 3LTPA 3PWGA 1QO5A 1M41A 3WX7A 2EG6A 4DUXA 3NQFA 1VRXA 4E2OA 4DZIA 1AVAA 2O7QA 3LBCA 2YXGA 3TZNA 3VD3A 1HXJA 4GPNA 1K1DA 3BDKA 4A8RA 5KMYA 5IHRA 1I2QA 3MHFA 1GOOA 1K7EA 4HJFA 1XSKA 1ZTVA 1UA3A 1K9FA 2OEMA 4L6DA 4RZ6A 3A9IA 3TVAA 3UXAA 4EYIB 2QAFA 4LB3A 2UZ9A 2ALDA 3GYEA 8CGTA 4HYKA 3HPXA 5CZSA 1UJQA 1TIMA 1Z69A 1VBGA 3GDTA 3WK2A 5F2MA 4NZJA 1XISA 4K2SA 2GOUA 5HJXA 3AICA 1QI2A 4JCMA 2C71A 4QS6A 3ANVA 4WUIA 5AY7A 4ZOAA 3R8GA 5LNWA 5KFOA 5IBXC 3G1SA 4Q8EA 1MQPA 3LLDA 3DERA 2QJGA 1XBXA 5I3HA 2WMHA 1KBKA 1HZYA 1YNQA 2E09A 4WKFA 1T40A 3LRLA 3FDSA 2BY2A 2XN2A 3EZ4A 1Q4NX 4PFMA 3URNA 1ECQA 4POCA 4UUIA 2BWGA 4CCZA 1Z41A 2DJXA 3BLEA 2NZLA 2F7FA 3U57A 3WK0A 1HL8A 4P2VA 1E6SM 3IACA 5AHFA 1OC7A 1YADA 1TUFA 5DX7A 3VX1A 4JX6A 4ML9A 1KGWA 1XCWA 5HJYA 2J66A 4GRSA 2V8ZA 3CHFA 4LNCA 5FKYA 1XBVA 4MYAA 2GUUA 2RKXA 4XIMA 4TX9A 3HM7A 4MB4A 1H49A 3NO1A 4CEUC 3NZGA 1G5AA 3FDGA 3B8SA 4PUUA 4MUPA 2JEIA 2B31A 2QCDB 5CSUA 3NOEA 3HURA 1F2JA 4C7DA 2Y61A 2IMWP 1C7TA 1V6UA 1SPQA 2DIEA 5BMXA 2ANUA 3QGKC 3MCOA 4I8DA 4Y8EA 4EPEC 3POCA 1PAMA 4L6HA 4M82A 1AA1B 3RB3A 4BFAA 1L6YA 1ZALA 1FBAA 3K1DA 3FA4A 1FCQA 1FDYA 2AGKA 4IMEA 5H8MA 1FWAC 5AHIA 1EEPA 1A5NC 5U7SA 2DORA 5XINA 3NIYA 2ASDA 1W1TA 3CQJA 3EOUA 1OD0A 1RA0A 2EPOA 1BWLA 2GSHA 3GDLA 1KR0A 4QIUA 1LORA 1Q7QA 4N4PA 5CPQA 3EDEA 3LZ3A 3T2QA 4I9AA 4JNMA 5A2AA 2CLMA 4FI4A 3DKLA 3M7SA 1NARA 1R3VA 1M5WA 3EEGA 4GYJA 3EKZA 5CSSA 1SR9A 3AJ7A 3IJ9A 2P9BA 1DV7A 2D2HA 3EWWA 3CQIA 1R38A 5DGBA 1EJTC 1ZCOA 3OIHA 3FNDA 4KIRA 2GVJA 2HRWA 3C2FA 5F7UA 2I17A 2FLLA 2ZTJA 4O3NA 2QJIA 1QW7A 1MNZA 1HO4A 2BHYA 4ED6A 1NP2A 6XIMA 2GGHA 3CPGA 5H1WA 2XGZA 2RDXA 3QC3A 3TN6A 2E9MA 5FF3A 3H2EA 1U1HA 2FGZA 1A3XA 1GYNA 1P6CA 1KA9F 1SFLA 2C13A 3H7VA 1X97A 2QW5A 1OB0A 2PBOA 3LDVA 1SZGA 3S6OA 3FYOA 4WHBA 3B9AA 4O3RA 4NY2A 4HPNA 4QQUA 4IH3A 4I6VA 4FLSA 1V6WA 3VOCA 4NNBA 3WLMA 2WLYA 4YL2A 1PZ2A 2QS8A 3W01A 3DG6A 1G94A 4AX6A 1FX6A 3TCEA 3DGRA 3RPMA 1QHZA 1XQLA 4H8UA 2B7QA 2DIJA 4DB7A 4BF9A 5CH9A 4DUWA 4NU7A 4DXKA 3NVDA 2WSPA 1EOKA 4GYKA 3RLHA 2G0WA 1V3KA 1OF8A 3IJQA 2ZUSA 3UPBA 3M6DA 3H2MA 1JGMA 1X1ZA 5D03A 3RM9A 3WDPP 3PW7A 4RLIA 2ACSA 4TR9A 1FXPA 1XIDA 3MU7A 4XBJA 1QATA 2XSBA 3LHVA 1RALA 4O14A 4LAOA 1J93A 3FJ6A 2AL2A 2F2KA 4LH8A 4MB5A 5F1UA 3KFTA 1FDJA 1R9ZA 4U6PA 3ZQ9A 2PBGA 4AY7A 4LUSB 3QHNA 4D8LA 4QFUA 1NQ6A 3WUFA 4LYQA 2J7EA 3HQPA 3I3EA 1FH9A 4P8UA 5AHLA 3H4DA 3HJEA 4Q22A 3LQLA 4G9PA 1VHNA 1XLEA 1VJSA 4H9ZA 3EA1A 4DIAA 3OGSA 4D6IA 4JTJA 1UQZA 3EX4A 3D3FA 3CH0A 3O6DA 4X63A 5LHFA 4LF2A 3OLEA 1KXVA 2RAGA 4GK8A 1QDSA 3GNNA 3VC5A 4L4OA 4M80A 3VNMA 3QN3A 2WZIA 2AU0A 4O53A 1TVNA 1UZHA 3WLTA 4ECZA 4F4XA 1GHRA 1CBGA 2QULA 4C6CA 3A24A 1EWEA 1K4GA 1R3SA 3NEVA 3OVQA 4GNVA 3KVLA 8XIMA 3MP5A 2XSAA 3P61A 3UJ2A 4X61A 5DLFA 4KEZA 4HOWA 3WQCA 4JDBA 4Z1CA 4LUSA 2W9MA 4UCFA 4JL2A 2Q71A 3CT7A 2NXHA 3RJYA 5CC5A 5LNSA 2YKKA 4A29A 4XZ9A 4IJBA 1H3GA 1EDGA 1ME7A 4DN1A 4NKCA 4CQCA 3A5VA 4Z1DA 1KRMA 3FJNA 4EEYA 2QGHA 1BTMA 3QZEA 2E6AA 3ABSA 4NASA 3PZPA 4OFCA 1X38A 5EFFA 3REQA 5CCZA 4CU8A 2NLIA 4JTEA 2JE8A 2X1UA 4CNTA 1AFSA 3E3HA 1VEOA 1W56A 5DG9A 4JFTA 1ZY9A 4JS3A 1GJWA 3T0TA 1KQYA 4W7UA 1Q85A 3DX5A 4LAUA 1B4KA 1LRNA 3U6WA 2GQ9A 2Z26A 4J2PA 3NSXA 3OLDA 3RAQA 3NDOA 1AW1A 1HX0A 2WCAA 3CL8A 2XCAA 3DC0A 1JZ4A 3E0WA 2Y24A 1HT6A 3I4KA 4EIVA 5EMUA 2J7GA 3OZOA 3ZLHA 1GZGA 2W91A 2BNJA 5F4XA 2E67A 3R0UA 1EIBA 3ZLGA 4HHHA 2I1OA 4Q43A 2Z2BA 2J7BA 6XIAA 4LUYA 5BU6A 2DZBA 2EEXA 1ZLPA 3HFTA 3BLLA 3SGGA 1UH4A 5EYWA 1YTKA 4NF7A 5CGTA 4BS0A 2J27A 4EWND 3G24A 4HA0A 1ZJAA 2FHCA 5A2CA 1QI3A 1V3JA 4JHZA 4O3QA 1YXYA 3I4EA 4ECYA 3GU2A 1OQFA 2G8ZA 4GXWA 1H11A 5FL1A 2FVLA 2P3EA 2JKPA 2YBVA 3KBJA 1NWTA 3U7VA 3DBNA 5LIKX 2C2DA 3ZOAA 2WNQA 3KBSA 2BOEX 4EOUA 2PTDA 2YLAA 3N9KA 3AIBA 4JYFA 4QG9A 3BPWA 4RPPA 1FVPA 4JEJA 2FLPA 1LBMA 1D8CA 3APGA 3G1FA 2NVDA 1MUWA 3RRAA 3MMWA 3MTWA 3TYEA 4NLGA 4GY7A 1C93A 1SR0A 1H09A 3WN6A 3P14A 4FXRA 1GPWA 3PJTA 3S8HA 1FKWA 1QOXA 4O4VA 4Q3MA 3I7RA 2QYGA 2FJKA 3KEHA 3LLFA 3BLIA 1R47A 4Y90A 2X7VA 5KFFA 2NVCA 4Y9MA 3B8UA 2PD9A 2FKPA 4P7LA 5D9MA 1GZ1A 4JTIA 3MDWA 3P84A 3QMSA 5DMLA 1A4MA 3OBEA 1GUVA 5J8LA 5DF0A 2FHFA 1CYGA 2VCBA 4YR0A 3BMVA 1ZNNA 1OFAA 3ANUA 5JMUA 1UP0A 5JUMA 4HU3A 1K4HA 3QY8A 1JAKA 2O55A 3AWOA 2PWGA 4J3XA 2ZDSA 4W86A 4U2ZA 1QPRA 4XAGA 3UXDA 3MSRA 1QTWA 3S6DA 2PDIA 5JQ9A 4N6EA 5L1JA 3AHTA 1VJIA 5E9AA 2VFHA 1OABA 1LRTA 5K9XA 2AGTA 3ZM8A 1B0IA 2MNRA 1TJ1A 4YMZA 5CZTA 3H2NA 3LCWA 5AC4A 3N6QA 1E0UA 3PVFA 1EC8A 4WSHA 1PCWA 1HIZA 4ECRA 3VDBA 2QDEA 2E40A 2C28A 4P61A 4Z2JA 1H1NA 3RCMA 3AS0A 3KVMA 3T4WA 1IZKA 4DI9A 2ISDA 2OKTA 2J7HA 4J3UA 2OWCA 4JCLA 3VNYA 2BBFA 4K37A 5BOOA 3LRMA 4W4QA 5AC5A 3CWNA 1R30A 3VGGA 1V0KA 1UP2A 3W3OA 3IVSA 4JQ3A 4KT2A 1IXQA 4WXYA 5HQLA 2RGLA 4LQ1A 4GWEA 1EIXA 5I3KA 3LV5A 5CBJA 4JAWA 1TJ0A 1SO6A 2C15A 4O16A 3TMQA 1UBPC 3HO8A 4AD5A 4CKQA 3SJNA 1VENA 4A21A 3KHHA 3WBYA 5GJNA 1EH9A 1F5ZA 5AYIA 4G7FA 1KM5A 3SRDA 8A3HA 5CBIA 1IF2A 3F1QA 4QWEA 2VEGA 4DAFA 3KHDA 1F76A 1NDVA 1H7NA 1UYQA 4J3SA 4YQWA 4D6CA 4B5SA 1T96A 1JUBA 4I3GA 5I3DA 1TTJA 3FXGA 3HBLA 1A3WA 1RQHA 3DKJA 2AGQA 1YYAA 2OTDA 3GDBA 4LALA 3C56A 4LNYA 1GVIA 9XIMA 4C6QA 3QR1A 2EG7A 1VF8A 3QC0A 2BZNA 3THUA 1PV8A 1VHCA 4QG8A 3VGFA 1G4PA 3HGSA 1UUOA 3ZJKA 3CWOX 5A69A 3BXWA 1BPLB 3M0JA 1AK5A 3MFHA 2DIKA 2WMGA 1SU5A 3M47A 3L66A 3MPGA 4KW2A 4GI4A 2QIIA 2R9RA 1LWJA 2Z1XA 3NDZA 2PDPA 2O0TA 1DORA 4D8AA 4J9NA 4DVOA 2VVSA 1JCXA 4I7WA 4QHRA 4R7WA 2GUBA 1J6OA 1OT2A 2HWGA 1B3YA 5GJMA 1UWSA 4D2JA 3FDKA 3O0FA 4X22A 1QHPA 2INZA 1A47A 3C2RA 3UJSA 5D2TA 4ZBCA 4MB1A 3M7WA 2PZNA 2PDXA 4CD5A 2DW6A 3PANA 3WDQA 4UXDA 3RF9A 4AC1X 1YBQA 4TTUA 2CCRA 2FMNA 3FAXA 5EKYA 2R14A 1GTEA 2PP1A 1HQTA 3UR7A 4JXCA 3CEPA 2ZWYA 3FAWA 3PAOA 1EQCA 4FHAA 3URQA 2XH0A 5TF0A 1GYMA 2V4QA 4PMUA 1V5XA 5HAOA 4EXQA 2DZSA 1YW1A 4OT7A 4DJDD 1YNYA 3CTTA 2DUZA 1OFRA 4NZ3A 4MNLA 4PC8A 2PPGA 5I00A 2R6OA 3M9MB 1UOKA 3KX6A 1P0BA 1UG6A 2CZEA 1WOBA 2ISWA 5CPMA 2FTWA 1Q65A 2YPIA 3EB4A 4IX0A 3VZXA 1FFQA 2J8FA 1TX0A 3L68A 1FWGC 2CBVA 1BTCA 1YBQB 3N2BA 1W9DM 4RNOA 1B57A 2E5DA 1X6LA 3AO0A 2R1LA 3S46A 5BZAA 1S5TA 4YVXA 3XINA 3KS5A 4QCFA 4CCEA 2VEFA 3CK5A 2YGYA 1MI3A 4DHGA 3NPUA 4HHLA 3PTDA 3UXIA 7ENLA 1G69A 3V16A 3QY6A 4I9JA 3GH5A 4W5ZA 3DHUA 4A8NA 5I5RA 3TFXA 4H6RA 4XO7A 1XUUA 1UD2A 4M7TA 5DBTA 4HMNA 3ABZA 5BOFA 3CV2A 3MYOA 3V18A 3I65A 5G4WA 1XRTA 3O6CA 4XAZA 1FCVA 1LQ2A 1GVOA 1XIHA 3LMYA 1OM0A 7REQA 4IGHA 1QNVA 3VOIA 3PM6A 3D0CA 4NZCA 4WY0A 1ZHAA 2POZA 1O5RA 3A12A 3VILA 1H7PA 4XISA 5T9BG 3T5JA 4NIRA 4ZGYA 3BJYA 1UP3A 4DL3A 2YXXA 4WIWA 1PL9A 3CUFA 2GGIA 3DENA 2C2EA 2HS6A 1JF6A 3HPSA 4MAVA 1JIHA 5CPOA 4IPJA 4DWDA 4BZYA 3C0SA 4PTWA 5DG8A 2NV2A 4IQJA 3L67A 4OOZA 2OFJA 2VL4A 1UASA 3SI8A 1JYWA 1RLCL 3AIQA 2DGAA 4H2HA 4IL2A 3WK3A 2A7PA 3WNPA 4C6LA 1R7AA 2JEFA 4CQ9A 2WQDA 1SW3A 2WJDA 1QPNA 2HVOA 4OBSA 1OJXA 4PBFA 4C6JA 2QV5A 2WMFA 1JZ2A 4WKHA 3SO7A 2FDSA 1QW8A 3PULA 2HSAA 3O16A 4RE2A 4ED3A 1PYFA 5CPLA 4Z42C 4PTNA 4DAIA 3GQYA 4W85A 5I6SA 3F2CA 1EFZA 1H1ZA 5BRPA 4KESA 3UF9A 5D8ZA 4ORMA 2D2JA 2XIJA 2HE5A 4MZ8A 3M43A 4GQRA 1XLMA 1G67A 4C6NA 5KFUA 4UQCA 3ISIX 4HA3A 3GIPA 4M51A 3PZMA 5H8UA 3JW7A 4Q6JA 2PODA 1DXEA 1GJUA 3IPWA 4FR1A 1CWYA 1PZ1A 1XYAA 1AL7A 2D0GA 1RY0A 1EB3A 3V6KA 4FX6M 3LGGA 1ZJBA 3E9AA 4JQAA 3GW0A 4D6DA 3D47A 3VE7A 3C8NA 2OQLA 1HJSA 3GWQA 1ALDA 2AAMA 3KRZA 3QXBA 3EWDA 3R1ZA 5KFSA 3E6EA 3SQMA 4JTLA 4M7SA 1SZFA 4K3ZA 2VX7A 4P7NA 3T5KA 1XLIA 3NWRA 1R8LA 4GC3A 5LSMA 1KFWA 3WJSA 5D05A 1W3HA 4GZ7A 3WENA 1B3WA 3EBVA 2GLKA 3QZAA 4O19A 4BF7A 2YL5A 1UUMA 2QUVA 1K6AA 3UWZA 4HOXA 1IEWA 1JNDA 4UWMA 3VGBA 4HSHA 3LG3A 2V81A 1PJ9A 2V5DA 5BWAA 4GVFA 1SGJA 1XBZA 2J6XA 3ARUA 4GGHA 4UZUA 4RDVA 3FX4A 4K68A 3TAKA 1P0DA 1PDZA 3OG3A 6ENLA 4DPQA 2PTXA 3OLGA 4F0RA 3PZOA 2X7WA 4H6KA 3UR8A 2JIWA 3Q65A 4HSOA 1TWDA 1EJ7L 1CZ1A 1ZGDA 1IEXA 1LG1A 1V3MA 1W17A 4TVDA 3W7PA 1XLJA 1JPIA 3GHSA 3B03A 3A47A 2D69A 4ZCWA 4MWAB 3MR5A 2VEIA 1UB3A 4A3HA 2QMKA 1EPXA 2ZUTA 4XX6A 3W73A 3GH7A 2W5FA 2YL6A 4Q7NA 1XLLA 3G8RA 3NXFA 3KLKA 4TQSA 3NXLA 2ZA1A 1IE7C 1SQ7A 2WLZA 1K77A 5HUOA 4OECA 3VIOA 1JX4A 4AYSA 1DJQA 2J88A 2OT1A 1HP4A 6REQB 4B92A 1QNOA 4OV4A 1U30A 2J25A 3EPOA 4BQ2A 5A6LA 4FNTA 1L8PA 4D8ZA 5EMMA 4HMDA 1KV8A 2G96A 3TNBA 4M6UA 1V6XA 1VFMA 1FP8A 2NQ5A 4IIFA 3U2EA 4UTIA 3APYA 4AIEA 4RNFA 1QOQA 2HXTA 1W2VA 2H3DA 7TAAA 5KFIA 1JFXA 4PBGA 4NSBA 4ICCX 1XCXA 1ZCCA 4W9TA 3G3MA 3DAQA 3V4BA 5JXQA 3CV1A 1H7WA 4A8LA 4UOQA 4N9EA 4XVEA 3W00A 2CLIA 2C6QA 1TZ7A 4JHMA 3MI6A 4Y2WA 4EVZA 4C5YA 5KFYA 2GDUA 4HNCA 3UA3A 3ALGA 1J4EA 3BW2A 1E71M 3DU0A 3H8AA 4JX4A 1E40A 2QCEA 3NUKA 1EJVC 3T6CA 2ISVA 5F4SA 1JDAA 2VKZG 3AU2A 4C6FA 1W0MA 4J3VA 1VCVA 5T26A 1X96A 3UGRA 3ECQA 4OJYA 2XSXA 3WNMA 1HKMA 3FA5A 3ZSTA 1RBAA 1BVZA 4EBCA 1TV8A 1XFCA 3SCRA 4ZQMA 1UPMB 3L12A 1TUXA 3CAQA 4Q4QA 4PUNA 3EXSA 3VIIA 5GJPA 2F6KA 1RP8A 3LXBA 4WQ6A 2QDHA 3WH9A 1ZAJA 4PMQA 4DRSA 3IV8A 4UTMA 4OGZA 5TAOA 3CV7A 3U5UA 3SM0A 3UG3A 5DANA 4CNSA 4FIRA 5LKYA 1J0KA 1B4EA 4DWSD 4HCHA 3R10A 3A4XA 5FJRA 3VXGA 1H7OA 5H91A 3MO7A 3VDAA 2XIIA 1G9HA 4I5RA 1UWTA 4L1WA 1V7YA 4JFVA 1A0DA 3VOHA 1EDQA 1TG7A 1W9VA 4MY9A 2REQB 4UMBA 1XIGA 3RBDA 4GC4A 4I9MA 2GZXA 4RL3A 1A4LA 4GKLA 4BWLA 1BYAA 4DY1A 1RUSA 1PVNA 2Q8LA 1X8CA 4AYGA 1XFBA 3FN9A 1GKQA 3B8WA 3WL0A 3GTHA 1ZS2A 4PUMA 1WB0A 4HA4A 4C1LA 1AJ0A 4Z17A 1O7AA 5D4YA 4W93A 2X16A 2P3ZA 3B8DA 2CLKA 4XSMA 4AB4A 4AIUA 3V6JA 3A4JA 3S9IA 3CV6A 1L6WA 3ZR6A 4RDWA 3GQCA 2XVGA 5C9XA 3H21A 2TYSA 4EXAA 2A6NA 2ZCGA 2PP0A 2VGIA 1NM9A 1SFTA 2Y8VA 1WX0A 1RYRA 2QCFA 4H9VA 4AUBA 3BGAA 2YLLA 4C60A 3E2QA 4FXJA 1TELA 1L2QA 2WC7A 2W61A 2C91A 4JTRA 3T08A 2JEJA 1A3HA 3V6HA 1FWEC 3PG9A 1K3UA 3TW6A 5KTLA 1C7SA 4XBSA 4QWCA 2VWTA 4X9SA 1NDZA 4B3ZA 5FCZA 5G4EA 1DHKA 1AJ2A 3LHUA 3ABOA 3M1ZA 1TFVA 3Q58A 5FF2A 2VDIA 3CUZA 1SMDA 2OR2A 3UXLA 2WHMA 2JEQA 1VEPA 2CZ5A 3KHRA 5AYZA 3SUUA 4RCXA 4WVXA 2IPJA 5LGZA 1I2NA 1JFHA 1UUQA 1W1ZA 4JNZA 3F4WA 1OFPA 3CJPA 3K46A 3WCZA 3M0ZA 3B9DA 4JV1A 1CIUA 4HT3A 4AMCA 3FW6A 1XIEA 4MKSA 1POJA 3V5CA 2UVUA 1UKPA 3EWXA 1OFOA 2OEJA 3G6VA 4NHVA 3DFTA 3VIKA 4AIBA 2D2OA 3ITTA 2OEKA 1L0PA 4FF7A 4KIEA 1L6GA 1R9XA 1BD0A 3L4UA 1ADSA 3K4AA 4Y9AA 4ECLA 1GONA 2FPTA 4XD5A 4EAYA 4GFIA 4L80A 5D8WA 3VTRA 1QK0A 5EY5A 2WPBA 2TPSA 1XCFA 3LERA 5FEXA 1RCOB 3KCOA 2FTYA 2VZVA 3R79A 3K13A 4IQEA 3C2VA 1EP3A 4NYUA 3PPGA 4AF0A 1NELA 3UT0A 2YBTA 5KT2A 1XGDA 4QS5A 3PSVA 3T40A 3PJXA 4QE5A 3MR6A 4MJZA 4XZWA 5AZ1A 3WIJA 4HK5A 4PBEA 2VELA 4HHMA 3N73A 4J28A 3EDDA 5A94A 1MZHA 1U5JA 3RLGA 3ARWA 1S1PA 5LNRA 2F61A 1HP5A 5HWJA 1OIFA 1MUMA 3E1F1 5E0CA 3I10A 4Y8FA 3TTSA 1XYCA 2J6VA 3W7JA 3MFIA 3HG4A 2NQZA 4J3WA 1GGOA 3UVIA 3LQGA 4QDMA 3MI3A 5C9UA 3PK7A 3KBVA 1C9DA 3JR2A 5FF0A 3I6TA 2RDWA 3QY7A 2Z24A 2FYMA 2FB3A 3TQ0A 2CLPA 3OO2A 4BEQA 2DPJA 2YX0A 3VIGA 2HNEA 4A6GA 1F61A 3ZR4A 4QWDA 2DJLA 1NEYA 3P62A 2JF6A 3GU1A 4L61A 3WH5A 4CD6A 1UZ1A 1J5SA 3GIJA 1QNSA 2Q09A 3TYZA 1IZCA 1TPFA 2E5BA 5FD0A 1VBHA 3V75A 5EMLA 1OC6A 4NILA 2EKGA 4QLKA 1SJDA 2BTMA 4BQ3A 2BY3A 1H61A 1F3XA 4M1BA 5F2IA 1YEYA 1MEWA 3G1RA 4KS0A 4OOUA 1V02A 3U5YA 1ML1A 1CXFA 3LHZA 2IS7A 2QDGA 1CCWB 4MVAA 3BH4A 3S2CA 4KPLA 5LNVA 3U4AA 4NX5A 5DGAA 4GBDA 1YX1A 4J9MA 4G7EB 3RPDA 3PZ9A 4UFLA 3E12A 1KWGA 4TVUA 3UZXA 3ITCA 5JUVA 2ZX8A 4S3CA 5HA7A 5EMKA 3PR4A 2XFFA 4RZRA 1PWLA 4IUGA <